BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS033F10

Length=623
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011073654.1|  PREDICTED: leucine-rich repeat receptor-like...    174   2e-46   Sesamum indicum [beniseed]
ref|XP_009613990.1|  PREDICTED: leucine-rich repeat receptor-like...    172   2e-45   Nicotiana tomentosiformis
dbj|BAK52390.1|  leucine rich repeat receptor protein kinase CLAV...    172   2e-45   Solanum peruvianum [Peruvian tomato]
ref|NP_001274713.1|  leucine-rich repeat receptor-like serine/thr...    172   2e-45   Solanum lycopersicum
dbj|BAK52389.1|  leucine rich repeat receptor protein kinase CLAV...    171   4e-45   Solanum pennellii
ref|XP_010271550.1|  PREDICTED: leucine-rich repeat receptor-like...    171   5e-45   Nelumbo nucifera [Indian lotus]
gb|AIT56194.1|  leucine-rich repeat receptor-like serine/threonin...    171   5e-45   Dimocarpus longan [longan]
emb|CDP02660.1|  unnamed protein product                                170   1e-44   Coffea canephora [robusta coffee]
ref|XP_006357743.1|  PREDICTED: leucine-rich repeat receptor-like...    169   2e-44   Solanum tuberosum [potatoes]
ref|XP_011099433.1|  PREDICTED: leucine-rich repeat receptor-like...    168   5e-44   Sesamum indicum [beniseed]
ref|XP_010268646.1|  PREDICTED: leucine-rich repeat receptor-like...    167   6e-44   Nelumbo nucifera [Indian lotus]
ref|XP_006364007.1|  PREDICTED: leucine-rich repeat receptor-like...    166   2e-43   Solanum tuberosum [potatoes]
ref|XP_004234641.1|  PREDICTED: leucine-rich repeat receptor-like...    166   2e-43   Solanum lycopersicum
ref|XP_009786199.1|  PREDICTED: leucine-rich repeat receptor-like...    166   3e-43   Nicotiana sylvestris
ref|XP_009771232.1|  PREDICTED: leucine-rich repeat receptor-like...    165   5e-43   Nicotiana sylvestris
gb|EYU41357.1|  hypothetical protein MIMGU_mgv1a000718mg                163   2e-42   Erythranthe guttata [common monkey flower]
ref|XP_010105101.1|  Leucine-rich repeat receptor-like serine/thr...    162   4e-42   Morus notabilis
emb|CBI35733.3|  unnamed protein product                                161   9e-42   Vitis vinifera
ref|XP_003635561.1|  PREDICTED: leucine-rich repeat receptor-like...    161   1e-41   Vitis vinifera
ref|XP_009605676.1|  PREDICTED: leucine-rich repeat receptor-like...    161   1e-41   Nicotiana tomentosiformis
ref|XP_009375880.1|  PREDICTED: leucine-rich repeat receptor-like...    156   5e-40   Pyrus x bretschneideri [bai li]
ref|XP_009354585.1|  PREDICTED: leucine-rich repeat receptor-like...    154   4e-39   Pyrus x bretschneideri [bai li]
ref|XP_008344369.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    154   4e-39   
gb|KDO78771.1|  hypothetical protein CISIN_1g001816mg                   153   8e-39   Citrus sinensis [apfelsine]
ref|XP_006426178.1|  hypothetical protein CICLE_v10024796mg             153   8e-39   Citrus clementina [clementine]
ref|XP_006466390.1|  PREDICTED: leucine-rich repeat receptor-like...    153   9e-39   Citrus sinensis [apfelsine]
ref|XP_002875982.1|  hypothetical protein ARALYDRAFT_906265             152   1e-38   Arabidopsis lyrata subsp. lyrata
ref|XP_008393812.1|  PREDICTED: leucine-rich repeat receptor-like...    152   2e-38   
ref|XP_007208421.1|  hypothetical protein PRUPE_ppa000739mg             151   4e-38   Prunus persica
ref|XP_006404116.1|  hypothetical protein EUTSA_v10010092mg             151   4e-38   
ref|XP_008354741.1|  PREDICTED: leucine-rich repeat receptor-like...    150   7e-38   
ref|NP_001235080.1|  receptor-like protein kinase 3 precursor           149   2e-37   
ref|NP_190536.1|  CLAVATA1-related receptor kinase-like protein         147   6e-37   Arabidopsis thaliana [mouse-ear cress]
gb|KFK34238.1|  hypothetical protein AALP_AA5G119100                    146   2e-36   Arabis alpina [alpine rockcress]
ref|XP_004288299.1|  PREDICTED: leucine-rich repeat receptor-like...    145   4e-36   Fragaria vesca subsp. vesca
ref|XP_006290548.1|  hypothetical protein CARUB_v10016631mg             144   7e-36   Capsella rubella
ref|XP_002310320.2|  hypothetical protein POPTR_0007s14500g             144   8e-36   Populus trichocarpa [western balsam poplar]
gb|EPS74129.1|  hypothetical protein M569_00625                         144   1e-35   Genlisea aurea
ref|XP_004511796.1|  PREDICTED: leucine-rich repeat receptor-like...    144   1e-35   
ref|XP_010028033.1|  PREDICTED: leucine-rich repeat receptor-like...    144   2e-35   Eucalyptus grandis [rose gum]
ref|XP_007047661.1|  Leucine-rich receptor-like protein kinase fa...    143   2e-35   
ref|NP_001237715.1|  receptor-like protein kinase 2 precursor           142   4e-35   Glycine max [soybeans]
ref|XP_011021820.1|  PREDICTED: leucine-rich repeat receptor-like...    142   5e-35   Populus euphratica
ref|XP_002864974.1|  hypothetical protein ARALYDRAFT_496807             142   6e-35   
gb|KJB48795.1|  hypothetical protein B456_008G087500                    142   6e-35   Gossypium raimondii
ref|XP_006393995.1|  hypothetical protein EUTSA_v10003584mg             142   7e-35   
ref|XP_010426489.1|  PREDICTED: leucine-rich repeat receptor-like...    142   8e-35   Camelina sativa [gold-of-pleasure]
gb|KHG03710.1|  Leucine-rich repeat receptor-like serine/threonin...    141   9e-35   Gossypium arboreum [tree cotton]
ref|XP_010444585.1|  PREDICTED: leucine-rich repeat receptor-like...    141   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010484412.1|  PREDICTED: leucine-rich repeat receptor-like...    141   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010463501.1|  PREDICTED: leucine-rich repeat receptor-like...    141   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010515326.1|  PREDICTED: leucine-rich repeat receptor-like...    141   1e-34   Camelina sativa [gold-of-pleasure]
gb|KJB18115.1|  hypothetical protein B456_003G034500                    140   4e-34   Gossypium raimondii
gb|KJB18113.1|  hypothetical protein B456_003G034400                    139   5e-34   Gossypium raimondii
ref|NP_201371.1|  leucine-rich repeat receptor-like serine/threon...    139   5e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006279943.1|  hypothetical protein CARUB_v10025808mg             139   7e-34   Capsella rubella
ref|XP_004143422.1|  PREDICTED: leucine-rich repeat receptor-like...    138   1e-33   Cucumis sativus [cucumbers]
ref|NP_001235065.1|  receptor-like protein kinase 1 precursor           138   1e-33   Glycine max [soybeans]
gb|KDP32143.1|  hypothetical protein JCGZ_12604                         138   1e-33   Jatropha curcas
gb|KHG04200.1|  Leucine-rich repeat receptor-like serine/threonin...    138   2e-33   Gossypium arboreum [tree cotton]
ref|XP_009150662.1|  PREDICTED: leucine-rich repeat receptor-like...    137   2e-33   Brassica rapa
ref|XP_010547579.1|  PREDICTED: leucine-rich repeat receptor-like...    137   2e-33   Tarenaya hassleriana [spider flower]
ref|XP_004509039.1|  PREDICTED: leucine-rich repeat receptor-like...    137   2e-33   Cicer arietinum [garbanzo]
ref|XP_010683073.1|  PREDICTED: leucine-rich repeat receptor-like...    137   3e-33   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK28239.1|  hypothetical protein AALP_AA8G490400                    136   7e-33   Arabis alpina [alpine rockcress]
ref|NP_001237688.1|  receptor-like protein kinase precursor             136   7e-33   Glycine max [soybeans]
ref|XP_002531999.1|  Receptor protein kinase CLAVATA1 precursor, ...    135   1e-32   Ricinus communis
ref|XP_010503631.1|  PREDICTED: leucine-rich repeat receptor-like...    135   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_007155783.1|  hypothetical protein PHAVU_003G231400g             134   4e-32   Phaseolus vulgaris [French bean]
ref|XP_009397330.1|  PREDICTED: leucine-rich repeat receptor-like...    129   1e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009394785.1|  PREDICTED: leucine-rich repeat receptor-like...    128   5e-30   
ref|XP_010518800.1|  PREDICTED: leucine-rich repeat receptor-like...    126   2e-29   Tarenaya hassleriana [spider flower]
ref|XP_008787359.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    126   2e-29   
ref|XP_010939309.1|  PREDICTED: leucine-rich repeat receptor-like...    125   3e-29   Elaeis guineensis
ref|XP_006852730.1|  hypothetical protein AMTR_s00033p00083200          125   4e-29   
ref|XP_010941985.1|  PREDICTED: leucine-rich repeat receptor-like...    125   6e-29   Elaeis guineensis
ref|XP_009408581.1|  PREDICTED: leucine-rich repeat receptor-like...    125   6e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009136515.1|  PREDICTED: leucine-rich repeat receptor-like...    124   2e-28   Brassica rapa
gb|AES94465.2|  LRR receptor-like kinase family protein                 123   2e-28   Medicago truncatula
ref|XP_003611507.1|  Receptor-like protein kinase                       123   2e-28   
ref|XP_008441113.1|  PREDICTED: leucine-rich repeat receptor-like...    123   2e-28   Cucumis melo [Oriental melon]
ref|XP_009394620.1|  PREDICTED: leucine-rich repeat receptor-like...    123   3e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010675918.1|  PREDICTED: leucine-rich repeat receptor-like...    121   7e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010685023.1|  PREDICTED: receptor-like protein 12                117   2e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009395647.1|  PREDICTED: leucine-rich repeat receptor-like...    116   5e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007156674.1|  hypothetical protein PHAVU_002G007600g             115   9e-26   Phaseolus vulgaris [French bean]
emb|CDY08759.1|  BnaA06g24650D                                          115   1e-25   Brassica napus [oilseed rape]
ref|XP_010936307.1|  PREDICTED: leucine-rich repeat receptor-like...    114   3e-25   
ref|XP_003608587.1|  Receptor-like protein kinase                       113   5e-25   Medicago truncatula
ref|XP_008790445.1|  PREDICTED: leucine-rich repeat receptor-like...    111   2e-24   Phoenix dactylifera
gb|ADB85326.1|  putative receptor protein kinase                        107   3e-24   Phyllostachys edulis [kikko-chiku]
ref|XP_008237309.1|  PREDICTED: leucine-rich repeat receptor-like...    110   5e-24   
ref|XP_009396449.1|  PREDICTED: leucine-rich repeat receptor-like...    108   3e-23   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ84911.1|  predicted protein                                      104   5e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008440463.1|  PREDICTED: leucine-rich repeat receptor-like...    103   1e-21   Cucumis melo [Oriental melon]
ref|XP_008787754.1|  PREDICTED: leucine-rich repeat receptor-like...    102   3e-21   Phoenix dactylifera
ref|XP_004143533.1|  PREDICTED: leucine-rich repeat receptor-like...    102   3e-21   Cucumis sativus [cucumbers]
ref|XP_004160944.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    102   3e-21   
ref|XP_009411355.1|  PREDICTED: leucine-rich repeat receptor-like...    102   4e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007017845.1|  Leucine-rich receptor-like protein kinase fa...    100   1e-20   
ref|XP_006650665.1|  PREDICTED: leucine-rich repeat receptor-like...    100   1e-20   Oryza brachyantha
ref|XP_008357152.1|  PREDICTED: receptor protein kinase CLAVATA1-...    100   2e-20   
ref|XP_008364929.1|  PREDICTED: receptor protein kinase CLAVATA1-...    100   2e-20   
ref|XP_011045060.1|  PREDICTED: receptor protein kinase CLAVATA1-...  98.6    8e-20   Populus euphratica
ref|XP_008370076.1|  PREDICTED: probable LRR receptor-like serine...  98.2    9e-20   
ref|XP_011083584.1|  PREDICTED: receptor protein kinase CLAVATA1      98.2    1e-19   Sesamum indicum [beniseed]
ref|XP_010676066.1|  PREDICTED: LRR receptor-like serine/threonin...  97.8    1e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001058840.2|  Os07g0134200                                     97.8    1e-19   
ref|XP_010277679.1|  PREDICTED: LRR receptor-like serine/threonin...  97.8    1e-19   Nelumbo nucifera [Indian lotus]
gb|EAZ02682.1|  hypothetical protein OsI_24796                        97.8    1e-19   Oryza sativa Indica Group [Indian rice]
dbj|BAC82955.1|  putative OsLRK1(receptor-type protein kinase)        97.4    1e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002307734.1|  receptor protein kinase                          97.4    1e-19   Populus trichocarpa [western balsam poplar]
ref|XP_010260843.1|  PREDICTED: leucine-rich repeat receptor-like...  97.4    2e-19   Nelumbo nucifera [Indian lotus]
ref|XP_008812886.1|  PREDICTED: probable LRR receptor-like serine...  97.4    2e-19   Phoenix dactylifera
emb|CDP18494.1|  unnamed protein product                              97.4    2e-19   Coffea canephora [robusta coffee]
gb|EMT21473.1|  Putative LRR receptor-like serine/threonine-prote...  97.1    2e-19   
ref|XP_010026766.1|  PREDICTED: putative receptor-like protein ki...  97.1    2e-19   
gb|KCW60108.1|  hypothetical protein EUGRSUZ_H02842                   97.1    2e-19   Eucalyptus grandis [rose gum]
ref|XP_002985227.1|  hypothetical protein SELMODRAFT_121783           97.1    2e-19   
tpg|DAA59489.1|  TPA: putative leucine-rich repeat receptor-like ...  96.3    4e-19   
gb|AAF73373.1|AF193835_1  LRK1 protein                                95.9    5e-19   Oryza sativa [red rice]
ref|XP_010690942.1|  PREDICTED: probable LRR receptor-like serine...  96.3    5e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010266811.1|  PREDICTED: receptor protein kinase CLAVATA1      95.9    5e-19   
ref|XP_004295533.1|  PREDICTED: leucine-rich repeat receptor-like...  95.9    6e-19   Fragaria vesca subsp. vesca
ref|XP_009407942.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  94.7    7e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011036960.1|  PREDICTED: probable LRR receptor-like serine...  95.5    7e-19   Populus euphratica
ref|XP_010686227.1|  PREDICTED: probable LRR receptor-like serine...  94.7    7e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011004294.1|  PREDICTED: leucine-rich repeat receptor-like...  95.5    8e-19   Populus euphratica
ref|XP_008811184.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  94.7    8e-19   Phoenix dactylifera
ref|XP_010520745.1|  PREDICTED: putative receptor-like protein ki...  95.5    9e-19   Tarenaya hassleriana [spider flower]
ref|XP_008665503.1|  PREDICTED: leucine-rich repeat receptor-like...  95.1    9e-19   Zea mays [maize]
ref|XP_011004295.1|  PREDICTED: leucine-rich repeat receptor-like...  95.1    1e-18   Populus euphratica
ref|XP_004955422.1|  PREDICTED: leucine-rich repeat receptor-like...  95.1    1e-18   
ref|XP_002466378.1|  hypothetical protein SORBIDRAFT_01g006690        95.1    1e-18   Sorghum bicolor [broomcorn]
gb|AHJ14779.1|  CLAVATA1                                              94.7    1e-18   Rhododendron ovatum
gb|EYU38789.1|  hypothetical protein MIMGU_mgv1a000850mg              94.7    1e-18   Erythranthe guttata [common monkey flower]
gb|KJB29653.1|  hypothetical protein B456_005G112100                  94.7    1e-18   Gossypium raimondii
ref|XP_004955796.1|  PREDICTED: probable LRR receptor-like serine...  94.7    1e-18   Setaria italica
emb|CDP04113.1|  unnamed protein product                              94.7    2e-18   Coffea canephora [robusta coffee]
ref|XP_010943209.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  94.4    2e-18   
gb|AAT64017.1|  putative leucine-rich repeat transmembrane protein    93.6    2e-18   Gossypium hirsutum [American cotton]
ref|XP_001752668.1|  CLL1B clavata1-like receptor S/T protein kin...  94.4    2e-18   
ref|XP_007214567.1|  hypothetical protein PRUPE_ppa000837mg           94.4    2e-18   Prunus persica
ref|XP_008225951.1|  PREDICTED: leucine-rich repeat receptor-like...  94.4    2e-18   Prunus mume [ume]
ref|XP_009108464.1|  PREDICTED: leucine-rich repeat receptor-like...  94.4    2e-18   Brassica rapa
gb|EEC68381.1|  hypothetical protein OsI_36527                        93.6    2e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_009334873.1|  PREDICTED: receptor protein kinase CLAVATA1      94.0    2e-18   Pyrus x bretschneideri [bai li]
ref|XP_009405747.1|  PREDICTED: leucine-rich repeat receptor-like...  94.0    3e-18   
gb|KFK42020.1|  hypothetical protein AALP_AA2G201900                  93.6    3e-18   Arabis alpina [alpine rockcress]
ref|XP_006663536.1|  PREDICTED: probable LRR receptor-like serine...  93.6    4e-18   Oryza brachyantha
ref|XP_008353615.1|  PREDICTED: LRR receptor-like serine/threonin...  89.0    4e-18   
ref|XP_010942232.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  92.8    4e-18   Elaeis guineensis
emb|CDX73202.1|  BnaC06g36500D                                        93.2    4e-18   
ref|XP_008808401.1|  PREDICTED: leucine-rich repeat receptor-like...  93.2    4e-18   Phoenix dactylifera
ref|XP_010257839.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  92.8    4e-18   Nelumbo nucifera [Indian lotus]
ref|XP_010269666.1|  PREDICTED: probable LRR receptor-like serine...  93.2    4e-18   
ref|XP_008797566.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  92.4    4e-18   Phoenix dactylifera
ref|XP_009345734.1|  PREDICTED: putative receptor-like protein ki...  93.2    4e-18   Pyrus x bretschneideri [bai li]
ref|XP_002305057.2|  hypothetical protein POPTR_0004s05880g           93.2    5e-18   
emb|CDY26403.1|  BnaA02g23670D                                        92.8    5e-18   Brassica napus [oilseed rape]
ref|XP_008225333.1|  PREDICTED: probable LRR receptor-like serine...  93.6    5e-18   
ref|XP_010905760.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  92.4    5e-18   Elaeis guineensis
ref|XP_007214129.1|  hypothetical protein PRUPE_ppa018020mg           93.2    5e-18   
ref|XP_010050671.1|  PREDICTED: putative receptor-like protein ki...  93.2    5e-18   Eucalyptus grandis [rose gum]
ref|XP_010471715.1|  PREDICTED: receptor protein kinase CLAVATA1 ...  93.2    5e-18   
ref|NP_001176614.1|  Os11g0568800                                     93.2    5e-18   
ref|XP_004291349.1|  PREDICTED: receptor protein kinase CLAVATA1      92.8    5e-18   Fragaria vesca subsp. vesca
ref|XP_006856744.1|  hypothetical protein AMTR_s00055p00012250        92.8    5e-18   
ref|XP_008387933.1|  PREDICTED: receptor protein kinase CLAVATA1      92.8    5e-18   Malus domestica [apple tree]
ref|XP_007151443.1|  hypothetical protein PHAVU_004G046800g           92.4    5e-18   Phaseolus vulgaris [French bean]
gb|EAZ18778.1|  hypothetical protein OsJ_34305                        92.8    6e-18   Oryza sativa Japonica Group [Japonica rice]
gb|ACD56664.1|  putative leucine-rich repeat transmembrane protein    92.4    6e-18   Gossypium arboreum [tree cotton]
gb|KCW80214.1|  hypothetical protein EUGRSUZ_C01568                   92.8    6e-18   Eucalyptus grandis [rose gum]
ref|XP_004238370.1|  PREDICTED: receptor protein kinase CLAVATA1      92.8    6e-18   Solanum lycopersicum
ref|XP_011021146.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  92.0    6e-18   Populus euphratica
ref|XP_002461427.1|  hypothetical protein SORBIDRAFT_02g002450        92.8    6e-18   Sorghum bicolor [broomcorn]
ref|XP_011021148.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  92.0    6e-18   Populus euphratica
emb|CAH56437.1|  somatic embryogenesis receptor-like kinase 1         92.0    6e-18   Poa pratensis
ref|XP_004138566.1|  PREDICTED: probable LRR receptor-like serine...  92.8    6e-18   
ref|XP_007213538.1|  hypothetical protein PRUPE_ppa019671mg           89.0    7e-18   
ref|XP_009418700.1|  PREDICTED: leucine-rich repeat receptor-like...  92.4    7e-18   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY63395.1|  BnaCnng41990D                                        91.7    7e-18   Brassica napus [oilseed rape]
ref|XP_004951350.1|  PREDICTED: probable LRR receptor-like serine...  92.0    7e-18   Setaria italica
emb|CDX87661.1|  BnaA07g32120D                                        92.4    7e-18   
gb|KEH33614.1|  LRR receptor-like kinase family protein               92.4    8e-18   Medicago truncatula
ref|XP_002264952.1|  PREDICTED: leucine-rich repeat receptor-like...  92.4    8e-18   Vitis vinifera
gb|EYU30632.1|  hypothetical protein MIMGU_mgv1a022995mg              89.4    8e-18   Erythranthe guttata [common monkey flower]
ref|XP_004981595.1|  PREDICTED: leucine-rich repeat receptor-like...  92.4    9e-18   Setaria italica
ref|XP_011019593.1|  PREDICTED: probably inactive leucine-rich re...  92.4    9e-18   Populus euphratica
gb|EYU26654.1|  hypothetical protein MIMGU_mgv1a001213mg              92.0    9e-18   Erythranthe guttata [common monkey flower]
ref|XP_009396215.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  91.7    9e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007025341.1|  Leucine-rich repeat protein kinase family pr...  91.7    9e-18   
ref|XP_009106236.1|  PREDICTED: receptor protein kinase CLAVATA1      92.4    9e-18   Brassica rapa
ref|XP_007040964.1|  Leucine-rich receptor-like protein kinase fa...  92.0    1e-17   
ref|XP_002317696.2|  hypothetical protein POPTR_0012s04160g           92.0    1e-17   
ref|XP_010927978.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  91.7    1e-17   Elaeis guineensis
ref|XP_007025340.1|  Leucine-rich repeat protein kinase family pr...  91.3    1e-17   
ref|XP_008351784.1|  PREDICTED: putative receptor-like protein ki...  92.0    1e-17   
ref|XP_001754727.1|  CLL1A clavata1-like receptor S/T protein kin...  92.0    1e-17   
emb|CDY36706.1|  BnaC02g31270D                                        92.0    1e-17   Brassica napus [oilseed rape]
ref|NP_001042048.1|  Os01g0152800                                     92.0    1e-17   
ref|XP_007021767.1|  Leucine-rich repeat protein kinase family pr...  92.0    1e-17   
gb|EAY72573.1|  hypothetical protein OsI_00439                        92.0    1e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_009417563.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  90.9    1e-17   
ref|XP_010675938.1|  PREDICTED: LRR receptor-like serine/threonin...  91.7    1e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006382632.1|  hypothetical protein POPTR_0005s03970g           92.0    1e-17   Populus trichocarpa [western balsam poplar]
ref|XP_009417562.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  91.3    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006338306.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  91.3    1e-17   Solanum tuberosum [potatoes]
ref|XP_010064788.1|  PREDICTED: putative receptor-like protein ki...  92.0    1e-17   Eucalyptus grandis [rose gum]
gb|KJB73883.1|  hypothetical protein B456_011G2584002                 88.2    1e-17   Gossypium raimondii
ref|XP_002269902.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      91.3    1e-17   Vitis vinifera
ref|XP_006300675.1|  hypothetical protein CARUB_v10019714mg           91.7    1e-17   Capsella rubella
gb|KCW69037.1|  hypothetical protein EUGRSUZ_F02592                   91.7    1e-17   Eucalyptus grandis [rose gum]
ref|XP_010428620.1|  PREDICTED: receptor protein kinase CLAVATA1-...  91.7    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_009588501.1|  PREDICTED: probable LRR receptor-like serine...  91.3    1e-17   
ref|XP_010999778.1|  PREDICTED: probable LRR receptor-like serine...  91.7    2e-17   Populus euphratica
ref|XP_009123620.1|  PREDICTED: putative receptor-like protein ki...  91.7    2e-17   Brassica rapa
ref|XP_004979517.1|  PREDICTED: putative receptor-like protein ki...  91.7    2e-17   Setaria italica
ref|XP_010910648.1|  PREDICTED: putative receptor-like protein ki...  89.0    2e-17   Elaeis guineensis
ref|XP_004232118.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      90.9    2e-17   Solanum lycopersicum
gb|KJB69703.1|  hypothetical protein B456_011G038400                  90.9    2e-17   Gossypium raimondii
ref|XP_010939071.1|  PREDICTED: probable LRR receptor-like serine...  91.3    2e-17   Elaeis guineensis
gb|KJB59753.1|  hypothetical protein B456_009G269700                  90.5    2e-17   Gossypium raimondii
gb|KJB69702.1|  hypothetical protein B456_011G038400                  90.5    2e-17   Gossypium raimondii
gb|ADD64789.1|  CLAVATA1                                              91.3    2e-17   Brassica napus [oilseed rape]
ref|NP_001238576.1|  receptor protein kinase-like protein precursor   91.3    2e-17   Glycine max [soybeans]
gb|AAT64032.1|  putative leucine-rich repeat transmembrane protein    90.5    2e-17   Gossypium hirsutum [American cotton]
gb|AAP49010.1|  CLV1-like receptor kinase                             91.3    2e-17   Brassica napus [oilseed rape]
ref|XP_002510557.1|  Receptor protein kinase CLAVATA1 precursor, ...  90.9    2e-17   
ref|XP_009614227.1|  PREDICTED: probable LRR receptor-like serine...  90.9    2e-17   Nicotiana tomentosiformis
ref|XP_010054700.1|  PREDICTED: putative receptor-like protein ki...  90.9    2e-17   Eucalyptus grandis [rose gum]
ref|XP_009391272.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  90.5    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008345324.1|  PREDICTED: putative receptor-like protein ki...  91.3    3e-17   
ref|XP_011462029.1|  PREDICTED: probable LRR receptor-like serine...  90.9    3e-17   Fragaria vesca subsp. vesca
ref|XP_008791706.1|  PREDICTED: putative receptor-like protein ki...  90.9    3e-17   
ref|XP_003571896.1|  PREDICTED: probable LRR receptor-like serine...  90.1    3e-17   Brachypodium distachyon [annual false brome]
gb|EEC66712.1|  hypothetical protein OsI_33040                        90.9    3e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_009391273.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  90.5    3e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010907375.1|  PREDICTED: probable LRR receptor-like serine...  90.9    3e-17   Elaeis guineensis
ref|XP_010935096.1|  PREDICTED: leucine-rich repeat receptor-like...  90.9    3e-17   Elaeis guineensis
ref|XP_010064793.1|  PREDICTED: putative receptor-like protein ki...  90.1    3e-17   
emb|CDP10862.1|  unnamed protein product                              90.1    3e-17   Coffea canephora [robusta coffee]
ref|NP_001238004.1|  receptor protein kinase-like protein precursor   90.9    3e-17   Glycine max [soybeans]
dbj|BAC41332.1|  LRR receptor-like kinase                             90.9    3e-17   Glycine max [soybeans]
emb|CCF03508.1|  receptor kinase                                      90.9    3e-17   Arabidopsis lyrata [lyrate rockcress]
ref|XP_006435205.1|  hypothetical protein CICLE_v10000156mg           90.5    3e-17   Citrus clementina [clementine]
ref|XP_002308597.2|  hypothetical protein POPTR_0006s25380g           90.5    3e-17   
ref|XP_011074693.1|  PREDICTED: receptor protein kinase CLAVATA1-...  90.5    3e-17   Sesamum indicum [beniseed]
emb|CDX92460.1|  BnaA10g14990D                                        90.5    3e-17   
ref|XP_006473681.1|  PREDICTED: receptor protein kinase CLAVATA1-...  90.5    3e-17   Citrus sinensis [apfelsine]
emb|CCF03505.1|  receptor kinase                                      90.9    3e-17   Arabidopsis lyrata [lyrate rockcress]
gb|AAX93041.1|  hypothetical protein LOC_Os11g07260                   90.5    3e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009782387.1|  PREDICTED: probable LRR receptor-like serine...  90.5    3e-17   Nicotiana sylvestris
gb|KHG24572.1|  Receptor protein kinase CLAVATA1                      90.5    3e-17   Gossypium arboreum [tree cotton]
gb|KDO84901.1|  hypothetical protein CISIN_1g002010mg                 90.5    3e-17   Citrus sinensis [apfelsine]
ref|XP_008346276.1|  PREDICTED: receptor-like protein kinase          90.1    4e-17   
ref|XP_002322110.2|  hypothetical protein POPTR_0015s04680g           90.5    4e-17   Populus trichocarpa [western balsam poplar]
ref|XP_004160745.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  90.5    4e-17   
ref|XP_002279563.1|  PREDICTED: receptor protein kinase CLAVATA1      90.5    4e-17   Vitis vinifera
ref|XP_007154851.1|  hypothetical protein PHAVU_003G152900g           89.7    4e-17   Phaseolus vulgaris [French bean]
ref|XP_010484821.1|  PREDICTED: putative receptor-like protein ki...  89.7    4e-17   Camelina sativa [gold-of-pleasure]
ref|XP_002526889.1|  serine-threonine protein kinase, plant-type,...  90.1    4e-17   
ref|NP_001065874.2|  Os11g0173800                                     90.1    4e-17   
emb|CBI19895.3|  unnamed protein product                              90.1    4e-17   Vitis vinifera
gb|KCW69044.1|  hypothetical protein EUGRSUZ_F02602                   89.7    4e-17   Eucalyptus grandis [rose gum]
ref|XP_006350351.1|  PREDICTED: probable LRR receptor-like serine...  90.5    4e-17   Solanum tuberosum [potatoes]
ref|XP_010416487.1|  PREDICTED: receptor protein kinase CLAVATA1-...  90.1    4e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010929457.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  89.7    4e-17   Elaeis guineensis
ref|XP_009376453.1|  PREDICTED: probable LRR receptor-like serine...  90.5    4e-17   Pyrus x bretschneideri [bai li]
ref|XP_003560981.1|  PREDICTED: putative leucine-rich repeat rece...  90.1    4e-17   
ref|XP_010256508.1|  PREDICTED: probable LRR receptor-like serine...  90.1    4e-17   Nelumbo nucifera [Indian lotus]
ref|XP_007158089.1|  hypothetical protein PHAVU_002G123200g           90.1    4e-17   Phaseolus vulgaris [French bean]
emb|CBI16897.3|  unnamed protein product                              89.7    5e-17   Vitis vinifera
ref|XP_002278965.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      89.7    5e-17   Vitis vinifera
gb|KDP44794.1|  hypothetical protein JCGZ_01294                       90.5    5e-17   Jatropha curcas
emb|CDY02112.1|  BnaA03g40550D                                        90.1    5e-17   
ref|XP_008369385.1|  PREDICTED: putative receptor-like protein ki...  90.1    5e-17   
gb|KDP44787.1|  hypothetical protein JCGZ_01287                       86.3    5e-17   Jatropha curcas
ref|XP_002300697.2|  receptor protein kinase                          90.1    5e-17   
ref|XP_011035599.1|  PREDICTED: probable LRR receptor-like serine...  90.1    5e-17   
ref|XP_002453589.1|  hypothetical protein SORBIDRAFT_04g008570        89.4    5e-17   
ref|XP_004972876.1|  PREDICTED: probable LRR receptor-like serine...  90.1    5e-17   
ref|XP_003557615.1|  PREDICTED: leucine-rich repeat receptor-like...  90.1    5e-17   
gb|ACD56650.1|  putative leucine-rich repeat transmembrane protein    89.4    5e-17   
emb|CAN63733.1|  hypothetical protein VITISV_025883                   89.4    5e-17   
ref|XP_010925613.1|  PREDICTED: probable LRR receptor-like serine...  89.0    6e-17   
gb|KCW80199.1|  hypothetical protein EUGRSUZ_C01543                   89.7    6e-17   
ref|XP_010925612.1|  PREDICTED: probable LRR receptor-like serine...  89.4    6e-17   
gb|EYU17827.1|  hypothetical protein MIMGU_mgv1a023554mg              89.7    6e-17   
ref|XP_007009033.1|  Serine-threonine protein kinase, plant-type,...  89.7    6e-17   
ref|XP_010911433.1|  PREDICTED: putative receptor-like protein ki...  87.8    7e-17   
ref|XP_007225356.1|  hypothetical protein PRUPE_ppa000916mg           89.7    7e-17   
ref|XP_010065839.1|  PREDICTED: putative receptor-like protein ki...  89.7    7e-17   
ref|XP_008221401.1|  PREDICTED: receptor protein kinase CLAVATA1      89.7    7e-17   
emb|CDP20234.1|  unnamed protein product                              89.7    7e-17   
ref|XP_011099082.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  89.0    7e-17   
ref|XP_011021261.1|  PREDICTED: probable LRR receptor-like serine...  89.7    7e-17   
ref|XP_011462028.1|  PREDICTED: LRR receptor-like serine/threonin...  86.3    8e-17   
ref|XP_002865197.1|  flagellin-sensitive 2                            89.7    8e-17   
ref|XP_006373507.1|  hypothetical protein POPTR_0017s14360g           89.0    8e-17   
emb|CBI21262.3|  unnamed protein product                              88.2    8e-17   
gb|KCW63525.1|  hypothetical protein EUGRSUZ_G01159                   88.6    8e-17   
ref|XP_010526993.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  89.0    8e-17   
ref|XP_006853709.1|  hypothetical protein AMTR_s00056p00150470        89.4    8e-17   
emb|CCF03506.1|  receptor kinase                                      89.7    8e-17   
ref|XP_009415746.1|  PREDICTED: leucine-rich repeat receptor-like...  89.4    8e-17   
ref|XP_009337767.1|  PREDICTED: probable LRR receptor-like serine...  89.4    8e-17   
ref|XP_011039407.1|  PREDICTED: probable LRR receptor-like serine...  88.6    9e-17   
ref|XP_010269665.1|  PREDICTED: probable LRR receptor-like serine...  89.4    9e-17   
ref|XP_008659447.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  85.1    9e-17   
emb|CCF03507.1|  receptor kinase                                      89.4    9e-17   
emb|CAH56436.1|  somatic embryogenesis receptor-like kinase 2         88.6    9e-17   
emb|CCF03504.1|  receptor kinase                                      89.4    9e-17   
ref|XP_008223897.1|  PREDICTED: probable LRR receptor-like serine...  89.4    9e-17   
ref|XP_006645505.1|  PREDICTED: putative receptor-like protein ki...  89.4    9e-17   
ref|XP_009400102.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  88.6    1e-16   
gb|KCW58273.1|  hypothetical protein EUGRSUZ_H00964                   89.4    1e-16   
ref|XP_009400110.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  88.6    1e-16   
ref|XP_002297907.2|  leucine-rich repeat transmembrane protein ki...  89.0    1e-16   
ref|XP_006383439.1|  hypothetical protein POPTR_0005s15520g           89.4    1e-16   
dbj|BAJ89729.1|  predicted protein                                    89.0    1e-16   
gb|EYU40965.1|  hypothetical protein MIMGU_mgv1a024855mg              89.0    1e-16   
ref|XP_011039404.1|  PREDICTED: probable LRR receptor-like serine...  88.6    1e-16   
gb|KCW54708.1|  hypothetical protein EUGRSUZ_I00657                   86.3    1e-16   
ref|XP_010026074.1|  PREDICTED: receptor protein kinase CLAVATA1      89.0    1e-16   
emb|CDY23037.1|  BnaC07g31500D                                        89.0    1e-16   
ref|XP_006423117.1|  hypothetical protein CICLE_v10027688mg           89.4    1e-16   
ref|XP_006358680.1|  PREDICTED: probable LRR receptor-like serine...  89.0    1e-16   
ref|XP_009377798.1|  PREDICTED: probable LRR receptor-like serine...  89.0    1e-16   
ref|XP_010257102.1|  PREDICTED: putative receptor-like protein ki...  89.0    1e-16   
ref|XP_007012155.1|  Probably inactive leucine-rich repeat recept...  89.0    1e-16   
ref|XP_004954644.1|  PREDICTED: putative receptor-like protein ki...  89.0    1e-16   
gb|EEC69968.1|  hypothetical protein OsI_00436                        89.0    1e-16   
emb|CAN71566.1|  hypothetical protein VITISV_016304                   86.3    1e-16   
ref|XP_011470626.1|  PREDICTED: LRR receptor-like serine/threonin...  86.3    1e-16   
ref|XP_010026767.1|  PREDICTED: probable LRR receptor-like serine...  89.0    1e-16   
ref|XP_008349363.1|  PREDICTED: putative receptor-like protein ki...  89.0    1e-16   
ref|XP_006590881.1|  PREDICTED: receptor protein kinase CLAVATA1-...  88.2    1e-16   
gb|KJB73884.1|  hypothetical protein B456_011G258500                  89.0    1e-16   
ref|XP_007009038.1|  Serine-threonine protein kinase, plant-type,...  89.0    1e-16   
gb|EEC68386.1|  hypothetical protein OsI_36534                        88.6    1e-16   
ref|XP_008792970.1|  PREDICTED: probable LRR receptor-like serine...  87.8    1e-16   
emb|CDX84254.1|  BnaC04g10160D                                        88.6    1e-16   
ref|XP_008444584.1|  PREDICTED: probable LRR receptor-like serine...  88.6    1e-16   
emb|CCF03509.1|  receptor kinase                                      89.0    1e-16   
ref|XP_002317403.1|  leucine-rich repeat transmembrane protein ki...  87.8    2e-16   
ref|XP_009618941.1|  PREDICTED: putative receptor-like protein ki...  88.6    2e-16   
gb|KEH43256.1|  LRR receptor-like kinase                              88.6    2e-16   
gb|KEH43257.1|  LRR receptor-like kinase                              88.6    2e-16   
gb|EMT23949.1|  Putative LRR receptor-like serine/threonine-prote...  87.8    2e-16   
ref|XP_009618942.1|  PREDICTED: putative receptor-like protein ki...  88.6    2e-16   
ref|XP_008364895.1|  PREDICTED: probable LRR receptor-like serine...  87.8    2e-16   
ref|XP_010654174.1|  PREDICTED: putative receptor-like protein ki...  88.6    2e-16   
ref|XP_010058160.1|  PREDICTED: putative receptor-like protein ki...  88.2    2e-16   
gb|KGN62467.1|  hypothetical protein Csa_2G354930                     88.6    2e-16   
gb|KHN25406.1|  Receptor protein kinase CLAVATA1                      88.6    2e-16   
emb|CAN83822.1|  hypothetical protein VITISV_030954                   89.0    2e-16   
gb|KCW80480.1|  hypothetical protein EUGRSUZ_C018221                  85.1    2e-16   
gb|KCW69036.1|  hypothetical protein EUGRSUZ_F02590                   88.6    2e-16   
ref|XP_009800500.1|  PREDICTED: putative receptor-like protein ki...  88.6    2e-16   
ref|XP_010092495.1|  putative LRR receptor-like serine/threonine-...  85.1    2e-16   
ref|XP_004143021.1|  PREDICTED: probable LRR receptor-like serine...  88.2    2e-16   
gb|AAB58929.1|  CLV1 receptor kinase                                  88.2    2e-16   
ref|NP_177710.1|  receptor protein kinase CLAVATA1                    88.2    2e-16   
gb|AAD02501.1|  receptor kinase                                       88.2    2e-16   
pir||E96787  protein T4O12.5 [imported] - Arabidopsis thaliana        88.2    2e-16
ref|XP_011012715.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  87.8    2e-16   
ref|NP_001152329.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  87.8    2e-16   
ref|XP_011012714.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  87.8    2e-16   
ref|XP_006279948.1|  hypothetical protein CARUB_v10025818mg           88.2    2e-16   
emb|CDX72123.1|  BnaC08g27510D                                        88.2    2e-16   
gb|KCW71731.1|  hypothetical protein EUGRSUZ_E00238                   88.2    2e-16   
ref|XP_009377741.1|  PREDICTED: probable LRR receptor-like serine...  88.2    2e-16   
ref|XP_010257264.1|  PREDICTED: probably inactive leucine-rich re...  88.2    2e-16   
ref|XP_002304615.1|  leucine-rich repeat transmembrane protein ki...  88.2    2e-16   
ref|XP_009409686.1|  PREDICTED: putative receptor-like protein ki...  88.6    2e-16   
ref|XP_008792202.1|  PREDICTED: probable LRR receptor-like serine...  87.8    2e-16   
ref|XP_006413888.1|  hypothetical protein EUTSA_v10024310mg           88.2    2e-16   
ref|XP_002305306.2|  hypothetical protein POPTR_0004s10790g           87.8    2e-16   
ref|XP_006384231.1|  hypothetical protein POPTR_0004s10790g           87.8    2e-16   
emb|CDP19652.1|  unnamed protein product                              88.2    2e-16   
ref|XP_008339051.1|  PREDICTED: putative receptor-like protein ki...  88.2    2e-16   
ref|XP_009351465.1|  PREDICTED: probable LRR receptor-like serine...  87.4    2e-16   
ref|XP_008783060.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  87.4    2e-16   
ref|XP_009107554.1|  PREDICTED: probable LRR receptor-like serine...  87.4    2e-16   
ref|XP_007214468.1|  hypothetical protein PRUPE_ppa023770mg           85.1    2e-16   
ref|XP_007219655.1|  hypothetical protein PRUPE_ppa025151mg           88.2    2e-16   
ref|XP_010248541.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  87.4    2e-16   
gb|EEC68365.1|  hypothetical protein OsI_36500                        87.0    2e-16   
gb|EYU21721.1|  hypothetical protein MIMGU_mgv1a019783mg              87.8    3e-16   
ref|XP_007157219.1|  hypothetical protein PHAVU_002G052600g           83.6    3e-16   
ref|NP_001068120.1|  Os11g0570000                                     87.0    3e-16   
ref|XP_007026751.1|  LRR receptor-like serine/threonine-protein k...  87.8    3e-16   
ref|XP_009340992.1|  PREDICTED: probable LRR receptor-like serine...  87.8    3e-16   
ref|XP_010041038.1|  PREDICTED: putative receptor-like protein ki...  87.4    3e-16   
emb|CAN71863.1|  hypothetical protein VITISV_023530                   87.8    3e-16   
ref|XP_009368577.1|  PREDICTED: leucine-rich repeat receptor-like...  87.8    3e-16   
gb|KCW74133.1|  hypothetical protein EUGRSUZ_E02764                   87.4    3e-16   
ref|XP_010262819.1|  PREDICTED: putative receptor-like protein ki...  87.8    3e-16   
emb|CDY45620.1|  BnaCnng13280D                                        87.8    3e-16   
ref|XP_006587651.1|  PREDICTED: probable LRR receptor-like serine...  87.8    3e-16   
ref|XP_004173630.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  85.5    3e-16   
ref|XP_009393965.1|  PREDICTED: leucine-rich repeat receptor-like...  87.0    3e-16   
ref|XP_009131797.1|  PREDICTED: LRR receptor-like serine/threonin...  87.8    3e-16   
emb|CBI29704.3|  unnamed protein product                              87.4    3e-16   
ref|XP_007153543.1|  hypothetical protein PHAVU_003G044400g           87.0    3e-16   
ref|XP_008347286.1|  PREDICTED: LRR receptor-like serine/threonin...  87.4    3e-16   
gb|KEH19631.1|  LRR receptor-like kinase                              87.8    3e-16   
gb|EAY80122.1|  hypothetical protein OsI_35294                        87.8    3e-16   
gb|KJB73886.1|  hypothetical protein B456_011G258700                  87.4    3e-16   
gb|EYU40960.1|  hypothetical protein MIMGU_mgv1a018813mg              87.4    3e-16   
gb|KFK34061.1|  hypothetical protein AALP_AA5G097000                  87.4    3e-16   
gb|KCW80196.1|  hypothetical protein EUGRSUZ_C01538                   87.4    3e-16   
ref|XP_002263291.2|  PREDICTED: leucine-rich repeat receptor-like...  87.4    3e-16   
ref|XP_002889046.1|  hypothetical protein ARALYDRAFT_476729           87.4    3e-16   
ref|XP_006382044.1|  hypothetical protein POPTR_0006s25380g           87.4    3e-16   
ref|XP_008808621.1|  PREDICTED: leucine-rich repeat receptor-like...  87.4    3e-16   
emb|CBI25249.3|  unnamed protein product                              87.8    4e-16   
gb|ABF99108.1|  Receptor protein kinase CLAVATA1 precursor, putat...  87.4    4e-16   
ref|XP_003600865.1|  Kinase-like protein                              87.4    4e-16   
gb|EYU34890.1|  hypothetical protein MIMGU_mgv1a025800mg              87.4    4e-16   
ref|XP_009409684.1|  PREDICTED: putative receptor-like protein ki...  87.8    4e-16   
gb|EEE51731.1|  hypothetical protein OsJ_33139                        87.8    4e-16   
ref|XP_007009037.1|  LRR receptor-like serine/threonine-protein k...  87.4    4e-16   
ref|XP_010539846.1|  PREDICTED: receptor protein kinase CLAVATA1      87.4    4e-16   
gb|KJB40660.1|  hypothetical protein B456_007G073100                  87.4    4e-16   
gb|KJB13140.1|  hypothetical protein B456_002G060700                  86.3    4e-16   
ref|XP_009781121.1|  PREDICTED: probable LRR receptor-like serine...  86.7    4e-16   
gb|KCW63523.1|  hypothetical protein EUGRSUZ_G011582                  84.3    4e-16   
emb|CDP14590.1|  unnamed protein product                              87.4    4e-16   
ref|XP_008371495.1|  PREDICTED: probable LRR receptor-like serine...  86.7    4e-16   
ref|XP_010050768.1|  PREDICTED: putative receptor-like protein ki...  87.4    4e-16   
ref|XP_008371496.1|  PREDICTED: probable LRR receptor-like serine...  86.7    4e-16   
gb|AAX93038.1|  hypothetical protein LOC_Os11g07230                   87.8    4e-16   
ref|XP_007213585.1|  hypothetical protein PRUPE_ppa003046mg           86.7    4e-16   
gb|EAY92008.1|  hypothetical protein OsI_13698                        87.4    4e-16   
gb|EYU26005.1|  hypothetical protein MIMGU_mgv1a024580mg              86.7    4e-16   
ref|XP_006390268.1|  hypothetical protein EUTSA_v10018069mg           87.4    4e-16   
gb|AAP68887.1|  putative receptor-like protein kinase 1               87.4    4e-16   
ref|XP_009781120.1|  PREDICTED: probable LRR receptor-like serine...  86.7    4e-16   
emb|CCF03501.1|  receptor kinase                                      87.4    5e-16   
emb|CCF03510.1|  receptor kinase                                      87.4    5e-16   
gb|KCW80486.1|  hypothetical protein EUGRSUZ_C01828                   87.0    5e-16   
ref|XP_011022287.1|  PREDICTED: leucine-rich repeat receptor-like...  87.0    5e-16   
ref|XP_010535394.1|  PREDICTED: putative receptor-like protein ki...  87.0    5e-16   
gb|KJB73903.1|  hypothetical protein B456_011G260200                  87.0    5e-16   
ref|XP_009373071.1|  PREDICTED: probable LRR receptor-like serine...  87.0    5e-16   
gb|AAB82755.1|  receptor kinase-like protein                          87.0    5e-16   
ref|XP_006283067.1|  hypothetical protein CARUB_v10004060mg           87.0    5e-16   
ref|XP_008224399.1|  PREDICTED: probable LRR receptor-like serine...  87.0    5e-16   
ref|XP_004964649.1|  PREDICTED: putative leucine-rich repeat rece...  87.0    5e-16   
ref|XP_008223875.1|  PREDICTED: probable LRR receptor-like serine...  87.0    5e-16   
ref|XP_008794419.1|  PREDICTED: putative leucine-rich repeat rece...  87.0    5e-16   
ref|XP_002970036.1|  hypothetical protein SELMODRAFT_146738           87.0    5e-16   
emb|CDP19927.1|  unnamed protein product                              87.0    5e-16   
ref|XP_011035024.1|  PREDICTED: receptor protein kinase CLAVATA1-...  86.7    5e-16   
ref|XP_010100900.1|  Protein NSP-INTERACTING KINASE 1                 86.7    5e-16   
emb|CDP16554.1|  unnamed protein product                              86.3    6e-16   
gb|EYU40963.1|  hypothetical protein MIMGU_mgv1a000739mg              87.0    6e-16   
gb|EAZ18782.1|  hypothetical protein OsJ_34308                        87.0    6e-16   
ref|XP_010054697.1|  PREDICTED: putative receptor-like protein ki...  87.0    6e-16   
ref|NP_001068117.1|  Os11g0569500                                     87.0    6e-16   
gb|KDP36903.1|  hypothetical protein JCGZ_08194                       87.0    6e-16   
ref|XP_008362210.1|  PREDICTED: probable LRR receptor-like serine...  87.0    6e-16   
gb|EYU17822.1|  hypothetical protein MIMGU_mgv1a018971mg              86.3    6e-16   
emb|CDP20776.1|  unnamed protein product                              84.7    6e-16   
ref|XP_010068376.1|  PREDICTED: putative receptor-like protein ki...  87.0    6e-16   
ref|XP_008370155.1|  PREDICTED: probable LRR receptor-like serine...  86.7    6e-16   
gb|KCW77199.1|  hypothetical protein EUGRSUZ_D01548                   87.0    6e-16   
ref|XP_009630581.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      86.3    6e-16   
ref|XP_009803321.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  86.3    6e-16   
ref|XP_008225339.1|  PREDICTED: probable LRR receptor-like serine...  86.3    6e-16   
gb|KCW86689.1|  hypothetical protein EUGRSUZ_B03306                   86.3    6e-16   
ref|XP_008459453.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      86.3    6e-16   
ref|XP_008358557.1|  PREDICTED: LRR receptor-like serine/threonin...  87.0    6e-16   
gb|KCW62804.1|  hypothetical protein EUGRSUZ_G003951                  83.2    6e-16   
ref|XP_010241414.1|  PREDICTED: probable LRR receptor-like serine...  86.7    6e-16   
ref|XP_003612525.1|  Kinase-like protein                              86.7    6e-16   
ref|XP_004141483.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  86.3    6e-16   
ref|XP_003565662.1|  PREDICTED: probable LRR receptor-like serine...  86.7    7e-16   
ref|XP_009803320.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  86.3    7e-16   
emb|CCF03503.1|  receptor kinase                                      86.7    7e-16   
ref|XP_004309032.2|  PREDICTED: probable LRR receptor-like serine...  87.0    7e-16   
ref|XP_010100747.1|  putative LRR receptor-like serine/threonine-...  85.9    7e-16   
ref|XP_009141291.1|  PREDICTED: probable leucine-rich repeat rece...  86.7    7e-16   
emb|CDX91804.1|  BnaC03g31060D                                        86.7    7e-16   
gb|KCW63534.1|  hypothetical protein EUGRSUZ_G01170                   86.7    8e-16   
ref|XP_004308533.1|  PREDICTED: probable LRR receptor-like serine...  86.7    8e-16   
ref|XP_008385914.1|  PREDICTED: probable LRR receptor-like serine...  86.7    8e-16   
ref|XP_008243752.1|  PREDICTED: protein NSP-INTERACTING KINASE 2      85.9    8e-16   
gb|KDP24340.1|  hypothetical protein JCGZ_25636                       85.9    8e-16   
ref|XP_010091686.1|  Protein NSP-INTERACTING KINASE 2                 85.9    8e-16   
ref|XP_009418103.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  85.9    8e-16   
ref|XP_006848177.1|  hypothetical protein AMTR_s00029p00235900        86.7    8e-16   
ref|XP_010033733.1|  PREDICTED: probable LRR receptor-like serine...  86.3    8e-16   
ref|XP_006421471.1|  hypothetical protein CICLE_v10004276mg           86.3    8e-16   
ref|XP_010058159.1|  PREDICTED: putative receptor-like protein ki...  86.3    8e-16   
ref|XP_010068348.1|  PREDICTED: putative receptor-like protein ki...  86.7    8e-16   
emb|CCF12094.1|  receptor kinase                                      86.7    8e-16   
ref|XP_002311067.2|  leucine-rich repeat transmembrane protein ki...  86.3    8e-16   



>ref|XP_011073654.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Sesamum indicum]
Length=1015

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 110/154 (71%), Gaps = 4/154 (3%)
 Frame = +1

Query  163  RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvs  342
            R+S GA  G+   + E  ALLSIKAA T D QS+L SWN STSHCTW  VTCD     V+
Sbjct  16   RYSTGARPGR---MPEYRALLSIKAAITEDPQSTLASWNASTSHCTWEGVTCDVSGRHVT  72

Query  343  ldlsgl-NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  519
                   +L+G LSPDVG L FLVNLS+AAN LSGPVPP+IS I  LR+LNLSNN+F  +
Sbjct  73   ALDISNLSLTGTLSPDVGHLRFLVNLSVAANSLSGPVPPQISDIPNLRYLNLSNNVFNLS  132

Query  520  FPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTS  621
            FP QL +L NLQVLDLYNNN+TGD P + Y +TS
Sbjct  133  FPPQLYRLKNLQVLDLYNNNMTGDFPSQAYLLTS  166


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G L+P++G L  L ++ ++ N LSG +PP  + +  +  LNL  N    + P  + +L
Sbjct  274  LTGGLTPELGNLKSLKSMDLSNNMLSGELPPSFAELKNMTLLNLFRNKLTGSIPDFIGEL  333

Query  544  ANLQVLDLYNNNLTGDLP  597
              LQVL L+ NN TG +P
Sbjct  334  PELQVLQLWENNFTGSIP  351


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NLSG ++P++ +   L  + ++ NQLSG VP EI+ +  L +LNLS N    + P  +A 
Sbjct  513  NLSGPIAPEISRCKLLTFVDLSRNQLSGSVPTEITGMRILNYLNLSRNHLVGSIPSSIAS  572

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  +D   NN +G +P
Sbjct  573  MQSLTSVDFSYNNFSGLVP  591


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +  ++G L  L  L +  N L+G + PE+  + +L+ ++LSNN+     P   A+L
Sbjct  250  LSGEIPAEIGNLQNLDTLFLQVNGLTGGLTPELGNLKSLKSMDLSNNMLSGELPPSFAEL  309

Query  544  ANLQVLDLYNNNLTGDLP  597
             N+ +L+L+ N LTG +P
Sbjct  310  KNMTLLNLFRNKLTGSIP  327


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG +  ++G+L  L  +  + N LSGP+ PEIS    L F++LS N    + P ++  +
Sbjct  490  FSGRIPAEIGKLQQLSKMDFSHNNLSGPIAPEISRCKLLTFVDLSRNQLSGSVPTEITGM  549

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G +P  +  M S
Sbjct  550  RILNYLNLSRNHLVGSIPSSIASMQS  575



>ref|XP_009613990.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana tomentosiformis]
Length=1019

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = +1

Query  178  AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg  357
            + A KP  + E  ALLS+K A T D QS+L SWNISTSHCTW+ VTCD   HV SL++S 
Sbjct  19   SAAAKPHFLPEYRALLSLKTAITDDPQSALISWNISTSHCTWKGVTCDKYRHVTSLNISN  78

Query  358  lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  537
            LNL+G L P++GQL +LVNLS+A NQ SGP+P E+S IS LR+LNLSNNIF  +FP QL 
Sbjct  79   LNLTGTLPPEIGQLRYLVNLSVAVNQFSGPIPVELSLISNLRYLNLSNNIFNLSFPQQLT  138

Query  538  QLANLQVLDLYNNNLTGDLPVEVYKMTS  621
            QL NL+VLD+YNNNLTG+L V V+ +T+
Sbjct  139  QLINLEVLDIYNNNLTGELAVGVHNLTN  166


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 51/85 (60%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             +G + P+ G+ PFL  L+++ N+L+G +PPEI  I+TL+ L +   N F    P ++  
Sbjct  177  FTGRIPPEFGKFPFLKYLAVSGNELAGDIPPEIGNITTLKELYVGYYNTFSGGIPPEIGN  236

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L   D  N  L+G++P E+ K+
Sbjct  237  LSELVRFDAANCGLSGNIPSEIGKL  261


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +  ++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+     P  L++L
Sbjct  250  LSGNIPSEIGKLKKLDTLFLQVNSLSGSLIPEIGYLKSLKSLDLSNNLLSGEIPLTLSEL  309

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  310  KNLTLLNLFRNKLYGSIP  327


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L P++G L  L +L ++ N LSG +P  +S +  L  LNL  N    + P  + +L
Sbjct  274  LSGSLIPEIGYLKSLKSLDLSNNLLSGEIPLTLSELKNLTLLNLFRNKLYGSIPEFIQEL  333

Query  544  ANLQVLDLYNNNLTGDLPV  600
              L+VL L+ NN TG +P+
Sbjct  334  PKLEVLQLWENNFTGSIPM  352


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG +  ++G+L  L  +  + N  SGP+PPEIS    L F++LS N      P ++  +
Sbjct  490  FSGRIPAEIGKLQQLSKMDFSGNGFSGPIPPEISNCKALTFIDLSRNKLSGEIPTEITGM  549

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L++  N+L G +P  +  M S
Sbjct  550  RILNYLNVSRNHLVGSIPASISAMQS  575


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 42/84 (50%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G L   +G    +  L +  N+ SG +P EI  +  L  ++ S N F    P +++  
Sbjct  466  LTGRLPSSIGSFSGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSGNGFSGPIPPEISNC  525

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L+G++P E+  M
Sbjct  526  KALTFIDLSRNKLSGEIPTEITGM  549



>dbj|BAK52390.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
peruvianum]
Length=1015

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 111/152 (73%), Gaps = 0/152 (0%)
 Frame = +1

Query  166  HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsl  345
            H     AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SL
Sbjct  11   HFTDFSAGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSL  70

Query  346  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  525
            D+SG NL+G L P+VG L FL NLS+A NQ +GPVP EIS I  L +LNLSNNIFG  FP
Sbjct  71   DISGFNLTGTLPPEVGNLRFLQNLSVAVNQFTGPVPVEISFIPNLSYLNLSNNIFGMEFP  130

Query  526  HQLAQLANLQVLDLYNNNLTGDLPVEVYKMTS  621
             QL +L NLQVLDLYNNN+TG+LPVEVY+MT 
Sbjct  131  SQLTRLRNLQVLDLYNNNMTGELPVEVYQMTK  162


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +  ++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+F    P   A+L
Sbjct  246  LSGKIPREIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAEL  305

Query  544  ANLQVLDLYNNNLTGDLP  597
             N+ +++L+ N L G +P
Sbjct  306  KNITLVNLFRNKLYGSIP  323


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+P++G L  L +L ++ N  SG +PP  + +  +  +NL  N    + P  +  L
Sbjct  270  LSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRNKLYGSIPEFIEDL  329

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+VL L+ NN TG +P
Sbjct  330  PELEVLQLWENNFTGSIP  347


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NLSG ++P++ Q   L  + ++ NQLSG +P EI+ +  L +LNLS N    + P  ++ 
Sbjct  509  NLSGPIAPEISQCKLLTYVDLSRNQLSGEIPTEITGMRILNYLNLSRNHLVGSIPAPISS  568

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  +D   NN +G +P
Sbjct  569  MQSLTSVDFSYNNFSGLVP  587


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 45/87 (52%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG +  ++G+L  L  +  + N LSGP+ PEIS    L +++LS N      P ++  
Sbjct  485  KFSGRIPAEIGKLQQLSKIDFSHNNLSGPIAPEISQCKLLTYVDLSRNQLSGEIPTEITG  544

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            +  L  L+L  N+L G +P  +  M S
Sbjct  545  MRILNYLNLSRNHLVGSIPAPISSMQS  571



>ref|NP_001274713.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1-like precursor [Solanum lycopersicum]
 dbj|BAK52388.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
lycopersicum]
 dbj|BAK52391.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
lycopersicum]
Length=1016

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 111/152 (73%), Gaps = 0/152 (0%)
 Frame = +1

Query  166  HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsl  345
            H     AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SL
Sbjct  12   HFTDFSAGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSL  71

Query  346  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  525
            D+SG NL+G L P+VG L FL NLS+A NQ +GPVP EIS I  L +LNLSNNIFG  FP
Sbjct  72   DISGFNLTGTLPPEVGNLRFLQNLSVAVNQFTGPVPVEISFIPNLSYLNLSNNIFGMEFP  131

Query  526  HQLAQLANLQVLDLYNNNLTGDLPVEVYKMTS  621
             QL +L NLQVLDLYNNN+TG+LPVEVY+MT 
Sbjct  132  SQLTRLRNLQVLDLYNNNMTGELPVEVYQMTK  163


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+F    P   A+L
Sbjct  247  LSGKIPPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAEL  306

Query  544  ANLQVLDLYNNNLTGDLP  597
             N+ +++L+ N L G +P
Sbjct  307  KNITLVNLFRNKLYGSIP  324


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+P++G L  L +L ++ N  SG +PP  + +  +  +NL  N    + P  +  L
Sbjct  271  LSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRNKLYGSIPEFIEDL  330

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+VL L+ NN TG +P
Sbjct  331  PELEVLQLWENNFTGSIP  348


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NLSG ++P++ Q   L  + ++ NQLSG +P EI+ +  L +LNLS N    + P  ++ 
Sbjct  510  NLSGPIAPEISQCKLLTYVDLSRNQLSGEIPTEITGMRILNYLNLSRNHLVGSIPAPISS  569

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  +D   NN +G +P
Sbjct  570  MQSLTSVDFSYNNFSGLVP  588


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 45/87 (52%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG +  ++G+L  L  +  + N LSGP+ PEIS    L +++LS N      P ++  
Sbjct  486  KFSGRIPAEIGKLQQLSKIDFSHNNLSGPIAPEISQCKLLTYVDLSRNQLSGEIPTEITG  545

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            +  L  L+L  N+L G +P  +  M S
Sbjct  546  MRILNYLNLSRNHLVGSIPAPISSMQS  572



>dbj|BAK52389.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
pennellii]
Length=1016

 Score =   171 bits (433),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  184  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  363
            AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SLD+SG N
Sbjct  18   AGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSLDISGFN  77

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G L P+VG L FL NLS+A NQ +GPVP EIS I  L +LNLSNNIFG  FP QL +L
Sbjct  78   LTGTLPPEVGNLRFLQNLSVAVNQFTGPVPVEISFIPNLSYLNLSNNIFGMEFPSQLTRL  137

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
             NLQVLDLYNNN+TG+LPVEVY+MT 
Sbjct  138  RNLQVLDLYNNNMTGELPVEVYQMTK  163


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+F    P   A+L
Sbjct  247  LSGEIPPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAEL  306

Query  544  ANLQVLDLYNNNLTGDLP  597
             N+ +++L+ N L G +P
Sbjct  307  KNITLVNLFRNKLYGSIP  324


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+P++G L  L +L ++ N  SG +PP  + +  +  +NL  N    + P  +  L
Sbjct  271  LSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRNKLYGSIPEFIEDL  330

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+VL L+ NN TG +P
Sbjct  331  PELEVLQLWENNFTGSIP  348


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NLSG ++P++ Q   L  + ++ NQLSG +P EI+ +  L +LNLS N    + P  ++ 
Sbjct  510  NLSGPIAPEISQCKLLTYVDLSRNQLSGEIPTEITGMRILNYLNLSRNHLVGSIPAPISS  569

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  +D   NN +G +P
Sbjct  570  MQSLTSVDFSYNNFSGLVP  588


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 45/87 (52%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG +  ++G+L  L  +  + N LSGP+ PEIS    L +++LS N      P ++  
Sbjct  486  KFSGRIPAEIGKLQQLSKIDFSHNNLSGPIAPEISQCKLLTYVDLSRNQLSGEIPTEITG  545

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            +  L  L+L  N+L G +P  +  M S
Sbjct  546  MRILNYLNLSRNHLVGSIPAPISSMQS  572



>ref|XP_010271550.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nelumbo nucifera]
Length=1032

 Score =   171 bits (432),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = +1

Query  184  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  363
            AGKP+ ++E  ALLS+K A + D Q  L +WN STSHCTW  V+CDSL  VVSLDLS +N
Sbjct  23   AGKPVRISENRALLSLKTAISDDPQGFLQNWNFSTSHCTWTGVSCDSLNRVVSLDLSNMN  82

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            +SG+LSPDVGQL  LVNL++AAN + GP+PP IS IS LR LNLSNN+F  TFP QL++L
Sbjct  83   ISGILSPDVGQLRNLVNLTVAANLIYGPIPPGISYISGLRLLNLSNNVFNGTFPSQLSRL  142

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L+VLDLYNNN+TGDLPVEV  M
Sbjct  143  KYLEVLDLYNNNMTGDLPVEVSDM  166


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +  ++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+    FP   ++L
Sbjct  252  LSGEIPHELGKLQKLDTLFLQVNGLSGELTPELGQLKSLKSMDLSNNMLSGEFPETFSEL  311

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  312  KNLTLLNLFRNKLHGAIP  329


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+P++GQL  L ++ ++ N LSG  P   S +  L  LNL  N      P  +  L
Sbjct  276  LSGELTPELGQLKSLKSMDLSNNMLSGEFPETFSELKNLTLLNLFRNKLHGAIPDFIGDL  335

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+VL L+ NN TG +P
Sbjct  336  PELEVLQLWENNFTGSIP  353


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ Q   L  + ++ N+LSG +PPEI+ +  L +LNLS N    + P  ++ +
Sbjct  516  FSGSIAPEISQCKLLTFVDLSRNELSGEIPPEITGMRILNYLNLSRNHLVGSIPASISTM  575

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  576  QSLTSVDFSYNNLSGLVP  593


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 51/85 (60%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             SG + P+ G+  FL  ++++ N+L+GP+PP I  ++ L+ L L   N + S  P ++  
Sbjct  179  FSGRIPPEYGRWEFLEYMALSGNELTGPIPPTIGNLTKLQQLYLGYYNTYESGIPAEMGN  238

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L  L  LD+ N  L+G++P E+ K+
Sbjct  239  LTELVRLDMANCGLSGEIPHELGKL  263



>gb|AIT56194.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Dimocarpus longan]
Length=1015

 Score =   171 bits (432),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  381
            V+E  ALLSIK+A +ADSQ++L+SWN +TSHCTW  VTCDS  HV SLDL  LNLSG LS
Sbjct  21   VSEYRALLSIKSALSADSQAALSSWNATTSHCTWTGVTCDSRHHVTSLDLRDLNLSGTLS  80

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
             DV  L FL NL++AANQ SGP+PPEIS +S LRFLNLSNN+F  +FP QLA+LANL+V+
Sbjct  81   SDVAHLQFLRNLTVAANQFSGPIPPEISQLSALRFLNLSNNVFNGSFPSQLARLANLEVM  140

Query  562  DLYNNNLTGDLPVEVYKM  615
            DLYNNN+T +LPV V ++
Sbjct  141  DLYNNNMTDELPVGVTQL  158


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 45/87 (52%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG + P+VG L  L  +  + N+ SG + PEIS    L F++LS N      P+++  
Sbjct  483  KFSGQIPPEVGSLKQLSKMGFSDNRFSGQIAPEISKCKLLTFVDLSRNELSGVVPNEITG  542

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            +  L  L+L  N+L G +P  +  M S
Sbjct  543  MKILNYLNLSRNHLVGSIPAAIASMQS  569


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+F    P   A+L
Sbjct  244  LSGEIPGEIGKLQKLDTLFLQVNGLSGTLARELGNLKSLKSMDLSNNMFTGEIPASFAEL  303

Query  544  ANLQVLDLYNNNLTGDLP  597
             N+ +L+L+ N L G +P
Sbjct  304  KNMTLLNLFRNKLHGAIP  321


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ +   L  + ++ N+LSG VP EI+ +  L +LNLS N    + P  +A +
Sbjct  508  FSGQIAPEISKCKLLTFVDLSRNELSGVVPNEITGMKILNYLNLSRNHLVGSIPAAIASM  567

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  568  QSLTSVDFSYNNLSGLVP  585


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 49/85 (58%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             SG +  + G   FL  L+++ N+L G +PPEI  ++TLR L +   N +    P ++  
Sbjct  171  FSGEIPAEYGGWEFLEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNTYTGGLPPEIGN  230

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L++L  LD  N  L+G++P E+ K+
Sbjct  231  LSSLVRLDAANCALSGEIPGEIGKL  255


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+ ++G L  L ++ ++ N  +G +P   + +  +  LNL  N      P  + +L
Sbjct  268  LSGTLARELGNLKSLKSMDLSNNMFTGEIPASFAELKNMTLLNLFRNKLHGAIPEFIGEL  327

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+VL L+ NN TG +P
Sbjct  328  PKLEVLQLWENNFTGSIP  345


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 45/87 (52%), Gaps = 3/87 (3%)
 Frame = +1

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  546
            +G L P++G L  LV L  A   LSG +P EI  +  L  L L  N    T   +L  L 
Sbjct  221  TGGLPPEIGNLSSLVRLDAANCALSGEIPGEIGKLQKLDTLFLQVNGLSGTLARELGNLK  280

Query  547  NLQVLDLYNNNLTGDLP---VEVYKMT  618
            +L+ +DL NN  TG++P    E+  MT
Sbjct  281  SLKSMDLSNNMFTGEIPASFAELKNMT  307



>emb|CDP02660.1| unnamed protein product [Coffea canephora]
Length=1017

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 106/139 (76%), Gaps = 1/139 (1%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLSGVLSP  384
            E  ALLSIK+A TAD QSSL SWN ST+HC+W  VTCDS    V+       NL+G LSP
Sbjct  26   EYKALLSIKSAITADPQSSLASWNDSTTHCSWSGVTCDSYGRHVTALDISGLNLTGSLSP  85

Query  385  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLD  564
            DV  L  L+NLS+AANQ  GPVPPEIS+ISTLR+LNLSNNIF  TFP QL +L NL+VLD
Sbjct  86   DVSHLRLLLNLSVAANQFCGPVPPEISSISTLRYLNLSNNIFNLTFPRQLIRLKNLEVLD  145

Query  565  LYNNNLTGDLPVEVYKMTS  621
             YNNN++G LPV+VY++T+
Sbjct  146  FYNNNMSGPLPVDVYQLTN  164


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G L  L  L +  N LSGP+  E+  + +L+ ++LSNN+F    P   AQL
Sbjct  248  LSGEVPPELGMLQNLDTLFLQVNALSGPLTSELGYLKSLKSMDLSNNMFTGEIPSSFAQL  307

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  308  KNLTLLNLFRNQLHGSIP  325


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ +   L  + ++ NQL+G +P EI+ +  L +LNLS N    + P  +A +
Sbjct  512  FSGPIAPEISECKLLTFVDLSRNQLAGEIPTEITGMRILNYLNLSRNHLVGSIPSPIASM  571

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  572  QSLTSVDFSYNNLSGMVP  589


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 44/87 (51%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              +G +  ++G+L  L  +  + N  SGP+ PEIS    L F++LS N      P ++  
Sbjct  487  KFTGPIPAEIGKLQQLSKIDFSHNSFSGPIAPEISECKLLTFVDLSRNQLAGEIPTEITG  546

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            +  L  L+L  N+L G +P  +  M S
Sbjct  547  MRILNYLNLSRNHLVGSIPSPIASMQS  573


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 43/84 (51%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L P +G    +    +  N+ +GP+P EI  +  L  ++ S+N F      ++++ 
Sbjct  464  LSGPLPPSIGNFVGVQKFLLDGNKFTGPIPAEIGKLQQLSKIDFSHNSFSGPIAPEISEC  523

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L G++P E+  M
Sbjct  524  KLLTFVDLSRNQLAGEIPTEITGM  547


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  540
             SG +  + G  P L  L+++ N+L+G +PPEI+ ++ L+ L +   N F    P Q+  
Sbjct  175  FSGGIPAEYGSFPNLEYLAVSGNELAGRIPPEIANLTKLQHLYIGYFNTFSGGIPPQIGN  234

Query  541  LANLQVLDLYNNNLTGDLPVEV  606
            L+ L   D  N  L+G++P E+
Sbjct  235  LSQLLRFDAANCGLSGEVPPEL  256



>ref|XP_006357743.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Solanum tuberosum]
Length=1017

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 112/152 (74%), Gaps = 0/152 (0%)
 Frame = +1

Query  166  HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsl  345
            H     AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SL
Sbjct  12   HFTDFSAGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSL  71

Query  346  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  525
            D+SG NL+G L P+VG L FL NLS+A NQ +GP+P EIS I  L +LNLSNNIFG  FP
Sbjct  72   DISGFNLTGTLPPEVGNLRFLQNLSVAVNQFTGPIPVEISFIPNLGYLNLSNNIFGMEFP  131

Query  526  HQLAQLANLQVLDLYNNNLTGDLPVEVYKMTS  621
             QL +L NLQVLDLYNNN+TG+LP+EVY+MT+
Sbjct  132  PQLTRLRNLQVLDLYNNNMTGELPLEVYQMTN  163


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+F    P   A+L
Sbjct  247  LSGEIPPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAEL  306

Query  544  ANLQVLDLYNNNLTGDLP  597
             N+ +++L+ N L G +P
Sbjct  307  KNITLVNLFRNKLYGSIP  324


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+P++G L  L +L ++ N  SG +PP  + +  +  +NL  N    + P  +  L
Sbjct  271  LSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRNKLYGSIPEFIEDL  330

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+VL L+ NN TG +P
Sbjct  331  PELEVLQLWENNFTGSIP  348


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            N SG ++P++ Q   L  + ++ NQLSG +P EI+ +  L +LNLS N    + P  ++ 
Sbjct  510  NFSGPMAPEISQCKLLTYVDLSRNQLSGEIPSEITGMRILNYLNLSRNHLVGSIPSPISS  569

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  +D   NN +G +P
Sbjct  570  MQSLTSVDFSYNNFSGLVP  588


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 44/87 (51%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG +  ++G+L  L  +  + N  SGP+ PEIS    L +++LS N      P ++  
Sbjct  486  KFSGRIPAEIGKLQQLSKIDFSHNNFSGPMAPEISQCKLLTYVDLSRNQLSGEIPSEITG  545

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            +  L  L+L  N+L G +P  +  M S
Sbjct  546  MRILNYLNLSRNHLVGSIPSPISSMQS  572



>ref|XP_011099433.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Sesamum indicum]
Length=1008

 Score =   168 bits (425),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 115/145 (79%), Gaps = 1/145 (1%)
 Frame = +1

Query  178  AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCd-sllhvvsldls  354
            + A +P  ++E  ALLSIKAA T D QS+L SWN++T+HCTW+ +TCD S  HV SLD+S
Sbjct  16   SAAARPPRMSEYRALLSIKAAITDDPQSALASWNLTTNHCTWKGITCDPSRRHVTSLDIS  75

Query  355  glNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  534
             L+L+G LSPDVGQL FLVNLS+AAN +SGPVPP+IS I  LR+LNLSNN+F  +FP +L
Sbjct  76   NLSLTGTLSPDVGQLRFLVNLSVAANFISGPVPPQISDIPNLRYLNLSNNVFNLSFPPEL  135

Query  535  AQLANLQVLDLYNNNLTGDLPVEVY  609
             +L NLQVLDLYNNN+TGD P + Y
Sbjct  136  YRLRNLQVLDLYNNNMTGDFPSKAY  160


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P++G L  L  L +  N LSG + PE+  + +L+ ++LSNN+F    P   A+L
Sbjct  248  LTGEIPPEIGNLQNLDTLFLQVNGLSGSLTPELGNLKSLKSMDLSNNMFSGEIPPSFAEL  307

Query  544  ANLQVLDLYNNNLTGDLP  597
             N+ +L+L+ N LTG +P
Sbjct  308  KNMTLLNLFRNKLTGSIP  325


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             SG + P+ G  P+L  L+++ N+L+G +PPEI  ++ L+ L +   N F    P ++  
Sbjct  175  FSGEIPPEFGSFPYLEYLAVSGNELTGAIPPEIGNLTQLKELYIGYYNAFTGGMPKEIGN  234

Query  541  LANLQVLDLYNNNLTGDLPVEV  606
            L+ L  LD  N  LTG++P E+
Sbjct  235  LSQLVRLDAANCGLTGEIPPEI  256


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+P++G L  L ++ ++ N  SG +PP  + +  +  LNL  N    + P  + +L
Sbjct  272  LSGSLTPELGNLKSLKSMDLSNNMFSGEIPPSFAELKNMTLLNLFRNKLTGSIPDFIGEL  331

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+VL L+ NN TG +P
Sbjct  332  PELEVLQLWENNFTGIIP  349


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G+++P++ Q   L  + ++ NQLSG +P EI+ +  L +LNLS N    + P  +A +
Sbjct  512  LTGLIAPEISQCKLLTFVDLSRNQLSGDIPTEITGMRILNYLNLSRNHLVGSIPSSIASM  571

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  572  QSLTSVDFSYNNLSGLVP  589


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG +  ++G+L  L  +  + N+L+G + PEIS    L F++LS N      P ++  +
Sbjct  488  FSGRIPAEIGKLQQLSKMDFSHNELTGLIAPEISQCKLLTFVDLSRNQLSGDIPTEITGM  547

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G +P  +  M S
Sbjct  548  RILNYLNLSRNHLVGSIPSSIASMQS  573


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 44/85 (52%), Gaps = 0/85 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            +L+G L P +G    +  L +  N+ SG +P EI  +  L  ++ S+N        +++Q
Sbjct  463  HLTGPLPPSIGNFVGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSHNELTGLIAPEISQ  522

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
               L  +DL  N L+GD+P E+  M
Sbjct  523  CKLLTFVDLSRNQLSGDIPTEITGM  547



>ref|XP_010268646.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nelumbo nucifera]
Length=1034

 Score =   167 bits (424),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = +1

Query  184  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  363
            AG+PL + E  ALLSIK A + D Q+SL +WN+STSHCTW  V+CDS   VVSLDLS +N
Sbjct  20   AGRPLRIPEYRALLSIKTAISDDPQASLPNWNLSTSHCTWTGVSCDSFNRVVSLDLSNMN  79

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG+LSPDVGQL  L+NL+ AAN  SGP+P EIS IS LR LNLSNN+F  +FP + ++L
Sbjct  80   LSGILSPDVGQLRNLINLTAAANFFSGPIPSEISHISGLRLLNLSNNVFNGSFPSEFSRL  139

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L+VLDLYNNN+TGDLPV+V +M
Sbjct  140  KLLEVLDLYNNNMTGDLPVDVSEM  163


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+P++GQL  L ++ ++ N L+G +P   S +  L  LNL  N      P  +  L
Sbjct  273  LSGGLTPELGQLKSLKSMDLSNNMLAGEIPATFSELKNLTLLNLFRNKLHGAIPDFIGDL  332

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+VL L+ NN TG +P
Sbjct  333  PALEVLQLWENNFTGSIP  350


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P+  +L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   ++L
Sbjct  249  LSGEIPPEFSKLQKLDTLFLQVNGLSGGLTPELGQLKSLKSMDLSNNMLAGEIPATFSEL  308

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  309  KNLTLLNLFRNKLHGAIP  326


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++ ++ Q   L  + ++ N+LSG +PPE++ +  L +LNLS N    + P  +A +
Sbjct  513  FSGPIASEISQCKLLTFVDLSRNELSGVIPPEMTGMRILNYLNLSRNHLTGSIPASIATM  572

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  573  QSLTSVDFSYNNLSGLVP  590


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 0/77 (0%)
 Frame = +1

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  546
             G + P++G L  LV L +A   LSG +PPE S +  L  L L  N        +L QL 
Sbjct  226  EGGIPPELGNLTELVRLDMANCGLSGEIPPEFSKLQKLDTLFLQVNGLSGGLTPELGQLK  285

Query  547  NLQVLDLYNNNLTGDLP  597
            +L+ +DL NN L G++P
Sbjct  286  SLKSMDLSNNMLAGEIP  302


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             SG +  + G+  FL  L+++ N+L G +PPEI  ++ L+ L L   N +    P +L  
Sbjct  176  FSGRIPSEYGRWEFLEYLALSGNELGGTIPPEIGNLTKLQQLYLGYYNSYEGGIPPELGN  235

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L  L  LD+ N  L+G++P E  K+
Sbjct  236  LTELVRLDMANCGLSGEIPPEFSKL  260


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 44/84 (52%), Gaps = 0/84 (0%)
 Frame = +1

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  549
            G +  ++G+L  L  +  + N+ SGP+  EIS    L F++LS N      P ++  +  
Sbjct  491  GSIPAEIGRLQQLSKMDFSNNRFSGPIASEISQCKLLTFVDLSRNELSGVIPPEMTGMRI  550

Query  550  LQVLDLYNNNLTGDLPVEVYKMTS  621
            L  L+L  N+LTG +P  +  M S
Sbjct  551  LNYLNLSRNHLTGSIPASIATMQS  574



>ref|XP_006364007.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Solanum tuberosum]
Length=1022

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = +1

Query  190  KPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLS  369
            KP  V E  ALLS+K + T D QS+L SWNISTSHCTWR VTCD   HV SLD+SG NL+
Sbjct  24   KPPYVPEYRALLSLKTSITDDPQSALLSWNISTSHCTWRGVTCDRYRHVTSLDISGFNLT  83

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  549
            G L+P+VG L FL+NLS+A NQ SGP+P E+S I  L +LNLSNNIF  +FP QL  L  
Sbjct  84   GTLTPEVGHLRFLLNLSVAVNQFSGPIPIELSFIPNLSYLNLSNNIFNLSFPPQLTHLRY  143

Query  550  LQVLDLYNNNLTGDLPVEVYKMTS  621
            L+VLD+YNNN+TGDLPV VY +T+
Sbjct  144  LKVLDIYNNNMTGDLPVGVYNLTN  167


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 50/85 (59%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             SG + P+ G+ PFL  L+++ N L G +PPEI  I+TLR L +   N F    P ++  
Sbjct  178  FSGSIPPEYGRFPFLEYLAVSGNALVGMIPPEIGNITTLRELYIGYYNTFSGGLPAEIGN  237

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L  LD  N  L+G++P E+ K+
Sbjct  238  LSELIRLDAANCGLSGEIPPEIGKL  262


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G+L  L  L +  N LSG V PE+  + +L+ L+LSNN+     P    +L
Sbjct  251  LSGEIPPEIGKLQKLDTLFLQVNGLSGSVTPELGNLKSLKSLDLSNNMLSGEIPFTFTEL  310

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  311  KNLTLLNLFRNKLYGSIP  328


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG ++P++G L  L +L ++ N LSG +P   + +  L  LNL  N    + P  +  L
Sbjct  275  LSGSVTPELGNLKSLKSLDLSNNMLSGEIPFTFTELKNLTLLNLFRNKLYGSIPEFIEDL  334

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+VL L+ NN TG +P
Sbjct  335  PKLEVLQLWENNFTGSIP  352


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG++ P++ +   L  + ++ N+LSG VP EI+ +  L +LN+S N    + P  +A +
Sbjct  515  FSGLIPPEISRCKALTYVDLSRNKLSGEVPTEITGMRILNYLNVSRNQLVGSIPAPIAAM  574

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  575  QSLTSVDFSYNNLSGLVP  592


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 43/87 (49%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG +  ++G+L  L  +  + N  SG +PPEIS    L +++LS N      P ++  
Sbjct  490  KFSGQIPAELGKLQQLSKMDFSGNSFSGLIPPEISRCKALTYVDLSRNKLSGEVPTEITG  549

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            +  L  L++  N L G +P  +  M S
Sbjct  550  MRILNYLNVSRNQLVGSIPAPIAAMQS  576


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 45/79 (57%), Gaps = 2/79 (3%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             SG L  ++G L  L+ L  A   LSG +PPEI  +  L  L L  N + GS  P +L  
Sbjct  227  FSGGLPAEIGNLSELIRLDAANCGLSGEIPPEIGKLQKLDTLFLQVNGLSGSVTP-ELGN  285

Query  541  LANLQVLDLYNNNLTGDLP  597
            L +L+ LDL NN L+G++P
Sbjct  286  LKSLKSLDLSNNMLSGEIP  304



>ref|XP_004234641.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Solanum lycopersicum]
Length=1022

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 108/144 (75%), Gaps = 0/144 (0%)
 Frame = +1

Query  190  KPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLS  369
            KP  V E  ALLS+K A T D QS+L SWNISTSHCTWR VTCD   HV SLD+SG NL+
Sbjct  24   KPPYVPEYRALLSLKTAITDDPQSALLSWNISTSHCTWRGVTCDRYRHVTSLDISGFNLT  83

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  549
            G L+P+VG L FL+NLS+A NQ SGP+P E+S I  LR+LNLSNNIF  +FP QL  L  
Sbjct  84   GTLTPEVGHLRFLLNLSVAVNQFSGPIPVELSFIPNLRYLNLSNNIFNLSFPPQLTHLRY  143

Query  550  LQVLDLYNNNLTGDLPVEVYKMTS  621
            L VLD+YNNN+TG+LPV  Y +T+
Sbjct  144  LNVLDIYNNNMTGELPVGFYNLTN  167


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 50/85 (59%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             SG + P+ G+ PFL  L+++ N L G +PPEI  I+TLR L +   N F    P ++  
Sbjct  178  FSGSIPPEYGRFPFLEYLAVSGNALVGRIPPEIGNITTLRELYIGYYNTFSGGLPAEIGY  237

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L  LD  N  L+G++P E+ K+
Sbjct  238  LSELIRLDAANCGLSGEIPPEIGKL  262


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 49/84 (58%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G+L  L  L +  N LSG V PE+  + +L+ L+LSNN+     P    +L
Sbjct  251  LSGEIPPEIGKLQKLDTLFLQVNGLSGSVTPELGNLKSLKSLDLSNNMLSGEIPLTFTEL  310

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
             NL +L+L+ N L G +P  +  M
Sbjct  311  KNLTLLNLFRNKLYGSMPEFIEDM  334


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG ++P++G L  L +L ++ N LSG +P   + +  L  LNL  N    + P  +  +
Sbjct  275  LSGSVTPELGNLKSLKSLDLSNNMLSGEIPLTFTELKNLTLLNLFRNKLYGSMPEFIEDM  334

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+VL L+ NN TG +P
Sbjct  335  PKLEVLQLWENNFTGSIP  352


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG++ P++ +   L  + ++ N+LSG VP EI+ +  L +LN+S N    + P  +A +
Sbjct  515  FSGLIPPEISRCKALTYVDLSRNKLSGEVPTEITGMRILNYLNVSRNQLVGSIPAPIAAM  574

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  575  QSLTSVDFSYNNLSGLVP  592


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 46/80 (58%), Gaps = 2/80 (3%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             SG L  ++G L  L+ L  A   LSG +PPEI  +  L  L L  N + GS  P +L  
Sbjct  227  FSGGLPAEIGYLSELIRLDAANCGLSGEIPPEIGKLQKLDTLFLQVNGLSGSVTP-ELGN  285

Query  541  LANLQVLDLYNNNLTGDLPV  600
            L +L+ LDL NN L+G++P+
Sbjct  286  LKSLKSLDLSNNMLSGEIPL  305


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 43/87 (49%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG +  ++G+L  L  +  + N  SG +PPEIS    L +++LS N      P ++  
Sbjct  490  KFSGQIPGELGKLQQLSKMDFSGNSFSGLIPPEISRCKALTYVDLSRNKLSGEVPTEITG  549

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            +  L  L++  N L G +P  +  M S
Sbjct  550  MRILNYLNVSRNQLVGSIPAPIAAMQS  576



>ref|XP_009786199.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana sylvestris]
Length=1015

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 113/150 (75%), Gaps = 2/150 (1%)
 Frame = +1

Query  178  AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldl  351
            + A KP  + E  ALLS+K A + D QS+L SWN ST  SHCTW+ VTCD   HV SL++
Sbjct  15   SAAAKPHFLPEYRALLSLKTAISDDPQSALISWNSSTTTSHCTWKGVTCDKYRHVTSLNI  74

Query  352  sglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  531
            S LNL+G L P++GQL +LVNLS+A NQ SGP+P E+S IS LR+LNLSNNIF  +FP Q
Sbjct  75   SNLNLTGTLPPEIGQLRYLVNLSVAVNQFSGPIPVELSVISNLRYLNLSNNIFNLSFPQQ  134

Query  532  LAQLANLQVLDLYNNNLTGDLPVEVYKMTS  621
            L QL NL+VLD+YNNNLTG LPV V+ +T+
Sbjct  135  LTQLINLEVLDIYNNNLTGQLPVGVHNLTN  164


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 51/85 (60%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             +G + P+ G+ PFL  L+++ N+L+G +PPEI  I+TL+ L +   N F    P ++  
Sbjct  175  FTGRIPPEFGKFPFLKYLAVSGNELAGDIPPEIGNITTLKELYVGYYNTFSGGIPPEIGN  234

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L   D  N  L+G++P E+ K+
Sbjct  235  LSELVRFDAANCGLSGEIPAEIGKL  259


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +  ++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+     P  L++L
Sbjct  248  LSGEIPAEIGKLKKLDTLFLQVNSLSGSLIPEIGYLKSLKSLDLSNNLLSGEIPLTLSEL  307

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  308  KNLTLLNLFRNKLYGSIP  325


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L P++G L  L +L ++ N LSG +P  +S +  L  LNL  N    + P  + +L
Sbjct  272  LSGSLIPEIGYLKSLKSLDLSNNLLSGEIPLTLSELKNLTLLNLFRNKLYGSIPEFIEEL  331

Query  544  ANLQVLDLYNNNLTGDLPV  600
              L+VL L+ NN TG +P+
Sbjct  332  PKLEVLQLWENNFTGSIPM  350


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG +  ++G+L  L  +  + N  SGP+PPEIS    L F++LS N      P ++  +
Sbjct  488  FSGRIPAEIGKLQQLSKMDFSGNGFSGPIPPEISHCKALTFVDLSRNKLSGEIPTEITGM  547

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L++  N+L G +P  +  M S
Sbjct  548  RILNYLNVSRNHLVGSIPASISAMQS  573



>ref|XP_009771232.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana sylvestris]
Length=1019

 Score =   165 bits (418),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  184  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  363
            AGK   + E  ALL++K A T D Q +L SWNISTSHCTW+ VTCD   HV SLD+SG N
Sbjct  20   AGKQPRIPEYQALLALKTAITDDPQLALASWNISTSHCTWKGVTCDRYRHVTSLDISGFN  79

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            ++G L P+VG L FL NLS+  NQ SGP+P EIS I  L +LNLSNNIF   FP QL +L
Sbjct  80   VTGTLPPEVGNLRFLQNLSVDLNQFSGPIPVEISFIPNLHYLNLSNNIFSLGFPPQLTRL  139

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
             NL+VLDLYNNN+TGDLPV+VY+MT+
Sbjct  140  RNLKVLDLYNNNMTGDLPVDVYQMTN  165


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+P++G L  L +L ++ N LSG VPP  + +  L  LNL  N    + P  +  L
Sbjct  273  LSGSLTPEIGTLKSLKSLDLSNNMLSGEVPPTFADLKNLTLLNLFRNKLHGSIPEFIGDL  332

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+VL L+ NN TG +P
Sbjct  333  PELEVLQLWENNFTGSIP  350


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +  ++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+     P   A L
Sbjct  249  LSGEIPAELGKLQNLDTLFLQVNSLSGSLTPEIGTLKSLKSLDLSNNMLSGEVPPTFADL  308

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  309  KNLTLLNLFRNKLHGSIP  326


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
              G + P+ G+  FL  L+++ N+L G +PPEI  I+TL  L +   N F    P ++  
Sbjct  176  FGGRIPPEYGRFQFLEYLAVSGNELVGEIPPEIGNITTLHELYVGYYNTFSGGIPPEIGN  235

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L   D  N  L+G++P E+ K+
Sbjct  236  LSQLVRFDAANCGLSGEIPAELGKL  260


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            + SG ++P++ +   L  + ++ NQLSG +P EI+ +  L +LNLS N    + P  ++ 
Sbjct  512  DFSGPIAPEISKCKLLTYVDLSRNQLSGEIPTEITGMRILNYLNLSRNHLVGSIPAPISS  571

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  +D   NN +G +P
Sbjct  572  MQSLTSVDFSYNNFSGLVP  590


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 44/87 (51%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG +  ++G+L  L  +  + N  SGP+ PEIS    L +++LS N      P ++  
Sbjct  488  KFSGRIPAEIGKLQQLSKIDFSHNDFSGPIAPEISKCKLLTYVDLSRNQLSGEIPTEITG  547

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            +  L  L+L  N+L G +P  +  M S
Sbjct  548  MRILNYLNLSRNHLVGSIPAPISSMQS  574



>gb|EYU41357.1| hypothetical protein MIMGU_mgv1a000718mg [Erythranthe guttata]
Length=1006

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 107/151 (71%), Gaps = 1/151 (1%)
 Frame = +1

Query  172  AGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldl  351
             G+ A  P  + E  ALLSIKAA T D QS+L SWN +T HCTWR VTCD+    V+   
Sbjct  16   GGSAAATPPHMPEYRALLSIKAAITDDPQSALASWNATTHHCTWRGVTCDASGRRVASLD  75

Query  352  sg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH  528
               L+L+GVLSPDVG+L FLVN S AAN LSGP+PP+IS I  LR LNLSNN+F  +FP 
Sbjct  76   ISNLSLAGVLSPDVGRLRFLVNFSAAANFLSGPIPPQISDIPNLRHLNLSNNVFNLSFPA  135

Query  529  QLAQLANLQVLDLYNNNLTGDLPVEVYKMTS  621
            +L  L NL+VLD+YNNN+TGD P + Y +T+
Sbjct  136  ELYHLKNLEVLDVYNNNMTGDFPSQAYLLTN  166


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            +SG L P++G L  L ++ ++ N LSG +PP  S +  +  LNL  N F  + P  +  L
Sbjct  274  ISGGLPPELGNLKSLKSMDLSNNILSGEIPPSFSQLQNITLLNLFRNKFTGSIPDFIGDL  333

Query  544  ANLQVLDLYNNNLTGDLP  597
              LQVL L+ NN TG +P
Sbjct  334  PELQVLQLWENNFTGIIP  351


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +  ++G L  L  L +  N +SG +PPE+  + +L+ ++LSNNI     P   +QL
Sbjct  250  LSGQIPAEIGNLQNLDTLFLQVNGISGGLPPELGNLKSLKSMDLSNNILSGEIPPSFSQL  309

Query  544  ANLQVLDLYNNNLTGDLP  597
             N+ +L+L+ N  TG +P
Sbjct  310  QNITLLNLFRNKFTGSIP  327


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  540
             +GV  P+ G  P L  L+++ N+L+G +PP+I  ++ L+ L +   N F    P ++  
Sbjct  177  FTGVFPPEFGSFPHLEYLAVSGNELTGAIPPQIGNLTHLKELYIGYFNTFTGGIPKEIGN  236

Query  541  LANLQVLDLYNNNLTGDLPVEV  606
            L+NL   D  N  L+G +P E+
Sbjct  237  LSNLIRFDAANCGLSGQIPAEI  258


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            + SG +SP++ +   L  + ++ N+LSGP+P EI+++  L +LNLS N      P  ++ 
Sbjct  514  DFSGQISPEISRCKLLTFVDLSHNRLSGPIPTEITSMKILNYLNLSRNNLMGNIPSSISG  573

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  +D   NN +G +P
Sbjct  574  MQSLTSVDFSYNNFSGLVP  592


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG +  ++G+L  L  +  + N  SG + PEIS    L F++LS+N      P ++  +
Sbjct  491  FSGEIPAEIGKLQQLSKIDFSRNDFSGQISPEISRCKLLTFVDLSHNRLSGPIPTEITSM  550

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  NNL G++P  +  M S
Sbjct  551  KILNYLNLSRNNLMGNIPSSISGMQS  576



>ref|XP_010105101.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Morus notabilis]
 gb|EXC03886.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Morus notabilis]
Length=1021

 Score =   162 bits (410),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  381
            V E  ALLS KAA T D QSSL +WN ST HCTW  +TCDS  HV SLDLSGLNLSG LS
Sbjct  26   VPEYKALLSFKAALTDDPQSSLATWNASTLHCTWFGITCDSRRHVTSLDLSGLNLSGSLS  85

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            P++  L FL N+S+A NQ SGP+P EISAIS LR LNLSNN+F  TFP +L+QL NLQ+L
Sbjct  86   PELAYLRFLSNVSLADNQFSGPIPAEISAISGLRLLNLSNNVFNGTFPPELSQLKNLQIL  145

Query  562  DLYNNNLTGDLPVEVYKM  615
            DLYNNN+TGDLP++V  +
Sbjct  146  DLYNNNMTGDLPLDVVDL  163


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G+L  L  L +  N LSG + PE+ ++++L+ ++LSNN+     P   A+L
Sbjct  249  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGSLNSLKSMDLSNNMLSGEIPPSFAEL  308

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  309  KNLTLLNLFRNKLHGAIP  326


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+P++G L  L ++ ++ N LSG +PP  + +  L  LNL  N      P  + +L
Sbjct  273  LSGSLTPELGSLNSLKSMDLSNNMLSGEIPPSFAELKNLTLLNLFRNKLHGAIPEFIGEL  332

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+VL L+ NN TG +P
Sbjct  333  PELEVLQLWENNFTGSIP  350


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG+++P++ Q   L  + ++ N+LSG +P EI+ +  L +LNLS N      P  +A 
Sbjct  513  KFSGLITPEISQCKVLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLVGNIPSSIAS  572

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  +D   NNL+G +P
Sbjct  573  MQSLTSVDFSYNNLSGLVP  591


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 49/85 (58%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             SG +  + G+  FL  L+++ N+LSG +PPEI +++ LR L +   N +    P ++  
Sbjct  176  FSGAIPKEYGRWEFLEYLAVSGNELSGKIPPEIGSLTNLRELYIGYYNTYEGGLPAEIGN  235

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L   D  N  L+G++P E+ K+
Sbjct  236  LSELVRFDGANCALSGEIPPEIGKL  260


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 47/87 (54%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG + P++G+L  +  +  + N+ SG + PEIS    L F++LS N      P+++  
Sbjct  489  KFSGRIPPEIGRLQQVSKIDFSHNKFSGLITPEISQCKVLTFVDLSRNELSGEIPNEITG  548

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            +  L  L+L  N+L G++P  +  M S
Sbjct  549  MRILNYLNLSRNHLVGNIPSSIASMQS  575


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 45/84 (54%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L P +G    +  L +  N+ SG +PPEI  +  +  ++ S+N F      +++Q 
Sbjct  466  LSGSLPPSIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQVSKIDFSHNKFSGLITPEISQC  525

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L+G++P E+  M
Sbjct  526  KVLTFVDLSRNELSGEIPNEITGM  549


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 43/81 (53%), Gaps = 0/81 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P   +L  L  L++  N+L G +P  I  +  L  L L  N F  + P  L + 
Sbjct  297  LSGEIPPSFAELKNLTLLNLFRNKLHGAIPEFIGELPELEVLQLWENNFTGSIPQGLGRN  356

Query  544  ANLQVLDLYNNNLTGDLPVEV  606
              LQ+LDL +N LTG LP ++
Sbjct  357  GKLQLLDLSSNKLTGTLPPDM  377



>emb|CBI35733.3| unnamed protein product [Vitis vinifera]
Length=948

 Score =   161 bits (408),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = +1

Query  184  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  363
            A  P  + E  ALLS++ A + D +S L +WNISTSHCTW  VTCD+  HVV+L+LSGLN
Sbjct  39   AATPPRIPEYRALLSLRTAISYDPESPLAAWNISTSHCTWTGVTCDARRHVVALNLSGLN  98

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG LS D+  L FLVNL++AANQ  GP+PPE+S +S LR LNLSNN+F  TFP QLA+L
Sbjct  99   LSGSLSSDIAHLRFLVNLTLAANQFVGPIPPELSLVSGLRQLNLSNNVFNETFPSQLARL  158

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L+VLDLYNNN+TGDLP+ V +M
Sbjct  159  KRLEVLDLYNNNMTGDLPLAVTEM  182


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G+L  L  L +  N LSGP+ PE+  + +L+ ++LSNN+     P   A+L
Sbjct  268  LSGEIPPEIGKLQNLDTLFLQVNTLSGPLTPELGNLKSLKSMDLSNNVLAGEIPEAFAEL  327

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  328  KNLTLLNLFRNKLHGAIP  345


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 44/84 (52%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G L P VG    L  L +  N+ SG +PPEI  +  L  ++ SNN F      +++Q 
Sbjct  484  LTGSLPPSVGNFSGLQKLLLDGNKFSGRIPPEIGMLQQLSKMDFSNNKFSGEITPEISQC  543

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L GD+P E+  M
Sbjct  544  KVLTFVDLSRNELFGDIPTEITGM  567


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             +G++ P  GQ  FL  L+++ N+L GP+PPEI  +++L+ L +   N +    P ++  
Sbjct  195  FTGIIPPAYGQWEFLEYLAVSGNELHGPIPPEIGNLTSLQQLYVGYYNTYDGGIPPEIGN  254

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L +L  LD+ N  L+G++P E+ K+
Sbjct  255  LTSLVRLDMANCLLSGEIPPEIGKL  279


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG ++P++ Q   L  + ++ N+L G +P EI+ +  L +LNLS N    + P  LA 
Sbjct  531  KFSGEITPEISQCKVLTFVDLSRNELFGDIPTEITGMRILNYLNLSRNHLIGSIPASLAS  590

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  +D   NNL+G +P
Sbjct  591  MQSLTSVDFSYNNLSGLVP  609


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 44/87 (51%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG + P++G L  L  +  + N+ SG + PEIS    L F++LS N      P ++  
Sbjct  507  KFSGRIPPEIGMLQQLSKMDFSNNKFSGEITPEISQCKVLTFVDLSRNELFGDIPTEITG  566

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            +  L  L+L  N+L G +P  +  M S
Sbjct  567  MRILNYLNLSRNHLIGSIPASLASMQS  593



>ref|XP_003635561.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Vitis vinifera]
Length=1017

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = +1

Query  184  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  363
            A  P  + E  ALLS++ A + D +S L +WNISTSHCTW  VTCD+  HVV+L+LSGLN
Sbjct  20   AATPPRIPEYRALLSLRTAISYDPESPLAAWNISTSHCTWTGVTCDARRHVVALNLSGLN  79

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG LS D+  L FLVNL++AANQ  GP+PPE+S +S LR LNLSNN+F  TFP QLA+L
Sbjct  80   LSGSLSSDIAHLRFLVNLTLAANQFVGPIPPELSLVSGLRQLNLSNNVFNETFPSQLARL  139

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L+VLDLYNNN+TGDLP+ V +M
Sbjct  140  KRLEVLDLYNNNMTGDLPLAVTEM  163


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G+L  L  L +  N LSGP+ PE+  + +L+ ++LSNN+     P   A+L
Sbjct  249  LSGEIPPEIGKLQNLDTLFLQVNTLSGPLTPELGNLKSLKSMDLSNNVLAGEIPEAFAEL  308

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  309  KNLTLLNLFRNKLHGAIP  326


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 44/84 (52%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G L P VG    L  L +  N+ SG +PPEI  +  L  ++ SNN F      +++Q 
Sbjct  465  LTGSLPPSVGNFSGLQKLLLDGNKFSGRIPPEIGMLQQLSKMDFSNNKFSGEITPEISQC  524

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L GD+P E+  M
Sbjct  525  KVLTFVDLSRNELFGDIPTEITGM  548


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             +G++ P  GQ  FL  L+++ N+L GP+PPEI  +++L+ L +   N +    P ++  
Sbjct  176  FTGIIPPAYGQWEFLEYLAVSGNELHGPIPPEIGNLTSLQQLYVGYYNTYDGGIPPEIGN  235

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L +L  LD+ N  L+G++P E+ K+
Sbjct  236  LTSLVRLDMANCLLSGEIPPEIGKL  260


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG ++P++ Q   L  + ++ N+L G +P EI+ +  L +LNLS N    + P  LA 
Sbjct  512  KFSGEITPEISQCKVLTFVDLSRNELFGDIPTEITGMRILNYLNLSRNHLIGSIPASLAS  571

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  +D   NNL+G +P
Sbjct  572  MQSLTSVDFSYNNLSGLVP  590


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 44/87 (51%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG + P++G L  L  +  + N+ SG + PEIS    L F++LS N      P ++  
Sbjct  488  KFSGRIPPEIGMLQQLSKMDFSNNKFSGEITPEISQCKVLTFVDLSRNELFGDIPTEITG  547

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            +  L  L+L  N+L G +P  +  M S
Sbjct  548  MRILNYLNLSRNHLIGSIPASLASMQS  574



>ref|XP_009605676.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana tomentosiformis]
Length=1017

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 107/146 (73%), Gaps = 0/146 (0%)
 Frame = +1

Query  184  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  363
            AGK   + E  ALL++K A   D Q +L SWN STSHCTW+ VTCD   HV SLD+SG N
Sbjct  19   AGKHPRIPEYQALLALKTAIIDDPQLALASWNNSTSHCTWKGVTCDRYRHVTSLDISGFN  78

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            ++G L P+VG   FL NLS+A NQ SGP+P EIS I  L +LNLSNNIF   FP QL +L
Sbjct  79   VTGTLPPEVGNFRFLQNLSVALNQFSGPIPVEISFIPNLHYLNLSNNIFSLGFPPQLTRL  138

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
             NL+VLDLYNNN+TGDLPV+VY+MT+
Sbjct  139  RNLKVLDLYNNNMTGDLPVDVYQMTN  164


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+P++G L  L +L ++ N LSG VPP  + +  L  LNL  N    + P  +  L
Sbjct  272  LSGSLTPEIGTLKSLKSLDLSNNMLSGEVPPTFADLKNLTLLNLFRNKLHGSIPEFIGDL  331

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+VL L+ NN TG +P
Sbjct  332  PELEVLQLWENNFTGSIP  349


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
              G + P+ G+  FL  L+++ N+L G +PPEI  I+TL  L +   N F    P ++  
Sbjct  175  FGGRIPPEYGRFQFLEYLAVSGNELVGVIPPEIGNITTLHELYVGYYNTFSGGIPPEIGN  234

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L   D  N  L+G++P E+ K+
Sbjct  235  LSQLVRFDAANCGLSGEIPAEIEKL  259


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +  ++ +L  L  L +  N LSG + PEI  + +L+ L+LSNN+     P   A L
Sbjct  248  LSGEIPAEIEKLQNLDTLFLQVNSLSGSLTPEIGTLKSLKSLDLSNNMLSGEVPPTFADL  307

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  308  KNLTLLNLFRNKLHGSIP  325


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            + SG ++P++ +   L  + ++ NQLSG +P EI+ +  L +LNLS N    + P  ++ 
Sbjct  511  DFSGPIAPEISKCKLLTYVDLSRNQLSGEIPTEITGMRILNYLNLSRNHLVGSIPTPISS  570

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  +D   NN +G +P
Sbjct  571  MQSLTSVDFSYNNFSGLVP  589


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 44/87 (51%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG +  ++G+L  L  +  + N  SGP+ PEIS    L +++LS N      P ++  
Sbjct  487  KFSGRIPVEIGKLQQLSKIDFSHNDFSGPIAPEISKCKLLTYVDLSRNQLSGEIPTEITG  546

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            +  L  L+L  N+L G +P  +  M S
Sbjct  547  MRILNYLNLSRNHLVGSIPTPISSMQS  573



>ref|XP_009375880.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Pyrus x bretschneideri]
Length=1015

 Score =   156 bits (395),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 103/143 (72%), Gaps = 1/143 (1%)
 Frame = +1

Query  196  LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLSG  372
            + ++   ALLS+K++ T+D  S+L++W  +TSHCTW  VTCDS    V+       +L+G
Sbjct  20   IAMSNYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTG  79

Query  373  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  552
             LSPDV  L FL NL++A NQ SGP+PPEISA+S LR LNLSNN+F +TFP QL+ L  L
Sbjct  80   TLSPDVAHLRFLANLTLAENQFSGPIPPEISALSGLRLLNLSNNVFNTTFPPQLSNLTRL  139

Query  553  QVLDLYNNNLTGDLPVEVYKMTS  621
             VLDLYNNNLTGDLPV V  MTS
Sbjct  140  TVLDLYNNNLTGDLPVSVTHMTS  162


 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  540
             SG + P+ G+ PFL  L+++ N+L GP+PPEI  ++TL+ L +   N +    P ++  
Sbjct  173  FSGQIPPEFGRFPFLEYLAVSGNELGGPIPPEIGNLTTLKELYIGYFNSYEGGIPPEIGN  232

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+NL   D  N NLTG++P EV ++
Sbjct  233  LSNLVRFDAANCNLTGEIPPEVGRL  257


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL+G + P+VG+L  +  L +  N LSG +  E+  + +L+ ++LSNN+F    P   ++
Sbjct  245  NLTGEIPPEVGRLQNVDTLFLQVNALSGSLTLELGYLKSLKSMDLSNNVFTGEIPGSFSE  304

Query  541  LANLQVLDLYNNNLTGDLP  597
            L NL +L+L+ N L G +P
Sbjct  305  LKNLTLLNLFRNRLHGAIP  323


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 44/87 (51%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG + P++G+L  +  +    N+  GP+ PEIS    L F++LS N      P ++  
Sbjct  485  KFSGRIPPEIGRLQQVSKMDFKHNKFMGPITPEISHCKLLTFVDLSRNELSGEIPKEITG  544

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            +  L  L+L  N+L G +P  +  M S
Sbjct  545  MRILNYLNLSRNHLVGSIPSSISTMQS  571


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/76 (32%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = +1

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  549
            G ++P++     L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  ++ + +
Sbjct  512  GPITPEISHCKLLTFVDLSRNELSGEIPKEITGMRILNYLNLSRNHLVGSIPSSISTMQS  571

Query  550  LQVLDLYNNNLTGDLP  597
            L  +D   NNL+G +P
Sbjct  572  LTSVDFSYNNLSGLVP  587


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 43/84 (51%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L P +G    +  L +  N+ SG +PPEI  +  +  ++  +N F      +++  
Sbjct  462  LSGSLPPSIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQVSKMDFKHNKFMGPITPEISHC  521

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L+G++P E+  M
Sbjct  522  KLLTFVDLSRNELSGEIPKEITGM  545



>ref|XP_009354585.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Pyrus x bretschneideri]
Length=1014

 Score =   154 bits (389),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLSGVL  378
            +++  ALLS+K++ T+D  S+L++W  +TSHCTW  VTCDS    V+       +L+G L
Sbjct  21   MSDYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTGTL  80

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  558
            SPD+  L FL NL++A NQ SGP+PP+ISA+S LR LNLSNN+F +TFP QL+ L  L V
Sbjct  81   SPDLAHLRFLSNLTLAENQFSGPIPPDISALSGLRLLNLSNNVFNTTFPPQLSNLTRLTV  140

Query  559  LDLYNNNLTGDLPVEVYKMTS  621
            LDLYNNNLTGDLPV V  MTS
Sbjct  141  LDLYNNNLTGDLPVSVTHMTS  161


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  540
             SG + P+ G+ PFL  L+++ N+L G +PPEI  ++TL+ L +   N +    P ++  
Sbjct  172  FSGQIPPEFGRFPFLEYLAVSGNELGGSIPPEIGNLTTLKELYIGYFNSYEGGMPPEIGN  231

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+NL   D  N NLTG++P E+ ++
Sbjct  232  LSNLVRFDAANCNLTGEVPPELGRL  256


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL+G + P++G+L  +  L +  N LSG + PE+  + +L+ ++LSNN+F    P   ++
Sbjct  244  NLTGEVPPELGRLQNVDTLFLQVNALSGSLTPELGYLKSLKSMDLSNNMFTGEIPGSFSE  303

Query  541  LANLQVLDLYNNNLTGDLP  597
            L NL +L+L+ N L G +P
Sbjct  304  LKNLTLLNLFRNRLHGAIP  322


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+P++G L  L ++ ++ N  +G +P   S +  L  LNL  N      P  +  L
Sbjct  269  LSGSLTPELGYLKSLKSMDLSNNMFTGEIPGSFSELKNLTLLNLFRNRLHGAIPEFIGDL  328

Query  544  ANLQVLDLYNNNLTGDLP  597
              LQVL L+ NN TG +P
Sbjct  329  PELQVLQLWENNFTGSIP  346


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 45/84 (54%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++  +N F  +   +++Q 
Sbjct  461  LSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKMDFKHNKFMGSITPEISQC  520

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L+G++P E+  M
Sbjct  521  KLLTFVDLSRNELSGEIPNEITGM  544


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 49/77 (64%), Gaps = 2/77 (3%)
 Frame = +1

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQLA  546
            G ++P++ Q   L  + ++ N+LSG +P EI+ +  L +LNLS N++FGS  P  ++ + 
Sbjct  511  GSITPEISQCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLFGS-IPSSISTMQ  569

Query  547  NLQVLDLYNNNLTGDLP  597
            +L  +D   NNL+G +P
Sbjct  570  SLTSVDFSYNNLSGLVP  586


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 44/87 (51%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG + P++G+L  L  +    N+  G + PEIS    L F++LS N      P+++  
Sbjct  484  KFSGRIPPEIGRLQQLSKMDFKHNKFMGSITPEISQCKLLTFVDLSRNELSGEIPNEITG  543

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            +  L  L+L  N+L G +P  +  M S
Sbjct  544  MRILNYLNLSRNHLFGSIPSSISTMQS  570



>ref|XP_008344369.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Malus domestica]
Length=1015

 Score =   154 bits (388),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 103/143 (72%), Gaps = 1/143 (1%)
 Frame = +1

Query  196  LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLSG  372
            + ++   ALLS+K++ T+D  S+L++W  +TSHCTW  VTCDS    V+       +L+G
Sbjct  20   IAMSNYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTG  79

Query  373  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  552
             LSPD+  L FL NL++A NQ SGP+PPEISA+S LR LNLSNN+F +TFP +L+ L  L
Sbjct  80   TLSPDLAHLRFLANLTLADNQFSGPIPPEISALSGLRLLNLSNNVFNTTFPXKLSNLTRL  139

Query  553  QVLDLYNNNLTGDLPVEVYKMTS  621
             VLDLYNNNLTGDLPV V  MTS
Sbjct  140  TVLDLYNNNLTGDLPVSVTHMTS  162


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  540
             SG + P+ G+ PFL  L+++ N+L GP+PPEI  ++TL+ L +   N +    P ++  
Sbjct  173  FSGQIPPEFGRFPFLEYLAVSGNELGGPIPPEIGNLTTLKELYIGYFNSYEGGIPPEIGN  232

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+NL   D  N NLTG++P E+ ++
Sbjct  233  LSNLVRFDAANCNLTGEVPPELGRL  257


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL+G + P++G+L  +  L +  N LSG + PE+  + +L+ ++LSNN+F    P   ++
Sbjct  245  NLTGEVPPELGRLQNVDTLFLQVNALSGSLTPELGYLKSLKSMDLSNNVFTGEIPGSFSE  304

Query  541  LANLQVLDLYNNNLTGDLP  597
            L NL +L+L+ N L G +P
Sbjct  305  LKNLTLLNLFRNRLHGAIP  323


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+P++G L  L ++ ++ N  +G +P   S +  L  LNL  N      P  +  L
Sbjct  270  LSGSLTPELGYLKSLKSMDLSNNVFTGEIPGSFSELKNLTLLNLFRNRLHGAIPDFIGDL  329

Query  544  ANLQVLDLYNNNLTGDLP  597
              LQVL L+ NN TG +P
Sbjct  330  PELQVLQLWENNFTGSIP  347


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 42/86 (49%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG + P++G+L  L  +    N+  G + PEIS    L F++LS N      P +   +
Sbjct  486  FSGRIPPEIGRLQQLSKIDFKHNKFMGSITPEISHCKLLTFVDLSRNELSGEIPKEXTGM  545

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G +P  +  M S
Sbjct  546  RILNYLNLSRNHLVGSIPSSISTMQS  571


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 43/84 (51%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++  +N F  +   +++  
Sbjct  462  LSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFKHNKFMGSITPEISHC  521

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L+G++P E   M
Sbjct  522  KLLTFVDLSRNELSGEIPKEXTGM  545



>gb|KDO78771.1| hypothetical protein CISIN_1g001816mg [Citrus sinensis]
Length=1010

 Score =   153 bits (386),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  381
            V E  ALLSIK++ T D QSSL +WN +TSHCTW  VTCDS  HV SLDLSGLNLSG LS
Sbjct  20   VPEYKALLSIKSSITDDPQSSLAAWNATTSHCTWPGVTCDSRRHVTSLDLSGLNLSGALS  79

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            PDV  L FL NLS+AANQLSGP+PPEISA+S+LR LNLSNN+F  +FP QL+QLA+LQVL
Sbjct  80   PDVAHLRFLQNLSVAANQLSGPIPPEISALSSLRLLNLSNNVFNGSFPPQLSQLASLQVL  139

Query  562  DLYNNNLTGDLPVEVYKM  615
            DLYNNN+TGDLP+ V ++
Sbjct  140  DLYNNNMTGDLPLAVTQL  157


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +  D+G+L  L  L +  N LSGP+  E+  + +L+ ++LSNNIF    P   A+L
Sbjct  243  LSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLKSLKSMDLSNNIFTGEIPASFAEL  302

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  303  KNLTLLNLFRNKLHGAIP  320


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 45/87 (52%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG +  ++G+L  L  +  + N+ SG + PEIS    L F++LS N      P+QL  
Sbjct  482  KFSGQIPAEIGKLQQLSKMDFSHNKFSGRIAPEISQCKLLTFVDLSRNELSGEIPNQLTG  541

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            +  L  L+L  N+L G +P  +  M S
Sbjct  542  MRILNYLNLSRNHLVGSIPASIASMQS  568


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG ++P++ Q   L  + ++ N+LSG +P +++ +  L +LNLS N    + P  +A 
Sbjct  506  KFSGRIAPEISQCKLLTFVDLSRNELSGEIPNQLTGMRILNYLNLSRNHLVGSIPASIAS  565

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  +D   NNL+G +P
Sbjct  566  MQSLTSVDFSYNNLSGLVP  584



>ref|XP_006426178.1| hypothetical protein CICLE_v10024796mg [Citrus clementina]
 gb|ESR39418.1| hypothetical protein CICLE_v10024796mg [Citrus clementina]
Length=1012

 Score =   153 bits (386),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  381
            V E  ALLSIK++ T D QSSL +WN +TSHCTW  VTCDS  HV SLDLSGLNLSG LS
Sbjct  22   VPEYKALLSIKSSITDDPQSSLAAWNATTSHCTWPGVTCDSRRHVTSLDLSGLNLSGALS  81

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            PDV  L FL NLS+AANQLSGP+PPEISA+S+LR LNLSNN+F  +FP QL+QLA+LQVL
Sbjct  82   PDVAHLRFLQNLSVAANQLSGPIPPEISALSSLRLLNLSNNVFNGSFPPQLSQLASLQVL  141

Query  562  DLYNNNLTGDLPVEVYKM  615
            DLYNNN+TGDLP+ V ++
Sbjct  142  DLYNNNMTGDLPLAVTQL  159


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +  D+G+L  L  L +  N LSGP+  E+  + +L+ ++LSNNIF    P   A+L
Sbjct  245  LSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLKSLKSMDLSNNIFTGEIPASFAEL  304

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  305  KNLTLLNLFRNKLHGAIP  322


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 45/87 (52%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG +  ++G+L  L  +  + N+ SG + PEIS    L F++LS N      P+QL  
Sbjct  484  KFSGQIPAEIGKLQQLSKMDFSHNKFSGRIAPEISQCKLLTFVDLSRNELSGEIPNQLTG  543

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            +  L  L+L  N+L G +P  +  M S
Sbjct  544  MRILNYLNLSRNHLVGSIPASIASMQS  570


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG ++P++ Q   L  + ++ N+LSG +P +++ +  L +LNLS N    + P  +A 
Sbjct  508  KFSGRIAPEISQCKLLTFVDLSRNELSGEIPNQLTGMRILNYLNLSRNHLVGSIPASIAS  567

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  +D   NNL+G +P
Sbjct  568  MQSLTSVDFSYNNLSGLVP  586



>ref|XP_006466390.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Citrus sinensis]
Length=1010

 Score =   153 bits (386),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  381
            V E  ALLSIK++ T D QSSL +WN +TSHCTW  VTCDS  HV SLDLSGLNLSG LS
Sbjct  20   VPEYKALLSIKSSITDDPQSSLAAWNATTSHCTWPGVTCDSRRHVTSLDLSGLNLSGALS  79

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            PDV  L FL NLS+AANQLSGP+PPEISA+S+LR LNLSNN+F  +FP QL+QLA+LQVL
Sbjct  80   PDVAHLRFLQNLSVAANQLSGPIPPEISALSSLRLLNLSNNVFNGSFPPQLSQLASLQVL  139

Query  562  DLYNNNLTGDLPVEVYKM  615
            DLYNNN+TGDLP+ V ++
Sbjct  140  DLYNNNMTGDLPLAVTQL  157


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +  D+G+L  L  L +  N LSGP+  E+  + +L+ ++LSNNIF    P   A+L
Sbjct  243  LSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLKSLKSMDLSNNIFTGEIPASFAEL  302

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  303  KNLTLLNLFRNKLHGAIP  320


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 45/87 (52%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG +  ++G+L  L  +  + N+ SG + PEIS    L F++LS N      P+QL  
Sbjct  482  KFSGQIPAEIGKLQQLSKMDFSHNKFSGRIAPEISQCKLLTFVDLSRNELSGEIPNQLTG  541

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            +  L  L+L  N+L G +P  +  M S
Sbjct  542  MRILNYLNLSRNHLVGSIPASIASMQS  568


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG ++P++ Q   L  + ++ N+LSG +P +++ +  L +LNLS N    + P  +A 
Sbjct  506  KFSGRIAPEISQCKLLTFVDLSRNELSGEIPNQLTGMRILNYLNLSRNHLVGSIPASIAS  565

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  +D   NNL+G +P
Sbjct  566  MQSLTSVDFSYNNLSGLVP  584



>ref|XP_002875982.1| hypothetical protein ARALYDRAFT_906265 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52241.1| hypothetical protein ARALYDRAFT_906265 [Arabidopsis lyrata subsp. 
lyrata]
Length=1001

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 103/141 (73%), Gaps = 2/141 (1%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  378
            +TE  ALLS+K++FT D  S LTSWN+ST+ C+W  VTCD  L  V+      LNLSG L
Sbjct  25   ITELNALLSLKSSFTIDEHSPLTSWNLSTTFCSWTGVTCDVSLRHVTSLDLSGLNLSGTL  84

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQ  555
            S DV  LP L NLS+AANQ+SGP+PPEIS +  LR LNLSNN+F  ++P +L+  L NL+
Sbjct  85   SSDVSHLPLLQNLSLAANQISGPIPPEISNLYELRHLNLSNNVFNGSYPDELSSGLVNLR  144

Query  556  VLDLYNNNLTGDLPVEVYKMT  618
            VLDLYNNNLTGDLPV +  +T
Sbjct  145  VLDLYNNNLTGDLPVSITNLT  165


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P++G+L  L  L +  N  SG +  E+  IS+L+ ++LSNN+F    P   +QL
Sbjct  250  LTGEIPPEIGKLQKLDTLFLQVNAFSGTLTSELGFISSLKSMDLSNNMFTGEIPASFSQL  309

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
             NL +L+L+ N L G +P  + +M
Sbjct  310  KNLTLLNLFRNKLYGAIPEFIGEM  333


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 46/84 (55%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L   +G    +  L +  N+ +GP+PPEI  +  L  L+ S+N+F      ++++ 
Sbjct  467  LSGPLPAAIGNFSGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRC  526

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L+GD+P E+  M
Sbjct  527  KLLTFVDLSRNELSGDIPKEITGM  550


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G + P++G+L  L  L  + N  SG + PEIS    L F++LS N      P ++  +
Sbjct  491  FAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGDIPKEITGM  550

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G +PV +  M S
Sbjct  551  RILNYLNLSRNHLVGSIPVTIASMQS  576


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 46/85 (54%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             SG +    G  P L  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  177  FSGKIPATYGTWPVLEYLAVSGNELIGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  236

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L   D  N  LTG++P E+ K+
Sbjct  237  LSELVRFDAANCGLTGEIPPEIGKL  261


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  +A +
Sbjct  515  FSGRIAPEISRCKLLTFVDLSRNELSGDIPKEITGMRILNYLNLSRNHLVGSIPVTIASM  574

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  575  QSLTSVDFSYNNLSGLVP  592



>ref|XP_008393812.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Malus domestica]
Length=1014

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLSGVL  378
            +++  ALLS+K++ T+D  S+L++W  +TSHCTW  VTCDS    V+       +L+G L
Sbjct  21   MSDYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTGTL  80

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  558
            SPD+  L FL NL++A NQ SGP+PP+ISA+S LR LNLSNN+F +TFP QL+ L  L V
Sbjct  81   SPDLAHLRFLSNLTLAENQFSGPIPPDISALSGLRLLNLSNNVFNTTFPRQLSNLTRLTV  140

Query  559  LDLYNNNLTGDLPVEVYKMTS  621
            LDLYNNNLTG LPV V  MTS
Sbjct  141  LDLYNNNLTGKLPVSVTHMTS  161


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  540
             SG + P+ G+ PFL  L+++ N+L G +PPEI  ++TL+ L +   N +    P ++  
Sbjct  172  FSGQIPPEFGRFPFLEYLAVSGNELGGSIPPEIGNLTTLKELYIGYFNSYEGGIPPEIGN  231

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+NL   D  N NLTG++P E+ ++
Sbjct  232  LSNLVRFDAANCNLTGEVPPELGRL  256


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL+G + P++G+L  +  L +  N LSG + PE+  + +L+ ++LSNN++    P   ++
Sbjct  244  NLTGEVPPELGRLQNVDTLFLQVNALSGWLTPELGYLKSLKSMDLSNNMYTGEIPGSFSE  303

Query  541  LANLQVLDLYNNNLTGDLP  597
            L NL +L+L+ N L G +P
Sbjct  304  LKNLTLLNLFRNRLHGAIP  322


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+P++G L  L ++ ++ N  +G +P   S +  L  LNL  N      P  +  L
Sbjct  269  LSGWLTPELGYLKSLKSMDLSNNMYTGEIPGSFSELKNLTLLNLFRNRLHGAIPEFIGDL  328

Query  544  ANLQVLDLYNNNLTGDLP  597
              LQVL L+ NN TG +P
Sbjct  329  PELQVLQLWENNFTGSIP  346


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG + P++G+L  L  +    N+  G + PEIS    L F++LS N      P ++  
Sbjct  484  KFSGRIPPEIGRLQQLSKMDFKHNKFMGSITPEISLCKLLTFVDLSRNELSGEIPKEITG  543

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            +  L  L+L  N+L G +P  +  M S
Sbjct  544  MRILNYLNLSRNHLXGSIPSSISTMQS  570


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/76 (32%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = +1

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  549
            G ++P++     L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  ++ + +
Sbjct  511  GSITPEISLCKLLTFVDLSRNELSGEIPKEITGMRILNYLNLSRNHLXGSIPSSISTMQS  570

Query  550  LQVLDLYNNNLTGDLP  597
            L  +D   NNL+G +P
Sbjct  571  LTSVDFSYNNLSGLVP  586


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 44/84 (52%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++  +N F  +   +++  
Sbjct  461  LSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKMDFKHNKFMGSITPEISLC  520

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L+G++P E+  M
Sbjct  521  KLLTFVDLSRNELSGEIPKEITGM  544



>ref|XP_007208421.1| hypothetical protein PRUPE_ppa000739mg [Prunus persica]
 gb|EMJ09620.1| hypothetical protein PRUPE_ppa000739mg [Prunus persica]
Length=1017

 Score =   151 bits (381),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 103/140 (74%), Gaps = 0/140 (0%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  381
            +++  ALLS K++ ++D  S L+SW  +TSHCTW  VTCDS  HV SLDLS  +L G LS
Sbjct  22   MSDYRALLSFKSSISSDPNSVLSSWTPTTSHCTWTGVTCDSRRHVTSLDLSSSDLVGTLS  81

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
             D+  L FL NL++A NQ SGP+P EISA+S LR LNLSNNIF +TFP QL+ L  L VL
Sbjct  82   SDIAHLRFLSNLTLADNQFSGPIPSEISALSGLRLLNLSNNIFNTTFPPQLSNLTRLAVL  141

Query  562  DLYNNNLTGDLPVEVYKMTS  621
            DLYNNNLTGDLPV V  MTS
Sbjct  142  DLYNNNLTGDLPVSVTHMTS  161


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             SG + P+ G+ P L  L+I+ N+L G +PPEI  +++L+ L +   NI+    P ++  
Sbjct  172  FSGRIPPEFGRFPLLEYLAISGNELGGSIPPEIGNLTSLKELYIGYYNIYEGGIPPEIGN  231

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L  LD  N NLTG++P E+ ++
Sbjct  232  LSQLVRLDAANCNLTGEVPRELGRL  256


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG + P++G+L  L  +  + N+  GP+ PEIS    L F++LS N      P ++  +
Sbjct  485  FSGRIPPEIGRLQQLSKIDFSHNKFLGPIAPEISQCKLLTFVDLSRNELAGEIPKEITGM  544

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G +P  +  M S
Sbjct  545  RILNYLNLSRNHLVGSIPSSISTMQS  570


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 41/78 (53%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+ ++G L  L ++ ++ N  SG +P   S +  L  LNL  N      P  +  L
Sbjct  269  LSGSLTAELGSLKSLKSMDLSNNMFSGEIPGSFSELKNLTLLNLFRNKLHGAIPEFIGDL  328

Query  544  ANLQVLDLYNNNLTGDLP  597
              LQVL L+ NN TG +P
Sbjct  329  PELQVLQLWENNFTGSIP  346


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL+G +  ++G+L  +  L +  N LSG +  E+ ++ +L+ ++LSNN+F    P   ++
Sbjct  244  NLTGEVPRELGRLQNVDTLFLQVNALSGSLTAELGSLKSLKSMDLSNNMFSGEIPGSFSE  303

Query  541  LANLQVLDLYNNNLTGDLP  597
            L NL +L+L+ N L G +P
Sbjct  304  LKNLTLLNLFRNKLHGAIP  322


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 44/84 (52%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++ S+N F      +++Q 
Sbjct  461  LSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFSHNKFLGPIAPEISQC  520

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L G++P E+  M
Sbjct  521  KLLTFVDLSRNELAGEIPKEITGM  544


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/76 (32%), Positives = 45/76 (59%), Gaps = 0/76 (0%)
 Frame = +1

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  549
            G ++P++ Q   L  + ++ N+L+G +P EI+ +  L +LNLS N    + P  ++ + +
Sbjct  511  GPIAPEISQCKLLTFVDLSRNELAGEIPKEITGMRILNYLNLSRNHLVGSIPSSISTMQS  570

Query  550  LQVLDLYNNNLTGDLP  597
            L  +D   NNL+G +P
Sbjct  571  LTSVDFSYNNLSGLVP  586



>ref|XP_006404116.1| hypothetical protein EUTSA_v10010092mg [Eutrema salsugineum]
 gb|ESQ45569.1| hypothetical protein EUTSA_v10010092mg [Eutrema salsugineum]
Length=1009

 Score =   151 bits (381),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 104/150 (69%), Gaps = 7/150 (5%)
 Frame = +1

Query  184  AGKPLGVTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls  354
            AG+P  ++E  ALLS+K++ T    D  S LTSW +STS C W  VTCD     V+    
Sbjct  31   AGRP--ISEYHALLSLKSSLTGGENDQHSPLTSWKLSTSFCLWTGVTCDVSRRHVTSLDL  88

Query  355  g-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  531
              LNLSG LS DV  LP L NLS+AANQ+SGP+PPEIS +S LR LNLSNNIF  ++P +
Sbjct  89   SGLNLSGTLSSDVAHLPLLQNLSVAANQISGPIPPEISNLSELRHLNLSNNIFNGSYPDE  148

Query  532  L-AQLANLQVLDLYNNNLTGDLPVEVYKMT  618
            L A L NLQVLDLYNNNLTGDLPV +  +T
Sbjct  149  LSAGLVNLQVLDLYNNNLTGDLPVSITNLT  178


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P++ +L  L  L +  N  SGP+ PE+  IS+L+ ++LSNN+F    P    QL
Sbjct  263  LTGEIPPEIWKLQKLDTLFLQVNAFSGPLTPELGMISSLKSMDLSNNMFTGEIPASFEQL  322

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  323  KNLTLLNLFRNKLYGAIP  340


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 44/76 (58%), Gaps = 1/76 (1%)
 Frame = +1

Query  391  GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQLANLQVLDL  567
            G  P L  L+++ N+L G +PPEI  +++LR L +   N F    P ++  L+ L   D 
Sbjct  199  GTWPVLEYLAVSGNELVGKIPPEIGNLTSLRELYIGYYNAFEDGLPPEIGNLSELVRFDA  258

Query  568  YNNNLTGDLPVEVYKM  615
             N  LTG++P E++K+
Sbjct  259  ANCGLTGEIPPEIWKL  274


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++     L  + ++ N+LSG +P EI+++  L +LN+S N    + P  +A +
Sbjct  527  FSGRITPEISHCKLLTFVDLSRNELSGEIPNEITSMRILNYLNISRNHLVGSIPVTIASM  586

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  587  QSLTSVDFSYNNLSGLVP  604


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 42/80 (53%), Gaps = 0/80 (0%)
 Frame = +1

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  555
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N F      +L  +++L+
Sbjct  243  LPPEIGNLSELVRFDAANCGLTGEIPPEIWKLQKLDTLFLQVNAFSGPLTPELGMISSLK  302

Query  556  VLDLYNNNLTGDLPVEVYKM  615
             +DL NN  TG++P    ++
Sbjct  303  SMDLSNNMFTGEIPASFEQL  322



>ref|XP_008354741.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Malus domestica]
Length=1015

 Score =   150 bits (379),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 102/143 (71%), Gaps = 1/143 (1%)
 Frame = +1

Query  196  LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLSG  372
            + ++   ALLS+K++ T+   S+L++W  +TSHCTW  VTCDS    V+       +L+G
Sbjct  20   IAMSNYRALLSLKSSITSXPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTG  79

Query  373  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  552
             LSPD+  L FL NL++A NQ SGP+PPEISA+S LR LNLSNN+F +TFP +L+ L  L
Sbjct  80   TLSPDLAHLRFLANLTLADNQFSGPIPPEISALSGLRLLNLSNNVFNTTFPPKLSNLTRL  139

Query  553  QVLDLYNNNLTGDLPVEVYKMTS  621
             VLDLYNNNLTGDLPV V  MTS
Sbjct  140  TVLDLYNNNLTGDLPVSVTHMTS  162


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  540
             SG + P+ G+ PFL  L+++ N+L GP+PPEI  ++TL+ L +   N +    P ++  
Sbjct  173  FSGQIPPEFGRFPFLEYLAVSGNELGGPIPPEIGNLTTLKELYIGYFNSYEGGIPPEIGN  232

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+NL   D  N NLTG++P E+ ++
Sbjct  233  LSNLVRFDAANCNLTGEVPPELGRL  257


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL+G + P++G+L  +  L +  N LSG + PE+  + +L+ ++LSNN+F    P   ++
Sbjct  245  NLTGEVPPELGRLQNVDTLFLQVNALSGSLTPELGYLKSLKSMDLSNNVFTGEIPGSFSE  304

Query  541  LANLQVLDLYNNNLTGDLP  597
            L NL +L+L+ N L G +P
Sbjct  305  LKNLTLLNLFRNRLHGAIP  323


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+P++G L  L ++ ++ N  +G +P   S +  L  LNL  N      P  +  L
Sbjct  270  LSGSLTPELGYLKSLKSMDLSNNVFTGEIPGSFSELKNLTLLNLFRNRLHGAIPDFIGDL  329

Query  544  ANLQVLDLYNNNLTGDLP  597
              LQVL L+ NN TG +P
Sbjct  330  PELQVLQLWENNFTGSIP  347


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 42/86 (49%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG + P++G+L  L  +    N+  G + PEIS    L F++LS N      P +   +
Sbjct  486  FSGRIPPEIGRLQQLSKIDFKHNKFMGSITPEISHCKLLTFVDLSRNELSGEIPKEXTGM  545

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G +P  +  M S
Sbjct  546  RILNYLNLSRNHLVGSIPSSISTMQS  571


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 43/84 (51%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++  +N F  +   +++  
Sbjct  462  LSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFKHNKFMGSITPEISHC  521

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L+G++P E   M
Sbjct  522  KLLTFVDLSRNELSGEIPKEXTGM  545



>ref|NP_001235080.1| receptor-like protein kinase 3 precursor [Glycine max]
 gb|AAF91324.1|AF244890_1 receptor-like protein kinase 3 [Glycine max]
Length=1012

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  381
            ++E  ALLS+++A T  +   LTSWN ST +C+W  VTCD+  HV SLDL+GL+LSG LS
Sbjct  25   ISEYRALLSLRSAITDATPPLLTSWNSSTPYCSWLGVTCDNRRHVTSLDLTGLDLSGPLS  84

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
             DV  LPFL NLS+A+N+ SGP+PP +SA+S LRFLNLSNN+F  TFP +L++L NL+VL
Sbjct  85   ADVAHLPFLSNLSLASNKFSGPIPPSLSALSGLRFLNLSNNVFNETFPSELSRLQNLEVL  144

Query  562  DLYNNNLTGDLPVEVYKM  615
            DLYNNN+TG LP+ V +M
Sbjct  145  DLYNNNMTGVLPLAVAQM  162


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G + P +G+L  L  +  + N+ SGP+ PEIS    L FL+LS N      P+++  +
Sbjct  488  FTGRIPPQIGRLQQLSKIDFSGNKFSGPIVPEISQCKLLTFLDLSRNELSGDIPNEITGM  547

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G +P  +  M S
Sbjct  548  RILNYLNLSRNHLVGGIPSSISSMQS  573


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 44/84 (52%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSGVL P +G    +  L +  N  +G +PP+I  +  L  ++ S N F      +++Q 
Sbjct  464  LSGVLPPSIGNFSSVQKLILDGNMFTGRIPPQIGRLQQLSKIDFSGNKFSGPIVPEISQC  523

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  LDL  N L+GD+P E+  M
Sbjct  524  KLLTFLDLSRNELSGDIPNEITGM  547


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+P++G L  L ++ ++ N LSG +P     +  +  LNL  N      P  + +L
Sbjct  272  LSGSLTPELGNLKSLKSMDLSNNMLSGEIPARFGELKNITLLNLFRNKLHGAIPEFIGEL  331

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+V+ L+ NN TG +P
Sbjct  332  PALEVVQLWENNFTGSIP  349


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +   +G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P +  +L
Sbjct  248  LSGEIPAALGKLQKLDTLFLQVNALSGSLTPELGNLKSLKSMDLSNNMLSGEIPARFGEL  307

Query  544  ANLQVLDLYNNNLTGDLP  597
             N+ +L+L+ N L G +P
Sbjct  308  KNITLLNLFRNKLHGAIP  325


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG + P++ Q   L  L ++ N+LSG +P EI+ +  L +LNLS N      P  ++ 
Sbjct  511  KFSGPIVPEISQCKLLTFLDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGGIPSSISS  570

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  +D   NNL+G +P
Sbjct  571  MQSLTSVDFSYNNLSGLVP  589


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 46/83 (55%), Gaps = 1/83 (1%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            N++GVL   V Q+  L +L +  N  SG +PPE      L++L +S N    T P ++  
Sbjct  150  NMTGVLPLAVAQMQNLRHLHLGGNFFSGQIPPEYGRWQRLQYLAVSGNELEGTIPPEIGN  209

Query  541  LANLQVLDL-YNNNLTGDLPVEV  606
            L++L+ L + Y N  TG +P E+
Sbjct  210  LSSLRELYIGYYNTYTGGIPPEI  232



>ref|NP_190536.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
 sp|Q9M2Z1.1|BAME2_ARATH RecName: Full=Leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2; AltName: Full=Protein BARELY ANY MERISTEM 
2; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB66905.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAO64138.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|AAP04098.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 dbj|BAF00510.1| receptor protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59331.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE78574.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
Length=1002

 Score =   147 bits (372),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 103/142 (73%), Gaps = 3/142 (2%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSL-TSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGV  375
            +TE  ALLS+K++FT D  S L TSWN+ST+ C+W  VTCD  L  V+      LNLSG 
Sbjct  25   ITELHALLSLKSSFTIDEHSPLLTSWNLSTTFCSWTGVTCDVSLRHVTSLDLSGLNLSGT  84

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANL  552
            LS DV  LP L NLS+AANQ+SGP+PP+IS +  LR LNLSNN+F  +FP +L+  L NL
Sbjct  85   LSSDVAHLPLLQNLSLAANQISGPIPPQISNLYELRHLNLSNNVFNGSFPDELSSGLVNL  144

Query  553  QVLDLYNNNLTGDLPVEVYKMT  618
            +VLDLYNNNLTGDLPV +  +T
Sbjct  145  RVLDLYNNNLTGDLPVSLTNLT  166


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P++G+L  L  L +  N  +G +  E+  IS+L+ ++LSNN+F    P   +QL
Sbjct  251  LTGEIPPEIGKLQKLDTLFLQVNAFTGTITQELGLISSLKSMDLSNNMFTGEIPTSFSQL  310

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
             NL +L+L+ N L G +P  + +M
Sbjct  311  KNLTLLNLFRNKLYGAIPEFIGEM  334


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG + P++G+L  L  L  + N  SG + PEIS    L F++LS N      P++L  +
Sbjct  492  FSGSIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGDIPNELTGM  551

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G +PV +  M S
Sbjct  552  KILNYLNLSRNHLVGSIPVTIASMQS  577


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             SG +    G  P L  L+++ N+L+G +PPEI  ++TLR L +   N F +  P ++  
Sbjct  178  FSGKIPATYGTWPVLEYLAVSGNELTGKIPPEIGNLTTLRELYIGYYNAFENGLPPEIGN  237

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L   D  N  LTG++P E+ K+
Sbjct  238  LSELVRFDAANCGLTGEIPPEIGKL  262


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 46/84 (55%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L   +G L  +  L +  N+ SG +PPEI  +  L  L+ S+N+F      ++++ 
Sbjct  468  LSGSLPAAIGNLSGVQKLLLDGNKFSGSIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRC  527

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L+GD+P E+  M
Sbjct  528  KLLTFVDLSRNELSGDIPNELTGM  551


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 43/80 (54%), Gaps = 0/80 (0%)
 Frame = +1

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  555
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N F  T   +L  +++L+
Sbjct  231  LPPEIGNLSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNAFTGTITQELGLISSLK  290

Query  556  VLDLYNNNLTGDLPVEVYKM  615
             +DL NN  TG++P    ++
Sbjct  291  SMDLSNNMFTGEIPTSFSQL  310


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ +   L  + ++ N+LSG +P E++ +  L +LNLS N    + P  +A +
Sbjct  516  FSGRIAPEISRCKLLTFVDLSRNELSGDIPNELTGMKILNYLNLSRNHLVGSIPVTIASM  575

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  576  QSLTSVDFSYNNLSGLVP  593



>gb|KFK34238.1| hypothetical protein AALP_AA5G119100 [Arabis alpina]
Length=998

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 111/148 (75%), Gaps = 5/148 (3%)
 Frame = +1

Query  184  AGKPLGVTEQAALLSIKAAFTADSQSS-LTSWNISTSHCTWRRVTCdsl-lhvvsldlsg  357
            A +P   TE  ALLS+K + T+  QSS LTSWN+S S C W  VTCD    HV SLDLS 
Sbjct  17   AARP--TTELHALLSLKTSLTSGEQSSSLTSWNLSKSFCLWAGVTCDVSLRHVTSLDLSS  74

Query  358  lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-  534
            LNLSG LS DV  LP L NLS+AANQ+SGP+PPEI+ +S LR LNLSNN+F  ++P+QL 
Sbjct  75   LNLSGTLSSDVAHLPLLQNLSVAANQISGPIPPEIANLSELRHLNLSNNVFNGSYPNQLS  134

Query  535  AQLANLQVLDLYNNNLTGDLPVEVYKMT  618
            A+LANLQVLDLYNNNLTGDLPV +  +T
Sbjct  135  ARLANLQVLDLYNNNLTGDLPVSITNLT  162


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P++G+L  L  L +  N  SGP+  E+  IS+L+ ++LSNN+F    P    QL
Sbjct  247  LTGEIPPEIGKLQKLDTLFLQVNAFSGPLTSELGVISSLKSMDLSNNMFTGEIPASFEQL  306

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  307  KNLTLLNLFRNKLYGAIP  324


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 0/85 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            +LSG L P +G    +  L +  N+  GP+PPEI  +  L  L+ S+N+F      +++Q
Sbjct  463  HLSGPLPPAIGNFSGVQKLLLDGNKFGGPIPPEIGRLQQLSKLDFSHNLFPGRIAPEISQ  522

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
               L  +DL  N L+G++P E+  M
Sbjct  523  CKLLTFVDLSRNELSGEIPNEITGM  547


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 45/76 (59%), Gaps = 0/76 (0%)
 Frame = +1

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  549
            G ++P++ Q   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  +A + +
Sbjct  514  GRIAPEISQCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLLGSIPVTMASMQS  573

Query  550  LQVLDLYNNNLTGDLP  597
            L  +D   NNL+G +P
Sbjct  574  LTSVDFSYNNLSGLVP  589


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             +G +    G  P L  L+++ N+L G +PPEI  ++TL+ L +   N F +  P ++ +
Sbjct  174  FTGRIPAVYGSWPVLEYLAVSGNELVGKIPPEIGNLTTLKELYIGYYNAFENGLPPEIGK  233

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L   D  N  LTG++P E+ K+
Sbjct  234  LSELVRFDAANCGLTGEIPPEIGKL  258


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 44/86 (51%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
              G + P++G+L  L  L  + N   G + PEIS    L F++LS N      P+++  +
Sbjct  488  FGGPIPPEIGRLQQLSKLDFSHNLFPGRIAPEISQCKLLTFVDLSRNELSGEIPNEITGM  547

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G +PV +  M S
Sbjct  548  RILNYLNLSRNHLLGSIPVTMASMQS  573



>ref|XP_004288299.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Fragaria vesca subsp. vesca]
Length=1023

 Score =   145 bits (366),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 103/135 (76%), Gaps = 1/135 (1%)
 Frame = +1

Query  217  ALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQ  396
            ALLS+K++   D  S L+SW  +TSHCTW  VTCDS  HV SLDLSGLNLSG LSPD+  
Sbjct  38   ALLSLKSSLD-DPDSRLSSWTPNTSHCTWAGVTCDSHNHVTSLDLSGLNLSGYLSPDIAF  96

Query  397  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  576
            L +L NL++A N LSGP+PPEISA+  LR LNLSNN+F  TFP +L+ L NL+VLDLYNN
Sbjct  97   LVYLSNLTLAENNLSGPIPPEISALPALRLLNLSNNVFNRTFPPELSNLTNLRVLDLYNN  156

Query  577  NLTGDLPVEVYKMTS  621
            NLTG LPV V  MT+
Sbjct  157  NLTGVLPVSVTHMTN  171


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NLSG + P++G+L  +  L +  N LSG +  E+ ++ +L+ ++LSNN+F    P   A+
Sbjct  254  NLSGEIPPELGRLQNVDTLFLQVNALSGSLTSELGSLKSLKSMDLSNNLFSGEIPTSFAE  313

Query  541  LANLQVLDLYNNNLTGDLP  597
            L NL +L+L+ N L G +P
Sbjct  314  LKNLTLLNLFRNQLHGAIP  332


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG + P++G L  L  +  + N  SGP+ PEIS    L +++LS N      P ++  +
Sbjct  495  FSGRIPPEIGHLEQLSKIDFSHNLFSGPIAPEISRCKVLAYVDLSRNELSGEIPKEITGM  554

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G++P  +  M S
Sbjct  555  RILNYLNLSRNHLVGNIPAPISAMQS  580


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 46/84 (55%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++ S+N+F      ++++ 
Sbjct  471  LSGPLPPAIGNFTGVQKLLLDGNKFSGRIPPEIGHLEQLSKIDFSHNLFSGPIAPEISRC  530

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L+G++P E+  M
Sbjct  531  KVLAYVDLSRNELSGEIPKEITGM  554


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N      P  ++ +
Sbjct  519  FSGPIAPEISRCKVLAYVDLSRNELSGEIPKEITGMRILNYLNLSRNHLVGNIPAPISAM  578

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  579  QSLTSVDFSYNNLSGLVP  596



>ref|XP_006290548.1| hypothetical protein CARUB_v10016631mg [Capsella rubella]
 gb|EOA23446.1| hypothetical protein CARUB_v10016631mg [Capsella rubella]
Length=997

 Score =   144 bits (364),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 100/142 (70%), Gaps = 2/142 (1%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  378
            +TE  ALLS+K++ T D  S L SWN+ST+ C+W  VTCD     V+      L+LSG L
Sbjct  22   ITELQALLSLKSSLTGDEHSPLNSWNLSTTFCSWTGVTCDVSRRHVTSLDLSGLDLSGTL  81

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQ  555
            S DV  LP L NLS+AANQ+SGP+PPEIS +S LR LNLSNN+F  ++P +L+  L NL+
Sbjct  82   SSDVSHLPLLQNLSLAANQISGPIPPEISNLSELRHLNLSNNVFNGSYPDELSSGLVNLR  141

Query  556  VLDLYNNNLTGDLPVEVYKMTS  621
            VLDLYNNNLTG LP+ +  +T 
Sbjct  142  VLDLYNNNLTGVLPLSITNLTE  163


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P++G+L  L  L +  N  +G +  E+  IS+L+ ++ SNN+F    P   A+L
Sbjct  247  LTGAIPPEIGKLQNLDTLFLQVNAFAGTLTQELGWISSLKSMDFSNNMFTGEIPASFAEL  306

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  307  KNLTLLNLFRNKLYGAIP  324


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 46/84 (55%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L   +G    +  L +  N+ +GP+PPEI  +  L  L+ S+N+F      ++++ 
Sbjct  463  LSGPLPAAIGNFSGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRC  522

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L+GD+P E+  M
Sbjct  523  KLLTFVDLSRNELSGDIPNEITGM  546


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G + P++G+L  L  L  + N  SG + PEIS    L F++LS N      P+++  +
Sbjct  487  FAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGDIPNEITGM  546

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G +PV +  M S
Sbjct  547  KILNYLNLSRNHLVGSIPVTIASMQS  572


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  +A +
Sbjct  511  FSGRIAPEISRCKLLTFVDLSRNELSGDIPNEITGMKILNYLNLSRNHLVGSIPVTIASM  570

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  571  QSLTSVDFSYNNLSGLVP  588


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +1

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  555
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N F  T   +L  +++L+
Sbjct  227  LPPEIGNLSELVRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFAGTLTQELGWISSLK  286

Query  556  VLDLYNNNLTGDLP  597
             +D  NN  TG++P
Sbjct  287  SMDFSNNMFTGEIP  300


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 45/85 (53%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             SG +    G  P L  L+++ N+L G +PPEI  +++LR L +   N F    P ++  
Sbjct  174  FSGKIPATYGTWPVLEYLAVSGNELIGKIPPEIGNLTSLRELYIGYYNAFEDGLPPEIGN  233

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L   D  N  LTG +P E+ K+
Sbjct  234  LSELVRFDAANCGLTGAIPPEIGKL  258



>ref|XP_002310320.2| hypothetical protein POPTR_0007s14500g [Populus trichocarpa]
 gb|EEE90770.2| hypothetical protein POPTR_0007s14500g [Populus trichocarpa]
Length=1020

 Score =   144 bits (364),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 98/139 (71%), Gaps = 1/139 (1%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLSGVL  378
            V+E  ALLSIK++ T D QS L++WN +T  C+W  +TCD     V+       NLSG L
Sbjct  28   VSEYEALLSIKSSITDDPQSFLSAWNSTTPLCSWTGITCDHTGRRVTSLDLSGLNLSGTL  87

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  558
            S DV  L +L NLS+A NQ SGP+P  +SA+++LR LNLSNNIF STFP QL+ L NLQV
Sbjct  88   SSDVAHLRYLQNLSLAVNQFSGPIPASLSAVTSLRSLNLSNNIFNSTFPPQLSSLKNLQV  147

Query  559  LDLYNNNLTGDLPVEVYKM  615
            LDLYNNN+TG LP+ V +M
Sbjct  148  LDLYNNNMTGGLPLTVVEM  166


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G+L  L  L +  N LSG + PE+ ++ +L+ ++LSNN+F    P   A+L
Sbjct  252  LSGQIPPEIGRLQKLDTLFLQVNGLSGSLTPELGSLKSLKSMDLSNNMFTGEIPTSFAEL  311

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  312  KNLTLLNLFRNKLYGAIP  329


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 46/87 (53%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG + P++G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P ++  
Sbjct  491  KFSGSIPPEIGRLQQLTKMDFSHNKFSGPIAPEISQCKLLTFVDLSRNELSGEIPTEITG  550

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            +  L  L+L  N+L G +P  +  M S
Sbjct  551  MRILNYLNLSRNHLVGSIPAPIATMQS  577


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+P++G L  L ++ ++ N  +G +P   + +  L  LNL  N      P  +A+L
Sbjct  276  LSGSLTPELGSLKSLKSMDLSNNMFTGEIPTSFAELKNLTLLNLFRNKLYGAIPEFIAEL  335

Query  544  ANLQVLDLYNNNLTGDLP  597
              LQVL L+ NN T  +P
Sbjct  336  PELQVLQLWENNFTSTIP  353


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG ++P++ Q   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  +A 
Sbjct  515  KFSGPIAPEISQCKLLTFVDLSRNELSGEIPTEITGMRILNYLNLSRNHLVGSIPAPIAT  574

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  +D   NNL+G +P
Sbjct  575  MQSLTSVDFSYNNLSGLVP  593


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G +     +L  L  L++  N+L G +P  I+ +  L+ L L  N F ST P  L Q 
Sbjct  300  FTGEIPTSFAELKNLTLLNLFRNKLYGAIPEFIAELPELQVLQLWENNFTSTIPQALGQN  359

Query  544  ANLQVLDLYNNNLTGDLP  597
              L++LDL +N LTG LP
Sbjct  360  GKLEILDLSSNKLTGTLP  377



>gb|EPS74129.1| hypothetical protein M569_00625, partial [Genlisea aurea]
Length=970

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 108/149 (72%), Gaps = 1/149 (1%)
 Frame = +1

Query  166  HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsl  345
            H     A +P  ++E  AL+SIKAA + +++ +L SWN   SHC+WR VTCDSL   V+ 
Sbjct  15   HLQRCAAVRPPRMSEYHALVSIKAAISEEARPALASWNSGASHCSWRGVTCDSLGRHVTG  74

Query  346  -dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  522
             D+S L+LSG LSPDVGQL FLVNLS AAN LSGPVP EI+ I  LR+LNLSNN+F  +F
Sbjct  75   LDISNLSLSGSLSPDVGQLLFLVNLSAAANLLSGPVPAEIADIPNLRYLNLSNNVFNLSF  134

Query  523  PHQLAQLANLQVLDLYNNNLTGDLPVEVY  609
            P +L +L NLQVLDLYNNN+TGD P   Y
Sbjct  135  PTELYRLKNLQVLDLYNNNMTGDFPSRAY  163


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             +G + P+ G  P L  L+++ N+LSG +PPE+  ++ L+ L +   N F    P ++  
Sbjct  178  FTGTMPPEFGSFPHLEYLAVSGNELSGTIPPELGNLTQLKELYVGYYNTFSGGLPKEIGN  237

Query  541  LANLQVLDLYNNNLTGDLPVEV  606
            L+NL  LD  +  L+GD+P E+
Sbjct  238  LSNLLRLDAASCGLSGDIPSEI  259


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG L+P++G L  L ++ ++ N LSG +P   + +  L  LNL  N    + P+ + +L
Sbjct  275  FSGGLTPELGNLKNLKSMDLSNNALSGEIPSSFAELKNLTLLNLFRNKLNGSIPNFIGEL  334

Query  544  ANLQVLDLYNNNLTGDLP  597
              LQVL L+ NN TG +P
Sbjct  335  PQLQVLQLWENNFTGSIP  352


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG + P++ Q   L  + ++ NQL+G VP EISA+  L +LNLS N      P  ++ +
Sbjct  515  FSGQIPPELSQCKQLAFVDLSRNQLNGRVPSEISAMKILNYLNLSRNQLDGNIPSSISSM  574

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NN TG +P
Sbjct  575  QSLTSVDFSYNNFTGLVP  592


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +  ++G L  L  L +  N  SG + PE+  +  L+ ++LSNN      P   A+L
Sbjct  251  LSGDIPSEIGMLQNLDTLFLQVNGFSGGLTPELGNLKNLKSMDLSNNALSGEIPSSFAEL  310

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  311  KNLTLLNLFRNKLNGSIP  328



>ref|XP_004511796.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cicer arietinum]
Length=1009

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 104/138 (75%), Gaps = 0/138 (0%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  381
            ++E  ALLS++ A T  +   L+SWN ST+HC W  VTCD+  HV +L+L+GLNLSG L+
Sbjct  23   ISEYRALLSLREAITDTNPPILSSWNPSTTHCIWLGVTCDTRRHVTALNLTGLNLSGTLA  82

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
             D+  LPFL NLS+A N+ SG +PP +SA+S LR LNLSNN+F  TFP +L+QL +L+VL
Sbjct  83   ADIAHLPFLSNLSLADNKFSGEIPPSLSAVSGLRLLNLSNNVFNGTFPSELSQLKSLEVL  142

Query  562  DLYNNNLTGDLPVEVYKM  615
            DLYNNN+TG LP+ V ++
Sbjct  143  DLYNNNMTGTLPLAVTEL  160


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G +   +G+L  L N+  + N+ SGP+  EIS    L F++LS N      P+++  +
Sbjct  486  FTGKIPSQIGRLQQLSNIDFSHNKFSGPIASEISQCKLLTFVDLSRNELSGVIPNEITGM  545

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G +P+ +  M S
Sbjct  546  RILNYLNLSRNHLVGSIPISISSMQS  571


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 48/84 (57%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P   +QL
Sbjct  246  LSGEIPAEMGKLQKLDTLFLQVNALSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFSQL  305

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
             NL +L+L+ N L G +P  +  M
Sbjct  306  KNLTLLNLFRNKLHGAIPEFIGDM  329


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+ ++G L  L ++ ++ N L+G +P   S +  L  LNL  N      P  +  +
Sbjct  270  LSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFSQLKNLTLLNLFRNKLHGAIPEFIGDM  329

Query  544  ANLQVLDLYNNNLTGDLPV  600
              L+V+ L+ NN TG++P+
Sbjct  330  PALEVVQLWENNFTGNIPM  348


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 44/83 (53%), Gaps = 0/83 (0%)
 Frame = +1

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  546
            +G + P++G L  LV L  A   LSG +P E+  +  L  L L  N    +   +L  L 
Sbjct  223  AGGIPPEIGNLTELVRLDAAYCGLSGEIPAEMGKLQKLDTLFLQVNALSGSLTWELGNLK  282

Query  547  NLQVLDLYNNNLTGDLPVEVYKM  615
            +L+ +DL NN LTG++P    ++
Sbjct  283  SLKSMDLSNNMLTGEIPTSFSQL  305



>ref|XP_010028033.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Eucalyptus grandis]
 gb|KCW54695.1| hypothetical protein EUGRSUZ_I00635 [Eucalyptus grandis]
Length=1023

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 115/159 (72%), Gaps = 9/159 (6%)
 Frame = +1

Query  163  RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTS-------HCTWRRVTCd  321
            R  A A A  P  +TE  ALLSI+AA T D QS+L+SW  + +       HC+W+ VTCD
Sbjct  17   RRGAAASAA-PTRLTEPLALLSIRAAVTGDPQSALSSWTSAAAAAANGSSHCSWQGVTCD  75

Query  322  -sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS  498
                HV +LDLS L L+G LSPDV  L FL++LS+AANQLSGP+PP+ISA++ LR+LNLS
Sbjct  76   PRRRHVTALDLSSLELAGALSPDVAHLRFLISLSVAANQLSGPIPPQISALAALRYLNLS  135

Query  499  NNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKM  615
            NN+F  TFP +L  L NL+VLDLYNNN+TGDLPV V +M
Sbjct  136  NNVFNGTFPPRLGLLRNLRVLDLYNNNMTGDLPVAVAEM  174


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++ +L  L  L +  N  +G +P EI  +++L+ L+LSNN+F    P   +QL
Sbjct  260  LSGEIPPEIAKLQNLDTLFLQVNGFAGSLPAEIGYLNSLKSLDLSNNMFAGEIPESFSQL  319

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L L+ N L G++P
Sbjct  320  KNLTLLHLFRNKLNGEIP  337


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 51/87 (59%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            N SG + P++G+L  L  +  ++N+ SGP+P +IS    L F++LS N      P+++  
Sbjct  500  NFSGQIPPEIGRLQQLAKIDFSSNRYSGPIPAQISQCKLLTFVDLSGNELSGEIPNEITG  559

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            +  L  L+L +NNL+G +P  +  M S
Sbjct  560  MRILNYLNLSSNNLSGSIPPSISTMQS  586


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 51/85 (60%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
              G + P+ G+  F+  L+++ ++L+G +PPEI  ++TLR L L   N +  + P ++  
Sbjct  187  FGGRIPPEYGRWEFIEYLAVSGDELTGAIPPEIGNLTTLRELYLGYYNSYDGSLPPEIGN  246

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L  LD  +  L+G++P E+ K+
Sbjct  247  LSQLVRLDAASCGLSGEIPPEIAKL  271



>ref|XP_007047661.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOX91818.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=1018

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 104/145 (72%), Gaps = 3/145 (2%)
 Frame = +1

Query  184  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-l  360
            A +P  V+E  ALL++K++FT D +S L++WN +T  C++  V CD     V+       
Sbjct  19   AARP--VSEFRALLAVKSSFTDDPESYLSNWNATTRFCSFTGVACDYTGRHVTSIDLSNF  76

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NLSG LSP    L FL +LS+AANQ+SGP+P E++A+S+LR+ NLSNN+F  +FP QL+Q
Sbjct  77   NLSGTLSPSFSHLRFLQSLSLAANQISGPIPTELAALSSLRYFNLSNNVFNGSFPSQLSQ  136

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L NLQVLDLYNNN+TG+LP+ V ++
Sbjct  137  LKNLQVLDLYNNNMTGELPISVTEL  161


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  +A 
Sbjct  511  KFSGTIAPEISKCKLLTFVDLSRNELSGEIPTEITGMRILNYLNLSRNHLIGSIPSSIAT  570

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  +D   NNL+G +P
Sbjct  571  MQSLTSVDFSYNNLSGLVP  589


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 50/105 (48%), Gaps = 24/105 (23%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA--  537
            LSG + P++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   A  
Sbjct  247  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLKSLKSMDLSNNMLAGEIPESFANL  306

Query  538  ----------------------QLANLQVLDLYNNNLTGDLPVEV  606
                                  +L  L+VL L+ NN TG +P ++
Sbjct  307  KNLTLLNLFRNKLHGQIPEFIGELPELEVLQLWENNFTGSIPQQL  351


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 40/78 (51%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
              G L P++G L  LV    A   LSG +PPEI  +  L  L L  N    +   +L  L
Sbjct  223  FEGGLPPEIGNLSELVRFDAANCMLSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTL  282

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L+ +DL NN L G++P
Sbjct  283  KSLKSMDLSNNMLAGEIP  300



>ref|NP_001237715.1| receptor-like protein kinase 2 precursor [Glycine max]
 gb|AAF91323.1|AF244889_1 receptor-like protein kinase 2 [Glycine max]
Length=1012

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  381
            ++E  ALLS+++  T  +   L+SWN S  +C+W  VTCD+  HV +L+L+GL+LSG LS
Sbjct  25   ISEYRALLSLRSVITDATPPVLSSWNASIPYCSWLGVTCDNRRHVTALNLTGLDLSGTLS  84

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
             DV  LPFL NLS+AAN+ SGP+PP +SA+S LR+LNLSNN+F  TFP +L +L +L+VL
Sbjct  85   ADVAHLPFLSNLSLAANKFSGPIPPSLSALSGLRYLNLSNNVFNETFPSELWRLQSLEVL  144

Query  562  DLYNNNLTGDLPVEVYKM  615
            DLYNNN+TG LP+ V +M
Sbjct  145  DLYNNNMTGVLPLAVAQM  162


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+P++G L  L ++ ++ N LSG +P     +  +  LNL  N      P  + +L
Sbjct  272  LSGSLTPELGNLKSLKSMDLSNNMLSGEIPASFGELKNITLLNLFRNKLHGAIPEFIGEL  331

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+V+ L+ NNLTG +P
Sbjct  332  PALEVVQLWENNLTGSIP  349


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG ++P++ Q   L  L ++ N+LSG +P EI+ +  L +LNLS N    + P  ++ 
Sbjct  511  KFSGPIAPEISQCKLLTFLDLSRNELSGDIPNEITGMRILNYLNLSKNHLVGSIPSSISS  570

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  +D   NNL+G +P
Sbjct  571  MQSLTSVDFSYNNLSGLVP  589


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G +   +G+L  L  +  + N+ SGP+ PEIS    L FL+LS N      P+++  +
Sbjct  488  FTGRIPTQIGRLQQLSKIDFSGNKFSGPIAPEISQCKLLTFLDLSRNELSGDIPNEITGM  547

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G +P  +  M S
Sbjct  548  RILNYLNLSKNHLVGSIPSSISSMQS  573


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG LSP +G    +  L +  N  +G +P +I  +  L  ++ S N F      +++Q 
Sbjct  464  LSGALSPSIGNFSSVQKLLLDGNMFTGRIPTQIGRLQQLSKIDFSGNKFSGPIAPEISQC  523

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  LDL  N L+GD+P E+  M
Sbjct  524  KLLTFLDLSRNELSGDIPNEITGM  547


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +   +G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P    +L
Sbjct  248  LSGEIPAALGKLQKLDTLFLQVNALSGSLTPELGNLKSLKSMDLSNNMLSGEIPASFGEL  307

Query  544  ANLQVLDLYNNNLTGDLP  597
             N+ +L+L+ N L G +P
Sbjct  308  KNITLLNLFRNKLHGAIP  325


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 45/83 (54%), Gaps = 1/83 (1%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            N++GVL   V Q+  L +L +  N  SG +PPE      L++L +S N    T P ++  
Sbjct  150  NMTGVLPLAVAQMQNLRHLHLGGNFFSGQIPPEYGRWQRLQYLAVSGNELDGTIPPEIGN  209

Query  541  LANLQVLDL-YNNNLTGDLPVEV  606
            L +L+ L + Y N  TG +P E+
Sbjct  210  LTSLRELYIGYYNTYTGGIPPEI  232



>ref|XP_011021820.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Populus euphratica]
Length=1020

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 98/139 (71%), Gaps = 1/139 (1%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  378
            V+E  ALLSIK++ T D QS L++WN +   C+W  +TCD     V+      LNLSG L
Sbjct  28   VSEYEALLSIKSSITDDPQSFLSAWNSTAPLCSWTGITCDHTGRRVTSLDLSGLNLSGTL  87

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  558
            S D+  L +L NLS+A NQ SGP+P  +SA+++LR LNLSNNIF STFP QL+ L NLQV
Sbjct  88   SSDIAHLRYLQNLSLAVNQFSGPIPASLSAVTSLRSLNLSNNIFNSTFPPQLSSLKNLQV  147

Query  559  LDLYNNNLTGDLPVEVYKM  615
            LDLYNNN+TG LP+ V +M
Sbjct  148  LDLYNNNMTGGLPLTVVEM  166


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G+L  L  L +  N LSG +  E+ ++ +L+ ++LSNN+F    P   A+L
Sbjct  252  LSGQIPPEIGRLQKLDTLFLQVNGLSGSLTLELGSLKSLKSMDLSNNMFTGEIPTSFAEL  311

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  312  KNLTLLNLFRNKLYGAIP  329


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 46/87 (53%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG + P++G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P ++  
Sbjct  491  KFSGSIPPEIGRLQQLTKMDFSHNKFSGPIAPEISQCKLLTFVDLSRNELSGEIPTEITG  550

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            +  L  L+L  N+L G +P  +  M S
Sbjct  551  MRILNYLNLSRNHLVGSIPSPIATMQS  577


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG ++P++ Q   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  +A 
Sbjct  515  KFSGPIAPEISQCKLLTFVDLSRNELSGEIPTEITGMRILNYLNLSRNHLVGSIPSPIAT  574

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  +D   NNL+G +P
Sbjct  575  MQSLTSVDFSYNNLSGLVP  593


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G +     +L  L  L++  N+L G +P  I+ +  L+ L L  N F ST P  L Q 
Sbjct  300  FTGEIPTSFAELKNLTLLNLFRNKLYGAIPEFIAELPELQVLQLWENNFTSTIPQALGQN  359

Query  544  ANLQVLDLYNNNLTGDLP  597
              LQ+LDL +N LTG LP
Sbjct  360  GKLQILDLSSNKLTGTLP  377


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+ ++G L  L ++ ++ N  +G +P   + +  L  LNL  N      P  +A+L
Sbjct  276  LSGSLTLELGSLKSLKSMDLSNNMFTGEIPTSFAELKNLTLLNLFRNKLYGAIPEFIAEL  335

Query  544  ANLQVLDLYNNNLTGDLP  597
              LQVL L+ NN T  +P
Sbjct  336  PELQVLQLWENNFTSTIP  353



>ref|XP_002864974.1| hypothetical protein ARALYDRAFT_496807 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41233.1| hypothetical protein ARALYDRAFT_496807 [Arabidopsis lyrata subsp. 
lyrata]
Length=1003

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 100/144 (69%), Gaps = 5/144 (3%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLS  369
            ++E  ALLS+K++ T    D  S L+SW +STS CTW  VTCD     V+       NLS
Sbjct  23   ISEFRALLSLKSSLTGAGDDINSPLSSWKVSTSFCTWTGVTCDVSRRHVTSLDLSGLNLS  82

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LA  546
            G LSPDV  L  L NLS+A NQ+SGP+PPEIS++S LR LNLSNN+F  +FP +++  L 
Sbjct  83   GTLSPDVSHLRLLQNLSLADNQISGPIPPEISSLSGLRHLNLSNNVFNGSFPDEISSGLV  142

Query  547  NLQVLDLYNNNLTGDLPVEVYKMT  618
            NL+VLD+YNNNLTGDLPV V  +T
Sbjct  143  NLRVLDVYNNNLTGDLPVSVTNLT  166


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P++G+L  L  L +  N  SG +  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  251  LTGEIPPEIGKLQKLDTLFLQVNVFSGSLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  310

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G++P
Sbjct  311  KNLTLLNLFRNKLHGEIP  328


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  555
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N+F  +   +L  L++L+
Sbjct  231  LPPEIGNLSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGSLTWELGTLSSLK  290

Query  556  VLDLYNNNLTGDLP  597
             +DL NN  TG++P
Sbjct  291  SMDLSNNMFTGEIP  304


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 44/81 (54%), Gaps = 1/81 (1%)
 Frame = +1

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQLANL  552
            + P  G  P +  L+++ N+L G +PPEI  + TLR L +   N F    P ++  L+ L
Sbjct  182  IPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLKTLRELYIGYYNAFEDGLPPEIGNLSEL  241

Query  553  QVLDLYNNNLTGDLPVEVYKM  615
               D  N  LTG++P E+ K+
Sbjct  242  VRFDAANCGLTGEIPPEIGKL  262


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  ++ +
Sbjct  515  FSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGMKILNYLNLSRNNLVGSIPGSISSM  574

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  LD   NNL+G +P
Sbjct  575  QSLTSLDFSYNNLSGLVP  592


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 45/84 (54%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      ++++ 
Sbjct  467  LSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRC  526

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L+G++P E+  M
Sbjct  527  KLLTFVDLSRNELSGEIPNEITGM  550


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 43/86 (50%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
              G +  +VG+L  L  +  + N  SG + PEIS    L F++LS N      P+++  +
Sbjct  491  FEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGM  550

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  NNL G +P  +  M S
Sbjct  551  KILNYLNLSRNNLVGSIPGSISSMQS  576



>gb|KJB48795.1| hypothetical protein B456_008G087500 [Gossypium raimondii]
Length=1013

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 99/136 (73%), Gaps = 1/136 (1%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsld-lsglNLSGVL  378
            V+E  ALL++K++ T D QS L++WN +T  C++  VTCD     V+   LS  NLSG L
Sbjct  24   VSEFQALLAVKSSITDDPQSYLSNWNATTPLCSFTGVTCDYTGRHVTSLNLSYFNLSGTL  83

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  558
            SP    L FL N S+AANQL GP+P E++A+S LR+LNLSNN+F  +FP QL+QL NLQV
Sbjct  84   SPSFSHLQFLQNFSLAANQLYGPIPTELAALSALRYLNLSNNVFNGSFPTQLSQLKNLQV  143

Query  559  LDLYNNNLTGDLPVEV  606
            LDLYNNN+TG+LP+ V
Sbjct  144  LDLYNNNMTGELPISV  159


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   A L
Sbjct  248  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLESLKSMDLSNNMLAGEIPESFADL  307

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  308  KNLTLLNLFRNKLHGQIP  325


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+P++G L  L ++ ++ N L+G +P   + +  L  LNL  N      P  + +L
Sbjct  272  LSGSLTPELGTLESLKSMDLSNNMLAGEIPESFADLKNLTLLNLFRNKLHGQIPEFIGEL  331

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+VL L+ NN TG++P
Sbjct  332  PELEVLQLWENNFTGNIP  349


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 40/78 (51%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
              G L P++G L  LV    A   LSG +PPEI  +  L  L L  N    +   +L  L
Sbjct  224  FEGGLPPEIGNLSELVRFDAANCMLSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTL  283

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L+ +DL NN L G++P
Sbjct  284  ESLKSMDLSNNMLAGEIP  301


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P + +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  ++ +
Sbjct  513  FSGPVAPGISKCKLLTFVDLSRNELSGEIPTEITGMRILNYLNLSRNHLIGSIPSSISTM  572

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  573  QSLTSVDFSYNNLSGLVP  590



>ref|XP_006393995.1| hypothetical protein EUTSA_v10003584mg [Eutrema salsugineum]
 gb|ESQ31281.1| hypothetical protein EUTSA_v10003584mg [Eutrema salsugineum]
Length=1007

 Score =   142 bits (357),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 102/150 (68%), Gaps = 7/150 (5%)
 Frame = +1

Query  184  AGKPLGVTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls  354
            AG+P  ++E  AL+S+K++ T    D  S L SW  STS CTW  VTCD     V+    
Sbjct  19   AGRP--ISELHALISLKSSLTGAGEDPNSPLASWKSSTSFCTWTGVTCDISRRHVTSLDL  76

Query  355  gl-NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  531
               NLSG LSPDV +LP L NLS+A NQ+SGP+PPEIS +  LR LNLSNN+F  +FP +
Sbjct  77   SGLNLSGTLSPDVSRLPLLQNLSVADNQISGPIPPEISNLYGLRHLNLSNNVFNGSFPDE  136

Query  532  LAQ-LANLQVLDLYNNNLTGDLPVEVYKMT  618
            ++  L NL+VLD+YNNNLTGDLP+ V  +T
Sbjct  137  ISSGLVNLRVLDVYNNNLTGDLPLSVTNLT  166


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  251  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  310

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G++P
Sbjct  311  KNLTLLNLFRNKLHGEIP  328


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++     L  + ++ N+LSG +P EI+ +  L +LNLS N    T P  ++ +
Sbjct  515  FSGRIAPEISHCKLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGTIPGSISSM  574

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  LD   NNL+G +P
Sbjct  575  QSLTSLDFSYNNLSGLVP  592


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 44/84 (52%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      +++  
Sbjct  467  LSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISHC  526

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L+GD+P E+  M
Sbjct  527  KLLTFVDLSRNELSGDIPNEITGM  550


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 43/80 (54%), Gaps = 0/80 (0%)
 Frame = +1

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  555
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N+F      +L  L++L+
Sbjct  231  LPPEIGNLSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLK  290

Query  556  VLDLYNNNLTGDLPVEVYKM  615
             +DL NN  TG++P    ++
Sbjct  291  SMDLSNNMFTGEIPASFAEL  310


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 46/85 (54%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             +G +    G  P +  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  178  FAGQIPSSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  237

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L   D  N  LTG++P E+ K+
Sbjct  238  LSELVRFDAANCGLTGEIPPEIGKL  262



>ref|XP_010426489.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=1000

 Score =   142 bits (357),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 101/144 (70%), Gaps = 4/144 (3%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSL-TSWNIS-TSHCTWRRVTCdsllhvvsldlsg-lNLSG  372
            +TE  ALLS+K++ T D  S L TSWN+S T+ C+W  V CD     V+      LNLSG
Sbjct  23   ITELNALLSLKSSLTGDDHSPLLTSWNLSSTTFCSWTGVKCDVSRRHVTSLDLSGLNLSG  82

Query  373  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LAN  549
             LS DV  LP L NLS+AANQ+SGP+PPEIS +S LR LNLSNN+F  ++P +L+  L N
Sbjct  83   TLSSDVSHLPLLQNLSLAANQISGPIPPEISKLSELRLLNLSNNVFNGSYPDELSSGLVN  142

Query  550  LQVLDLYNNNLTGDLPVEVYKMTS  621
            L+VLDLYNNNLTGDLP+ +  +T 
Sbjct  143  LRVLDLYNNNLTGDLPLSITNLTE  166


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P++G+L  L  L +  N  +GP+  E+  IS+L+ ++LSNN+F    P   ++L
Sbjct  250  LTGAIPPEIGKLQNLDTLFLQVNAFAGPLTSELGLISSLKSMDLSNNMFTGEIPTSFSEL  309

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  310  KNLTLLNLFRNKLYGAIP  327


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 46/84 (55%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L   +G    +  L +  N+ +GP+PPEI  +  L  L+ S+N+F      ++++ 
Sbjct  466  LSGSLPAAIGNFSGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRC  525

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L+GD+P E+  M
Sbjct  526  KLLTFVDLSRNELSGDIPNEITGM  549


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G + P++G+L  L  L  + N  SG + PEIS    L F++LS N      P+++  +
Sbjct  490  FAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGDIPNEITGM  549

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G +PV +  M S
Sbjct  550  RILNYLNLSRNHLVGSIPVSIASMQS  575


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  +A +
Sbjct  514  FSGRIAPEISRCKLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGSIPVSIASM  573

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  574  QSLTSVDFSYNNLSGLVP  591


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 44/85 (52%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             SG +    G  P L  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  177  FSGKIPATYGTWPVLEYLAVSGNELIGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  236

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L  L   D  N  LTG +P E+ K+
Sbjct  237  LTELLRFDAANCGLTGAIPPEIGKL  261



>gb|KHG03710.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
 gb|KHG03906.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1013

 Score =   141 bits (356),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 95/136 (70%), Gaps = 1/136 (1%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLSGVL  378
            V E  ALL++K++ T D QS L++WN +   C++  VTCD     V+       NLSG L
Sbjct  24   VLEFQALLAVKSSITGDPQSYLSNWNATIPLCSFTGVTCDYTGRHVTSLDLSYFNLSGTL  83

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  558
            SP    L FL N S+AANQL GP+P E++A+S LR+LNLSNN+F  +FP QL+QL NLQV
Sbjct  84   SPSFSHLRFLQNFSLAANQLYGPIPTELAALSALRYLNLSNNVFNGSFPTQLSQLKNLQV  143

Query  559  LDLYNNNLTGDLPVEV  606
            LDLYNNN+TGDLP+ V
Sbjct  144  LDLYNNNMTGDLPISV  159


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   A L
Sbjct  248  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLKSLKSMDLSNNMLAGEIPESFADL  307

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  308  KNLTLLNLFRNKLHGQIP  325


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+P++G L  L ++ ++ N L+G +P   + +  L  LNL  N      P  + +L
Sbjct  272  LSGSLTPELGTLKSLKSMDLSNNMLAGEIPESFADLKNLTLLNLFRNKLHGQIPGFIGEL  331

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+VL L+ NN TG +P
Sbjct  332  PELEVLQLWENNFTGSIP  349


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 40/78 (51%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
              G L P++G L  LV    A   LSG +PPEI  +  L  L L  N    +   +L  L
Sbjct  224  FEGGLPPEIGNLSELVRFDAANCMLSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTL  283

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L+ +DL NN L G++P
Sbjct  284  KSLKSMDLSNNMLAGEIP  301


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG ++P + +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  ++ 
Sbjct  512  KFSGPVAPGISKCKLLTFVDLSRNELSGEIPTEITGMRILNYLNLSRNHLIGSIPSSIST  571

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  +D   NNL+G +P
Sbjct  572  MQSLTSVDFSYNNLSGLVP  590



>ref|XP_010444585.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1006

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 99/145 (68%), Gaps = 6/145 (4%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NL  366
            ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD     V+       NL
Sbjct  23   ISEFRALLSLKSSLTGAGSDDQNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDLSGLNL  82

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-L  543
            SG LSPDV  L  L NLS+A NQ+SGP+PPEIS +S LR LNLSNN+F  +FP +L+  L
Sbjct  83   SGTLSPDVSHLRLLQNLSLAENQISGPIPPEISILSGLRHLNLSNNVFNGSFPDELSSGL  142

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMT  618
             NL+VLD+YNNNLTGDLP+ V  +T
Sbjct  143  VNLRVLDVYNNNLTGDLPLSVTNLT  167


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  252  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  311

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G++P
Sbjct  312  KNLTLLNLFRNKLHGEIP  329


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             +G + P  G  P +  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  179  FAGKIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  238

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L  LD  N  LTG++P E+ K+
Sbjct  239  LSELVRLDGANCGLTGEIPPEIGKL  263


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  555
            L P++G L  LV L  A   L+G +PPEI  +  L  L L  N+F      +L  L++L+
Sbjct  232  LPPEIGNLSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLK  291

Query  556  VLDLYNNNLTGDLP  597
             +DL NN  TG++P
Sbjct  292  SMDLSNNMFTGEIP  305


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  ++ +
Sbjct  516  FSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLLGSIPGSISSM  575

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  LD   NNL+G +P
Sbjct  576  QSLTSLDFSYNNLSGLVP  593



>ref|XP_010484412.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1005

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 99/145 (68%), Gaps = 6/145 (4%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NL  366
            ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD     V+       NL
Sbjct  23   ISEFRALLSLKSSLTGAGTDDQNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDLSGLNL  82

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-L  543
            SG LSPDV  L  L NLS+A NQ+SGP+PPEIS +S LR LNLSNN+F  +FP +L+  L
Sbjct  83   SGTLSPDVSHLRLLQNLSLAENQISGPIPPEISILSGLRHLNLSNNVFNGSFPDELSSGL  142

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMT  618
             NL+VLD+YNNNLTGDLP+ V  +T
Sbjct  143  VNLRVLDVYNNNLTGDLPLSVTNLT  167


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  252  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  311

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G++P
Sbjct  312  KNLTLLNLFRNKLHGEIP  329


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             +G + P  G  P +  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  179  FAGKIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  238

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L  LD  N  LTG++P E+ K+
Sbjct  239  LSELVRLDGANCGLTGEIPPEIGKL  263


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  555
            L P++G L  LV L  A   L+G +PPEI  +  L  L L  N+F      +L  L++L+
Sbjct  232  LPPEIGNLSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLK  291

Query  556  VLDLYNNNLTGDLP  597
             +DL NN  TG++P
Sbjct  292  SMDLSNNMFTGEIP  305


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  ++ +
Sbjct  516  FSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLLGSIPGSISSM  575

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  LD   NNL+G +P
Sbjct  576  QSLTSLDFSYNNLSGLVP  593



>ref|XP_010463501.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1006

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 99/145 (68%), Gaps = 6/145 (4%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NL  366
            ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD     V+       NL
Sbjct  23   ISEFRALLSLKSSLTGAGTDDKNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDLSGLNL  82

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-L  543
            SG LSPDV  L  L NLS+A NQ+SGP+PPEIS +S LR LNLSNN+F  +FP +L+  L
Sbjct  83   SGTLSPDVSHLRLLQNLSLAENQISGPIPPEISNLSGLRHLNLSNNVFNGSFPDELSSGL  142

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMT  618
             NL+VLD+YNNNLTGDLP+ V  +T
Sbjct  143  VNLRVLDVYNNNLTGDLPLSVTNLT  167


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P++G+L  L  L +  N  SGP+  E+ ++S+L+ ++LSNN+F    P   A+L
Sbjct  252  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGSLSSLKSMDLSNNMFTGEIPTSFAEL  311

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G++P
Sbjct  312  KNLTLLNLFRNKLHGEIP  329


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 49/85 (58%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             +G + P  G  P +  L+++ N+L G +PPEI  ++TLR L +   N F +  P ++  
Sbjct  179  FAGKIPPLYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFENGLPPEIGN  238

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L  LD  N  LTG++P E+ K+
Sbjct  239  LSELVRLDGANCGLTGEIPPEIGKL  263


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = +1

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  555
            L P++G L  LV L  A   L+G +PPEI  +  L  L L  N+F      +L  L++L+
Sbjct  232  LPPEIGNLSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGSLSSLK  291

Query  556  VLDLYNNNLTGDLPVEVYKM  615
             +DL NN  TG++P    ++
Sbjct  292  SMDLSNNMFTGEIPTSFAEL  311


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  ++ +
Sbjct  516  FSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLLGSIPGSISSM  575

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  LD   NNL+G +P
Sbjct  576  QSLTSLDFSYNNLSGLVP  593



>ref|XP_010515326.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=1000

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 102/143 (71%), Gaps = 4/143 (3%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSL-TSWNISTS-HCTWRRVTCdsllhvvsldlsg-lNLSG  372
            +TE  ALLS+K++ T D  S L +SWN+ST+  C+W  VTCD     V+      LNLSG
Sbjct  23   ITEFNALLSLKSSLTGDDHSPLLSSWNLSTTTFCSWTGVTCDVSRRHVTSLDLSGLNLSG  82

Query  373  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LAN  549
             LS DV  LP L NLS+AANQ+SGP+PPEIS +S LR LNLSNN+F  ++P +L+  L N
Sbjct  83   TLSSDVSHLPLLQNLSLAANQISGPIPPEISNLSELRLLNLSNNVFNGSYPDELSSGLVN  142

Query  550  LQVLDLYNNNLTGDLPVEVYKMT  618
            L+VLDLYNNNLTGDLP+ +  +T
Sbjct  143  LRVLDLYNNNLTGDLPLSITNLT  165


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P++G+L  L  L +  N  SGP+  E+  IS+L+ ++LSNN+F    P   ++L
Sbjct  250  LTGAIPPEIGKLQNLDTLFLQVNAFSGPLTSELGLISSLKSMDLSNNMFTGEIPTSFSEL  309

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  310  KNLTLLNLFRNKLYGAIP  327


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G + PD+G+L  L  L  + N  SG + PEIS    L F++LS N      P+++  +
Sbjct  490  FTGPIPPDIGRLQQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGDIPNEITGM  549

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G +PV +  M S
Sbjct  550  RILNYLNLSRNHLVGSIPVSIASMQS  575


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 46/84 (55%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L   +G    +  L +  N+ +GP+PP+I  +  L  L+ S+N+F      ++++ 
Sbjct  466  LSGSLPAAIGNFSGVQKLLLDGNKFTGPIPPDIGRLQQLSKLDFSHNLFSGRIAPEISRC  525

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L+GD+P E+  M
Sbjct  526  KLLTFVDLSRNELSGDIPNEITGM  549


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 45/85 (53%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             SG +    G  P L  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  177  FSGKIPATYGTWPVLEYLAVSGNELTGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  236

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L  L   D  N  LTG +P E+ K+
Sbjct  237  LTELLRFDAANCGLTGAIPPEIGKL  261


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  +A +
Sbjct  514  FSGRIAPEISRCKLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGSIPVSIASM  573

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  574  QSLTSVDFSYNNLSGLVP  591



>gb|KJB18115.1| hypothetical protein B456_003G034500 [Gossypium raimondii]
Length=1014

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 99/139 (71%), Gaps = 1/139 (1%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  378
            VTE  AL+++K++ T D QS L++WN ST  C++  VTCD     V+      + L+G L
Sbjct  27   VTELRALIAVKSSITDDPQSYLSNWNASTPLCSFAGVTCDLTGRHVTSIDLTNVTLAGTL  86

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  558
            SP +  L FL NLS+A N LSGP+P E++ +S LR+LNLSNN+F  +FP QL+QL NLQ+
Sbjct  87   SPSLAHLRFLQNLSVAGNDLSGPIPTELAVLSNLRYLNLSNNVFNGSFPTQLSQLKNLQI  146

Query  559  LDLYNNNLTGDLPVEVYKM  615
            LDLYNNN+TG+LPV V ++
Sbjct  147  LDLYNNNMTGELPVSVTEL  165


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G+L  L  L +  N LSG + PE+  +++L+ ++LSNN+F    P   AQL
Sbjct  251  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLNSLKSMDLSNNMFTGEIPASFAQL  310

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  311  KNLTLLNLFRNKLHGRIP  328


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
             LSG++ P++ +   L  + ++ N+LSG +P EI+++  L +LNLS N    + P  ++ 
Sbjct  515  KLSGLIPPEICKCKLLTFVDLSGNELSGRIPTEITSMRILNYLNLSRNHLLGSIPSSIST  574

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  +D   NNL+G +P
Sbjct  575  MQSLTSVDFSYNNLSGLVP  593


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 45/87 (52%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG +  ++G+L  L  +  + N+LSG +PPEI     L F++LS N      P ++  
Sbjct  491  KFSGPIPAEIGKLQQLSKIDFSHNKLSGLIPPEICKCKLLTFVDLSGNELSGRIPTEITS  550

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            +  L  L+L  N+L G +P  +  M S
Sbjct  551  MRILNYLNLSRNHLLGSIPSSISTMQS  577


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L   VG    +  L +  N+ SGP+P EI  +  L  ++ S+N      P ++ + 
Sbjct  468  LSGALPASVGNFSGVQKLLLDGNKFSGPIPAEIGKLQQLSKIDFSHNKLSGLIPPEICKC  527

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L+G +P E+  M
Sbjct  528  KLLTFVDLSGNELSGRIPTEITSM  551



>gb|KJB18113.1| hypothetical protein B456_003G034400 [Gossypium raimondii]
 gb|KJB18114.1| hypothetical protein B456_003G034400 [Gossypium raimondii]
Length=1026

 Score =   139 bits (351),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 99/139 (71%), Gaps = 1/139 (1%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLSGVL  378
            VTE +AL+++K++ T D QS L++WN +T  C++  V CD     V+        LSG L
Sbjct  27   VTELSALIAVKSSITDDPQSYLSNWNANTPLCSFAGVACDLTGRHVTSIDLTNFTLSGTL  86

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  558
            SP +  L FL NLS+AAN LSGP+P E++ +S LR+LNLSNN+F  +FP QL+QL NLQ+
Sbjct  87   SPSLAHLRFLQNLSVAANDLSGPIPTELAVLSNLRYLNLSNNVFNGSFPTQLSQLKNLQI  146

Query  559  LDLYNNNLTGDLPVEVYKM  615
            LDLYNNN+TG+LPV V ++
Sbjct  147  LDLYNNNMTGELPVSVTEL  165


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P+VG+L  L  L +  N LSG + PE+  +++L+ ++LSNN+F    P   AQL
Sbjct  251  LSGEIPPEVGKLQRLHTLFLQVNALSGSLTPELGTLNSLKSMDLSNNMFTGEIPASFAQL  310

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  311  KNLTLLNLFRNKLHGQIP  328


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L   VG    +  L +  N+ SGP+P EI  +  L  ++ S+N F    P ++ + 
Sbjct  468  LSGALPASVGNFSGVQKLLLDGNKFSGPIPAEIGKLQQLSKIDFSHNKFSGLIPPEICKC  527

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L+G +P E+  M
Sbjct  528  KLLTFVDLSRNELSGQIPTEITSM  551


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG++ P++ +   L  + ++ N+LSG +P EI+++  L +LNLS N    + P  ++ 
Sbjct  515  KFSGLIPPEICKCKLLTFVDLSRNELSGQIPTEITSMRILNYLNLSRNHLLGSIPSSIST  574

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  +D   NNL+G +P
Sbjct  575  MQSLTSVDFSYNNLSGLVP  593



>ref|NP_201371.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Arabidopsis thaliana]
 ref|NP_001190624.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Arabidopsis thaliana]
 sp|O49545.1|BAME1_ARATH RecName: Full=Leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1; AltName: Full=Protein BARELY ANY MERISTEM 
1; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA16688.1| receptor protein kinase - like protein [Arabidopsis thaliana]
 dbj|BAB10677.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAM20665.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAP68249.1| At5g65700 [Arabidopsis thaliana]
 dbj|BAE98627.1| receptor protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59407.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED98091.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
 gb|AED98092.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
Length=1003

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 98/144 (68%), Gaps = 5/144 (3%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLS  369
            ++E  ALLS+K + T    D  S L+SW +STS CTW  VTCD     V+       NLS
Sbjct  23   ISEFRALLSLKTSLTGAGDDKNSPLSSWKVSTSFCTWIGVTCDVSRRHVTSLDLSGLNLS  82

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LA  546
            G LSPDV  L  L NLS+A N +SGP+PPEIS++S LR LNLSNN+F  +FP +++  L 
Sbjct  83   GTLSPDVSHLRLLQNLSLAENLISGPIPPEISSLSGLRHLNLSNNVFNGSFPDEISSGLV  142

Query  547  NLQVLDLYNNNLTGDLPVEVYKMT  618
            NL+VLD+YNNNLTGDLPV V  +T
Sbjct  143  NLRVLDVYNNNLTGDLPVSVTNLT  166


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  251  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  310

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G++P
Sbjct  311  KNLTLLNLFRNKLHGEIP  328


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             +G + P  G  P +  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  178  FAGKIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  237

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L   D  N  LTG++P E+ K+
Sbjct  238  LSELVRFDGANCGLTGEIPPEIGKL  262


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ +   L  + ++ N+LSG +P EI+A+  L +LNLS N    + P  ++ +
Sbjct  515  FSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITAMKILNYLNLSRNHLVGSIPGSISSM  574

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  LD   NNL+G +P
Sbjct  575  QSLTSLDFSYNNLSGLVP  592


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  555
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N+F      +L  L++L+
Sbjct  231  LPPEIGNLSELVRFDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLK  290

Query  556  VLDLYNNNLTGDLP  597
             +DL NN  TG++P
Sbjct  291  SMDLSNNMFTGEIP  304


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 45/84 (54%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      ++++ 
Sbjct  467  LSGPLPPAIGNFTGVQKLLLDGNKFQGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRC  526

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L+G++P E+  M
Sbjct  527  KLLTFVDLSRNELSGEIPNEITAM  550



>ref|XP_006279943.1| hypothetical protein CARUB_v10025808mg [Capsella rubella]
 gb|EOA12841.1| hypothetical protein CARUB_v10025808mg [Capsella rubella]
Length=1004

 Score =   139 bits (349),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 98/145 (68%), Gaps = 6/145 (4%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NL  366
            ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD     V+       NL
Sbjct  23   ISEFRALLSLKSSLTGAGSDDKNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDLSGLNL  82

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-L  543
            SG LSPDV  L  L NLS+A NQ+SGP+P EIS +S LR LNLSNN+F  +FP +L+  L
Sbjct  83   SGTLSPDVSHLRLLQNLSLAENQISGPIPTEISNLSGLRHLNLSNNVFNGSFPDELSYGL  142

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMT  618
             NL+VLD+YNNNLTGDLPV V  +T
Sbjct  143  VNLRVLDVYNNNLTGDLPVSVTNLT  167


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  252  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  311

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G++P
Sbjct  312  KNLTLLNLFRNKLHGEIP  329


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 49/85 (58%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             +G + P  G  P +  L+++ N+L G +PPEI  ++TLR L +   N F +  P ++  
Sbjct  179  FAGKIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFENGLPPEIGN  238

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L  LD  N  LTG++P E+ K+
Sbjct  239  LSELVRLDGANCGLTGEIPPEIGKL  263


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  ++ +
Sbjct  516  FSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGMKILNYLNLSRNHLVGSIPGSISSM  575

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  LD   NNL+G +P
Sbjct  576  QSLTSLDFSYNNLSGLVP  593


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  555
            L P++G L  LV L  A   L+G +PPEI  +  L  L L  N+F      +L  L++L+
Sbjct  232  LPPEIGNLSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLK  291

Query  556  VLDLYNNNLTGDLP  597
             +DL NN  TG++P
Sbjct  292  SMDLSNNMFTGEIP  305


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 45/84 (54%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      ++++ 
Sbjct  468  LSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRC  527

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L+G++P E+  M
Sbjct  528  KLLTFVDLSRNELSGEIPNEITGM  551



>ref|XP_004143422.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 ref|XP_004163335.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 gb|KGN48657.1| hypothetical protein Csa_6G497080 [Cucumis sativus]
Length=1019

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  381
            V+E  ALLS+K + T D +SSL SWN STSHCTW  VTCD   HV +LDL+ L LSG LS
Sbjct  26   VSEYRALLSLKTSITGDPKSSLASWNASTSHCTWFGVTCDLRRHVTALDLTALGLSGSLS  85

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            PDV  L FL NLS+AAN+ SGP+PPE+S+IS+LR LNLSNN+F  +FP + +QL NL VL
Sbjct  86   PDVAFLRFLTNLSLAANEFSGPIPPELSSISSLRLLNLSNNVFDGSFPSRFSQLQNLHVL  145

Query  562  DLYNNNLTGDLPVEVYKMT  618
            DLYNNN+TGD P+ V +M+
Sbjct  146  DLYNNNMTGDFPIVVTQMS  164


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G+L  L  L +  N LSGP+ PEI  +++L+ L+LSNN+     P   AQL
Sbjct  249  LSGRIPPELGKLQNLDTLFLQVNALSGPLTPEIGQLNSLKSLDLSNNMLVGEIPVSFAQL  308

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  309  KNLTLLNLFRNKLHGAIP  326


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 48/87 (55%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG + P++G+L  L  +  ++N LSGP+ PEIS    L F++LS N      P+++  
Sbjct  488  KFSGQIPPEIGRLQQLSKIDFSSNMLSGPIAPEISQCKLLTFVDLSRNQLSGEIPNEITS  547

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            +  L  L+L  N+L G +P  +  M S
Sbjct  548  MRILNYLNLSKNHLVGGIPATIASMQS  574


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG ++P++ Q   L  + ++ NQLSG +P EI+++  L +LNLS N      P  +A +
Sbjct  513  LSGPIAPEISQCKLLTFVDLSRNQLSGEIPNEITSMRILNYLNLSKNHLVGGIPATIASM  572

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  573  QSLTSVDFSYNNLSGLVP  590


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 50/85 (59%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  540
             +G + P+VG++  L  L+++ N+LSG +PPE+  ++ LR L +   N +    P ++  
Sbjct  176  FAGRIPPEVGRMQSLEYLAVSGNELSGSIPPELGNLTNLRELYIGYFNAYDGGLPAEIGN  235

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L  LD  N  L+G +P E+ K+
Sbjct  236  LSQLVRLDAANCGLSGRIPPELGKL  260


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 44/83 (53%), Gaps = 0/83 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+P++GQL  L +L ++ N L G +P   + +  L  LNL  N      P  +  L
Sbjct  273  LSGPLTPEIGQLNSLKSLDLSNNMLVGEIPVSFAQLKNLTLLNLFRNKLHGAIPSFIGDL  332

Query  544  ANLQVLDLYNNNLTGDLPVEVYK  612
              L+VL L+ NN T  +P  + K
Sbjct  333  PKLEVLQLWENNFTEAIPQNLGK  355


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +1

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  549
            G L  ++G L  LV L  A   LSG +PPE+  +  L  L L  N        ++ QL +
Sbjct  227  GGLPAEIGNLSQLVRLDAANCGLSGRIPPELGKLQNLDTLFLQVNALSGPLTPEIGQLNS  286

Query  550  LQVLDLYNNNLTGDLPVEVYKM  615
            L+ LDL NN L G++PV   ++
Sbjct  287  LKSLDLSNNMLVGEIPVSFAQL  308



>ref|NP_001235065.1| receptor-like protein kinase 1 precursor [Glycine max]
 gb|AAF91322.1|AF244888_1 receptor-like protein kinase 1 [Glycine max]
Length=1008

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 104/139 (75%), Gaps = 1/139 (1%)
 Frame = +1

Query  202  VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  378
            ++E  ALLS KA+  T D   +L+SWN ST  C+W  +TCDS  HV SL+L+ L+LSG L
Sbjct  19   ISEYRALLSFKASSLTDDPTHALSSWNSSTPFCSWFGLTCDSRRHVTSLNLTSLSLSGTL  78

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  558
            S D+  LPFL +LS+A N+ SGP+P   SA+S LRFLNLSNN+F +TFP QL +LANL+V
Sbjct  79   SDDLSHLPFLSHLSLADNKFSGPIPASFSALSALRFLNLSNNVFNATFPSQLNRLANLEV  138

Query  559  LDLYNNNLTGDLPVEVYKM  615
            LDLYNNN+TG+LP+ V  M
Sbjct  139  LDLYNNNMTGELPLSVAAM  157


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+P++G L  L ++ ++ N LSG VP   + +  L  LNL  N      P  + +L
Sbjct  267  LSGSLTPELGSLKSLKSMDLSNNMLSGEVPASFAELKNLTLLNLFRNKLHGAIPEFVGEL  326

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+VL L+ NN TG +P
Sbjct  327  PALEVLQLWENNFTGSIP  344


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +  ++G+L  L  L +  N LSG + PE+ ++ +L+ ++LSNN+     P   A+L
Sbjct  243  LSGEIPAELGKLQNLDTLFLQVNALSGSLTPELGSLKSLKSMDLSNNMLSGEVPASFAEL  302

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  303  KNLTLLNLFRNKLHGAIP  320


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G + P +G L  L  +  + N+ SGP+ PEIS    L F++LS N      P+++  +
Sbjct  483  FTGRIPPQIGMLQQLSKIDFSHNKFSGPIAPEISKCKLLTFIDLSGNELSGEIPNKITSM  542

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G +P  +  M S
Sbjct  543  RILNYLNLSRNHLDGSIPGNIASMQS  568


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ +   L  + ++ N+LSG +P +I+++  L +LNLS N    + P  +A +
Sbjct  507  FSGPIAPEISKCKLLTFIDLSGNELSGEIPNKITSMRILNYLNLSRNHLDGSIPGNIASM  566

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NN +G +P
Sbjct  567  QSLTSVDFSYNNFSGLVP  584



>gb|KDP32143.1| hypothetical protein JCGZ_12604 [Jatropha curcas]
Length=1013

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 105/139 (76%), Gaps = 2/139 (1%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCd-sllhvvsldlsglNLSGVL  378
            ++E  ALLS+KAA   D QS+L SWN S S C+W  VTCD S  HV SLDLS LNLSG+L
Sbjct  23   MSEYQALLSVKAAID-DPQSALVSWNSSNSLCSWSGVTCDPSGRHVTSLDLSSLNLSGIL  81

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  558
            S D+  L +L NL++AANQLSGP+PP++SAI  LR LNLSNN+F  TFP QL+QL NLQV
Sbjct  82   SSDIAHLRYLQNLTLAANQLSGPIPPQLSAIPGLRSLNLSNNVFNGTFPSQLSQLKNLQV  141

Query  559  LDLYNNNLTGDLPVEVYKM  615
            LDLYNNN+T  LP+ V  M
Sbjct  142  LDLYNNNMTDVLPLAVTDM  160


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG + P +G+L  L  +  ++N+ SGP+ PEIS    L F++LS N      P ++  +
Sbjct  486  FSGAIPPQIGRLQQLSKMDFSSNKFSGPITPEISQCKLLTFVDLSRNELSGAIPTEITGM  545

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G +P  +  M S
Sbjct  546  RILNYLNLSRNHLIGSIPSSIATMQS  571


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ Q   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  +A +
Sbjct  510  FSGPITPEISQCKLLTFVDLSRNELSGAIPTEITGMRILNYLNLSRNHLIGSIPSSIATM  569

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNLTG +P
Sbjct  570  QSLTSVDFSYNNLTGLVP  587


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 50/85 (59%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             SG + P+ G+  FL  L+I+ N+L GP+PPEI  ++ L+ L +   N +    P ++  
Sbjct  173  FSGKIPPEYGKWEFLEYLAISGNELVGPIPPEIGNLTRLQQLYIGYYNSYEGGLPPEIGN  232

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L++L   D  N  L+G++P E+ K+
Sbjct  233  LSDLVRFDAANCMLSGEIPKEIGKL  257


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+ ++G L  L ++ ++ N L+G +P   S +  L  LNL  N      P  +  L
Sbjct  270  LSGSLTEELGNLKSLKSMDLSNNMLTGEIPSSFSELKNLTLLNLFRNKLYGAIPEFIGDL  329

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+VL L+ NN TG +P
Sbjct  330  PKLEVLQLWENNFTGSIP  347


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 44/84 (52%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L P +G    +  L +  N+ SG +PP+I  +  L  ++ S+N F      +++Q 
Sbjct  462  LSGSLPPSIGNFSGVQKLLLDGNKFSGAIPPQIGRLQQLSKMDFSSNKFSGPITPEISQC  521

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L+G +P E+  M
Sbjct  522  KLLTFVDLSRNELSGAIPTEITGM  545


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P   ++L
Sbjct  246  LSGEIPKEIGKLQKLDTLFLQVNGLSGSLTEELGNLKSLKSMDLSNNMLTGEIPSSFSEL  305

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  306  KNLTLLNLFRNKLYGAIP  323


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 40/77 (52%), Gaps = 0/77 (0%)
 Frame = +1

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  546
             G L P++G L  LV    A   LSG +P EI  +  L  L L  N    +   +L  L 
Sbjct  223  EGGLPPEIGNLSDLVRFDAANCMLSGEIPKEIGKLQKLDTLFLQVNGLSGSLTEELGNLK  282

Query  547  NLQVLDLYNNNLTGDLP  597
            +L+ +DL NN LTG++P
Sbjct  283  SLKSMDLSNNMLTGEIP  299



>gb|KHG04200.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1014

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 98/139 (71%), Gaps = 1/139 (1%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLSGVL  378
            VTE  AL+++K++ T D QS L++WN +T  C++  VTCD     V+        LSG L
Sbjct  27   VTELRALIAVKSSITDDPQSYLSNWNATTPLCSFAGVTCDLTGRHVTSIDLTNFTLSGTL  86

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  558
            SP +  L FL NLS+A N L+GP+P E++ +S LR+LNLSNN+F  +FP QL+QL NLQV
Sbjct  87   SPSLAHLRFLQNLSVADNNLTGPIPTELAVLSNLRYLNLSNNVFNGSFPTQLSQLKNLQV  146

Query  559  LDLYNNNLTGDLPVEVYKM  615
            LDLYNNN+TG+LPV V ++
Sbjct  147  LDLYNNNMTGELPVSVTEL  165


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G+L  L  L +  N LSG + PE+  +++L+ ++LSNN+F    P   AQL
Sbjct  251  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLNSLKSMDLSNNMFTGEIPASFAQL  310

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  311  KNLTLLNLFRNKLHGQIP  328


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L   +G    +  L +  N+ SGP+P EI  +  L  ++ S+N F    P ++ + 
Sbjct  468  LSGALPASIGNFSGVQKLLLDGNKFSGPIPAEIGTLQQLSKIDFSHNKFSGLIPPEICKC  527

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L+G +P E+  M
Sbjct  528  ELLTFVDLSRNELSGRIPTEITSM  551


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG++ P++ +   L  + ++ N+LSG +P EI+++  L FLNLS N    + P  ++ +
Sbjct  516  FSGLIPPEICKCELLTFVDLSRNELSGRIPTEITSMRILNFLNLSRNHLLGSIPSSISTM  575

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  576  QSLTSVDFSYNNLSGLVP  593



>ref|XP_009150662.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brassica rapa]
Length=997

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 106/142 (75%), Gaps = 3/142 (2%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSS-LTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGV  375
            ++E  ALLS+K++ T D+ +S L SW  +TS CTW  VTCD     V SLDLS LNLSG 
Sbjct  23   ISEFRALLSLKSSLTGDAPNSPLASWKPTTSFCTWTGVTCDVSRRHVTSLDLSSLNLSGT  82

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLANL  552
            LSPDV  LP L NLS+A NQ+SGP+PPEIS +S LR LNLSNNIF  +FP ++ A LANL
Sbjct  83   LSPDVSHLPLLQNLSLADNQISGPIPPEISNLSGLRHLNLSNNIFNGSFPGEISAGLANL  142

Query  553  QVLDLYNNNLTGDLPVEVYKMT  618
            +VLD+YNNN+TGDLP+ V  +T
Sbjct  143  RVLDVYNNNMTGDLPLSVTNLT  164


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   + L
Sbjct  249  LNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNNMFTGEIPASFSDL  308

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G++P
Sbjct  309  KNLTLLNLFRNKLHGEIP  326


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  ++ +
Sbjct  513  FSGGIAPEISRCKLLTFVDLSRNELSGEIPKEITGMKILNYLNLSRNHLIGSIPGSISSM  572

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  LD   NNL+G +P
Sbjct  573  QSLTSLDFSYNNLSGLVP  590


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  555
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N+F      +L +L++L+
Sbjct  229  LPPEIGNLSELVRFDAANCALNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLK  288

Query  556  VLDLYNNNLTGDLP  597
             +DL NN  TG++P
Sbjct  289  SMDLSNNMFTGEIP  302


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 45/84 (54%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      ++++ 
Sbjct  465  LSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGRLQQLSKIDFSHNLFSGGIAPEISRC  524

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L+G++P E+  M
Sbjct  525  KLLTFVDLSRNELSGEIPKEITGM  548


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  540
             +G + P  G  P +  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  176  FAGEIPPSYGTWPEIEYLAVSGNELTGKIPPEIGNLTTLRELYIGYFNAFEDGLPPEIGN  235

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L   D  N  L G++P E+ ++
Sbjct  236  LSELVRFDAANCALNGEIPPEIGRL  260


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG L+ ++G+L  L ++ ++ N  +G +P   S +  L  LNL  N      P  + +L
Sbjct  273  FSGPLTWELGKLSSLKSMDLSNNMFTGEIPASFSDLKNLTLLNLFRNKLHGEIPEFIGEL  332

Query  544  ANLQVLDLYNNNLTGDLPVEV  606
             +L+VL L+ NN TG +P ++
Sbjct  333  PDLEVLQLWENNFTGSIPEKL  353



>ref|XP_010547579.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Tarenaya hassleriana]
Length=1015

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 101/150 (67%), Gaps = 8/150 (5%)
 Frame = +1

Query  187  GKPLGVTEQAALLSIKAAFTADSQ----SSLTSWNISTSHCTWRRVTCdsllhvvsldls  354
            G+P  ++E  ALLSIK++ +        S L +WN ST+ C W  VTCD+    V     
Sbjct  22   GRP--ISEFRALLSIKSSLSGAGDGPNSSPLATWNDSTTFCAWTGVTCDASGRHVISLDL  79

Query  355  gl-NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  531
               NLSG LSPD+  L  L NLS+A+NQ+SGP+PPE+S++S LR+LNLSNN+F  +FP +
Sbjct  80   SGLNLSGTLSPDIAHLFLLQNLSVASNQISGPIPPEVSSLSGLRYLNLSNNVFNGSFPDE  139

Query  532  L-AQLANLQVLDLYNNNLTGDLPVEVYKMT  618
            L A   NL+VLDLYNNNLTGDLPV V  +T
Sbjct  140  LSAGAVNLRVLDLYNNNLTGDLPVSVTNLT  169


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P+VG+L  L  L +  N LSGP+  E+  +S+L+ ++LSNN+F    P   AQL
Sbjct  254  LTGKIPPEVGKLQKLDTLFLQVNALSGPLTTELGTLSSLKSMDLSNNMFTGEIPASFAQL  313

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  314  KNLTLLNLFRNKLHGAIP  331


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 47/87 (54%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              +G + P VG+L  L  + I+ NQLSG + PEIS    L F++LS N      P+++  
Sbjct  493  KFTGPIPPQVGKLQQLSKMDISHNQLSGRIAPEISQCKLLTFVDLSRNELSGEIPNEITG  552

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            +  L  L+L  N+L G +P  V  M S
Sbjct  553  MRILNYLNLSRNHLVGPIPASVASMQS  579


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 46/85 (54%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             +G + P  G  P L  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  181  FAGRIPPAYGSWPVLEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  240

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L   D  N  LTG +P EV K+
Sbjct  241  LSELVRFDAANCGLTGKIPPEVGKL  265


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG ++P++ Q   L  + ++ N+LSG +P EI+ +  L +LNLS N      P  +A +
Sbjct  518  LSGRIAPEISQCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLVGPIPASVASM  577

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  578  QSLTSVDFSYNNLSGLVP  595


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 46/84 (55%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L P +G    +  L +  N+ +GP+PP++  +  L  +++S+N        +++Q 
Sbjct  470  LSGPLPPAIGNFYGVQKLLLDGNKFTGPIPPQVGKLQQLSKMDISHNQLSGRIAPEISQC  529

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L+G++P E+  M
Sbjct  530  KLLTFVDLSRNELSGEIPNEITGM  553



>ref|XP_004509039.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cicer arietinum]
Length=1005

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 99/140 (71%), Gaps = 2/140 (1%)
 Frame = +1

Query  202  VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCds-llhvvsldlsglNLSGV  375
            ++E   LLS K++  T D   SL SWN ST+HC+W  +TC     HV S+DLS L L+  
Sbjct  22   ISEHKTLLSFKSSSITDDPTHSLISWNSSTTHCSWHGITCTGPHRHVTSIDLSSLTLTAT  81

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  555
            LS  +  LPFL NLS+A N+ SGP+PP  S++ +LRFLNLSNN+F  TFP QL++L+NL 
Sbjct  82   LSDHLSNLPFLSNLSLADNKFSGPIPPSFSSLYSLRFLNLSNNVFNGTFPSQLSRLSNLH  141

Query  556  VLDLYNNNLTGDLPVEVYKM  615
            VLDLYNNN+TG LP+ V +M
Sbjct  142  VLDLYNNNMTGTLPLSVTRM  161


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN F    P   A+L
Sbjct  247  LTGEIPPELGKLQNLDTLFLQVNALSGSLTPELGNLKSLKSMDLSNNAFDGEVPASFAEL  306

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
             NL +L+L+ N L G +P  + +M
Sbjct  307  KNLTLLNLFRNKLHGAIPEFIGEM  330


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 49/85 (58%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             +G + P+ G  P L  L+++ N+LSGP+PPEI  +++LR L +   N +    P ++  
Sbjct  174  FTGKIPPEYGTWPHLEYLAVSGNELSGPIPPEIGNLTSLRELYIGYYNTYDGGIPPEIGN  233

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ +   D     LTG++P E+ K+
Sbjct  234  LSAMVRFDAAYCGLTGEIPPELGKL  258


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG ++P++     L  + ++ N+LSG +P EI+ +  L +LNLS N    T P  +A 
Sbjct  510  KFSGPIAPEISHCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLVGTIPGSIAS  569

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  +D   NNLTG +P
Sbjct  570  MQSLTSVDFSYNNLTGLVP  588


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G +  ++G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P+++  +
Sbjct  487  FTGKIPSEIGKLQQLSKIDFSHNKFSGPIAPEISHCKLLTFVDLSRNELSGEIPNEITGM  546

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G +P  +  M S
Sbjct  547  RILNYLNLSRNHLVGTIPGSIASMQS  572


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 44/83 (53%), Gaps = 0/83 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+P++G L  L ++ ++ N   G VP   + +  L  LNL  N      P  + ++
Sbjct  271  LSGSLTPELGNLKSLKSMDLSNNAFDGEVPASFAELKNLTLLNLFRNKLHGAIPEFIGEM  330

Query  544  ANLQVLDLYNNNLTGDLPVEVYK  612
              L+VL ++ NN TG +P  + K
Sbjct  331  PALEVLQIWENNFTGSIPQSLGK  353



>ref|XP_010683073.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Beta vulgaris subsp. vulgaris]
Length=1009

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 93/144 (65%), Gaps = 6/144 (4%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl------NLS  369
            EQ ALL IK+A T D QSSL+SWN ST HCTW  + C S   +              NL+
Sbjct  24   EQKALLGIKSAITDDPQSSLSSWNTSTHHCTWDFIKCSSSSSLNHHQSVVSLNISGLNLT  83

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  549
            G+LSPD+G L  L NLS+A N  SGP+P  +S +S L  LNLSNNIF STFP  L+ L N
Sbjct  84   GILSPDIGFLTNLQNLSVAGNSFSGPIPSSLSLLSNLYHLNLSNNIFNSTFPSSLSPLQN  143

Query  550  LQVLDLYNNNLTGDLPVEVYKMTS  621
            LQ+LD+YNNNLTG LP+ V  M+ 
Sbjct  144  LQILDVYNNNLTGPLPLSVVNMSE  167


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG + P++G+L  L  +  ++N+ SG +P EIS    L F++LS N F    P ++  +
Sbjct  492  FSGSIPPEIGRLQQLSKIDFSSNKFSGEIPSEISKCKLLTFVDLSRNQFSGEIPKEITGM  551

Query  544  ANLQVLDLYNNNL  582
              L  L++  N+L
Sbjct  552  RILNYLNISRNHL  564



>gb|KFK28239.1| hypothetical protein AALP_AA8G490400 [Arabis alpina]
Length=1002

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 101/150 (67%), Gaps = 8/150 (5%)
 Frame = +1

Query  187  GKPLGVTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls  354
            GKP  ++E  ALLS+K++ T     D  S L+SW ++TS CTW  VTCD     V+    
Sbjct  20   GKP--ISEPRALLSLKSSLTVTGDDDKNSPLSSWKLTTSFCTWTGVTCDVSRRHVTSLDL  77

Query  355  gl-NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  531
               NL G LSP++  L  L NLS+A NQ+SG +PP+IS +S LR+LNLSNN+F  TFP +
Sbjct  78   SGLNLPGTLSPEISHLRLLQNLSLAENQISGQIPPQISNLSGLRYLNLSNNVFNGTFPDE  137

Query  532  LAQ-LANLQVLDLYNNNLTGDLPVEVYKMT  618
            ++  L NL++LD+YNNNLTGDLP+ V  +T
Sbjct  138  ISSGLVNLRILDVYNNNLTGDLPISVTNLT  167


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G +  ++G+L  L  L +  N  SGP+  E+ ++S+L+ ++LSNN+F    P   A+L
Sbjct  252  LTGEIPSEIGKLKKLDTLFLQVNVFSGPLTWELGSLSSLKSMDLSNNMFTGEIPTSFAEL  311

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G++P
Sbjct  312  KNLTLLNLFRNKLHGEIP  329


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 44/84 (52%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      +++  
Sbjct  468  LSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISHC  527

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L+GD+P E+  M
Sbjct  528  KLLTFVDLSRNELSGDIPNEITGM  551


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 46/85 (54%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             SG +    G  P +  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  179  FSGSIPSSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  238

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L   D  N  LTG++P E+ K+
Sbjct  239  LSELVRFDGANCGLTGEIPSEIGKL  263


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++     L  + ++ N+LSG +P EI+ +  L +LNLS N      P  ++ +
Sbjct  516  FSGRIAPEISHCKLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGAIPSSISSM  575

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  LD   NNL+G +P
Sbjct  576  QSLTSLDFSYNNLSGLVP  593


 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 42/80 (53%), Gaps = 0/80 (0%)
 Frame = +1

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  555
            L P++G L  LV    A   L+G +P EI  +  L  L L  N+F      +L  L++L+
Sbjct  232  LPPEIGNLSELVRFDGANCGLTGEIPSEIGKLKKLDTLFLQVNVFSGPLTWELGSLSSLK  291

Query  556  VLDLYNNNLTGDLPVEVYKM  615
             +DL NN  TG++P    ++
Sbjct  292  SMDLSNNMFTGEIPTSFAEL  311



>ref|NP_001237688.1| receptor-like protein kinase precursor [Glycine max]
 gb|ACM89563.1| receptor-like protein kinase [Glycine max]
Length=1010

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 99/139 (71%), Gaps = 1/139 (1%)
 Frame = +1

Query  202  VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  378
            ++E  ALLS KA+  T D   +L+SWN ST  C+W  VTCDS  HV  L+L+ L+LS  L
Sbjct  19   ISEYRALLSFKASSITNDPTHALSSWNSSTPFCSWFGVTCDSRRHVTGLNLTSLSLSATL  78

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  558
               +  LPFL +LS+A NQ SGP+P   SA+S LRFLNLSNN+F  TFP QLA+L+NL+V
Sbjct  79   YDHLSHLPFLSHLSLADNQFSGPIPVSFSALSALRFLNLSNNVFNQTFPSQLARLSNLEV  138

Query  559  LDLYNNNLTGDLPVEVYKM  615
            LDLYNNN+TG LP+ V  M
Sbjct  139  LDLYNNNMTGPLPLAVASM  157


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG + P +G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P+Q+  +
Sbjct  483  FSGRIPPQIGRLQQLSKIDFSHNKFSGPIAPEISRCKLLTFIDLSGNELSGEIPNQITSM  542

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G +P  +  M S
Sbjct  543  RILNYLNLSRNHLDGSIPGSIASMQS  568


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 45/83 (54%), Gaps = 0/83 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+ ++G L  L ++ ++ N LSG VP   + +  L  LNL  N      P  + +L
Sbjct  267  LSGSLTSELGNLKSLKSMDLSNNMLSGEVPASFAELKNLTLLNLFRNKLHGAIPEFVGEL  326

Query  544  ANLQVLDLYNNNLTGDLPVEVYK  612
              L+VL L+ NN TG +P  + K
Sbjct  327  PALEVLQLWENNFTGSIPQSLGK  349


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG ++P++ +   L  + ++ N+LSG +P +I+++  L +LNLS N    + P  +A 
Sbjct  506  KFSGPIAPEISRCKLLTFIDLSGNELSGEIPNQITSMRILNYLNLSRNHLDGSIPGSIAS  565

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  +D   NN +G +P
Sbjct  566  MQSLTSVDFSYNNFSGLVP  584


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P   A+L
Sbjct  243  LSGEIPAELGKLQNLDTLFLQVNSLSGSLTSELGNLKSLKSMDLSNNMLSGEVPASFAEL  302

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  303  KNLTLLNLFRNKLHGAIP  320



>ref|XP_002531999.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF30398.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=1021

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 106/141 (75%), Gaps = 4/141 (3%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsl-lhvvsldlsglNLSG  372
            ++E  ALLS+K+A   D Q +L SWN +  +  CTW  VTCD    H+ SLDLS LNLSG
Sbjct  25   ISEYQALLSLKSAID-DPQGALASWNSTNKNNLCTWSFVTCDYNNRHITSLDLSSLNLSG  83

Query  373  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  552
             LSPD+  L +L NL++AANQ+SGP+P ++SAIS LR LNLSNN+F  +FP QL+QL NL
Sbjct  84   TLSPDIAHLRYLQNLTLAANQISGPIPIQLSAISGLRCLNLSNNVFNGSFPTQLSQLKNL  143

Query  553  QVLDLYNNNLTGDLPVEVYKM  615
            QVLDLYNNN+TGDLP+ V +M
Sbjct  144  QVLDLYNNNMTGDLPLAVTEM  164


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG + P++G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P ++  +
Sbjct  491  FSGPIPPEIGKLQQLSKVDFSHNKFSGPIAPEISQCKLLTFVDLSRNELSGAIPTEITGM  550

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G +P  +  M S
Sbjct  551  RILNYLNLSRNHLVGSIPASIATMQS  576


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ Q   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  +A +
Sbjct  515  FSGPIAPEISQCKLLTFVDLSRNELSGAIPTEITGMRILNYLNLSRNHLVGSIPASIATM  574

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNLTG +P
Sbjct  575  QSLTSVDFSYNNLTGLVP  592


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P   AQL
Sbjct  250  LSGEIPKEIGKLQKLDTLFLQVNGLSGSLIEELGNLKSLKSMDLSNNMLSGEIPTSFAQL  309

Query  544  ANLQVLDLYNNNLTGDLP  597
            +NL +L+L+ N L G +P
Sbjct  310  SNLTLLNLFRNKLHGAIP  327


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 46/85 (54%), Gaps = 0/85 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            +L+G L   +G+   +  L +  N+ SGP+PPEI  +  L  ++ S+N F      +++Q
Sbjct  466  HLTGSLPSSIGKFSGVQKLLLDGNKFSGPIPPEIGKLQQLSKVDFSHNKFSGPIAPEISQ  525

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
               L  +DL  N L+G +P E+  M
Sbjct  526  CKLLTFVDLSRNELSGAIPTEITGM  550


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 49/85 (58%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             SG +  + G+  FL  L+++ N+L GP+PPEI  ++ L+ L +   N +    P ++  
Sbjct  177  FSGAIPREYGKWEFLEYLAVSGNELEGPIPPEIGNLTKLQQLYIGYYNTYEGGLPPEIGN  236

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L++L   D  N  L+G++P E+ K+
Sbjct  237  LSDLVRFDAANCMLSGEIPKEIGKL  261


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L  ++G L  L ++ ++ N LSG +P   + +S L  LNL  N      P  +  L
Sbjct  274  LSGSLIEELGNLKSLKSMDLSNNMLSGEIPTSFAQLSNLTLLNLFRNKLHGAIPEFIGDL  333

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+VL L+ NN TG +P
Sbjct  334  PQLEVLQLWENNFTGSIP  351



>ref|XP_010503631.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=999

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 99/143 (69%), Gaps = 4/143 (3%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSL-TSWNISTS-HCTWRRVTCdsllhvvsldlsg-lNLSG  372
            +TE  ALLS+K++ T D  S L +SWN+ST+  C+W  VTCD     V+      LNLSG
Sbjct  22   ITELNALLSLKSSLTGDDHSPLLSSWNLSTTTFCSWTGVTCDVSRRHVTSLDLSGLNLSG  81

Query  373  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LAN  549
             LS DV  LP L NLS+AANQ+SGP+PPE S +  LR LNLSNN+F  ++P +L+  L N
Sbjct  82   TLSSDVSHLPLLQNLSLAANQISGPIPPEFSNLYELRLLNLSNNVFNGSYPDELSSGLVN  141

Query  550  LQVLDLYNNNLTGDLPVEVYKMT  618
            L+VLDLYNNNLTG LP+ +  +T
Sbjct  142  LRVLDLYNNNLTGHLPLSITNLT  164


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P++G+L  L  L +  N  SGP+  E+  IS+L+ ++LSNN+F    P   ++L
Sbjct  249  LTGAIPPEIGKLQNLDTLFLQVNAFSGPLTSELGLISSLKSMDLSNNMFTGEIPTSFSEL  308

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  309  KNLTLLNLFRNKLYGAIP  326


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 46/84 (55%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L   +G    +  L +  N+ +GP+PPEI  +  L  L+ S+N+F      ++++ 
Sbjct  465  LSGSLPAAIGNFSGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRC  524

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L+GD+P E+  M
Sbjct  525  KLLTFVDLSRNELSGDIPNEITGM  548


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G + P++G+L  L  L  + N  SG + PEIS    L F++LS N      P+++  +
Sbjct  489  FAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGDIPNEITGM  548

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G +PV +  M S
Sbjct  549  RILNYLNLSRNHLVGSIPVSIASMQS  574


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  +A +
Sbjct  513  FSGRIAPEISRCKLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGSIPVSIASM  572

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  573  QSLTSVDFSYNNLSGLVP  590


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 45/85 (53%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             SG +    G  P L  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  176  FSGKIPATYGTWPVLEYLAVSGNELIGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  235

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L   D  N  LTG +P E+ K+
Sbjct  236  LSELLRFDAANCGLTGAIPPEIGKL  260



>ref|XP_007155783.1| hypothetical protein PHAVU_003G231400g [Phaseolus vulgaris]
 gb|ESW27777.1| hypothetical protein PHAVU_003G231400g [Phaseolus vulgaris]
Length=1018

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 101/139 (73%), Gaps = 1/139 (1%)
 Frame = +1

Query  202  VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  378
            ++E  ALLS KA+  T D  ++L+SWN ST++C+W  +TCDS LHV +L+L+  +LSG L
Sbjct  26   ISEYRALLSFKASSITDDPTNALSSWNSSTTYCSWLGITCDSRLHVTTLNLTSSSLSGTL  85

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  558
               +  LPFL  LS+A NQ SGP+P   S++S LR LNLSNN F +TFP  L++LANLQV
Sbjct  86   YDHLSHLPFLSYLSLADNQFSGPIPASFSSLSALRHLNLSNNAFNATFPSNLSRLANLQV  145

Query  559  LDLYNNNLTGDLPVEVYKM  615
            LDLYNNN+TG LP+ V  M
Sbjct  146  LDLYNNNMTGPLPLAVASM  164


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+P++G L  L ++ ++ N LSG VP   + +  L  LNL  N      P  + +L
Sbjct  274  LSGSLTPELGNLKSLKSMDLSNNILSGEVPASFTELKNLTLLNLFRNKLHGAIPEFVGEL  333

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+VL L+ NN TG +P
Sbjct  334  PALEVLQLWENNFTGSIP  351


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +  D+G+L  +  L +  N LSG + PE+  + +L+ ++LSNNI     P    +L
Sbjct  250  LSGEIPADLGRLQNMDTLFLQVNALSGSLTPELGNLKSLKSMDLSNNILSGEVPASFTEL  309

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  310  KNLTLLNLFRNKLHGAIP  327


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG +   +G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P+Q+  +
Sbjct  490  FSGQIPSQIGRLQQLSKIDFSRNEFSGPIAPEISRCKLLTFIDLSRNELSGEIPNQITAM  549

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G +P  +  M S
Sbjct  550  RILNYLNLSRNHLVGSIPGSIASMQS  575


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ +   L  + ++ N+LSG +P +I+A+  L +LNLS N    + P  +A +
Sbjct  514  FSGPIAPEISRCKLLTFIDLSRNELSGEIPNQITAMRILNYLNLSRNHLVGSIPGSIASM  573

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  574  QSLTSVDFSYNNLSGLVP  591



>ref|XP_009397330.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1023

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 101/146 (69%), Gaps = 4/146 (3%)
 Frame = +1

Query  169  SAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsld  348
            +A  GAG      E  ALLS+KA  + D  ++L  W+ +T HC+W  VTCD    VVSLD
Sbjct  20   AADDGAGY---AEEHRALLSLKAQLS-DPGAALGPWDATTDHCSWPGVTCDDAGAVVSLD  75

Query  349  lsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH  528
            LSG NLSG+L P VG+L  L+ LS AAN  SGP+P E++ +  LR LNLSNNIF  +FP 
Sbjct  76   LSGRNLSGLLPPAVGRLRSLLRLSAAANSFSGPIPSELALLPALRHLNLSNNIFNGSFPA  135

Query  529  QLAQLANLQVLDLYNNNLTGDLPVEV  606
             LA+LA+L+VLDLYNNNLTG LP E+
Sbjct  136  PLARLADLRVLDLYNNNLTGPLPREL  161


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G + P+VG+L  L  L +++N+ SGP+ PE+S    L F++LS N      P  +A +
Sbjct  492  FTGKIPPEVGRLQQLSKLDLSSNRFSGPITPEVSKCKLLTFVDLSRNELSGDVPADVAAM  551

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G +PV +  M S
Sbjct  552  RILNYLNLSRNHLEGPIPVAISTMQS  577


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G L  L  L +  N L G +PPE+S + +L+ ++LSNN      P   A L
Sbjct  250  LSGRIPPEMGNLRNLDTLFLQVNGLGGEIPPELSRLRSLKSMDLSNNALTGEIPPSFAAL  309

Query  544  ANLQVLDLYNNNLTGDLP  597
            +NL +L+L+ N L G +P
Sbjct  310  SNLTLLNLFRNKLFGAIP  327


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             SG + P+ G   FL  L+I+ N+L GP+PPEI  +S LR L +   N +    P ++  
Sbjct  177  FSGSIPPEYGSWQFLEYLAISGNELGGPIPPEIGNLSALRELYIGYYNSYDGGLPPEIGN  236

Query  541  LANLQVLDLYNNNLTGDLPVEV  606
            L+ L  LD  N  L+G +P E+
Sbjct  237  LSTLLRLDAANCGLSGRIPPEM  258


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 45/76 (59%), Gaps = 0/76 (0%)
 Frame = +1

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  549
            G L P++G L  L+ L  A   LSG +PPE+  +  L  L L  N  G   P +L++L +
Sbjct  228  GGLPPEIGNLSTLLRLDAANCGLSGRIPPEMGNLRNLDTLFLQVNGLGGEIPPELSRLRS  287

Query  550  LQVLDLYNNNLTGDLP  597
            L+ +DL NN LTG++P
Sbjct  288  LKSMDLSNNALTGEIP  303


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L G + P++ +L  L ++ ++ N L+G +PP  +A+S L  LNL  N      P  +  L
Sbjct  274  LGGEIPPELSRLRSLKSMDLSNNALTGEIPPSFAALSNLTLLNLFRNKLFGAIPEFVGDL  333

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+VL ++ NN TG +P
Sbjct  334  PELEVLQVWENNFTGSIP  351


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P+V +   L  + ++ N+LSG VP +++A+  L +LNLS N      P  ++ +
Sbjct  516  FSGPITPEVSKCKLLTFVDLSRNELSGDVPADVAAMRILNYLNLSRNHLEGPIPVAISTM  575

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  576  QSLTAVDFSYNNLSGVVP  593


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 45/87 (52%), Gaps = 1/87 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            L G + P++G L  L  L I   N   G +PPEI  +STL  L+ +N       P ++  
Sbjct  201  LGGPIPPEIGNLSALRELYIGYYNSYDGGLPPEIGNLSTLLRLDAANCGLSGRIPPEMGN  260

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            L NL  L L  N L G++P E+ ++ S
Sbjct  261  LRNLDTLFLQVNGLGGEIPPELSRLRS  287



>ref|XP_009394785.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1006

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 102/140 (73%), Gaps = 3/140 (2%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTS--HCTWRRVTCd-sllhvvsldlsglNLSGV  375
            ++  ALLS+KA F+  + + L++WN S    HC+W  V+CD     VVSLDL+GLNLSG 
Sbjct  30   SDVEALLSLKADFSDATSAVLSAWNSSADDDHCSWPGVSCDPLQGFVVSLDLTGLNLSGT  89

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  555
            LSP VG+L  L+NLS A+N LSGP+P E+S +S LR LNLSNN+F  +FP  LA+L NL 
Sbjct  90   LSPAVGRLRHLLNLSAASNSLSGPIPAELSRLSDLRHLNLSNNLFNGSFPSALARLKNLL  149

Query  556  VLDLYNNNLTGDLPVEVYKM  615
            VLDLYNNNLTG LP EV ++
Sbjct  150  VLDLYNNNLTGPLPTEVAEL  169


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG++SP++ Q   L  + ++ N+LSG +P EI+ +  L +LNLS N      P  +A +
Sbjct  521  FSGLISPEISQCKLLTFVDLSRNELSGEIPSEITGMRILNYLNLSRNQLEGNIPSSIATM  580

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  581  QSLTAIDFSYNNLSGLVP  598


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 54/109 (50%), Gaps = 25/109 (23%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  540
             +GV+ P+ G+  FL  L+++ N+L GP+PPE+  ++TLR L L   N F    P ++  
Sbjct  182  FTGVIPPEFGRWEFLEYLAVSGNELGGPIPPELGKLTTLRQLYLGYFNSFEGRIPPEIGG  241

Query  541  LANLQVLDLYN------------------------NNLTGDLPVEVYKM  615
            LA L  LD+ N                        N LTGDLP E+ ++
Sbjct  242  LAALVRLDMANCGLSGEIPPELGNLQNLDTIFLQVNGLTGDLPPEMGRL  290


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G L  L  + +  N L+G +PPE+  +  L+ ++LSNN      P   A L
Sbjct  255  LSGEIPPELGNLQNLDTIFLQVNGLTGDLPPEMGRLRNLKSMDLSNNALAGEIPATFADL  314

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  315  QNLTLLNLFRNKLHGSIP  332


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG + P++G+L  L  +  + NQ SG + PEIS    L F++LS N      P ++  +
Sbjct  497  FSGRIPPEIGRLQQLSKVDFSGNQFSGLISPEISQCKLLTFVDLSRNELSGEIPSEITGM  556

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N L G++P  +  M S
Sbjct  557  RILNYLNLSRNQLEGNIPSSIATMQS  582


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 44/84 (52%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L P VG    +  L +  NQ SG +PPEI  +  L  ++ S N F      +++Q 
Sbjct  473  LSGPLPPSVGNFSGVQKLLLNQNQFSGRIPPEIGRLQQLSKVDFSGNQFSGLISPEISQC  532

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L+G++P E+  M
Sbjct  533  KLLTFVDLSRNELSGEIPSEITGM  556


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G L P++G+L  L ++ ++ N L+G +P   + +  L  LNL  N    + P  +A L
Sbjct  279  LTGDLPPEMGRLRNLKSMDLSNNALAGEIPATFADLQNLTLLNLFRNKLHGSIPEFIADL  338

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+VL L+ NN TG +P
Sbjct  339  PTLEVLQLWENNFTGGIP  356


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            +  G + P++G L  LV L +A   LSG +PPE+  +  L  + L  N      P ++ +
Sbjct  230  SFEGRIPPEIGGLAALVRLDMANCGLSGEIPPELGNLQNLDTIFLQVNGLTGDLPPEMGR  289

Query  541  LANLQVLDLYNNNLTGDLP  597
            L NL+ +DL NN L G++P
Sbjct  290  LRNLKSMDLSNNALAGEIP  308


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 45/83 (54%), Gaps = 1/83 (1%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL+G L  +V +LP L +L +  N  +G +PPE      L +L +S N  G   P +L +
Sbjct  157  NLTGPLPTEVAELPELRHLHLGGNFFTGVIPPEFGRWEFLEYLAVSGNELGGPIPPELGK  216

Query  541  LANLQVLDL-YNNNLTGDLPVEV  606
            L  L+ L L Y N+  G +P E+
Sbjct  217  LTTLRQLYLGYFNSFEGRIPPEI  239



>ref|XP_010518800.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Tarenaya hassleriana]
Length=1011

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 85/126 (67%), Gaps = 2/126 (2%)
 Frame = +1

Query  247  ADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLSGVLSPDVGQLPFLVNLSI  423
            A   S+L +W  STS C W  VTCD+    V        NLSG LS D+  L  L N S+
Sbjct  40   AGDDSALATWTDSTSFCGWAGVTCDASRRHVISLDLSGLNLSGTLSSDIAHLRLLQNFSV  99

Query  424  AANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNNNLTGDLPV  600
            +ANQ+SGP+PPEIS++  LR+LNLSNN+F  +FP +L A L NL+VLDLYNNNLTGDLPV
Sbjct  100  SANQISGPIPPEISSLFGLRYLNLSNNVFNGSFPDELSAGLVNLRVLDLYNNNLTGDLPV  159

Query  601  EVYKMT  618
             V  +T
Sbjct  160  SVTNLT  165


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P++G+L  L  L +  N LSGP+ PE+  +  L  ++LSNN+F    P   AQL
Sbjct  250  LTGQIPPEIGKLQKLDTLFLQVNGLSGPLTPELGTLPILESMDLSNNMFVGEIPASFAQL  309

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  310  KNLTLLNLFRNKLHGAIP  327


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 44/81 (54%), Gaps = 0/81 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+P++G LP L ++ ++ N   G +P   + +  L  LNL  N      P  +  L
Sbjct  274  LSGPLTPELGTLPILESMDLSNNMFVGEIPASFAQLKNLTLLNLFRNKLHGAIPEFIGDL  333

Query  544  ANLQVLDLYNNNLTGDLPVEV  606
              L+VL L+ NN TG +P ++
Sbjct  334  PELEVLQLWENNFTGSIPRKL  354


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 45/85 (53%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             +G +    G  P +  L+++ N+L G +PPEI  +STLR L +   N F    P ++  
Sbjct  177  FAGRIPAAYGSWPVIEYLAVSGNELVGKIPPEIGNLSTLRELYIGYYNAFEDGLPPEIGN  236

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L   D  N  LTG +P E+ K+
Sbjct  237  LSELVRFDAANCGLTGQIPPEIGKL  261


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ Q   L  + ++ N+L+G +P EI+ +  L +LNLS N      P  ++ +
Sbjct  514  FSGRIAPEISQCKLLTFVDLSRNELAGEIPNEITGMRILNYLNLSRNHLVGPIPASISSM  573

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  574  QSLTSVDFSYNNLSGLVP  591


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 42/76 (55%), Gaps = 1/76 (1%)
 Frame = +1

Query  382  PDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  558
            P  G++ F L  +S++ NQLSGP+PP I   S ++ L L  N F    P Q+ +L  L  
Sbjct  447  PVTGRVAFNLGQISLSNNQLSGPLPPTIGNFSGVQKLLLDGNKFTGLIPQQIGKLQQLSK  506

Query  559  LDLYNNNLTGDLPVEV  606
            +D  +N  +G +  E+
Sbjct  507  MDFSHNRFSGRIAPEI  522



>ref|XP_008787359.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1, partial [Phoenix 
dactylifera]
Length=1004

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 99/147 (67%), Gaps = 5/147 (3%)
 Frame = +1

Query  169  SAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHC-TWRRVTCdsllhvvsl  345
            +A +G G+   V E  ALL +KAA   D   +L  W+ +  HC  W  V CD+   VVSL
Sbjct  19   AAASGRGR---VVEHRALLDLKAAL-GDPSGALAGWDATADHCQAWSGVACDAAGRVVSL  74

Query  346  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  525
            ++S LNLSG L   V +L  L++LS AAN+LSGP+PPE+S +S LRFLNLSNN F  T P
Sbjct  75   NISXLNLSGPLPRAVSRLRSLLHLSAAANELSGPIPPELSLLSGLRFLNLSNNAFNRTLP  134

Query  526  HQLAQLANLQVLDLYNNNLTGDLPVEV  606
              L++L NL VLDLYNNNLTG LPV+V
Sbjct  135  SALSRLKNLHVLDLYNNNLTGVLPVQV  161


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 47/86 (55%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG + P++G+L  L  +  + N+ SGP+ PEIS    L F++LS N F    P ++  +
Sbjct  492  FSGRIPPEIGRLQQLSKMDFSGNRFSGPITPEISKCKLLTFVDLSRNNFSGEIPAEITGM  551

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G +P  +  M S
Sbjct  552  RILNYLNLSRNHLEGKIPASISTMQS  577


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   A+L
Sbjct  250  LSGEIPPEIGNLQNLDTLFLQVNGLSGEITPELGKLRSLKSMDLSNNVLTGEIPRTFAEL  309

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  310  KNLTLLNLFRNKLHGAIP  327


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 45/84 (54%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L P +G+   +  L +  NQ SG +PPEI  +  L  ++ S N F      ++++ 
Sbjct  468  LSGALPPSIGKFSGVQKLLLNQNQFSGRIPPEIGRLQQLSKMDFSGNRFSGPITPEISKC  527

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  NN +G++P E+  M
Sbjct  528  KLLTFVDLSRNNFSGEIPAEITGM  551


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG ++P++G+L  L ++ ++ N L+G +P   + +  L  LNL  N      P  +  L
Sbjct  274  LSGEITPELGKLRSLKSMDLSNNVLTGEIPRTFAELKNLTLLNLFRNKLHGAIPDLIGDL  333

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+VL L+ NN TG++P
Sbjct  334  PRLEVLQLWENNFTGEIP  351


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 45/88 (51%), Gaps = 1/88 (1%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL+GVL   V  LP L +L +  N  SG +PPE      L +L +S N  G   P +L  
Sbjct  152  NLTGVLPVQVADLPALRHLHLGGNFFSGAIPPEYGRWEHLEYLAISGNELGGPIPPELGN  211

Query  541  LANLQVLDL-YNNNLTGDLPVEVYKMTS  621
            +  L+ L + Y N+  G LP  +  +T+
Sbjct  212  VTTLRELYIGYFNSFQGGLPAAIGNITA  239


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ +   L  + ++ N  SG +P EI+ +  L +LNLS N      P  ++ +
Sbjct  516  FSGPITPEISKCKLLTFVDLSRNNFSGEIPAEITGMRILNYLNLSRNHLEGKIPASISTM  575

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  576  QSLTAVDFSYNNLSGLVP  593



>ref|XP_010939309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1020

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 99/154 (64%), Gaps = 7/154 (5%)
 Frame = +1

Query  178  AGAGKPLG---VTEQAALLSIKAAFTADSQSSLTSWNISTS--HCTWRRVTCdsllhvvs  342
            AGA  P G     +QA LLS+K+A + D  ++L  WN + +  HC W  V CD+ L  V 
Sbjct  25   AGAPPPDGEASADDQATLLSLKSALS-DPGAALAGWNATAAPDHCAWHGVACDATLRRVV  83

Query  343  ldlsgl-NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  519
                   NLSG L   VG L  L+NLS A N LSGP+PPE+S +S LR LNLSNN+F  +
Sbjct  84   SLDLSGLNLSGSLPTAVGHLRHLLNLSAATNFLSGPIPPELSFLSDLRHLNLSNNLFNGS  143

Query  520  FPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTS  621
            FP  L +L NL+VLDLYNNNLTG LPVEV ++++
Sbjct  144  FPSALRRLKNLEVLDLYNNNLTGLLPVEVAELSN  177


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G+L  L  L +  N L+G +PPE+  + +L+ L+LSNN      P   A L
Sbjct  261  LSGSIPPELGRLENLDTLFLQVNGLAGELPPELGRLRSLKSLDLSNNALTGEIPPSFADL  320

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  321  WNLTLLNLFRNKLDGTVP  338


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G L P++G+L  L +L ++ N L+G +PP  + +  L  LNL  N    T P  +  L
Sbjct  285  LAGELPPELGRLRSLKSLDLSNNALTGEIPPSFADLWNLTLLNLFRNKLDGTVPDFIGDL  344

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+VL L++NN TG +P
Sbjct  345  PELEVLQLWDNNFTGIIP  362


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 42/76 (55%), Gaps = 0/76 (0%)
 Frame = +1

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  549
            G + P++G L  LV    A   LSG +PPE+  +  L  L L  N      P +L +L +
Sbjct  239  GGIPPEIGNLSALVRFDAANCGLSGSIPPELGRLENLDTLFLQVNGLAGELPPELGRLRS  298

Query  550  LQVLDLYNNNLTGDLP  597
            L+ LDL NN LTG++P
Sbjct  299  LKSLDLSNNALTGEIP  314


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG + P++G+L  L  +  + N+ SG + PEIS    L F++LS N      P ++A +
Sbjct  503  FSGRIPPEIGRLQQLSKVDFSGNRFSGEIAPEISKCKLLTFVDLSRNNLSGEIPAEIAGI  562

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L++  N+L G +P  +  M S
Sbjct  563  RILNYLNVSRNHLEGSIPPSIATMQS  588


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ +   L  + ++ N LSG +P EI+ I  L +LN+S N    + P  +A +
Sbjct  527  FSGEIAPEISKCKLLTFVDLSRNNLSGEIPAEIAGIRILNYLNVSRNHLEGSIPPSIATM  586

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  587  QSLTAVDFSYNNLSGLVP  604


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 44/81 (54%), Gaps = 0/81 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L   +G    L  L ++ NQ SG +PPEI  +  L  ++ S N F      ++++ 
Sbjct  479  LSGPLPLSIGNFSGLQKLLLSQNQFSGRIPPEIGRLQQLSKVDFSGNRFSGEIAPEISKC  538

Query  544  ANLQVLDLYNNNLTGDLPVEV  606
              L  +DL  NNL+G++P E+
Sbjct  539  KLLTFVDLSRNNLSGEIPAEI  559


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  540
             SGV+ P+ G+   +  L+++ N+L G +PPEI  +S LR L +   N +    P ++  
Sbjct  188  FSGVIPPEYGRWDHIEYLAVSGNELVGAIPPEIGNLSRLRQLYVGYFNSYDGGIPPEIGN  247

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L   D  N  L+G +P E+ ++
Sbjct  248  LSALVRFDAANCGLSGSIPPELGRL  272



>ref|XP_006852730.1| hypothetical protein AMTR_s00033p00083200 [Amborella trichopoda]
 gb|ERN14197.1| hypothetical protein AMTR_s00033p00083200 [Amborella trichopoda]
Length=1017

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 99/139 (71%), Gaps = 2/139 (1%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll-hvvsldlsglNLSGVLSP  384
            E   LLS+KAA   D  +SL SWN ST +C+W  V CD+   HVVSLDLS  NL+G L+P
Sbjct  28   EYRYLLSLKAAII-DPDNSLQSWNSSTDYCSWSGVACDASSNHVVSLDLSARNLNGTLAP  86

Query  385  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLD  564
            ++G+L  LVN+++A NQ +G +P EIS I+ L+ LNLSNN F + FP   + L NL+VLD
Sbjct  87   EIGRLRSLVNITVAENQFAGGIPLEISQINGLKLLNLSNNYFSANFPANFSGLKNLEVLD  146

Query  565  LYNNNLTGDLPVEVYKMTS  621
            LYNNNLTG LP+EV +M +
Sbjct  147  LYNNNLTGPLPLEVTEMEA  165


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P+  +L  L  L +  N LSGP+ PE+ ++ +L+ ++LSNN+     P + ++L
Sbjct  249  LSGSIPPEFRKLQKLDTLFLQVNGLSGPITPELGSLKSLKSMDLSNNMLDGQIPVEFSEL  308

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  309  KNLTLLNLFRNRLHGSIP  326


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG ++P++G L  L ++ ++ N L G +P E S +  L  LNL  N    + P  +  L
Sbjct  273  LSGPITPELGSLKSLKSMDLSNNMLDGQIPVEFSELKNLTLLNLFRNRLHGSIPGFIGDL  332

Query  544  ANLQVLDLYNNNLTGDLPVEV  606
              LQVL L+ NN TG +P ++
Sbjct  333  PELQVLQLWENNFTGSVPQQL  353


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG + PD+G+L  L  L  + N+ SG + PEI+    L  ++LS N    T P ++ ++
Sbjct  489  FSGQIPPDIGKLQQLSKLDFSDNKFSGEISPEITNCKLLTVVDLSGNELNGTIPSEITKM  548

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G +P  +  M S
Sbjct  549  RILNYLNLSRNHLMGGIPPSIQTMQS  574


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 42/84 (50%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L   +G+   L  L +  N  SG +PP+I  +  L  L+ S+N F      ++   
Sbjct  465  LSGQLPASIGKFSSLQKLLLDGNGFSGQIPPDIGKLQQLSKLDFSDNKFSGEISPEITNC  524

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L V+DL  N L G +P E+ KM
Sbjct  525  KLLTVVDLSGNELNGTIPSEITKM  548


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 43/83 (52%), Gaps = 0/83 (0%)
 Frame = +1

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  546
             G + P++G L  LV L +A   LSG +PPE   +  L  L L  N        +L  L 
Sbjct  226  EGGIPPELGNLSALVRLDMANCALSGSIPPEFRKLQKLDTLFLQVNGLSGPITPELGSLK  285

Query  547  NLQVLDLYNNNLTGDLPVEVYKM  615
            +L+ +DL NN L G +PVE  ++
Sbjct  286  SLKSMDLSNNMLDGQIPVEFSEL  308


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 49/85 (58%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  540
             +G + P+ G+  F+  L+++ N+L+G +P E+  ++ L+ L L   NI+    P +L  
Sbjct  176  FTGTIPPEYGKWGFIEYLAVSGNELTGKIPGELGNLTKLQQLYLGYYNIYEGGIPPELGN  235

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L  LD+ N  L+G +P E  K+
Sbjct  236  LSALVRLDMANCALSGSIPPEFRKL  260



>ref|XP_010941985.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1024

 Score =   125 bits (313),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 102/152 (67%), Gaps = 4/152 (3%)
 Frame = +1

Query  163  RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHC-TWRRVTCdsllhvv  339
            R SA A  G  +G  E  ALL +KAA   D   +L  W+ +  HC  W  V CD+   VV
Sbjct  16   RPSAAASGGGRVG--EHRALLDLKAAL-GDPSGALAGWDAAADHCQAWVGVACDAAGRVV  72

Query  340  sldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  519
            SL++S LNLSG L P V +L  L+ LS AANQLSGP+PPE+S +S LRFLNLSNN F  T
Sbjct  73   SLNISNLNLSGPLPPAVSRLRSLLRLSTAANQLSGPIPPELSLLSGLRFLNLSNNAFNET  132

Query  520  FPHQLAQLANLQVLDLYNNNLTGDLPVEVYKM  615
            FP  L++L NL VLDLYNNNLTG LP+EV ++
Sbjct  133  FPSALSRLKNLHVLDLYNNNLTGVLPLEVAEL  164


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G L  L  L +  N LSG + PE+  + +L+ ++LSNN      P   A+L
Sbjct  250  LSGKIPPEIGNLQNLDTLFLQVNGLSGGITPELGMLRSLKSMDLSNNALTGEIPRTFAEL  309

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  310  KNLTLLNLFRNRLHGAIP  327


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 47/88 (53%), Gaps = 1/88 (1%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL+GVL  +V +LP L +L +  N  SG +PPE      L +L +S N  G   P +L  
Sbjct  152  NLTGVLPLEVAELPALRHLHLGGNFFSGAIPPEYGRWEHLEYLAVSGNELGGPIPPELGN  211

Query  541  LANLQVLDL-YNNNLTGDLPVEVYKMTS  621
            +  L+ L + Y N+  G LP  +  +T+
Sbjct  212  VTTLRELYIGYFNSFQGSLPAAIGNITA  239


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG ++P++G L  L ++ ++ N L+G +P   + +  L  LNL  N      P  +  L
Sbjct  274  LSGGITPELGMLRSLKSMDLSNNALTGEIPRTFAELKNLTLLNLFRNRLHGAIPDLIGDL  333

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+VL L+ NN TG++P
Sbjct  334  PRLEVLQLWENNFTGEIP  351


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG +  ++G+L  L  +  + N+ SGP+ PEI     L F++LS N      P ++  +
Sbjct  492  FSGRIPLEIGRLQQLSKMDFSGNRFSGPITPEIRKCKLLTFVDLSRNNLSGEIPAEITGM  551

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G++P  +  M S
Sbjct  552  RILNYLNLSRNHLEGEIPASISTMQS  577


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 44/84 (52%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L P +G+   +  L +  NQ SG +P EI  +  L  ++ S N F      ++ + 
Sbjct  468  LSGALPPSIGKFSGVQKLLLNQNQFSGRIPLEIGRLQQLSKMDFSGNRFSGPITPEIRKC  527

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  NNL+G++P E+  M
Sbjct  528  KLLTFVDLSRNNLSGEIPAEITGM  551


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ +   L  + ++ N LSG +P EI+ +  L +LNLS N      P  ++ +
Sbjct  516  FSGPITPEIRKCKLLTFVDLSRNNLSGEIPAEITGMRILNYLNLSRNHLEGEIPASISTM  575

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  576  QSLTAVDFSYNNLSGLVP  593



>ref|XP_009408581.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1016

 Score =   125 bits (313),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 88/133 (66%), Gaps = 2/133 (2%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPD  387
            E  ALLSIK+  + D  ++LT+W+ +T HC W  VTCD    V        NLSG LSP 
Sbjct  30   EHHALLSIKSQLS-DPGAALTAWDPATDHCAWPGVTCDRAAVVELDLSGR-NLSGPLSPA  87

Query  388  VGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDL  567
             G L  L+ LS A N LSGP+PP ++ ++ LR LNLSNN+F  +FP  LA LA+L+VLDL
Sbjct  88   FGSLRSLLRLSAAENSLSGPIPPALALLTVLRHLNLSNNLFDGSFPPALAGLADLRVLDL  147

Query  568  YNNNLTGDLPVEV  606
            YNNNLTG LP EV
Sbjct  148  YNNNLTGPLPREV  160


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 48/87 (55%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            + +G + P+VG+L  L  L  + N+ +GP+ PEIS    L F++LS N      P ++A 
Sbjct  490  SFTGGIPPEVGRLQQLSKLDFSGNRFAGPITPEISKCKLLTFVDLSRNELSGDIPEEIAA  549

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            +  L  L+L  N+L G +P  +  M S
Sbjct  550  MRILNYLNLSRNHLEGQIPAAISTMQS  576


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G L  L +L +  N L G +P E+  + +L+ ++LSNN      P   A L
Sbjct  249  LSGRIPPEIGNLRILDSLFLQVNGLVGEIPLELGRLRSLKSMDLSNNALTGEIPPSFADL  308

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  309  GNLTLLNLFRNKLFGAIP  326


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             SG +  + G+  FL  L+++ N+L GP+PPEI  +S+LR L +   N +    P ++  
Sbjct  176  FSGSIPSEYGRWQFLEYLAVSGNELGGPIPPEIGNLSSLRELYIGYYNSYEGGLPPEIGN  235

Query  541  LANLQVLDLYNNNLTGDLPVEV  606
            L+ L  LD+ N  L+G +P E+
Sbjct  236  LSTLLRLDVANCGLSGRIPPEI  257


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = +1

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  546
             G L P++G L  L+ L +A   LSG +PPEI  +  L  L L  N      P +L +L 
Sbjct  226  EGGLPPEIGNLSTLLRLDVANCGLSGRIPPEIGNLRILDSLFLQVNGLVGEIPLELGRLR  285

Query  547  NLQVLDLYNNNLTGDLP  597
            +L+ +DL NN LTG++P
Sbjct  286  SLKSMDLSNNALTGEIP  302


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G ++P++ +   L  + ++ N+LSG +P EI+A+  L +LNLS N      P  ++ +
Sbjct  515  FAGPITPEISKCKLLTFVDLSRNELSGDIPEEIAAMRILNYLNLSRNHLEGQIPAAISTM  574

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  575  QSLTQVDFSYNNLSGVVP  592


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 44/83 (53%), Gaps = 0/83 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L G +  ++G+L  L ++ ++ N L+G +PP  + +  L  LNL  N      P  +  L
Sbjct  273  LVGEIPLELGRLRSLKSMDLSNNALTGEIPPSFADLGNLTLLNLFRNKLFGAIPEFVGDL  332

Query  544  ANLQVLDLYNNNLTGDLPVEVYK  612
              L+VL L+ NN TG +P  + K
Sbjct  333  PELEVLQLWENNFTGSVPRRLGK  355



>ref|XP_009136515.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Brassica rapa]
Length=993

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 86/124 (69%), Gaps = 2/124 (2%)
 Frame = +1

Query  256  QSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAAN  432
             S L SW++STS C W  VTCD+ L  V       LNLSG L   V  LP L NLS+AAN
Sbjct  45   HSPLASWDLSTSFCLWTGVTCDASLRHVISLDLSGLNLSGTLPSSVAHLPLLRNLSLAAN  104

Query  433  QLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNNNLTGDLPVEVY  609
            Q+SG +PPE++++S LR LNLSNN+F  +FP +L A L NL+VLDLYNNNLTGDLPV + 
Sbjct  105  QISGHIPPEMASLSELRRLNLSNNVFNGSFPDELSAGLVNLRVLDLYNNNLTGDLPVSIT  164

Query  610  KMTS  621
             +T 
Sbjct  165  NLTE  168


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L G + P++G+L  L  L +  N  SG +PPE+  IS+L+ ++LSNN+F    P +  QL
Sbjct  252  LRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNNMFTGEIPPRFEQL  311

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
             NL +L+L+ N L G +P  +  M
Sbjct  312  RNLTLLNLFRNKLYGAIPEFIGDM  335


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  540
             +G + P  G  P L  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  179  FAGRIPPAYGSWPALEYLAVSGNELAGKIPPEIGNLTTLRELYIGYFNAFDGGLPAEIGN  238

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L  LD  N  L G++P E+ ++
Sbjct  239  LSELLRLDAANCGLRGEIPPEIGRL  263


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 46/87 (53%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG +  ++G+L  L  L  + N  SG +PPEIS    L +++LS N      P+++  
Sbjct  493  KFSGAIPSEIGRLQQLSKLDFSHNLFSGGIPPEISRCKLLTYVDLSRNELSGEIPNEITS  552

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            +  L  L++  N+L G +PV +  M S
Sbjct  553  MRILNYLNVSRNHLVGSIPVTISSMQS  579


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
              G L  ++G L  L+ L  A   L G +PPEI  +  L  L L  N F  T P +L  +
Sbjct  228  FDGGLPAEIGNLSELLRLDAANCGLRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTI  287

Query  544  ANLQVLDLYNNNLTGDLP  597
            ++L+ +DL NN  TG++P
Sbjct  288  SSLKSMDLSNNMFTGEIP  305


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 48/83 (58%), Gaps = 6/83 (7%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            +SG +S ++GQ+      S++ NQLSGP+PP I + S ++ L L  N F    P ++ +L
Sbjct  452  ISGGVSVNLGQI------SLSNNQLSGPLPPAIGSFSGVQKLLLDGNKFSGAIPSEIGRL  505

Query  544  ANLQVLDLYNNNLTGDLPVEVYK  612
              L  LD  +N  +G +P E+ +
Sbjct  506  QQLSKLDFSHNLFSGGIPPEISR  528


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG + P++ +   L  + ++ N+LSG +P EI+++  L +LN+S N    + P  ++ +
Sbjct  518  FSGGIPPEISRCKLLTYVDLSRNELSGEIPNEITSMRILNYLNVSRNHLVGSIPVTISSM  577

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  578  QSLTSIDFSYNNLSGLVP  595



>gb|AES94465.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1014

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 104/138 (75%), Gaps = 0/138 (0%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  381
            ++E  ALLS + + T  +  SL+SWN +T+HCTW  VTC++  HV +++L+GL+LSG LS
Sbjct  25   ISEYRALLSFRQSITDSTPPSLSSWNTNTTHCTWFGVTCNTRRHVTAVNLTGLDLSGTLS  84

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
             ++  LPFL NLS+A N+ SG +PP +SA++ LR LNLSNN+F  TFP +L+ L NL+VL
Sbjct  85   DELSHLPFLTNLSLADNKFSGQIPPSLSAVTNLRLLNLSNNVFNGTFPSELSLLKNLEVL  144

Query  562  DLYNNNLTGDLPVEVYKM  615
            DLYNNN+TG LP+ V ++
Sbjct  145  DLYNNNMTGTLPLAVTEL  162


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 43/86 (50%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
              G +   +G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P+++  +
Sbjct  488  FEGKIPSQIGRLQQLSKIDFSHNRFSGPIAPEISKCKLLTFVDLSRNELSGIIPNEITHM  547

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L   ++  N+L G +P  +  M S
Sbjct  548  KILNYFNISRNHLVGSIPGSIASMQS  573


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 49/88 (56%), Gaps = 1/88 (1%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            N++G L   V +LP L +L +  N L+G +PPE  +   L++L +S N    T P ++  
Sbjct  150  NMTGTLPLAVTELPNLRHLHLGGNYLTGQIPPEYGSWQHLQYLAVSGNELDGTIPPEIGN  209

Query  541  LANLQVLDL-YNNNLTGDLPVEVYKMTS  621
            L +L+ L + Y N  TG +P ++  +T 
Sbjct  210  LTSLRELYIGYFNEYTGGIPPQIGNLTE  237


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 47/84 (56%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P    +L
Sbjct  248  LSGEIPHEIGKLQNLDTLFLQVNALSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFGEL  307

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
             NL +L+L+ N L G +P  +  M
Sbjct  308  KNLTLLNLFRNKLHGAIPEFIGDM  331


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ +   L  + ++ N+LSG +P EI+ +  L + N+S N    + P  +A +
Sbjct  512  FSGPIAPEISKCKLLTFVDLSRNELSGIIPNEITHMKILNYFNISRNHLVGSIPGSIASM  571

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  572  QSLTSVDFSYNNLSGLVP  589


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 44/81 (54%), Gaps = 0/81 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+ ++G L  L ++ ++ N L+G +P     +  L  LNL  N      P  +  +
Sbjct  272  LSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFGELKNLTLLNLFRNKLHGAIPEFIGDM  331

Query  544  ANLQVLDLYNNNLTGDLPVEV  606
              L+V+ L+ NN TG++P+ +
Sbjct  332  PALEVIQLWENNFTGNIPMSL  352



>ref|XP_003611507.1| Receptor-like protein kinase [Medicago truncatula]
Length=1109

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 104/138 (75%), Gaps = 0/138 (0%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  381
            ++E  ALLS + + T  +  SL+SWN +T+HCTW  VTC++  HV +++L+GL+LSG LS
Sbjct  25   ISEYRALLSFRQSITDSTPPSLSSWNTNTTHCTWFGVTCNTRRHVTAVNLTGLDLSGTLS  84

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
             ++  LPFL NLS+A N+ SG +PP +SA++ LR LNLSNN+F  TFP +L+ L NL+VL
Sbjct  85   DELSHLPFLTNLSLADNKFSGQIPPSLSAVTNLRLLNLSNNVFNGTFPSELSLLKNLEVL  144

Query  562  DLYNNNLTGDLPVEVYKM  615
            DLYNNN+TG LP+ V ++
Sbjct  145  DLYNNNMTGTLPLAVTEL  162


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 49/88 (56%), Gaps = 1/88 (1%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            N++G L   V +LP L +L +  N L+G +PPE  +   L++L +S N    T P ++  
Sbjct  150  NMTGTLPLAVTELPNLRHLHLGGNYLTGQIPPEYGSWQHLQYLAVSGNELDGTIPPEIGN  209

Query  541  LANLQVLDL-YNNNLTGDLPVEVYKMTS  621
            L +L+ L + Y N  TG +P ++  +T 
Sbjct  210  LTSLRELYIGYFNEYTGGIPPQIGNLTE  237


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 43/86 (50%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
              G +   +G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P+++  +
Sbjct  488  FEGKIPSQIGRLQQLSKIDFSHNRFSGPIAPEISKCKLLTFVDLSRNELSGIIPNEITHM  547

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L   ++  N+L G +P  +  M S
Sbjct  548  KILNYFNISRNHLVGSIPGSIASMQS  573


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ +   L  + ++ N+LSG +P EI+ +  L + N+S N    + P  +A +
Sbjct  512  FSGPIAPEISKCKLLTFVDLSRNELSGIIPNEITHMKILNYFNISRNHLVGSIPGSIASM  571

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  572  QSLTSVDFSYNNLSGLVP  589


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 47/84 (56%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P    +L
Sbjct  248  LSGEIPHEIGKLQNLDTLFLQVNALSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFGEL  307

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
             NL +L+L+ N L G +P  +  M
Sbjct  308  KNLTLLNLFRNKLHGAIPEFIGDM  331


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 44/81 (54%), Gaps = 0/81 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+ ++G L  L ++ ++ N L+G +P     +  L  LNL  N      P  +  +
Sbjct  272  LSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFGELKNLTLLNLFRNKLHGAIPEFIGDM  331

Query  544  ANLQVLDLYNNNLTGDLPVEV  606
              L+V+ L+ NN TG++P+ +
Sbjct  332  PALEVIQLWENNFTGNIPMSL  352



>ref|XP_008441113.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1, partial [Cucumis melo]
Length=977

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +1

Query  256  QSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQ  435
            +SSL SWN STSHCTW  VTCD   HV +LDL+ L LSG LSPDV  L FL NLS+AAN+
Sbjct  2    KSSLASWNASTSHCTWFGVTCDLRRHVTALDLTALGLSGSLSPDVAFLRFLTNLSLAANE  61

Query  436  LSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKM  615
             SGP+PPE+S+IS+LR LNLSNN+F  +FP + +QL NL VLDLYNNN+TGD P+ V +M
Sbjct  62   FSGPIPPELSSISSLRLLNLSNNVFDGSFPSRFSQLQNLHVLDLYNNNMTGDFPIVVTEM  121

Query  616  TS  621
            +S
Sbjct  122  SS  123


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G+L  L  L +  N LSGP+ PEI  +++L+ L+LSNN+     P   AQL
Sbjct  207  LSGRIPPELGKLQNLDTLFLQVNALSGPLTPEIGQLNSLKSLDLSNNMLVGEIPVSFAQL  266

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  267  KNLTLLNLFRNKLHGAIP  284


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 48/87 (55%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG + P++G+L  L  +  ++N LSGP+ PEIS    L F++LS N      P+++  
Sbjct  446  KFSGQIPPEIGRLQQLSKIDFSSNMLSGPIAPEISQCKLLTFVDLSRNQLSGEIPNEITS  505

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            +  L  L+L  N+L G +P  +  M S
Sbjct  506  MRILNYLNLSKNHLVGGIPATIASMQS  532


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 51/85 (60%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  540
             +G + P+VG++  L  L+++ N+LSGP+PPE+  ++ LR L +   N +    P ++  
Sbjct  134  FAGRIPPEVGRMQSLEYLAVSGNELSGPIPPELGNLTNLRELYIGYFNAYDGGLPAEIGN  193

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L  LD  N  L+G +P E+ K+
Sbjct  194  LSQLVRLDAANCGLSGRIPPELGKL  218


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG ++P++ Q   L  + ++ NQLSG +P EI+++  L +LNLS N      P  +A +
Sbjct  471  LSGPIAPEISQCKLLTFVDLSRNQLSGEIPNEITSMRILNYLNLSKNHLVGGIPATIASM  530

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  531  QSLTSVDFSYNNLSGLVP  548


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 44/83 (53%), Gaps = 0/83 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+P++GQL  L +L ++ N L G +P   + +  L  LNL  N      P  +  L
Sbjct  231  LSGPLTPEIGQLNSLKSLDLSNNMLVGEIPVSFAQLKNLTLLNLFRNKLHGAIPSFIGDL  290

Query  544  ANLQVLDLYNNNLTGDLPVEVYK  612
              L+VL L+ NN T  +P  + K
Sbjct  291  PKLEVLQLWENNFTEAIPQNLGK  313


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +1

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  549
            G L  ++G L  LV L  A   LSG +PPE+  +  L  L L  N        ++ QL +
Sbjct  185  GGLPAEIGNLSQLVRLDAANCGLSGRIPPELGKLQNLDTLFLQVNALSGPLTPEIGQLNS  244

Query  550  LQVLDLYNNNLTGDLPVEVYKM  615
            L+ LDL NN L G++PV   ++
Sbjct  245  LKSLDLSNNMLVGEIPVSFAQL  266



>ref|XP_009394620.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1003

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 100/140 (71%), Gaps = 4/140 (3%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNIS--TSHCTWRRVTCd-sllhvvsldlsglNLSGV  375
            TE  ALL +KAA  +D  ++L++WN S    HC+W  V CD     VVSLDLSGLNLSG 
Sbjct  29   TEVEALLELKAA-VSDPSAALSAWNSSDGVDHCSWPGVACDPLRGSVVSLDLSGLNLSGT  87

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  555
            LSP VG+L  L+NLS+A+N LSGP+P ++S ++ LR LNLS+N+   +FP  LA L NL 
Sbjct  88   LSPAVGRLRHLLNLSVASNSLSGPIPADLSRLADLRHLNLSDNLLNGSFPSALAHLKNLL  147

Query  556  VLDLYNNNLTGDLPVEVYKM  615
            VLDLYNNNLTG LP EV ++
Sbjct  148  VLDLYNNNLTGPLPAEVAEL  167


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG + P+ G+L  L  L ++ N+ SGP+ PEIS    L F++LS N      P  +A +
Sbjct  495  FSGRIPPETGRLQELCKLDLSGNRFSGPIAPEISRCKLLAFVDLSRNEISGEIPPDIAGM  554

Query  544  ANLQVLDLYNNNLTGDLP  597
              L  L+L  N+L G +P
Sbjct  555  RILNYLNLSRNHLEGSIP  572


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ +   L  + ++ N++SG +PP+I+ +  L +LNLS N    + P  LA +
Sbjct  519  FSGPIAPEISRCKLLAFVDLSRNEISGEIPPDIAGMRILNYLNLSRNHLEGSIPQSLATI  578

Query  544  ANLQVLDLYNNNLTG  588
             +L  +D   NNL+G
Sbjct  579  QSLTAVDFSYNNLSG  593


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = +1

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  549
            G + P++G+L  LV L +A   LSG +PPE+  +  L  L L  N      P  L +L +
Sbjct  231  GGIPPEIGRLAALVRLDMANCGLSGAIPPELGNLQNLDTLFLQVNGLAGDIPSALGRLRS  290

Query  550  LQVLDLYNNNLTGDLP  597
            L+ +D+ NN LTG++P
Sbjct  291  LKSMDISNNALTGEIP  306


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 47/88 (53%), Gaps = 1/88 (1%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL+G L  +V +LP L +L +  N  +G +PPE      L +L +S N  G   P +L  
Sbjct  155  NLTGPLPAEVAELPNLRHLHLGGNFFTGVIPPEFGGWEFLEYLAVSGNDLGGPIPPELGN  214

Query  541  LANLQVLDL-YNNNLTGDLPVEVYKMTS  621
            L  L+ L + Y N+  G +P E+ ++ +
Sbjct  215  LTRLRQLYVGYFNSFVGGIPPEIGRLAA  242



>ref|XP_010675918.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Beta vulgaris subsp. vulgaris]
Length=940

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 93/141 (66%), Gaps = 2/141 (1%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  378
            ++E+ ALLSIK+A T D Q+ L+SWN +T HC+W  +TC SL   V       L L+G+L
Sbjct  51   LSEEKALLSIKSAITDDPQNYLSSWNTTTHHCSWPFITCSSLSSSVISLDISGLELTGIL  110

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  558
            SPD+G L  L NL+IA N  S P+PP +S ++ LR+LNLS N F +TFP   + L  L +
Sbjct  111  SPDIGSLTHLQNLNIAENSFSDPIPPSLSLLTQLRYLNLSYNDF-TTFPSTFSSLKKLTI  169

Query  559  LDLYNNNLTGDLPVEVYKMTS  621
            LD+ +NN TG LP+ V +M+ 
Sbjct  170  LDILSNNFTGLLPLSVVEMSE  190



>ref|XP_010685023.1| PREDICTED: receptor-like protein 12 [Beta vulgaris subsp. vulgaris]
Length=762

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 99/153 (65%), Gaps = 12/153 (8%)
 Frame = +1

Query  190  KPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTC---------dsllhvvs  342
            KPL   EQ  LLSIK++ T D Q++L+SWN +T+HCTW  VTC          +   V+S
Sbjct  21   KPLQ-DEQKVLLSIKSSITDDPQNTLSSWNTTTNHCTWPFVTCSHHHHSPTNTTTSTVIS  79

Query  343  ldlsglNLSGVLS-PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  519
            LD+S LNL+G+LS  ++  L  L  LS+A N  SG +PP +S +S LR+LNLS+NIF  T
Sbjct  80   LDISSLNLTGILSLSNISLLTNLQKLSVADNYFSGQIPPSLSLLSNLRYLNLSDNIFNGT  139

Query  520  FPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMT  618
            FP  L+    L +LD+YNN LTG LP+ V  MT
Sbjct  140  FP-SLSSFKRLTILDVYNNYLTGSLPLSVINMT  171


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 39/76 (51%), Gaps = 0/76 (0%)
 Frame = +1

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  549
            G L    GQL  L N  +  N L G +PPE+  +  L  L L +N F    P +L  L  
Sbjct  185  GKLPSGYGQLKNLKNFYVDQNNLVGEIPPELGKLEKLDSLFLWSNYFSGDIPSELGSLKT  244

Query  550  LQVLDLYNNNLTGDLP  597
            L  +DL NN L+G++P
Sbjct  245  LISMDLSNNTLSGEIP  260



>ref|XP_009395647.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1004

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 88/123 (72%), Gaps = 1/123 (1%)
 Frame = +1

Query  250  DSQSSLTSWNISTSHCTWRRVTCd-sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIA  426
            D   +L +WN +  HC+W  V CD   + V+SLDL+GLNLSG LSP VG+L  LVNLS A
Sbjct  46   DPSGALYAWNSADGHCSWPGVACDPIRVFVLSLDLTGLNLSGTLSPAVGRLHHLVNLSTA  105

Query  427  ANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEV  606
            +N LSGP+P E+S +S LR LNLSNN+F  +FP   ++L NL VLDLYNNNL G LP EV
Sbjct  106  SNSLSGPLPAELSHLSNLRHLNLSNNLFNGSFPSAFSRLKNLLVLDLYNNNLAGTLPPEV  165

Query  607  YKM  615
             ++
Sbjct  166  SEL  168


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 51/85 (60%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  540
             SGV+ P+ G   FL  L+++ N+L GP+PPE+  ++ LR L +   N F    P ++  
Sbjct  181  FSGVIPPEFGHWEFLEYLAVSGNELGGPIPPELGNLTRLRQLYVGYFNSFEGGIPPEIGG  240

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L  LD+ N  LTGD+P E+ K+
Sbjct  241  LSELVRLDMANCGLTGDIPPELGKL  265


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P++G+L  L  L +  N LSG +PPE+  + +L+ ++LSNN      P   A L
Sbjct  254  LTGDIPPELGKLQNLDTLFLQVNGLSGRLPPELGGLRSLKSMDLSNNALTGEIPGSFADL  313

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  314  QNLTLLNLFRNKLHGSIP  331


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG + P++G+L  L  +  + NQ SGP+ PEIS    L F++LS N        ++A +
Sbjct  496  FSGGIPPEIGRLQQLSKVDFSGNQFSGPIAPEISRCKLLTFVDLSRNKLSGEILPEIAGM  555

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N L G +P  +  M S
Sbjct  556  RILNYLNLSRNQLEGSIPPSISTMQS  581


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            +  G + P++G L  LV L +A   L+G +PPE+  +  L  L L  N      P +L  
Sbjct  229  SFEGGIPPEIGGLSELVRLDMANCGLTGDIPPELGKLQNLDTLFLQVNGLSGRLPPELGG  288

Query  541  LANLQVLDLYNNNLTGDLP  597
            L +L+ +DL NN LTG++P
Sbjct  289  LRSLKSMDLSNNALTGEIP  307


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L P++G L  L ++ ++ N L+G +P   + +  L  LNL  N    + P  +  L
Sbjct  278  LSGRLPPELGGLRSLKSMDLSNNALTGEIPGSFADLQNLTLLNLFRNKLHGSIPEFVGDL  337

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+VL L+ NN TG +P
Sbjct  338  PALEVLQLWENNFTGGIP  355


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ +   L  + ++ N+LSG + PEI+ +  L +LNLS N    + P  ++ +
Sbjct  520  FSGPIAPEISRCKLLTFVDLSRNKLSGEILPEIAGMRILNYLNLSRNQLEGSIPPSISTM  579

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NN +G +P
Sbjct  580  QSLTAVDFSYNNFSGLVP  597



>ref|XP_007156674.1| hypothetical protein PHAVU_002G007600g [Phaseolus vulgaris]
 gb|ESW28668.1| hypothetical protein PHAVU_002G007600g [Phaseolus vulgaris]
Length=1005

 Score =   115 bits (289),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 107/140 (76%), Gaps = 0/140 (0%)
 Frame = +1

Query  196  LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGV  375
            L  +E  ALLS+++A T  +   L+SWN STS+C+W  VTCDS  HV++L+L+GL+LSG 
Sbjct  18   LPFSEYTALLSLRSAITDATPPVLSSWNASTSYCSWLGVTCDSHRHVIALNLTGLDLSGT  77

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  555
            LS D+  LPFL NLS+A N+ SGP+PP +S++S+LR LNLSNN F  TFP +L++L +L+
Sbjct  78   LSADIAHLPFLSNLSLATNKFSGPIPPALSSLSSLRLLNLSNNGFNQTFPPELSRLQSLE  137

Query  556  VLDLYNNNLTGDLPVEVYKM  615
            VLDLYNNN+TG LP+   +M
Sbjct  138  VLDLYNNNMTGALPLAAAQM  157


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 45/84 (54%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L P +G    +  L +  N  SGP+PP+I  +  L  ++ S N F      +++Q 
Sbjct  459  LSGPLPPSIGNFSSVQKLLLDGNMFSGPIPPQIGRLQQLSKIDFSGNKFSGRIEPEISQC  518

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  LDL  N+L+G++P E+  M
Sbjct  519  KLLTFLDLSRNDLSGEIPNEITGM  542


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG ++  +G+L  L  L +  N LSGP+ PE+  + +L+ ++LSNN+     P   ++L
Sbjct  243  LSGEITAALGKLQKLDTLFLQVNALSGPLTPELGNLKSLKSMDLSNNMLSGEIPATFSEL  302

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
             N+ +L+L+ N L G +P  + ++ S
Sbjct  303  KNITLLNLFRNKLHGAIPEFIGELPS  328


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+P++G L  L ++ ++ N LSG +P   S +  +  LNL  N      P  + +L
Sbjct  267  LSGPLTPELGNLKSLKSMDLSNNMLSGEIPATFSELKNITLLNLFRNKLHGAIPEFIGEL  326

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L+V+ L+ NN TG +P
Sbjct  327  PSLEVVQLWENNFTGSIP  344


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG + P++ Q   L  L ++ N LSG +P EI+ +  L  LNLS+N    + P  ++ 
Sbjct  506  KFSGRIEPEISQCKLLTFLDLSRNDLSGEIPNEITGMRILNCLNLSSNHLVGSIPSSISS  565

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  +D   NNL+G +P
Sbjct  566  MQSLTSVDFSYNNLSGLVP  584



>emb|CDY08759.1| BnaA06g24650D [Brassica napus]
Length=971

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 89/141 (63%), Gaps = 27/141 (19%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSS-LTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  378
            ++E  ALLS+K++ T D+ +S L SW  +TS CTW  VTC                    
Sbjct  23   ISEFRALLSLKSSLTGDAPNSPLASWKPTTSFCTWTGVTC--------------------  62

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQ  555
              DV +     NLS+A NQ+SGP+PPEIS +S LR LNLSNN+F  +FP +++  LANL+
Sbjct  63   --DVSRRH---NLSLADNQISGPIPPEISNLSGLRHLNLSNNVFNGSFPDKISSGLANLR  117

Query  556  VLDLYNNNLTGDLPVEVYKMT  618
            VLD+YNNN+TGDLP+ V  +T
Sbjct  118  VLDVYNNNMTGDLPLSVTNLT  138


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   + L
Sbjct  223  LNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNNMFTGEIPASFSDL  282

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G++P
Sbjct  283  KNLTLLNLFRNKLHGEIP  300


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  ++ +
Sbjct  487  FSGGIAPEISRCKLLTFVDLSRNELSGEIPKEITGMKILNYLNLSRNHLIGSIPGSISSM  546

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  LD   NNL+G +P
Sbjct  547  QSLTSLDFSYNNLSGLVP  564


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  555
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N+F      +L +L++L+
Sbjct  203  LPPEIGNLSELVRFDAANCALNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLK  262

Query  556  VLDLYNNNLTGDLP  597
             +DL NN  TG++P
Sbjct  263  SMDLSNNMFTGEIP  276


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 45/84 (54%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      ++++ 
Sbjct  439  LSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGGIAPEISRC  498

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L+G++P E+  M
Sbjct  499  KLLTFVDLSRNELSGEIPKEITGM  522


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  540
             +G + P  G  P +  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  150  FAGEIPPSYGTWPEIEYLAVSGNELTGKIPPEIGNLTTLRELYIGYFNAFEDGLPPEIGN  209

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L   D  N  L G++P E+ ++
Sbjct  210  LSELVRFDAANCALNGEIPPEIGRL  234


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG L+ ++G+L  L ++ ++ N  +G +P   S +  L  LNL  N      P  + +L
Sbjct  247  FSGPLTWELGKLSSLKSMDLSNNMFTGEIPASFSDLKNLTLLNLFRNKLHGEIPEFIGEL  306

Query  544  ANLQVLDLYNNNLTGDLPVEV  606
             +L+VL L+ NN TG +P ++
Sbjct  307  PDLEVLQLWENNFTGSIPEKL  327



>ref|XP_010936307.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1007

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 97/137 (71%), Gaps = 5/137 (4%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSWNISTS--HCTWRRVTCdsl--lhvvsldlsglNLSGV  375
            E+ ALLS+K+A + D  ++L  WN S +  HC+W  V CD      V++LDLSGLNLSG 
Sbjct  33   ERVALLSLKSALS-DPGAALAGWNASANPDHCSWPGVACDDAPLRRVIALDLSGLNLSGS  91

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  555
            L P V  L  L+NLS AAN LSGP+P ++S +S LR+LNLSNN+F  +FP  L +L NL+
Sbjct  92   LPPAVAHLRHLLNLSTAANLLSGPIPLDLSLLSDLRYLNLSNNVFNGSFPSALRRLKNLE  151

Query  556  VLDLYNNNLTGDLPVEV  606
            VLDLYNNNLTG LP EV
Sbjct  152  VLDLYNNNLTGILPAEV  168


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L P +G    +  L +  NQ SG +PPEI  +  L  ++ S+N F S  P ++++ 
Sbjct  475  LSGPLPPSIGNFSGVQKLLLNQNQFSGRIPPEIGRLQQLSKVDFSSNRFSSGIPPEISKC  534

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  NNL+GD+P E+  M
Sbjct  535  KLLTFVDLSRNNLSGDIPAEIAGM  558


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G L  L  L +  N LSG +PPE+  + +L+ ++LSNN      P   A L
Sbjct  257  LSGQIPPELGHLEHLDTLFLQVNGLSGELPPELGRLRSLKSMDLSNNALTGEIPPTFADL  316

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  317  RNLTLLNLFRNKLYGTIP  334


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L P++G+L  L ++ ++ N L+G +PP  + +  L  LNL  N    T P  +  L
Sbjct  281  LSGELPPELGRLRSLKSMDLSNNALTGEIPPTFADLRNLTLLNLFRNKLYGTIPDFIGDL  340

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+VL L++NN TG +P
Sbjct  341  PELEVLQLWDNNFTGIIP  358


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 47/86 (55%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG + P++G+L  L  +  ++N+ S  +PPEIS    L F++LS N      P ++A +
Sbjct  499  FSGRIPPEIGRLQQLSKVDFSSNRFSSGIPPEISKCKLLTFVDLSRNNLSGDIPAEIAGM  558

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G +P  +  M S
Sbjct  559  RILNYLNLSRNHLEGSIPPSISTMQS  584


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 42/76 (55%), Gaps = 0/76 (0%)
 Frame = +1

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  549
            G + P++G L  LV    A   LSG +PPE+  +  L  L L  N      P +L +L +
Sbjct  235  GGIPPEIGHLSALVRFDAANCGLSGQIPPELGHLEHLDTLFLQVNGLSGELPPELGRLRS  294

Query  550  LQVLDLYNNNLTGDLP  597
            L+ +DL NN LTG++P
Sbjct  295  LKSMDLSNNALTGEIP  310



>ref|XP_003608587.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES90784.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1005

 Score =   113 bits (283),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 101/139 (73%), Gaps = 2/139 (1%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  381
            ++E  +LLS K++ T D Q+ LTSWN  T +C+W  + C    HV+SL+L+ L+L+G LS
Sbjct  25   ISEYHSLLSFKSSITNDPQNILTSWNPKTPYCSWYGIKCSQHRHVISLNLTSLSLTGTLS  84

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
              +  LPFL NLS+A N+ SGP+P  +S++S+LRFLNLSNNIF  T P +L+ L NLQVL
Sbjct  85   --LSNLPFLTNLSLADNKFSGPIPSSLSSLSSLRFLNLSNNIFNGTLPQELSNLFNLQVL  142

Query  562  DLYNNNLTGDLPVEVYKMT  618
            DLYNNN+TG LPV V  ++
Sbjct  143  DLYNNNMTGSLPVSVTHLS  161


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN F    P   A+L
Sbjct  246  LTGEVPPELGKLQKLDTLFLQVNALSGSLTSELGNLKSLKSMDLSNNAFTGEVPVSFAEL  305

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
             NL +L+L+ N L G +P  + +M S
Sbjct  306  KNLTLLNLFRNKLHGAIPEFIGEMPS  331


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++     L  + ++ N+LSG +P EI+ +  L +LNLS N    T P  +A +
Sbjct  510  FSGPIAPEISHCKLLTFVDLSRNELSGEIPKEITKMKILNYLNLSRNHLVGTIPGSIASM  569

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNLTG +P
Sbjct  570  QSLTSVDFSYNNLTGLVP  587


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG +  ++G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P ++ ++
Sbjct  486  FSGKIPAEIGKLHQLSKIDFSHNKFSGPIAPEISHCKLLTFVDLSRNELSGEIPKEITKM  545

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G +P  +  M S
Sbjct  546  KILNYLNLSRNHLVGTIPGSIASMQS  571


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 0/77 (0%)
 Frame = +1

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  549
            G + P++G L  +V    A   L+G VPPE+  +  L  L L  N    +   +L  L +
Sbjct  224  GGIPPEIGNLSEMVRFDAAYCGLTGEVPPELGKLQKLDTLFLQVNALSGSLTSELGNLKS  283

Query  550  LQVLDLYNNNLTGDLPV  600
            L+ +DL NN  TG++PV
Sbjct  284  LKSMDLSNNAFTGEVPV  300


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 45/83 (54%), Gaps = 0/83 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+ ++G L  L ++ ++ N  +G VP   + +  L  LNL  N      P  + ++
Sbjct  270  LSGSLTSELGNLKSLKSMDLSNNAFTGEVPVSFAELKNLTLLNLFRNKLHGAIPEFIGEM  329

Query  544  ANLQVLDLYNNNLTGDLPVEVYK  612
             +L+VL ++ NN TG +P  + K
Sbjct  330  PSLEVLQIWENNFTGSIPQSLGK  352



>ref|XP_008790445.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=1019

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 90/130 (69%), Gaps = 5/130 (4%)
 Frame = +1

Query  226  SIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsl--lhvvsldlsglNLSGVLSPDVG  393
            S+K+A + D  ++L  WN S    HC+W  V CD+     V+SLDL+GLNLSG L P V 
Sbjct  42   SLKSALS-DPGAALAGWNASAYPDHCSWPGVACDNAPLRRVISLDLTGLNLSGSLPPAVA  100

Query  394  QLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYN  573
             L  L+NLS AAN LSGP+PPE+S +  LR LNLSNN+F  +FP  L +L +L+VLDLYN
Sbjct  101  HLRHLLNLSAAANLLSGPIPPELSLLFDLRHLNLSNNVFNGSFPSALRRLKHLEVLDLYN  160

Query  574  NNLTGDLPVE  603
            NNLTG LP E
Sbjct  161  NNLTGVLPAE  170


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G+L  L  L +  N LSG +PPE+  + +L+ ++LSNN F    P   A L
Sbjct  260  LSGEIPPELGRLENLDTLFLQVNGLSGELPPELGRLRSLKSMDLSNNAFTGEIPPTFADL  319

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  320  RNLTLLNLFRNKLYGTIP  337


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L P++G+L  L ++ ++ N  +G +PP  + +  L  LNL  N    T P  +  L
Sbjct  284  LSGELPPELGRLRSLKSMDLSNNAFTGEIPPTFADLRNLTLLNLFRNKLYGTIPDFIGDL  343

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+VL L++NN TG +P
Sbjct  344  PELEVLQLWDNNFTGIIP  361


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL+GVL  +   LP L +L +  N  SG +PPE      L +L +S N  G   P ++  
Sbjct  162  NLTGVLPAEAADLPNLRHLHLGGNFFSGVIPPEYGRWEHLEYLAVSGNELGGAIPPEIGN  221

Query  541  LANLQVLDL-YNNNLTGDLPVEVYKMTS  621
            L  L+ L + Y N+  G +P E  K+++
Sbjct  222  LTRLRQLYIGYFNSYDGGIPPEFGKLSA  249


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 41/76 (54%), Gaps = 0/76 (0%)
 Frame = +1

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  549
            G + P+ G+L  LV    A   LSG +PPE+  +  L  L L  N      P +L +L +
Sbjct  238  GGIPPEFGKLSALVRFDAANCGLSGEIPPELGRLENLDTLFLQVNGLSGELPPELGRLRS  297

Query  550  LQVLDLYNNNLTGDLP  597
            L+ +DL NN  TG++P
Sbjct  298  LKSMDLSNNAFTGEIP  313


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG + P++ +   L  + +  N LSG +P EI+ +  L +LNLS N    + P  +A +
Sbjct  526  FSGGIPPEMSKCKLLTFVDLGRNNLSGEIPGEIAGMRILNYLNLSRNHLEGSIPPSIATM  585

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  586  QSLTAVDFSYNNLSGLVP  603


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 3/80 (4%)
 Frame = +1

Query  382  PDVGQL---PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  552
            PD G     P L  +S++ N+LSGP+PP I   S ++ L L+ N F    P ++ +L  L
Sbjct  457  PDTGNASISPSLGQISLSNNRLSGPLPPCIGNFSGVQKLLLNQNQFSGRIPTEIGRLQQL  516

Query  553  QVLDLYNNNLTGDLPVEVYK  612
              +D  +N+ +G +P E+ K
Sbjct  517  SKVDFSSNSFSGGIPPEMSK  536



>gb|ADB85326.1| putative receptor protein kinase [Phyllostachys edulis]
Length=265

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 83/124 (67%), Gaps = 1/124 (1%)
 Frame = +1

Query  247  ADSQSSLTSW-NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSI  423
            +D   +L SW N + SHC W  VTC +   VV LD++GLNLSG L P + +L  L  LS+
Sbjct  36   SDPTGALASWANGTASHCAWAGVTCSTRGTVVGLDVAGLNLSGALPPALSRLRGLFRLSV  95

Query  424  AANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVE  603
            AAN  SGP+P  ++ +  L  LNLSNN F  +FP  LA+L +L+VLDLYNNNLT  LP+E
Sbjct  96   AANAFSGPIPASLARLQFLVHLNLSNNAFDGSFPAPLARLRSLRVLDLYNNNLTSPLPLE  155

Query  604  VYKM  615
            V +M
Sbjct  156  VVQM  159


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 47/88 (53%), Gaps = 1/88 (1%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL+  L  +V Q+P L +L +  N  SG +PPE      L++L +S N      P +L  
Sbjct  147  NLTSPLPLEVVQMPQLRHLHLGGNFFSGEIPPEYGRWGRLQYLAVSGNELSGKIPPELGN  206

Query  541  LANLQVLDL-YNNNLTGDLPVEVYKMTS  621
            L +L+ L + Y N+ +G LP E+  +T 
Sbjct  207  LTSLRELYIGYYNSYSGGLPPELGNLTE  234



>ref|XP_008237309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Prunus mume]
Length=968

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            +L G LS D+  L FL N ++A NQ SGP+P EISA+S LR LNLSNNIF +TFP QL+ 
Sbjct  26   DLVGTLSSDIAHLRFLSNGTLADNQFSGPIPSEISALSGLRLLNLSNNIFNTTFPPQLSN  85

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            L  L VLDLYNNNLTGDLPV V  MTS
Sbjct  86   LTRLAVLDLYNNNLTGDLPVAVTHMTS  112


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             SG + P+ G+ P L  L+++ N+L G +PPEI  +++L+ L +   N++    P ++  
Sbjct  123  FSGRIPPEFGRFPLLEYLAVSGNELGGSIPPEIGNLTSLKELYIGYYNVYEGGIPPEIGN  182

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L  LD  N NLTG++P E+ ++
Sbjct  183  LSQLVRLDAANCNLTGEVPRELGRL  207


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG + P++G+L  L  +  + N+  GP+ PEIS    L F++LS N      P ++  +
Sbjct  436  FSGRIPPEIGRLQQLSKIDFSHNKFLGPIAPEISQCKLLTFVDLSRNELAGEIPKEITGM  495

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G +P  +  M S
Sbjct  496  RILNYLNLSRNHLVGSIPSSISTMQS  521


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 41/78 (53%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L+ ++G L  L ++ ++ N  SG +P   S +  L  LNL  N      P  +  L
Sbjct  220  LSGSLTAELGSLKSLKSMDLSNNMFSGEIPGSFSELKNLTLLNLFRNKLHGAIPEFIGDL  279

Query  544  ANLQVLDLYNNNLTGDLP  597
              LQVL L+ NN TG +P
Sbjct  280  PELQVLQLWENNFTGSIP  297


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL+G +  ++G+L  +  L +  N LSG +  E+ ++ +L+ ++LSNN+F    P   ++
Sbjct  195  NLTGEVPRELGRLQNVDTLFLQVNALSGSLTAELGSLKSLKSMDLSNNMFSGEIPGSFSE  254

Query  541  LANLQVLDLYNNNLTGDLP  597
            L NL +L+L+ N L G +P
Sbjct  255  LKNLTLLNLFRNKLHGAIP  273


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 44/84 (52%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++ S+N F      +++Q 
Sbjct  412  LSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFSHNKFLGPIAPEISQC  471

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L G++P E+  M
Sbjct  472  KLLTFVDLSRNELAGEIPKEITGM  495


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/76 (32%), Positives = 45/76 (59%), Gaps = 0/76 (0%)
 Frame = +1

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  549
            G ++P++ Q   L  + ++ N+L+G +P EI+ +  L +LNLS N    + P  ++ + +
Sbjct  462  GPIAPEISQCKLLTFVDLSRNELAGEIPKEITGMRILNYLNLSRNHLVGSIPSSISTMQS  521

Query  550  LQVLDLYNNNLTGDLP  597
            L  +D   NNL+G +P
Sbjct  522  LTSVDFSYNNLSGLVP  537



>ref|XP_009396449.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1006

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 88/127 (69%), Gaps = 3/127 (2%)
 Frame = +1

Query  244  TADSQSSLTSWNISTS--HCTWRRVTCd-sllhvvsldlsglNLSGVLSPDVGQLPFLVN  414
             +D   +L++WN S S  HC+W  V CD     VVSLDL+G NLSG LS  V +L  L+N
Sbjct  43   VSDPSDALSAWNNSASGGHCSWPGVACDPLRGFVVSLDLTGFNLSGTLSLAVVRLRHLLN  102

Query  415  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  594
            LS A+N LSGP+P E+S +S LR LNLSNN+F  +FP  + +L NL VLD+YNNNLTG L
Sbjct  103  LSAASNSLSGPIPAELSRLSNLRHLNLSNNLFNGSFPSAIVRLKNLLVLDIYNNNLTGPL  162

Query  595  PVEVYKM  615
            P EV ++
Sbjct  163  PAEVSEL  169


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG + P++G+L  L  L  + N+ SGP+ PEIS    L F++LS N      P ++A +
Sbjct  497  FSGRIPPEMGRLQQLSKLDFSGNRFSGPIAPEISRCKLLTFVDLSRNELSGELPPEIAGM  556

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N L G +P  +  M S
Sbjct  557  RILNYLNLSRNQLEGSIPASIATMQS  582


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  540
             SGV+ P  G+  FL  L+++ N+L GP+PPE+  ++ LR L L   N F    P ++  
Sbjct  182  FSGVIPPVFGRWEFLEYLAVSGNELGGPIPPELGNLTRLRQLYLGYFNNFEGGIPPEIGG  241

Query  541  LANLQVLDLYNNNLTGDLPVEV  606
            L  L  LD+ N  LTG++P E+
Sbjct  242  LPELVRLDMANCGLTGEIPPEL  263


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            N  G + P++G LP LV L +A   L+G +PPE+  +  L  L L  N      P +L +
Sbjct  230  NFEGGIPPEIGGLPELVRLDMANCGLTGEIPPELGNLQNLDTLFLQVNGLSGRLPVELGR  289

Query  541  LANLQVLDLYNNNLTGDLP  597
            L +L+ +DL NN LTG++P
Sbjct  290  LRSLKSMDLSNNALTGEIP  308


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ +   L  + ++ N+LSG +PPEI+ +  L +LNLS N    + P  +A +
Sbjct  521  FSGPIAPEISRCKLLTFVDLSRNELSGELPPEIAGMRILNYLNLSRNQLEGSIPASIATM  580

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  581  QSLTAVDFSYNNLSGLVP  598


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 45/84 (54%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L P +G L  L  L +  NQ SG +PPE+  +  L  L+ S N F      ++++ 
Sbjct  473  LSGPLPPSIGNLTGLQKLLLNQNQFSGRIPPEMGRLQQLSKLDFSGNRFSGPIAPEISRC  532

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L+G+LP E+  M
Sbjct  533  KLLTFVDLSRNELSGELPPEIAGM  556


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P++G L  L  L +  N LSG +P E+  + +L+ ++LSNN      P   A L
Sbjct  255  LTGEIPPELGNLQNLDTLFLQVNGLSGRLPVELGRLRSLKSMDLSNNALTGEIPSSFADL  314

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  315  QNLTLLNLFRNKLHGSIP  332


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 43/83 (52%), Gaps = 1/83 (1%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL+G L  +V +LP L +L +  N  SG +PP       L +L +S N  G   P +L  
Sbjct  157  NLTGPLPAEVSELPNLRHLHLGGNFFSGVIPPVFGRWEFLEYLAVSGNELGGPIPPELGN  216

Query  541  LANLQVLDL-YNNNLTGDLPVEV  606
            L  L+ L L Y NN  G +P E+
Sbjct  217  LTRLRQLYLGYFNNFEGGIPPEI  239


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 45/79 (57%), Gaps = 6/79 (8%)
 Frame = +1

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  555
            +SPD+GQ+      S++ N+LSGP+PP I  ++ L+ L L+ N F    P ++ +L  L 
Sbjct  459  ISPDLGQI------SLSNNRLSGPLPPSIGNLTGLQKLLLNQNQFSGRIPPEMGRLQQLS  512

Query  556  VLDLYNNNLTGDLPVEVYK  612
             LD   N  +G +  E+ +
Sbjct  513  KLDFSGNRFSGPIAPEISR  531


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L  ++G+L  L ++ ++ N L+G +P   + +  L  LNL  N    + P  +  L
Sbjct  279  LSGRLPVELGRLRSLKSMDLSNNALTGEIPSSFADLQNLTLLNLFRNKLHGSIPEFVGDL  338

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+VL L+ NN TG +P
Sbjct  339  PALEVLQLWENNFTGGIP  356



>dbj|BAJ84911.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96166.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1020

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 77/124 (62%), Gaps = 2/124 (2%)
 Frame = +1

Query  250  DSQSSLTSW-NISTSHCTWRRVTCdsllhvvsldl-sglNLSGVLSPDVGQLPFLVNLSI  423
            D   SL SW N ST  C W  V+CD     V     SG NLSG +     +LP+L  L++
Sbjct  37   DPTGSLASWSNASTGPCAWSGVSCDGRSGAVVGVDLSGRNLSGAVPRAFSRLPYLARLNL  96

Query  424  AANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVE  603
            AAN LSGP+PP +S +  L +LNLS+N+   +FP  LA+L  L+VLDLYNNN TG LP+E
Sbjct  97   AANSLSGPIPPSLSRLGLLTYLNLSSNLLNGSFPPPLARLRALRVLDLYNNNFTGSLPLE  156

Query  604  VYKM  615
            V  M
Sbjct  157  VVGM  160


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            +  G +  ++G+   L  L ++ N+LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  510  SFDGGVPSEIGKCRLLTYLDVSQNKLSGDIPPAISGMRILNYLNLSRNQLDGEIPVTIAA  569

Query  541  LANLQVLDLYNNNLTGDLPV  600
            + +L  +D   NNL+G +PV
Sbjct  570  MQSLTAVDFSYNNLSGLVPV  589


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 48/83 (58%), Gaps = 3/83 (4%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR--FLNLSNNIFGSTFPHQLA  537
             SG + P+ G+   L  L+++ N+LSG +PPE+  +++LR  ++   NN  G   P +L 
Sbjct  173  FSGEIPPEYGRWGRLQYLAVSGNELSGKIPPELGNLTSLRQLYIGYYNNYSGG-IPAELG  231

Query  538  QLANLQVLDLYNNNLTGDLPVEV  606
             +  L  LD  N  L+G++P E+
Sbjct  232  NMTELVRLDAANCGLSGEIPPEL  254



>ref|XP_008440463.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Cucumis melo]
Length=973

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 99/138 (72%), Gaps = 2/138 (1%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsglNLSGVLS  381
            E  ALLS+K++ + D  SSL+SWN +   +HC+W  VTCDS  HVV+LDLS L+L+  LS
Sbjct  39   ESQALLSLKSSISDDPHSSLSSWNPAAVATHCSWLGVTCDSHRHVVALDLSSLDLTATLS  98

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            P +  L FL N+S   N+ SG +PPEI+++S+L+ LNLS+N+   + P + ++L NLQVL
Sbjct  99   PHIASLRFLTNVSFGLNKFSGGIPPEIASLSSLQLLNLSSNVLNGSIPSEFSRLKNLQVL  158

Query  562  DLYNNNLTGDLPVEVYKM  615
            D+YNNNLTG+ P  V +M
Sbjct  159  DVYNNNLTGEFPRVVTEM  176


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 44/83 (53%), Gaps = 1/83 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L  ++G L  +  L I+ N L G +P   +    LR L+L +N      P  +A L
Sbjct  286  LSGPLM-ELGGLKSIEALDISCNMLVGEIPISFAVFKNLRLLHLFDNKLSGEIPGFMADL  344

Query  544  ANLQVLDLYNNNLTGDLPVEVYK  612
              L++L L+NNN TG +P  + K
Sbjct  345  PKLEILQLWNNNFTGSIPRNLGK  367


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 46/85 (54%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             +G + P+VG+L FL  L+I  N L GP+P  I  ++ LR L +   N F    P  +  
Sbjct  189  FTGRIPPEVGRLQFLEFLAIHGNDLEGPIPQTIGNLTKLRELFIGYYNTFVGGIPATIGN  248

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L  LD  +  L+G +P E+ K+
Sbjct  249  LSELVRLDAASCGLSGKIPRELGKL  273



>ref|XP_008787754.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=990

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 83/149 (56%), Gaps = 27/149 (18%)
 Frame = +1

Query  163  RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHC-TWRRVTCdsllhvv  339
            R SA A AG+   V E  ALL +KAA +     S   W+ +  HC +W  V CD+     
Sbjct  15   RPSAAADAGEVTAV-EHRALLDVKAA-SGSPSGSFAGWDATADHCRSWAGVACDAAGR--  70

Query  340  sldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  519
                                  +V+L I+   LSGP+PPE+S +S LR+LNLSNN+F  T
Sbjct  71   ----------------------VVSLDISNLNLSGPIPPELSLLSGLRYLNLSNNVFNGT  108

Query  520  FPHQLAQLANLQVLDLYNNNLTGDLPVEV  606
            FP  L+ L NL+VLD+YNNNLTG LPV+V
Sbjct  109  FPSALSSLKNLRVLDIYNNNLTGVLPVDV  137


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 47/84 (56%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L   +G  P L  L +  NQ SG +PPEI  +  L  ++ S N F    P + ++ 
Sbjct  441  LSGALPSSIGNFPGLQKLLLGQNQFSGCIPPEIGKLQQLSKMDFSGNRFSCPIPAETSKC  500

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  NNL+G++PVE+ +M
Sbjct  501  KLLTFIDLSRNNLSGEIPVEITEM  524


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG + P++G+L  L  +  + N+ S P+P E S    L F++LS N      P ++ ++
Sbjct  465  FSGCIPPEIGKLQQLSKMDFSGNRFSCPIPAETSKCKLLTFIDLSRNNLSGEIPVEITEM  524

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G++P  +  M S
Sbjct  525  RILNYLNLSRNHLEGEIPTSISTMQS  550


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L G ++P++G+L  L ++ ++ N L+G +PP  + +  L  LNL  N      P  +  L
Sbjct  250  LFGEITPELGKLRSLKSMDLSNNALAGEIPPTFADLKNLTLLNLFRNKLYGAIPDFVGDL  309

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+VL L+ NN TG++P
Sbjct  310  PQLEVLQLWENNFTGEIP  327


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G L  L  L +  N L G + PE+  + +L+ ++LSNN      P   A L
Sbjct  226  LSGEIPPEMGNLQNLDTLFLQVNGLFGEITPELGKLRSLKSMDLSNNALAGEIPPTFADL  285

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  286  KNLTLLNLFRNKLYGAIP  303


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL+GVL  DV  LP L +L +  N  SG +PPE      + +L +S N  G     +L  
Sbjct  128  NLTGVLPVDVADLPALRHLHLGGNFFSGAIPPEYGRWEHIEYLAISGNELGGPITPELGN  187

Query  541  LANLQVLDL-YNNNLTGDLPVEVYKMTS  621
            L +L+ L + Y N+  G LP  +  +TS
Sbjct  188  LTSLRELYIGYFNSYQGSLPAAIGNLTS  215



>ref|XP_004143533.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 gb|KGN48656.1| Receptor-like protein kinase 3 [Cucumis sativus]
Length=984

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 99/138 (72%), Gaps = 2/138 (1%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsglNLSGVLS  381
            E  ALLS+K++ + D  SSL+SWN +   +HC+W  VTCDS  HVV+LDLS L+L+  +S
Sbjct  41   ESQALLSLKSSISDDPHSSLSSWNPAAVHAHCSWLGVTCDSRRHVVALDLSSLDLTATIS  100

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            P +  L FL N+S   N++ G +PPEI+++S+L+ LNLS+N+   + P + ++L NLQVL
Sbjct  101  PHISSLRFLTNVSFGLNKIFGGIPPEIASLSSLQLLNLSSNVLNGSIPSEFSRLKNLQVL  160

Query  562  DLYNNNLTGDLPVEVYKM  615
            D+YNNNLTGD P  V +M
Sbjct  161  DVYNNNLTGDFPRVVTEM  178


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 46/85 (54%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             +G + P+VG+L FL  L+I  N L GP+PP I  ++ LR L +   N F    P  +  
Sbjct  191  FTGRIPPEVGRLQFLEFLAIHGNDLEGPIPPAIGNLTKLRELFIGYYNTFVGGIPATIGN  250

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L  LD  +  L+G  P E+ K+
Sbjct  251  LSELVRLDAASCGLSGKFPRELGKL  275


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 43/83 (52%), Gaps = 1/83 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L  ++G L  +  L I+ N L G +P   +    LR L L +N      P  +A L
Sbjct  288  LSGSLM-ELGGLKSIEELDISCNMLVGEIPISFAVFKNLRLLQLFDNKLSGEIPEFMADL  346

Query  544  ANLQVLDLYNNNLTGDLPVEVYK  612
              L++L L+NNN TG +P  + K
Sbjct  347  PKLEILQLWNNNFTGSIPRNLGK  369



>ref|XP_004160944.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1-like [Cucumis sativus]
Length=984

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 99/138 (72%), Gaps = 2/138 (1%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsglNLSGVLS  381
            E  ALLS+K++ + D  SSL+SWN +   +HC+W  VTCDS  HVV+LDLS L+L+  +S
Sbjct  41   ESQALLSLKSSISDDPHSSLSSWNPAAVHAHCSWLGVTCDSRRHVVALDLSSLDLTATIS  100

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            P +  L FL N+S   N++ G +PPEI+++S+L+ LNLS+N+   + P + ++L NLQVL
Sbjct  101  PHISSLRFLTNVSFGLNKIFGGIPPEIASLSSLQLLNLSSNVLNGSIPSEFSRLKNLQVL  160

Query  562  DLYNNNLTGDLPVEVYKM  615
            D+YNNNLTGD P  V +M
Sbjct  161  DVYNNNLTGDFPRVVTEM  178


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 46/85 (54%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             +G + P+VG+L FL  L+I  N L GP+PP I  ++ LR L +   N F    P  +  
Sbjct  191  FTGRIPPEVGRLQFLEFLAIHGNDLEGPIPPAIGNLTKLRELFIGYYNTFVGGIPATIGN  250

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L+ L  LD  +  L+G  P E+ K+
Sbjct  251  LSELVRLDAASCGLSGKFPRELGKL  275


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 43/83 (52%), Gaps = 1/83 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L  ++G L  +  L I+ N L G +P   +    LR L L +N      P  +A L
Sbjct  288  LSGSLM-ELGGLKSIEELDISCNMLVGEIPISFAVFKNLRLLQLFDNKLSGEIPEFMADL  346

Query  544  ANLQVLDLYNNNLTGDLPVEVYK  612
              L++L L+NNN TG +P  + K
Sbjct  347  PKLEILQLWNNNFTGSIPRNLGK  369



>ref|XP_009411355.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1009

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 91/127 (72%), Gaps = 3/127 (2%)
 Frame = +1

Query  244  TADSQSSLTSWNIS--TSHCTWRRVTCd-sllhvvsldlsglNLSGVLSPDVGQLPFLVN  414
             +D  +SL++WN S    HC+W  V CD     VVSLDL+G NLSG L P VG+L  L+N
Sbjct  41   VSDPSASLSAWNSSAGVGHCSWPGVGCDPIQGSVVSLDLTGFNLSGSLFPAVGRLRHLLN  100

Query  415  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  594
            LS A+N LSGP+P EIS +++LR LNLSNN+   +FP  LA+L NL VLDLYNNNLTG L
Sbjct  101  LSAASNSLSGPIPAEISRLASLRHLNLSNNLLNGSFPSALARLKNLLVLDLYNNNLTGPL  160

Query  595  PVEVYKM  615
            PVEV ++
Sbjct  161  PVEVAQL  167


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            +  G + P++G LP LV L +A   L+G +PPE+  +  L  L L  N      P +L +
Sbjct  228  SFEGGIPPEIGSLPALVRLDMANCGLNGEIPPELWKLQNLDTLFLQVNGLAGDIPPELGR  287

Query  541  LANLQVLDLYNNNLTGDLP  597
            L +L+ +DL NN LTG++P
Sbjct  288  LRSLKSMDLSNNALTGEIP  306


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             S  + P++G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P ++A++
Sbjct  495  FSDRIPPEIGRLQELSKVDFSGNRFSGPITPEISRCKLLTFVDLSRNELSGEIPPEIARM  554

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N L G +P  +  M S
Sbjct  555  RILNYLNLSRNQLEGGIPPSIATMQS  580


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG ++P++ +   L  + ++ N+LSG +PPEI+ +  L +LNLS N      P  +A +
Sbjct  519  FSGPITPEISRCKLLTFVDLSRNELSGEIPPEIARMRILNYLNLSRNQLEGGIPPSIATM  578

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   N L+G +P
Sbjct  579  QSLTAVDFSYNKLSGHVP  596


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P++ +L  L  L +  N L+G +PPE+  + +L+ ++LSNN      P   A L
Sbjct  253  LNGEIPPELWKLQNLDTLFLQVNGLAGDIPPELGRLRSLKSMDLSNNALTGEIPATFADL  312

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  313  ENLTLLNLFRNKLRGLIP  330


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 44/83 (53%), Gaps = 1/83 (1%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL+G L  +V QLP L +L +  N  +G +PPE      L +L +S N  G   P +L  
Sbjct  155  NLTGPLPVEVAQLPNLRHLHLGGNFFTGVIPPEFGRWEFLEYLAVSGNELGGPIPPELGN  214

Query  541  LANLQVLDL-YNNNLTGDLPVEV  606
            L  L+ L + Y N+  G +P E+
Sbjct  215  LTRLRQLYVGYFNSFEGGIPPEI  237


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P++G+L  L ++ ++ N L+G +P   + +  L  LNL  N      P  + +L
Sbjct  277  LAGDIPPELGRLRSLKSMDLSNNALTGEIPATFADLENLTLLNLFRNKLRGLIPEFIGEL  336

Query  544  ANLQVLDLYNNNLTGDLPVEVYK  612
              L+VL L+ NN TG +P ++ +
Sbjct  337  PALEVLQLWENNFTGGIPRQLGR  359


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 44/84 (52%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P +G    +  L +  NQ S  +PPEI  +  L  ++ S N F      ++++ 
Sbjct  471  LSGSIPPSIGNYSGVQKLLLNQNQFSDRIPPEIGRLQELSKVDFSGNRFSGPITPEISRC  530

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  +DL  N L+G++P E+ +M
Sbjct  531  KLLTFVDLSRNELSGEIPPEIARM  554



>ref|XP_007017845.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY15070.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=982

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 89/145 (61%), Gaps = 4/145 (3%)
 Frame = +1

Query  199  GVTEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLS  369
            G ++   LL +K++      S L  W  S+S   HC +  V CD   HVVSL+ S   LS
Sbjct  25   GYSDLEVLLKLKSSMIGPKGSGLEDWEFSSSPSAHCHFSGVQCDEEFHVVSLNASFAPLS  84

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ-LAQLA  546
            G + P++G L  LVNL+IAA  L+G +P E+  +++L+  N+SNN+F  +FP + L  + 
Sbjct  85   GTIPPEIGLLNKLVNLTIAAANLTGKIPVEMGNLTSLKLFNISNNVFKGSFPGEILTGMT  144

Query  547  NLQVLDLYNNNLTGDLPVEVYKMTS  621
             L++LD YNNN TG LP+EV  +T+
Sbjct  145  ELEILDAYNNNFTGLLPIEVANLTN  169



>ref|XP_006650665.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Oryza brachyantha]
Length=1021

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 83/127 (65%), Gaps = 4/127 (3%)
 Frame = +1

Query  247  ADSQSSLTSW----NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVN  414
            +D   +L SW    N STSHC+W  VTC S   VV LD+SG NLSG L  ++ +L  L+ 
Sbjct  32   SDPTGALASWGNGTNTSTSHCSWAGVTCSSRGTVVGLDVSGFNLSGALPAELSRLRGLLR  91

Query  415  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  594
            L++ AN  SGP+P  +  +  L +LNLSNN F  +FP  LA+L  L+VLDLYNNNLT  L
Sbjct  92   LAVGANAFSGPIPGSLGRLQFLTYLNLSNNAFNGSFPAALARLRGLRVLDLYNNNLTSPL  151

Query  595  PVEVYKM  615
            P+EV +M
Sbjct  152  PMEVVQM  158


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SGV+ P++GQL  L    +++N   G VPPEI     L +L+LS N      P  ++ +
Sbjct  485  FSGVVPPEIGQLQQLSKADLSSNAFEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISGM  544

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G++P  +  M S
Sbjct  545  RILNYLNLSRNHLDGEIPPSIATMQS  570


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
              G + P++G+   L  L ++ N +SG +PP IS +  L +LNLS N      P  +A +
Sbjct  509  FEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNHLDGEIPPSIATM  568

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  569  QSLTAVDFSYNNLSGLVP  586


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN+     P   ++L
Sbjct  244  LSGEIPPELGKLQNLDTLFLQVNGLTGGIPSELGYLKSLSSLDLSNNVLTGEIPASFSEL  303

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
             NL +L+L+ N L GD+P  V  + S
Sbjct  304  KNLTLLNLFRNKLRGDIPDFVGDLPS  329


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 47/88 (53%), Gaps = 1/88 (1%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL+  L  +V Q+P L +L +  N  SG +PPE      +++L +S N      P +L  
Sbjct  146  NLTSPLPMEVVQMPLLRHLHLGGNFFSGEIPPEYGRWGRMQYLAVSGNELSGRIPPELGN  205

Query  541  LANLQVLDL-YNNNLTGDLPVEVYKMTS  621
            L +L+ L + Y N+ +G LP E+  +T 
Sbjct  206  LTSLRELYIGYYNSYSGGLPPELGNLTE  233


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 42/84 (50%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G L   +G    +  L +  N  SG VPPEI  +  L   +LS+N F    P ++ + 
Sbjct  461  LTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGQLQQLSKADLSSNAFEGGVPPEIGKC  520

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  LDL  NN++G +P  +  M
Sbjct  521  RLLTYLDLSRNNISGKIPPAISGM  544



>ref|XP_008357152.1| PREDICTED: receptor protein kinase CLAVATA1-like [Malus domestica]
Length=837

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 86/133 (65%), Gaps = 1/133 (1%)
 Frame = +1

Query  220  LLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQL  399
            LL +KAA     +S L  WN S+SHC++  V CD    VVSL++S L L G ++ ++G L
Sbjct  33   LLKLKAAMIGXKRSGLEDWNPSSSHCSFSGVLCDRDSRVVSLNVSNLPLYGTIAAEIGLL  92

Query  400  PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNN  576
              LVNL+IA N  +G +P E++ ++ L+ LN+S N+F  +FP ++   +  L+VLD YNN
Sbjct  93   DKLVNLTIAGNNFTGRLPAEMANLTALKHLNISGNLFHGSFPIEIVVGMTELEVLDAYNN  152

Query  577  NLTGDLPVEVYKM  615
            N TG LPVE+  +
Sbjct  153  NFTGTLPVELVSL  165


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL G +   +  L  L  L +  N+LSG +PPE+SA++ L  L+LS N      P   ++
Sbjct  250  NLVGPIPTTLSLLKHLHTLFLQVNRLSGSIPPELSALNRLMSLDLSINELSGEIPESFSE  309

Query  541  LANLQVLDLYNNNLTGDLP  597
            L N+ +++LY NNL G +P
Sbjct  310  LKNITLINLYRNNLYGPIP  328


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 47/79 (59%), Gaps = 2/79 (3%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNL-SNNIFGSTFPHQLAQ  540
            LSG + P++  L  L++L ++ N+LSG +P   S +  +  +NL  NN++G   P  +  
Sbjct  275  LSGSIPPELSALNRLMSLDLSINELSGEIPESFSELKNITLINLYRNNLYGP-IPKFIGD  333

Query  541  LANLQVLDLYNNNLTGDLP  597
              +L+VL ++ NN T +LP
Sbjct  334  FPHLEVLQIWENNFTFELP  352



>ref|XP_008364929.1| PREDICTED: receptor protein kinase CLAVATA1-like [Malus domestica]
Length=973

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 86/133 (65%), Gaps = 1/133 (1%)
 Frame = +1

Query  220  LLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQL  399
            LL +KAA     +S L  WN S+SHC++  V CD    VVSL++S L L G ++ ++G L
Sbjct  33   LLKLKAAMIGXKRSGLEDWNPSSSHCSFSGVLCDRDSRVVSLNVSNLPLYGTIAAEIGLL  92

Query  400  PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNN  576
              LVNL+IA N  +G +P E++ ++ L+ LN+S N+F  +FP ++   +  L+VLD YNN
Sbjct  93   DKLVNLTIAGNNFTGRLPAEMANLTALKHLNISGNLFHGSFPIEIVVGMTELEVLDAYNN  152

Query  577  NLTGDLPVEVYKM  615
            N TG LPVE+  +
Sbjct  153  NFTGTLPVELVSL  165


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL G +   +  L  L  L +  N+LSG +PPE+SA++ L  L+LS N      P   ++
Sbjct  250  NLVGPIPTTLSLLKHLHTLFLQVNRLSGSIPPELSALNRLMSLDLSINELSGEIPESFSE  309

Query  541  LANLQVLDLYNNNLTGDLP  597
            L N+ +++LY NNL G +P
Sbjct  310  LKNITLINLYRNNLYGPIP  328


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG +  ++  L  L  ++I+AN     +P  IS  S+L   +LS N      P  +A+L
Sbjct  490  FSGEIPSEIFDLKLLSRINISANNJGRKIPDSISRCSSLTSADLSQNNLVGEIPKGIAKL  549

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L +L+   N LTG++P E+  MTS
Sbjct  550  KVLSILNFSRNQLTGEIPAEIRYMTS  575


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 45/85 (53%), Gaps = 0/85 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            +LSG + P  G L  L  L +  N  SG +P EI  +  L  +N+S N  G   P  +++
Sbjct  465  HLSGKIPPAXGNLKSLQTLXLEMNGFSGEIPSEIFDLKLLSRINISANNJGRKIPDSISR  524

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
             ++L   DL  NNL G++P  + K+
Sbjct  525  CSSLTSADLSQNNLVGEIPKGIAKL  549


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 47/79 (59%), Gaps = 2/79 (3%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNL-SNNIFGSTFPHQLAQ  540
            LSG + P++  L  L++L ++ N+LSG +P   S +  +  +NL  NN++G   P  +  
Sbjct  275  LSGSIPPELSALNRLMSLDLSINELSGEIPESFSELKNITLINLYRNNLYGP-IPKFIGD  333

Query  541  LANLQVLDLYNNNLTGDLP  597
              +L+VL ++ NN T +LP
Sbjct  334  FPHLEVLQIWENNFTFELP  352



>ref|XP_011045060.1| PREDICTED: receptor protein kinase CLAVATA1-like [Populus euphratica]
Length=972

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 89/144 (62%), Gaps = 5/144 (3%)
 Frame = +1

Query  199  GVTEQAALLSIKAAFTADSQSSLTSWNIS----TSHCTWRRVTCdsllhvvsldlsglNL  366
            G ++   LL +K +    + + L  W  S    T+HC +  V CD    VVSL+LS  +L
Sbjct  20   GYSDLEVLLKLKTSMCGHNGTGLQDWVASPASPTAHCYFSGVMCDEDSRVVSLNLSFRHL  79

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QL  543
             G++ P++G L  LVNL+++ N L+G  P EI+ +++LR LN+SNN+    FP ++   +
Sbjct  80   PGLIPPEIGLLNKLVNLTLSGNNLTGGFPVEIAMLTSLRILNISNNVIAGNFPGKITLGM  139

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
            A L+VLD+YNNN TG LP E+ K+
Sbjct  140  AQLEVLDVYNNNFTGALPTEIVKL  163


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +  ++  + FL  + I  N + G +P  I   ++L  ++ S N      P  +A+L
Sbjct  488  LSGEIPEEICGMKFLTKIDIRGNNIRGEIPASIFQCTSLTSVDFSQNSLSGGVPKTIAKL  547

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
             +L  LDL  N LTG LPVE+  M S
Sbjct  548  KDLSFLDLSRNQLTGQLPVEIGYMRS  573


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL G +   +GQL  L +L +  N L+G +PPE+S + +L+ L+LS N      P   + 
Sbjct  248  NLDGEIPSTLGQLTHLHSLFLQVNNLTGHIPPELSGLISLKSLDLSINNLTGEIPESFSD  307

Query  541  LANLQVLDLYNNNLTGDLP  597
            L ++++++L+ N L G +P
Sbjct  308  LKDIELVNLFQNKLHGPIP  326


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 43/84 (51%), Gaps = 1/84 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG +   +  LP    + ++ N  SG +PPEIS    L  L++SNN      P  +  L
Sbjct  417  FSGTIPAGMFNLPMATLVELSNNFFSGELPPEISG-DALGLLSVSNNRITGKIPPAIGNL  475

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
             NLQ L L  N L+G++P E+  M
Sbjct  476  KNLQTLSLDTNRLSGEIPEEICGM  499



>ref|XP_008370076.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Malus domestica]
Length=1053

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 74/132 (56%), Gaps = 1/132 (1%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls-glNLSGVLS  381
            +++ ALL  K   T D Q  ++SWN ST  C WR VTC++    V        NL G L+
Sbjct  43   SDRLALLDFKKRITEDPQHIMSSWNDSTHFCGWRGVTCNNSNKRVLTLKLNSQNLVGSLT  102

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            P +G L +L  +++ +N   G +P EI  + +L +LNLS N FG   P  ++    L+VL
Sbjct  103  PSIGNLTYLTGINLTSNGFHGEIPQEIGRLRSLEYLNLSYNSFGGKIPTNMSSCTQLKVL  162

Query  562  DLYNNNLTGDLP  597
             +Y+N LTG +P
Sbjct  163  SIYSNKLTGSIP  174


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 46/85 (54%), Gaps = 0/85 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G L  +VG L  L  L ++ N+LSG +P  + +   L  L+L  N F    P  L  L
Sbjct  515  LTGSLPSEVGDLVNLAELDVSENKLSGEIPQTLGSCIMLVRLHLEGNKFEGIIPQSLKNL  574

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMT  618
             +L+ +D+  NNL+G LP  + K T
Sbjct  575  RSLEEIDVSGNNLSGQLPEFLGKFT  599


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            N  G +   +G+L  LV L + +N+LSGP+P  +  +S L  L L  N+F  + P  LA 
Sbjct  417  NFGGTVPNTIGKLQKLVELYLNSNKLSGPIPSSLGNLSALTNLYLDWNMFEGSIPPSLAN  476

Query  541  LANLQVLDLYNNNLTGDLPVE  603
               L +L L +NNL+G +P +
Sbjct  477  CQFLLILYLSHNNLSGSIPKQ  497



>ref|XP_011083584.1| PREDICTED: receptor protein kinase CLAVATA1 [Sesamum indicum]
Length=974

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 90/139 (65%), Gaps = 6/139 (4%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTS-----HCTWRRVTCdsllhvvsldlsglNLS  369
            ++   LL +K++    S S L  W    S     HC++  VTCD+   V SL+++ + L 
Sbjct  23   SDLETLLKLKSSLVGPSASGLHDWAAPPSPSSSAHCSFSGVTCDADARVTSLNVANVPLF  82

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QLA  546
            G L P++G L  LVNL++A N++SGP+P E+S +++L+++NLS+N+F  T P ++  +L 
Sbjct  83   GTLPPEIGLLDKLVNLTLAGNKISGPLPVEMSNLTSLKYVNLSSNVFNGTLPGEIVLKLT  142

Query  547  NLQVLDLYNNNLTGDLPVE  603
             L+V D+YNNN +G+LP E
Sbjct  143  ELEVFDVYNNNFSGNLPAE  161


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL+G L  ++  L  L++L I+ N L G +P   S +  L  +NL  N F   FP  +  
Sbjct  274  NLTGRLPSELSGLMSLMSLDISINNLIGEIPESFSKLKNLTLINLFQNKFQGPFPAFIGD  333

Query  541  LANLQVLDLYNNNLTGDLP  597
            L NL+VL ++NNN T  LP
Sbjct  334  LPNLEVLQIWNNNFTMGLP  352



>ref|XP_010676066.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
RCH1 [Beta vulgaris subsp. vulgaris]
Length=853

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 87/140 (62%), Gaps = 1/140 (1%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsld-lsglNLSGVL  378
            ++E+ ALLSIK+A T D  +SL+SW  +T HC+W  +TC S    V     + L L G+L
Sbjct  24   LSERQALLSIKSAITYDPFNSLSSWKNTTHHCSWPYITCSSSSSSVISLNFTELLLEGIL  83

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  558
            SPD+G L  L NLSI +N  SGP+P  +S ++ LR+L++S+N F    P  L+ L  L+ 
Sbjct  84   SPDIGFLTNLQNLSIRSNLFSGPLPHSLSLLTQLRYLHVSSNSFTGPIPSSLSLLTQLRH  143

Query  559  LDLYNNNLTGDLPVEVYKMT  618
            LD+  N+ TG +P  +  +T
Sbjct  144  LDVSFNSFTGPIPSSLSLLT  163


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = +1

Query  415  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  594
            L ++ N L+G +P  +  +S LR+LNL  N F    P +  +L  LQ L+L +N L+G L
Sbjct  192  LDVSGNNLNGTLPLSVVEMSELRYLNLGYNSFYGEIPPEFGKLKKLQTLNLVSNTLSGGL  251

Query  595  PVEV  606
            P E+
Sbjct  252  PFEL  255


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 53/105 (50%), Gaps = 24/105 (23%)
 Frame = +1

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGS----------  516
            G + P+ G+L  L  L++ +N LSG +P E+ ++  L+++ LS NN++GS          
Sbjct  225  GEIPPEFGKLKKLQTLNLVSNTLSGGLPFELGSLKNLKYIYLSINNLYGSIPDYIGDFPE  284

Query  517  -------------TFPHQLAQLANLQVLDLYNNNLTGDLPVEVYK  612
                         + P +L     LQ LD+ NN+ +G LPV + K
Sbjct  285  LESLSLGSNNFTGSIPQKLGTNGKLQYLDISNNSFSGSLPVSLCK  329


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 41/79 (52%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL+G L   V ++  L  L++  N   G +PPE   +  L+ LNL +N      P +L  
Sbjct  198  NLNGTLPLSVVEMSELRYLNLGYNSFYGEIPPEFGKLKKLQTLNLVSNTLSGGLPFELGS  257

Query  541  LANLQVLDLYNNNLTGDLP  597
            L NL+ + L  NNL G +P
Sbjct  258  LKNLKYIYLSINNLYGSIP  276



>ref|NP_001058840.2| Os07g0134200 [Oryza sativa Japonica Group]
 dbj|BAF20754.2| Os07g0134200 [Oryza sativa Japonica Group]
Length=883

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVL-  378
            E  ALL++KAA   D   +L SW  N ++S C W  V C++   VV LD+SG NL+G L 
Sbjct  27   EADALLAVKAALD-DPTGALASWTTNTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLP  85

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQ  555
               +  L  L  L +AAN LSGP+P  +S ++  L  LNLSNN    TFP QL++L  L+
Sbjct  86   GAALSGLQHLARLDLAANALSGPIPAALSRLAPFLTHLNLSNNGLNGTFPPQLSRLRALR  145

Query  556  VLDLYNNNLTGDLPVEVYKM  615
            VLDLYNNNLTG LP+EV  M
Sbjct  146  VLDLYNNNLTGALPLEVVSM  165


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
              G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A +
Sbjct  516  FDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAAM  575

Query  544  ANLQVLDLYNNNLTGDLPV  600
             +L  +D   NNL+G +P 
Sbjct  576  QSLTAVDFSYNNLSGLVPA  594


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 43/86 (50%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G + P++G+L  L    ++ N   G VPPEI     L +L+LS N      P  ++ +
Sbjct  492  FTGEIPPEIGRLQQLSKADLSGNSFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGM  551

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N L G++P  +  M S
Sbjct  552  RILNYLNLSRNQLDGEIPATIAAMQS  577


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  540
             SG + P+ G+   L  L+++ N+LSG +PPE+  +++LR L +   N +    P +L  
Sbjct  178  FSGGIPPEYGRWGRLQYLAVSGNELSGKIPPELGNLTSLRELYIGYFNSYSGGIPPELGN  237

Query  541  LANLQVLDLYNNNLTGDLPVEV  606
            + +L  LD  N  L+G++P E+
Sbjct  238  MTDLVRLDAANCGLSGEIPPEL  259


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G L  L  L +  N L+G +P E+  +++L  L+LSNN      P   A L
Sbjct  251  LSGEIPPELGNLANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADL  310

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
             NL +L+L+ N L GD+P  V  + S
Sbjct  311  KNLTLLNLFRNKLRGDIPEFVGDLPS  336


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 44/84 (52%), Gaps = 1/84 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            LSG + P++G L  L  L I   N  SG +PPE+  ++ L  L+ +N       P +L  
Sbjct  202  LSGKIPPELGNLTSLRELYIGYFNSYSGGIPPELGNMTDLVRLDAANCGLSGEIPPELGN  261

Query  541  LANLQVLDLYNNNLTGDLPVEVYK  612
            LANL  L L  N L G +P E+ K
Sbjct  262  LANLDTLFLQVNGLAGGIPRELGK  285



>ref|XP_010277679.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR [Nelumbo nucifera]
Length=1040

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 78/134 (58%), Gaps = 2/134 (1%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSP  384
            ++ ALL  K   T D +  L+SWN S   C WR VTC      V +      +L+G +SP
Sbjct  47   DKQALLEFKHQ-TTDPKGVLSSWNDSLHFCQWRGVTCGRRHQRVVILNLEGHHLTGTISP  105

Query  385  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLD  564
             +G L FL  + +  N L G +P E+  +  LR+++LSNN  G   P  L+Q +NL+VL 
Sbjct  106  HIGNLTFLRYIYLQNNSLYGSIPQELGRLFRLRYISLSNNTLGGEIPSNLSQCSNLRVLR  165

Query  565  LYNNNLTGDLPVEV  606
            L NNNL+G++P+E+
Sbjct  166  LLNNNLSGNIPIEL  179


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L  +VG L  ++ L  +AN++SG +P  I    +L  L ++NN+F  T P  L+ L
Sbjct  514  LSGSLPSEVGNLQSILVLDFSANKMSGEIPSTIGDCLSLEDLYMNNNLFDGTIPTSLSSL  573

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
             +++ +DL +NNL+G +P  + ++
Sbjct  574  KDIEEIDLSHNNLSGQIPKNLIEL  597


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NLSG +  ++G LP L +++++ NQL+G +P     +S+L  L LS N    + P +L  
Sbjct  170  NLSGNIPIELGFLPKLFHINLSKNQLTGRIPASFGNLSSLEDLFLSYNRLEGSIPEELGH  229

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMT  618
            L +L  L +  NNL+G  P  +Y ++
Sbjct  230  LTSLTSLVVGANNLSGVFPYSLYNLS  255



>gb|EAZ02682.1| hypothetical protein OsI_24796 [Oryza sativa Indica Group]
Length=1023

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVL-  378
            E  ALL++KAA   D   +L SW  N ++S C W  V C++   VV LD+SG NL+G L 
Sbjct  27   EADALLAVKAALD-DPTGALASWTTNTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLP  85

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQ  555
               +  L  L  L +AAN LSGP+P  +S ++  L  LNLSNN    TFP QL++L  L+
Sbjct  86   GAALSGLQHLARLDLAANALSGPIPAALSRLAPFLTHLNLSNNGLNGTFPPQLSRLRALR  145

Query  556  VLDLYNNNLTGDLPVEVYKM  615
            VLDLYNNNLTG LP+EV  M
Sbjct  146  VLDLYNNNLTGALPLEVVSM  165


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
              G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A +
Sbjct  516  FDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAAM  575

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  576  QSLTAVDFSYNNLSGLVP  593


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 43/86 (50%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G + P++G+L  L    ++ N   G VPPEI     L +L+LS N      P  ++ +
Sbjct  492  FTGEIPPEIGRLQQLSKADLSGNSFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGM  551

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N L G++P  +  M S
Sbjct  552  RILNYLNLSRNQLDGEIPATIAAMQS  577


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  540
             SG + P+ G+   L  L+++ N+LSG +PPE+  +++LR L +   N +    P +L  
Sbjct  178  FSGGIPPEYGRWGRLQYLAVSGNELSGKIPPELGNLTSLRELYIGYFNSYSGGIPPELGN  237

Query  541  LANLQVLDLYNNNLTGDLPVEV  606
            + +L  LD  N  L+G++P E+
Sbjct  238  MTDLVRLDAANCGLSGEIPPEL  259


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G L  L  L +  N L+G +P E+  +++L  L+LSNN      P   A L
Sbjct  251  LSGEIPPELGNLANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADL  310

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
             NL +L+L+ N L GD+P  V  + S
Sbjct  311  KNLTLLNLFRNKLRGDIPEFVGDLPS  336


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 44/84 (52%), Gaps = 1/84 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            LSG + P++G L  L  L I   N  SG +PPE+  ++ L  L+ +N       P +L  
Sbjct  202  LSGKIPPELGNLTSLRELYIGYFNSYSGGIPPELGNMTDLVRLDAANCGLSGEIPPELGN  261

Query  541  LANLQVLDLYNNNLTGDLPVEVYK  612
            LANL  L L  N L G +P E+ K
Sbjct  262  LANLDTLFLQVNGLAGGIPRELGK  285



>dbj|BAC82955.1| putative OsLRK1(receptor-type protein kinase) [Oryza sativa Japonica 
Group]
 dbj|BAD30615.1| putative OsLRK1(receptor-type protein kinase) [Oryza sativa Japonica 
Group]
 gb|EAZ38608.1| hypothetical protein OsJ_22997 [Oryza sativa Japonica Group]
 dbj|BAH01666.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1023

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVL-  378
            E  ALL++KAA   D   +L SW  N ++S C W  V C++   VV LD+SG NL+G L 
Sbjct  27   EADALLAVKAALD-DPTGALASWTTNTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLP  85

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQ  555
               +  L  L  L +AAN LSGP+P  +S ++  L  LNLSNN    TFP QL++L  L+
Sbjct  86   GAALSGLQHLARLDLAANALSGPIPAALSRLAPFLTHLNLSNNGLNGTFPPQLSRLRALR  145

Query  556  VLDLYNNNLTGDLPVEVYKM  615
            VLDLYNNNLTG LP+EV  M
Sbjct  146  VLDLYNNNLTGALPLEVVSM  165


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
              G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A +
Sbjct  516  FDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAAM  575

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  576  QSLTAVDFSYNNLSGLVP  593


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 43/86 (50%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G + P++G+L  L    ++ N   G VPPEI     L +L+LS N      P  ++ +
Sbjct  492  FTGEIPPEIGRLQQLSKADLSGNSFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGM  551

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N L G++P  +  M S
Sbjct  552  RILNYLNLSRNQLDGEIPATIAAMQS  577


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  540
             SG + P+ G+   L  L+++ N+LSG +PPE+  +++LR L +   N +    P +L  
Sbjct  178  FSGGIPPEYGRWGRLQYLAVSGNELSGKIPPELGNLTSLRELYIGYFNSYSGGIPPELGN  237

Query  541  LANLQVLDLYNNNLTGDLPVEV  606
            + +L  LD  N  L+G++P E+
Sbjct  238  MTDLVRLDAANCGLSGEIPPEL  259


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G L  L  L +  N L+G +P E+  +++L  L+LSNN      P   A L
Sbjct  251  LSGEIPPELGNLANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADL  310

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
             NL +L+L+ N L GD+P  V  + S
Sbjct  311  KNLTLLNLFRNKLRGDIPEFVGDLPS  336


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 44/84 (52%), Gaps = 1/84 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            LSG + P++G L  L  L I   N  SG +PPE+  ++ L  L+ +N       P +L  
Sbjct  202  LSGKIPPELGNLTSLRELYIGYFNSYSGGIPPELGNMTDLVRLDAANCGLSGEIPPELGN  261

Query  541  LANLQVLDLYNNNLTGDLPVEVYK  612
            LANL  L L  N L G +P E+ K
Sbjct  262  LANLDTLFLQVNGLAGGIPRELGK  285



>ref|XP_002307734.1| receptor protein kinase [Populus trichocarpa]
 gb|EEE94730.1| receptor protein kinase [Populus trichocarpa]
Length=973

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 89/144 (62%), Gaps = 5/144 (3%)
 Frame = +1

Query  199  GVTEQAALLSIKAAFTADSQSSLTSWNIS----TSHCTWRRVTCdsllhvvsldlsglNL  366
            G ++   LL +K +    + + L  W  S    T+HC +  VTCD    VVSL++S  +L
Sbjct  20   GYSDLEVLLKLKTSMYGHNGTGLQDWVASPASPTAHCYFSGVTCDEDSRVVSLNVSFRHL  79

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QL  543
             G + P++G L  LVNL+++ N L+G  P EI+ +++LR LN+SNN+    FP ++   +
Sbjct  80   PGSIPPEIGLLNKLVNLTLSGNNLTGGFPVEIAMLTSLRILNISNNVIAGNFPGKITLGM  139

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
            A L+VLD+YNNN TG LP E+ K+
Sbjct  140  ALLEVLDVYNNNFTGALPTEIVKL  163


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 47/86 (55%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +  ++  L  L  ++I AN + G +P  IS  ++L  ++ S N      P ++A+L
Sbjct  488  LSGEIPEEIWGLKSLTKINIRANNIRGEIPASISHCTSLTSVDFSQNSLSGEIPKKIAKL  547

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
             +L  LDL  N LTG LP E+  M S
Sbjct  548  NDLSFLDLSRNQLTGQLPGEIGYMRS  573


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 45/86 (52%), Gaps = 1/86 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG +   +  LP    + ++ N  SG +PPEIS    L  L++SNN      P  +  L
Sbjct  417  FSGTIPAGIFNLPLATLVELSNNLFSGELPPEISG-DALGLLSVSNNRITGKIPPAIGNL  475

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
             NLQ L L  N L+G++P E++ + S
Sbjct  476  KNLQTLSLDTNRLSGEIPEEIWGLKS  501



>ref|XP_010260843.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nelumbo nucifera]
 ref|XP_010260847.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nelumbo nucifera]
Length=1006

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 83/139 (60%), Gaps = 4/139 (3%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsg-lNLSGVL  378
            + +  LS+K AF   + + L +WN S   S C+W  + CD +   V        N+SGV+
Sbjct  53   QASIFLSLKQAFYVPT-TCLDTWNESNFMSLCSWTGIQCDDMGSSVVSLDISNFNISGVI  111

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  558
            SP +G+L  L+NLSIA N  SG  PPE+  +++LRFLN+SNN F  +     + L  L+V
Sbjct  112  SPAIGELQSLLNLSIAGNSFSGLFPPELHKLTSLRFLNISNNQFNGSLSWNFSSLRELEV  171

Query  559  LDLYNNNLTGDLPVEVYKM  615
            LD+YNNN  G LP+ V ++
Sbjct  172  LDVYNNNFFGSLPLGVTEL  190


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL+G + PD+G    L  L ++ NQLSGP+P +IS I  L +LN+S N    + P ++  
Sbjct  540  NLTGRIPPDIGNCLLLTYLDLSQNQLSGPIPVQISQIHILNYLNISWNHLNQSLPKEIGA  599

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L   D  +N+ +G +P
Sbjct  600  IKSLTSADFSHNDFSGRIP  618


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
              G + P+ G+L  LV+L +++  L GP+PPE+  ++ L  L L  N    + PHQ   L
Sbjct  252  FDGGIPPEFGKLVNLVHLDLSSCGLEGPIPPELGNLNKLDTLFLQTNQLSGSIPHQFGNL  311

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
            ++L+ LDL NN LTG++PVE  ++
Sbjct  312  SSLKSLDLSNNGLTGEIPVEFSEL  335


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            N  G L   V +LP L +L +  N +SG +PP   A+  L +L+L+ N  G   P +L  
Sbjct  178  NFFGSLPLGVTELPKLKHLDLGGNYISGKIPPSYGAMEELNYLSLAGNDLGGLIPGELGN  237

Query  541  LANLQVLDL-YNNNLTGDLPVEVYKMTS  621
            L NL+ L L Y N   G +P E  K+ +
Sbjct  238  LTNLKQLYLGYFNEFDGGIPPEFGKLVN  265


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            L+G  + D  ++P  L  L+++ N+LSG +P  I   S+L+ L L  N F    P +L +
Sbjct  468  LTGWFAEDPNKVPSKLGQLNLSNNRLSGSIPSSIGNFSSLQALLLGGNQFTGEIPSELGR  527

Query  541  LANLQVLDLYNNNLTGDLPVEV  606
            L NL  LD+  NNLTG +P ++
Sbjct  528  LKNLLKLDMSRNNLTGRIPPDI  549



>ref|XP_008812886.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Phoenix dactylifera]
Length=1123

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 78/136 (57%), Gaps = 2/136 (1%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLS--GVL  378
            T++ ALL+ KAA T D   SL SWN S S C W  V+C        + L   +LS  G +
Sbjct  38   TDRFALLAFKAAITHDPTGSLKSWNASASICRWAGVSCSPRDQERVVALVLESLSLGGSI  97

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  558
            SP +G L FL  L +  N+L G VPP++  +  L+ LNLS+N  G   P  L Q  +L  
Sbjct  98   SPSIGNLTFLTRLHLPGNRLGGVVPPDVGHLRHLKDLNLSSNSLGGPIPASLGQCRSLLG  157

Query  559  LDLYNNNLTGDLPVEV  606
            LDL +N L+G++PV++
Sbjct  158  LDLTDNLLSGNIPVQL  173


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L G L P VG+L  L  L+I+ N+LSG +P  I     L +L L  N F  + P  L  L
Sbjct  603  LDGPLPPSVGKLRNLQFLNISNNKLSGEIPTAIGDCQVLEYLYLEGNFFQGSIPSSLGNL  662

Query  544  ANLQVLDLYNNNLTGDLP  597
              + VLDL  NNL+G  P
Sbjct  663  KGIIVLDLSLNNLSGPFP  680


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL+G + P    L  L  L ++ N+L G +P ++  +++L+F  +S+N    T P  L  
Sbjct  281  NLTGNIPPSFTNLSHLAFLDLSENKLQGRLPEDLGHLTSLQFFQISDNKISGTIPSSLYN  340

Query  541  LANLQVLDLYNNNLTGDLPVEV  606
            +++LQ L    N L+G LP+++
Sbjct  341  ISSLQTLSAVENQLSGTLPLDI  362



>emb|CDP18494.1| unnamed protein product [Coffea canephora]
Length=1062

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 71/135 (53%), Gaps = 1/135 (1%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLS  381
            T+Q ALL  K     D    L+SWN S  HC W+ +TCD+    V+       +LSG LS
Sbjct  63   TDQLALLEFKQQILDDPHGVLSSWNHSEHHCQWQGITCDTQHQRVTALTLAGKSLSGTLS  122

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            P +G L F+ ++ +  N   G +PPEI  +  LRFLNLS N F    P  L+  + +  +
Sbjct  123  PHIGNLSFMKSIQLGGNLFHGEIPPEIGRLFRLRFLNLSRNTFSGEIPVNLSHCSQITTI  182

Query  562  DLYNNNLTGDLPVEV  606
             L  N L G +P E+
Sbjct  183  SLSRNRLQGKIPAEL  197


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G L  +VG+L  LV  +I+ N  SG +PP ++    L  L +  N F    P +LA L
Sbjct  536  FNGSLPLEVGKLIHLVVFNISYNMFSGEIPPSLADCLDLEHLRMEANFFHGMIPSKLASL  595

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              +Q +DL +N+LTG +P ++ K+ S
Sbjct  596  TGIQEIDLSSNSLTGQIPRDLGKLQS  621


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-  537
            NL G L  ++G L  L  L    NQLSG VP  I  IST+    L  N F  + P  +  
Sbjct  236  NLEGFLPKEIGSLTRLSELVATTNQLSGTVPDSIYNISTMTNFLLGGNFFHGSIPTYIGL  295

Query  538  QLANLQVLDLYNNNLTGDLPVEV  606
               NLQ L L  NN  G +PV +
Sbjct  296  TFKNLQTLSLGKNNFFGRIPVSI  318



>gb|EMT21473.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=1048

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 88/153 (58%), Gaps = 6/153 (4%)
 Frame = +1

Query  166  HSAGAGAGKPLGV---TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCds---l  327
            H AG G    LG    T+  +LL  K A T D   +L+SWN ST+ C W+ VTC +    
Sbjct  13   HIAGKGDCVVLGWNDNTDLHSLLEFKQAITKDPTRALSSWNRSTNFCRWKGVTCSADRPK  72

Query  328  lhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI  507
             HV+ L+L+  +L G +SP +G L +LV ++ + N  SG +PP    +  L+ L+LSNN+
Sbjct  73   RHVMKLELAAQSLVGHISPSLGNLTYLVTINFSTNSFSGNLPPLFHRLQNLQILDLSNNL  132

Query  508  FGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEV  606
                 P  LA  ++L+ LDLY N+L G +P E+
Sbjct  133  LHGVIPQGLANCSDLRKLDLYGNSLQGKIPEEI  165


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 52/85 (61%), Gaps = 0/85 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L G +  ++G L  L  L ++ N+L+G +P ++S I++L  L+++ N      PH+  +L
Sbjct  157  LQGKIPEEIGLLSHLSILELSVNKLTGTIPAKLSNITSLEILHVTGNQLEGRIPHEFGRL  216

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMT  618
            + ++ L L  N L+G++PV ++ +T
Sbjct  217  SKMRQLLLGGNRLSGEIPVALFNLT  241


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL GVL P+VG L  L  L +++N+L+G +P  ++    L  + +  N F    P  L  
Sbjct  500  NLEGVLPPEVGSLQQLTELQLSSNKLTGAIPKTLAQCKQLETIKMDQNFFTEDIPISLGD  559

Query  541  LANLQVLDLYNNNLTGDLP  597
            L +L  L+L +N L+G +P
Sbjct  560  LQSLTTLNLSHNKLSGAIP  578



>ref|XP_010026766.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Eucalyptus 
grandis]
Length=985

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 74/137 (54%), Gaps = 1/137 (1%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls-glNLSGVL  378
            +T++ ALL+ KA  T D   +L SWN +T HC W  V C  L   V+      L LSG +
Sbjct  1    MTDKLALLAFKATITEDPFGALNSWNHTTDHCQWHGVMCGHLHRRVTGLNLPSLKLSGSI  60

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  558
            SP +G L FL  L +  N     +P E+S + +LRFL LSNN      P  L+  A L  
Sbjct  61   SPHIGNLSFLRTLMLKNNSFHHKIPQEVSHLHSLRFLLLSNNTLDGEIPRNLSSCARLTR  120

Query  559  LDLYNNNLTGDLPVEVY  609
            L L NN L G++P+E +
Sbjct  121  LGLANNRLVGEIPIECF  137


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            +L+ VL  +VG+L  L  L ++ N L G +P  + +   L  L +  N F    P  ++ 
Sbjct  471  HLTDVLPEEVGKLNLLTQLDVSRNMLDGDIPASLGSCVGLEVLKMQENSFRGFIPSSISM  530

Query  541  LANLQVLDLYNNNLTGDLP  597
            L N++ +DL +NNL+G +P
Sbjct  531  LRNVKEIDLSHNNLSGQIP  549



>gb|KCW60108.1| hypothetical protein EUGRSUZ_H02842, partial [Eucalyptus grandis]
Length=940

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 74/137 (54%), Gaps = 1/137 (1%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls-glNLSGVL  378
            +T++ ALL+ KA  T D   +L SWN +T HC W  V C  L   V+      L LSG +
Sbjct  1    MTDKLALLAFKATITEDPFGALNSWNHTTDHCQWHGVMCGHLHRRVTGLNLPSLKLSGSI  60

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  558
            SP +G L FL  L +  N     +P E+S + +LRFL LSNN      P  L+  A L  
Sbjct  61   SPHIGNLSFLRTLMLKNNSFHHKIPQEVSHLHSLRFLLLSNNTLDGEIPRNLSSCARLTR  120

Query  559  LDLYNNNLTGDLPVEVY  609
            L L NN L G++P+E +
Sbjct  121  LGLANNRLVGEIPIECF  137


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            +L+ VL  +VG+L  L  L ++ N L G +P  + +   L  L +  N F    P  ++ 
Sbjct  471  HLTDVLPEEVGKLNLLTQLDVSRNMLDGDIPASLGSCVGLEVLKMQENSFRGFIPSSISM  530

Query  541  LANLQVLDLYNNNLTGDLP  597
            L N++ +DL +NNL+G +P
Sbjct  531  LRNVKEIDLSHNNLSGQIP  549



>ref|XP_002985227.1| hypothetical protein SELMODRAFT_121783 [Selaginella moellendorffii]
 gb|EFJ13721.1| hypothetical protein SELMODRAFT_121783 [Selaginella moellendorffii]
Length=1023

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 83/141 (59%), Gaps = 3/141 (2%)
 Frame = +1

Query  199  GVTEQAALLSIKAAFTADSQSSLTSW-NISTSHCTWRRVTCdsllhvvsldlsg-lNLSG  372
            G  +++ALL++KAA   DS  SL  W     + C W  +TCD  L  V        NLSG
Sbjct  22   GFQDKSALLALKAAMI-DSSGSLDDWTETDDTPCLWTGITCDDRLSRVVALDLSNKNLSG  80

Query  373  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  552
            + S  +G+L  L+NL++  N  +G +P E++ +  L FLN+S+N F   FP + + L  L
Sbjct  81   IFSSSIGRLTELINLTLDVNNFTGNLPSELATLHDLHFLNVSHNTFTGDFPGRFSNLQLL  140

Query  553  QVLDLYNNNLTGDLPVEVYKM  615
            +VLD YNNN +G LP+E+ ++
Sbjct  141  EVLDAYNNNFSGPLPIELSRL  161


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            + +G + P++G+L  L  L IA+  L G +P E+  +S L  L L  N      P QL  
Sbjct  222  HFTGGIPPELGRLLNLQKLDIASCGLEGVIPAELGNLSNLDSLFLQINHLSGPIPPQLGD  281

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L NL+ LDL NNNLTG +P+E+ K+
Sbjct  282  LVNLKSLDLSNNNLTGAIPIELRKL  306


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L GV+  ++G L  L +L +  N LSGP+PP++  +  L+ L+LSNN      P +L +L
Sbjct  247  LEGVIPAELGNLSNLDSLFLQINHLSGPIPPQLGDLVNLKSLDLSNNNLTGAIPIELRKL  306

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
             NL++L L+ N L+G++P  V  +
Sbjct  307  QNLELLSLFLNGLSGEIPAFVADL  330


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            +LSG + P +G L  L +L ++ N L+G +P E+  +  L  L+L  N      P  +A 
Sbjct  270  HLSGPIPPQLGDLVNLKSLDLSNNNLTGAIPIELRKLQNLELLSLFLNGLSGEIPAFVAD  329

Query  541  LANLQVLDLYNNNLTGDLP  597
            L NLQ L L+ NN TG+LP
Sbjct  330  LPNLQALLLWTNNFTGELP  348



>tpg|DAA59489.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1037

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 78/125 (62%), Gaps = 2/125 (2%)
 Frame = +1

Query  247  ADSQSSLTSWN--ISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLS  420
            +D   +L SW    ST  C W  VTC++   V+ LDLSG NLSG +   + +L  L  L 
Sbjct  45   SDPAGALASWTNATSTGACAWSGVTCNARAAVIGLDLSGRNLSGPVPTALSRLAHLARLD  104

Query  421  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPV  600
            +AAN L GP+P  +S + +L  LNLSNN+   TFP  LA+L  L+VLDLYNNNLTG LP+
Sbjct  105  LAANALCGPIPAPLSRLQSLTHLNLSNNVLNGTFPPPLARLRALRVLDLYNNNLTGPLPL  164

Query  601  EVYKM  615
             V  +
Sbjct  165  AVVGL  169


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N  G   P  +A +
Sbjct  520  LDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNHLGGEIPATIAAM  579

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  580  QSLTAVDFSYNNLSGLVP  597


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             SG + P+ G+   L  L+++ N+LSG +PPE+  ++TLR L +   N + S  P +L  
Sbjct  182  FSGEIPPEYGRWRRLQYLAVSGNELSGRIPPELGGLTTLRELYIGYYNSYSSGLPPELGN  241

Query  541  LANLQVLDLYNNNLTGDLPVEV  606
            + +L  LD  N  L+G++P E+
Sbjct  242  MTDLVRLDAANCGLSGEIPPEL  263


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G + P++G+L  L    ++ N L G VPPEI     L +L+LS N      P  ++ +
Sbjct  496  FTGAVPPEIGRLQQLSKADLSGNTLDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGM  555

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G++P  +  M S
Sbjct  556  RILNYLNLSRNHLGGEIPATIAAMQS  581


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 42/84 (50%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G L   +G+   L  L +  N  +G VPPEI  +  L   +LS N      P ++ + 
Sbjct  472  LTGALPASIGKFSGLQKLLLDQNAFTGAVPPEIGRLQQLSKADLSGNTLDGGVPPEIGKC  531

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  LDL  NNL+G++P  +  M
Sbjct  532  RLLTYLDLSRNNLSGEIPPAISGM  555


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G   P + +L  L  L +  N L+GP+P  +  +  LR L+L  N F    P +  + 
Sbjct  134  LNGTFPPPLARLRALRVLDLYNNNLTGPLPLAVVGLPVLRHLHLGGNFFSGEIPPEYGRW  193

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              LQ L +  N L+G +P E+  +T+
Sbjct  194  RRLQYLAVSGNELSGRIPPELGGLTT  219


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G L  L  L +  N L+G +PPE+  + +L  L+LSNN      P   A L
Sbjct  255  LSGEIPPELGNLANLDTLFLQVNGLAGAIPPELGRLKSLSSLDLSNNALTGEIPASFAAL  314

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
             NL +L+L+ N L G +P  V  + S
Sbjct  315  RNLTLLNLFRNKLRGSIPELVGDLPS  340


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P++G+L  L +L ++ N L+G +P   +A+  L  LNL  N    + P  +  L
Sbjct  279  LAGAIPPELGRLKSLSSLDLSNNALTGEIPASFAALRNLTLLNLFRNKLRGSIPELVGDL  338

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L+VL L+ NN TG +P
Sbjct  339  PSLEVLQLWENNFTGGIP  356



>gb|AAF73373.1|AF193835_1 LRK1 protein [Oryza sativa]
Length=970

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVL-  378
            E  ALL++KAA   D   +L SW  N ++S C W  V C++   VV LD+SG NL+G L 
Sbjct  27   EADALLAVKAALD-DPTGALASWTTNTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLP  85

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQ  555
               +  L  L  L +AAN LSGP+P  +S ++  L  LNLSNN    TFP QL++L  L+
Sbjct  86   GAALSGLQHLARLDLAANALSGPIPAALSRLAPFLTHLNLSNNGLNGTFPPQLSRLRALR  145

Query  556  VLDLYNNNLTGDLPVEVYKM  615
            VLDLYNNNLTG LP+EV  +
Sbjct  146  VLDLYNNNLTGALPLEVVSL  165


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  546
            +G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A + 
Sbjct  521  TGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAAMQ  580

Query  547  NLQVLDLYNNNLTGDLPV  600
            +L  +D   NNL+G +P 
Sbjct  581  SLTAVDFSYNNLSGLVPA  598


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 46/84 (55%), Gaps = 1/84 (1%)
 Frame = +1

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  546
            SG + P++G +  LV L  A   LSG +PPE+  ++ L  L L  N      P +L +LA
Sbjct  228  SGGIPPELGNMTDLVRLDAANCGLSGEIPPELGNLANLDTLFLRVNGLAGGIPRELGKLA  287

Query  547  NLQ-VLDLYNNNLTGDLPVEVYKM  615
            +LQ  +DL    L G+ P +V ++
Sbjct  288  SLQPKVDLSKKGLAGEDPAKVRRL  311



>ref|XP_010690942.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Beta vulgaris subsp. vulgaris]
Length=1030

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 75/135 (56%), Gaps = 1/135 (1%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldl-sglNLSGVLS  381
            T+Q ALL +K+  T D    ++SWN +   CTW  VTCD + H V        NL+G++S
Sbjct  29   TDQKALLEMKSKITHDPLGVMSSWNDNLPFCTWHGVTCDRVHHRVIALDLQSSNLTGIIS  88

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            P +G L FL  L I  N L G +PPEI  +  LR + L NN  G   P  ++  ++L  L
Sbjct  89   PYLGNLSFLRELHIENNNLQGTIPPEIGRLHRLRVMWLVNNSIGGKIPRDISGCSSLVSL  148

Query  562  DLYNNNLTGDLPVEV  606
             +Y N L GD+P E+
Sbjct  149  YIYRNKLVGDIPFEL  163


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 41/79 (52%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            +LSG+L  +VG L  L  L +  N  SG +P  I     L  L L  N F    P  L  
Sbjct  497  HLSGLLPQEVGLLNNLAGLDLTRNMFSGEIPHTIGQCIALEELYLGRNYFQGAIPDALQM  556

Query  541  LANLQVLDLYNNNLTGDLP  597
            L  LQVLDL  NNL+G++P
Sbjct  557  LKGLQVLDLSQNNLSGEIP  575



>ref|XP_010266811.1| PREDICTED: receptor protein kinase CLAVATA1 [Nelumbo nucifera]
 ref|XP_010266812.1| PREDICTED: receptor protein kinase CLAVATA1 [Nelumbo nucifera]
Length=979

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 88/141 (62%), Gaps = 4/141 (3%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLSGV  375
            T+  ALL +K A      S L  WN+S+S   HC +  V+CD    VV+L++S + L G 
Sbjct  25   TDLDALLKLKTAMIGRRGSGLDDWNVSSSRNSHCLFSGVSCDENSRVVALNVSYVPLFGT  84

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QLANL  552
            +SP++G L  LVNL+++ N L+G +P EI+ +++L+ LN+SNN F    P  +A  L  +
Sbjct  85   VSPEIGLLNKLVNLTLSCNNLTGKLPEEIANLTSLKLLNISNNAFVGGVPEGIAGGLLEV  144

Query  553  QVLDLYNNNLTGDLPVEVYKM  615
            ++ D+YNNN TG LP  + K+
Sbjct  145  EIFDIYNNNFTGRLPTGLVKL  165


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL+G +   +G+L  L  L +  N+LSG +P E+S + +L+ L+LSNN      P   ++
Sbjct  250  NLTGEIPASLGRLKLLHTLFLQLNKLSGLIPAELSGLVSLKSLDLSNNDLTGEIPESFSE  309

Query  541  LANLQVLDLYNNNLTGDLP  597
            L  L +++L+ N+L G +P
Sbjct  310  LKQLTLINLFRNHLRGRIP  328


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            ++G + P +  L  L  LS+  N  SG +PPEI  +  L  +N+S+N      P  L   
Sbjct  466  ITGKIPPAIANLTNLRTLSLDVNLFSGEIPPEIFGLKMLSKINISSNNITGEIPIALGHC  525

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
             +L  +D   NNL G +P E+ K+
Sbjct  526  KSLSSVDFSRNNLFGRIPREIAKL  549



>ref|XP_004295533.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Fragaria vesca subsp. vesca]
Length=982

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 84/142 (59%), Gaps = 5/142 (4%)
 Frame = +1

Query  202  VTEQAALL-SIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lNLS  369
            +  QA++L S+K  F A S  SL+SWN+S     C+W  + CD+L   V        NLS
Sbjct  26   LRRQASILASVKQGFEA-SDPSLSSWNVSNYKFLCSWAGIMCDNLSRSVISLDVSNYNLS  84

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  549
            G LSPD+ +L  LVNLS++ N  SG  P  I  +  L++LN+SNN FG +   + AQL  
Sbjct  85   GSLSPDITELRTLVNLSVSGNDFSGSFPAGIHKLPRLQYLNISNNGFGGSMDWEFAQLKE  144

Query  550  LQVLDLYNNNLTGDLPVEVYKM  615
            L +LD YNN+  G LP+ V ++
Sbjct  145  LILLDAYNNDFNGSLPLGVTQL  166


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            N SG + P++G    L  L ++ NQLSGP+PP++  I  L + N+S N    + P +L  
Sbjct  517  NFSGSIPPEIGNCTLLTYLDLSQNQLSGPIPPQVVQIHILNYFNVSWNHLNQSLPKELGS  576

Query  541  LANLQVLDLYNNNLTGDLP  597
            L +L   D  +N+ +G +P
Sbjct  577  LKSLTSADFSHNSFSGSVP  595


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 50/81 (62%), Gaps = 0/81 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +   +G L  L +L ++ N L+G +P E SA+  L  LNL  N F    PH++A+L
Sbjct  276  LSGSIPAQLGNLSSLRSLDLSNNALTGDIPVEFSALRELTLLNLFINKFHGEIPHEIAEL  335

Query  544  ANLQVLDLYNNNLTGDLPVEV  606
             NL+VL L+ NN TG +P ++
Sbjct  336  PNLEVLKLWQNNFTGAIPSKL  356


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 45/88 (51%), Gaps = 1/88 (1%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            + +G L   V QLP L  L    N  SG +PP    +S L +L+++ N      P +L  
Sbjct  154  DFNGSLPLGVTQLPKLKRLDFGGNYFSGSIPPSYGNMSQLNYLSVAGNDLSGFIPSELGN  213

Query  541  LANLQVLDL-YNNNLTGDLPVEVYKMTS  621
            L NL  L L Y N+  G +P E+ K+T+
Sbjct  214  LTNLTQLFLGYYNDFDGGIPPEIGKLTN  241


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 48/81 (59%), Gaps = 0/81 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            +  G + P++G+L  L +L +A   L G +PPE+  +  L  L L  N    + P QL  
Sbjct  227  DFDGGIPPEIGKLTNLFHLDLANCGLEGSIPPELGNLKKLDTLFLQTNQLSGSIPAQLGN  286

Query  541  LANLQVLDLYNNNLTGDLPVE  603
            L++L+ LDL NN LTGD+PVE
Sbjct  287  LSSLRSLDLSNNALTGDIPVE  307


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G +  D+G+L  ++ L ++ N  SG +PPEI   + L +L+LS N      P Q+ Q+
Sbjct  494  FTGEIPSDIGRLRNVLKLDMSRNNFSGSIPPEIGNCTLLTYLDLSQNQLSGPIPPQVVQI  553

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L   ++  N+L   LP E+  + S
Sbjct  554  HILNYFNVSWNHLNQSLPKELGSLKS  579



>ref|XP_009407942.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
Length=623

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 79/145 (54%), Gaps = 3/145 (2%)
 Frame = +1

Query  169  SAGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvs  342
            +AG     P GV  E  AL+ IKA+   D  S L +W+  S   C+W  VTC     VV 
Sbjct  20   AAGTALLSPKGVNFEVQALMGIKASLM-DPHSVLENWDQDSVDPCSWTMVTCSPENLVVG  78

Query  343  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  522
            L     NLSG LSP +G L  L  L +  N +SGP+PPEI  +S L+ ++LSNN F    
Sbjct  79   LATPSQNLSGTLSPSIGNLTNLKILFLQNNNMSGPIPPEIGKLSKLQTIDLSNNYFSGEI  138

Query  523  PHQLAQLANLQVLDLYNNNLTGDLP  597
            P  L  L NLQ + L NN+L+G  P
Sbjct  139  PDSLGNLNNLQYMRLNNNSLSGAFP  163



>ref|XP_011036960.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Populus euphratica]
Length=1022

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 83/140 (59%), Gaps = 1/140 (1%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLS  381
            T++ ALLS+K+  T D  ++L SWN ++S C W RV+C+ +   V       L L+G +S
Sbjct  37   TDKEALLSLKSQVTTDPSNTLFSWNNNSSPCNWTRVSCNQVNQRVVGLDLSGLRLTGSIS  96

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            P++G L FL +L +  NQ +G +P +I A+S L  LN+S N      P  + +  NLQ+L
Sbjct  97   PNIGNLSFLRSLHLQGNQFTGLIPDQIGALSRLSVLNISFNSITGRIPLNITKCLNLQIL  156

Query  562  DLYNNNLTGDLPVEVYKMTS  621
            DL  N ++G +P E+  + S
Sbjct  157  DLMQNEISGAIPEELSNLKS  176


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            +SG +  ++  L  L  L +  N+L G +PP  + I++L  LNL+ N  G   P    + 
Sbjct  163  ISGAIPEELSNLKSLEILKLGGNKLWGTIPPSFANITSLLTLNLATNNLGGMIPDDFGRF  222

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
             NL  LDL  NNLTG++P+ +Y ++S
Sbjct  223  KNLNHLDLSINNLTGNVPLSLYNISS  248


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            +SG + P++G+L  L  L +AAN++SG +P  +  +  L  ++LS N    + P      
Sbjct  411  VSGEIPPEIGELTNLQELHLAANKISGRIPNSLGKLQKLNEIDLSTNDLVGSLPTTFVNF  470

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  +DL +N + G +P E++ ++S
Sbjct  471  QQLVSMDLSSNRINGSIPKEIFSLSS  496


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            + G +   +  L  L  L+I+ N +SG +PPEI  ++ L+ L+L+ N      P+ L +L
Sbjct  387  IYGRIPASIRHLRSLALLNISYNYVSGEIPPEIGELTNLQELHLAANKISGRIPNSLGKL  446

Query  544  ANLQVLDLYNNNLTGDLP  597
              L  +DL  N+L G LP
Sbjct  447  QKLNEIDLSTNDLVGSLP  464



>ref|XP_010686227.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 [Beta vulgaris subsp. vulgaris]
Length=614

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 80/144 (56%), Gaps = 2/144 (1%)
 Frame = +1

Query  193  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  366
            P GV  E AAL+S+K     D    L  W+I S   CTW  V C +   V+SLD++ + L
Sbjct  24   PKGVNYEVAALMSLKNKMRDDKYHVLDGWDINSVDPCTWYMVACSAEASVISLDMASMGL  83

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  546
            SG LSP +G L  L ++S+  NQLSGP+P EI  +  L+ L+LS N F    P  +  L 
Sbjct  84   SGTLSPSIGNLTHLRSISMQNNQLSGPIPDEIGKLQELQTLDLSGNQFSGEIPGSIGNLG  143

Query  547  NLQVLDLYNNNLTGDLPVEVYKMT  618
            +L  L L  N L+G +P  V  +T
Sbjct  144  HLSYLKLSRNKLSGQIPEHVANLT  167



>ref|XP_011004294.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X1 [Populus euphratica]
Length=988

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 82/142 (58%), Gaps = 5/142 (4%)
 Frame = +1

Query  202  VTEQAALL-SIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lNLS  369
            +  QA++L S+K +  +    SL SWN+S  H  C+W  + CD +   V        N+S
Sbjct  33   LKRQASILVSLKQSLES-YDPSLDSWNVSNYHLLCSWTGIQCDDMNRSVVALDISNSNIS  91

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  549
            G LSP + +L  LVNLSI  N  S   P EI  +  L+FLN+SNN+F      + +QL  
Sbjct  92   GTLSPAITELRSLVNLSIQGNSFSDEFPREIHKLIRLQFLNISNNLFSGELAWEFSQLKE  151

Query  550  LQVLDLYNNNLTGDLPVEVYKM  615
            LQVLD+YNNNL G LP+ V ++
Sbjct  152  LQVLDVYNNNLNGTLPLGVTQL  173


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
              G + P+ G+L  LV++ +A   LSGP+PPE+  ++ L  L L  N      P +L  L
Sbjct  235  FDGGIPPEFGKLINLVHIDLANCSLSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNL  294

Query  544  ANLQVLDLYNNNLTGDLPVE  603
            +++  LDL NN LTGD+P+E
Sbjct  295  SSIISLDLSNNALTGDIPLE  314


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NLSG + P++G    L  L ++ NQLSGP+P  I+ I  L +LN+S N    + P ++  
Sbjct  523  NLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVHITQIHILNYLNISWNHLNQSLPKEIGS  582

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L   D  +NN +G +P
Sbjct  583  MKSLTSADFSHNNFSGSIP  601


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            LSG +   + + P  L  +++A N+LSGP+P  I   S L+ L LS N F    P Q+ Q
Sbjct  451  LSGQVPQQISKTPSKLAQMNLADNRLSGPLPASIGNFSNLQILLLSGNRFTGEIPSQIGQ  510

Query  541  LANLQVLDLYNNNLTGDLPVEV  606
            L N+  LD+  NNL+G++P E+
Sbjct  511  LKNVFTLDMSRNNLSGNIPPEI  532


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 50/81 (62%), Gaps = 0/81 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P++G L  +++L ++ N L+G +P E S +  L  LNL  N      P+ +A+L
Sbjct  283  LTGPIPPELGNLSSIISLDLSNNALTGDIPLEFSGLRRLTLLNLFLNKLHGEIPYFIAEL  342

Query  544  ANLQVLDLYNNNLTGDLPVEV  606
              L+VL L++NN TG +P ++
Sbjct  343  PELEVLKLWHNNFTGAIPAKL  363


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G L  L  L +  N+L+GP+PPE+  +S++  L+LSNN      P + + L
Sbjct  259  LSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNLSSIISLDLSNNALTGDIPLEFSGL  318

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L +L+L+ N L G++P  + ++
Sbjct  319  RRLTLLNLFLNKLHGEIPYFIAEL  342


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G +   +GQL  +  L ++ N LSG +PPEI    TL +L+LS N      P  + Q+
Sbjct  500  FTGEIPSQIGQLKNVFTLDMSRNNLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVHITQI  559

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L++  N+L   LP E+  M S
Sbjct  560  HILNYLNISWNHLNQSLPKEIGSMKS  585



>ref|XP_008811184.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Phoenix dactylifera]
Length=635

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 87/153 (57%), Gaps = 3/153 (2%)
 Frame = +1

Query  169  SAGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvs  342
            ++ AG   P GV  E  AL+ IKA+   D  S L +W+  S   C+W  VTC     V+S
Sbjct  31   ASAAGLLSPKGVNFEVQALMGIKASLK-DPHSVLENWDRDSVDPCSWAMVTCSPENLVIS  89

Query  343  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  522
            L +   NLSG LS  +G L  L  + +  N +SGP+PPEI  +S L+ L+LSNN F    
Sbjct  90   LGIPSQNLSGTLSSSIGNLTNLETVLLQNNNISGPIPPEIGKLSKLKTLDLSNNYFTGGI  149

Query  523  PHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTS  621
            P  + QL +LQ L L NN+L+G LP+ +  +T 
Sbjct  150  PTSIGQLESLQYLRLNNNSLSGALPLSLANLTE  182



>ref|XP_010520745.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Tarenaya 
hassleriana]
Length=999

 Score = 95.5 bits (236),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 83/140 (59%), Gaps = 1/140 (1%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  378
            VT++ AL+S ++  + DS +  +SW+ +TS C W  V+C +    V       L  +G +
Sbjct  32   VTDREALISFRSKLSVDSPNPFSSWDKNTSPCDWTGVSCGTRNLRVISLNLSGLGFTGFI  91

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  558
            SP +G L FL +L +  N+L GP+P EI+ +  LR LNLS+N    + P   ++L  L+V
Sbjct  92   SPSIGNLSFLTSLQLQRNRLYGPIPEEIANLFRLRNLNLSSNSLEGSLPSNTSKLVELKV  151

Query  559  LDLYNNNLTGDLPVEVYKMT  618
            LDL +N ++G +PV +  +T
Sbjct  152  LDLTSNKISGPIPVNIGYLT  171


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            +SG +  ++G L  L  LS+  N L GP+PP ++ +S L  LNL  N      P  L++L
Sbjct  159  ISGPIPVNIGYLTKLQVLSLGKNLLHGPLPPSMANLSLLTVLNLDTNSLNGPIPESLSRL  218

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L+VLDL  NNLTG +P  +Y M+S
Sbjct  219  RRLKVLDLSINNLTGTIPPSIYNMSS  244



>ref|XP_008665503.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Zea mays]
 tpg|DAA51666.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1034

 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 81/129 (63%), Gaps = 6/129 (5%)
 Frame = +1

Query  247  ADSQSSLTSWNISTS-HCTWRRVTCd----sllhvvsldlsglNLSGVLSPDVGQLPFLV  411
            +D   +L SW+ ++S HC W  VTC         VV LD+SGLNLSG L P + +L  L 
Sbjct  34   SDPTGALASWDAASSDHCAWVGVTCAPRGSGGGVVVGLDVSGLNLSGALPPALSRLRGLQ  93

Query  412  NLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT-G  588
             LS+AAN   GP+PP ++ +  L  LNLSNN F  +FP  LA+L  L+VLDLYNNNLT  
Sbjct  94   RLSVAANGFYGPIPPSLARLQLLVHLNLSNNAFNGSFPPALARLRALRVLDLYNNNLTSA  153

Query  589  DLPVEVYKM  615
             LP+EV  M
Sbjct  154  TLPLEVTHM  162


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
               G + P+VG+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  512  KFEGGVPPEVGKCRLLTYLDMSQNNLSGKIPPAISGMRILNYLNLSRNHLDGEIPPSIAT  571

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  +D   NNL+G +P
Sbjct  572  MQSLTAVDFSYNNLSGLVP  590


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 50/85 (59%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             SG + P+ G+ P L  L+++ N+LSG +PPE+  +++LR L +   N +    P +L  
Sbjct  175  FSGEIPPEYGRWPRLQYLAVSGNELSGKIPPELGNLTSLRELYIGYYNSYTGGLPPELGN  234

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L  L  LD  N  L+G++P E+ ++
Sbjct  235  LTELVRLDAANCGLSGEIPPELGRL  259


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG + P++G+L  L    +++N+  G VPPE+     L +L++S N      P  ++ +
Sbjct  489  FSGAIPPEIGRLQQLSKADLSSNKFEGGVPPEVGKCRLLTYLDMSQNNLSGKIPPAISGM  548

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G++P  +  M S
Sbjct  549  RILNYLNLSRNHLDGEIPPSIATMQS  574


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN      P   ++L
Sbjct  248  LSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGYLRSLSSLDLSNNALTGEIPASFSEL  307

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
             NL +L+L+ N L GD+P  V  + S
Sbjct  308  KNLTLLNLFRNKLRGDIPGFVGDLPS  333



>ref|XP_011004295.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X2 [Populus euphratica]
Length=893

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 82/142 (58%), Gaps = 5/142 (4%)
 Frame = +1

Query  202  VTEQAALL-SIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lNLS  369
            +  QA++L S+K +  +    SL SWN+S  H  C+W  + CD +   V        N+S
Sbjct  33   LKRQASILVSLKQSLES-YDPSLDSWNVSNYHLLCSWTGIQCDDMNRSVVALDISNSNIS  91

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  549
            G LSP + +L  LVNLSI  N  S   P EI  +  L+FLN+SNN+F      + +QL  
Sbjct  92   GTLSPAITELRSLVNLSIQGNSFSDEFPREIHKLIRLQFLNISNNLFSGELAWEFSQLKE  151

Query  550  LQVLDLYNNNLTGDLPVEVYKM  615
            LQVLD+YNNNL G LP+ V ++
Sbjct  152  LQVLDVYNNNLNGTLPLGVTQL  173


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
              G + P+ G+L  LV++ +A   LSGP+PPE+  ++ L  L L  N      P +L  L
Sbjct  235  FDGGIPPEFGKLINLVHIDLANCSLSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNL  294

Query  544  ANLQVLDLYNNNLTGDLPVE  603
            +++  LDL NN LTGD+P+E
Sbjct  295  SSIISLDLSNNALTGDIPLE  314


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NLSG + P++G    L  L ++ NQLSGP+P  I+ I  L +LN+S N    + P ++  
Sbjct  523  NLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVHITQIHILNYLNISWNHLNQSLPKEIGS  582

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L   D  +NN +G +P
Sbjct  583  MKSLTSADFSHNNFSGSIP  601


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            LSG +   + + P  L  +++A N+LSGP+P  I   S L+ L LS N F    P Q+ Q
Sbjct  451  LSGQVPQQISKTPSKLAQMNLADNRLSGPLPASIGNFSNLQILLLSGNRFTGEIPSQIGQ  510

Query  541  LANLQVLDLYNNNLTGDLPVEV  606
            L N+  LD+  NNL+G++P E+
Sbjct  511  LKNVFTLDMSRNNLSGNIPPEI  532


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G L  L  L +  N+L+GP+PPE+  +S++  L+LSNN      P + + L
Sbjct  259  LSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNLSSIISLDLSNNALTGDIPLEFSGL  318

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L +L+L+ N L G++P  + ++
Sbjct  319  RRLTLLNLFLNKLHGEIPYFIAEL  342


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 50/81 (62%), Gaps = 0/81 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P++G L  +++L ++ N L+G +P E S +  L  LNL  N      P+ +A+L
Sbjct  283  LTGPIPPELGNLSSIISLDLSNNALTGDIPLEFSGLRRLTLLNLFLNKLHGEIPYFIAEL  342

Query  544  ANLQVLDLYNNNLTGDLPVEV  606
              L+VL L++NN TG +P ++
Sbjct  343  PELEVLKLWHNNFTGAIPAKL  363


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G +   +GQL  +  L ++ N LSG +PPEI    TL +L+LS N      P  + Q+
Sbjct  500  FTGEIPSQIGQLKNVFTLDMSRNNLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVHITQI  559

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L++  N+L   LP E+  M S
Sbjct  560  HILNYLNISWNHLNQSLPKEIGSMKS  585



>ref|XP_004955422.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Setaria italica]
Length=1030

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 76/118 (64%), Gaps = 2/118 (2%)
 Frame = +1

Query  259  SSLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAAN  432
             +L SW  N + S C W  VTC++   V+ +DLSG NLSG +   + +LP L  L +AAN
Sbjct  47   GALASWTANATASPCAWSGVTCNARGAVIGVDLSGRNLSGPVPAALSRLPHLARLDLAAN  106

Query  433  QLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEV  606
              SGP+P  ++ +  L  LNLSNN+   TFP  LA+L  L+V+DLYNNNLTG LP+ V
Sbjct  107  AFSGPIPTPLARLRYLTHLNLSNNVLNGTFPPPLARLRALRVVDLYNNNLTGPLPLGV  164


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A +
Sbjct  518  LDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNHLDGEIPATIAAM  577

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  578  QSLTAVDFSYNNLSGLVP  595


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G + P++G+L  L    ++ N L G VPPEI     L +L+LS N      P  ++ +
Sbjct  494  FNGAVPPEIGRLQQLSKADLSGNSLDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGM  553

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G++P  +  M S
Sbjct  554  RILNYLNLSRNHLDGEIPATIAAMQS  579


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 62/139 (45%), Gaps = 15/139 (11%)
 Frame = +1

Query  193  PLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSG  372
            PLGV    AL  +          +  S  I   + TW R+          L +SG  LSG
Sbjct  161  PLGVAALPALRHLHLG------GNFFSGEIPPEYGTWGRLQ--------YLAVSGNELSG  206

Query  373  VLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  549
             + P++G L  L  L I   N  SG +PPE+  ++ L  L+ +N       P +L  LAN
Sbjct  207  RIPPELGNLTSLRELYIGYYNSYSGGIPPELGNMTELVRLDAANCGLSGEIPPELGNLAN  266

Query  550  LQVLDLYNNNLTGDLPVEV  606
            L  L L  N L G +P E+
Sbjct  267  LDTLFLQVNGLAGGIPPEL  285


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G L  L  L +  N L+G +PPE+  + +L  L+LSNN      P   A L
Sbjct  253  LSGEIPPELGNLANLDTLFLQVNGLAGGIPPELGRLRSLSSLDLSNNALTGEIPATFAAL  312

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
             NL +L+L+ N L G +P  V  + S
Sbjct  313  KNLTLLNLFRNKLRGSIPELVGDLPS  338



>ref|XP_002466378.1| hypothetical protein SORBIDRAFT_01g006690 [Sorghum bicolor]
 gb|EER93376.1| hypothetical protein SORBIDRAFT_01g006690 [Sorghum bicolor]
Length=1030

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 80/124 (65%), Gaps = 5/124 (4%)
 Frame = +1

Query  259  SSLTSWNISTS-HCTWRRVTCd---sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIA  426
             +L SW +++S HC W  VTC    S   VV LD+SGLNLSG L P + +L  L  LS+A
Sbjct  45   GALASWGVASSDHCAWAGVTCAPRGSGGVVVGLDVSGLNLSGALPPALSRLRGLQRLSVA  104

Query  427  ANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT-GDLPVE  603
            AN   GP+PP ++ +  L  LNLSNN F  +FP  LA+L  L+VLDLYNNNLT   LP+E
Sbjct  105  ANGFYGPIPPSLARLQLLVHLNLSNNAFNGSFPPALARLRALRVLDLYNNNLTSATLPLE  164

Query  604  VYKM  615
            V  M
Sbjct  165  VTHM  168


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
               G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  518  KFEGGVPPEIGKCRLLTYLDMSQNNLSGKIPPAISGMRILNYLNLSRNHLDGEIPPSIAT  577

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  +D   NNL+G +P
Sbjct  578  MQSLTAVDFSYNNLSGLVP  596


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 50/85 (59%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             SG + P+ G+ P L  L+++ N+LSG +PPE+  +++LR L +   N +    P +L  
Sbjct  181  FSGEIPPEYGRWPRLQYLAVSGNELSGKIPPELGNLTSLRELYIGYYNSYTGGLPPELGN  240

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L  L  LD  N  L+G++P E+ ++
Sbjct  241  LTELVRLDAANCGLSGEIPPELGRL  265


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG + P++G+L  L    +++N+  G VPPEI     L +L++S N      P  ++ +
Sbjct  495  FSGAIPPEIGRLQQLSKADLSSNKFEGGVPPEIGKCRLLTYLDMSQNNLSGKIPPAISGM  554

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G++P  +  M S
Sbjct  555  RILNYLNLSRNHLDGEIPPSIATMQS  580



>gb|AHJ14779.1| CLAVATA1 [Rhododendron ovatum]
Length=992

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 77/137 (56%), Gaps = 3/137 (2%)
 Frame = +1

Query  220  LLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDV  390
            LLS+K AF     S LTSWN+S   S CTW  + CD+    +        N+SG L P +
Sbjct  41   LLSLKQAFEPPEDSCLTSWNVSNYNSLCTWTGIKCDAKNTSILSLDISNYNISGYLLPAI  100

Query  391  GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLY  570
              +  LVNLS++ N LSG  P +I  +  L+FLN+SNN F  +   Q ++L  L VLD Y
Sbjct  101  SDIHTLVNLSVSGNSLSGTFPVDIHKLVRLQFLNISNNQFNGSLNWQFSKLKKLVVLDAY  160

Query  571  NNNLTGDLPVEVYKMTS  621
            NN  +G LP+ V  ++ 
Sbjct  161  NNEFSGSLPLGVTDLSK  177


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 52/103 (50%), Gaps = 25/103 (24%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI------------  507
            L G + P++G L  L  L +  NQLSG +PPE++ ++TL+  +LSNN+            
Sbjct  261  LKGPIPPELGNLNKLDTLFLQTNQLSGSIPPELANLTTLKSFDLSNNVLTGEIPVELFSG  320

Query  508  -------------FGSTFPHQLAQLANLQVLDLYNNNLTGDLP  597
                         F    P  LA+L NL+VL L+ NN TG +P
Sbjct  321  LKELTLLNLFLNKFHGEIPRVLAELPNLEVLKLWQNNFTGSIP  363


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
              G +  ++G L  LV L +++  L GP+PPE+  ++ L  L L  N    + P +LA L
Sbjct  237  FDGGIPAELGNLVNLVRLDLSSCGLKGPIPPELGNLNKLDTLFLQTNQLSGSIPPELANL  296

Query  544  ANLQVLDLYNNNLTGDLPVEVY  609
              L+  DL NN LTG++PVE++
Sbjct  297  TTLKSFDLSNNVLTGEIPVELF  318


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            N SG +  ++     L  L ++ NQLSGP+P +I+ I  L +LN+S N    + P ++  
Sbjct  526  NFSGQIPAEISNCLMLTYLDLSQNQLSGPIPDQIAQIHILNYLNISWNHLNQSLPKEIGL  585

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L   D  +NN +G +P
Sbjct  586  MKSLTSADFSHNNFSGPIP  604


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 45/84 (54%), Gaps = 0/84 (0%)
 Frame = +1

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  549
            G +  D+G+L  +  L ++ N  SG +P EIS    L +L+LS N      P Q+AQ+  
Sbjct  505  GDIPSDIGRLKNIFKLDMSRNNFSGQIPAEISNCLMLTYLDLSQNQLSGPIPDQIAQIHI  564

Query  550  LQVLDLYNNNLTGDLPVEVYKMTS  621
            L  L++  N+L   LP E+  M S
Sbjct  565  LNYLNISWNHLNQSLPKEIGLMKS  588


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            L+G L     +LP  L  L++A N+LSG +P  I   S+L  L L+ N F    P  + +
Sbjct  454  LTGQLEQQRSKLPMKLGQLNLANNRLSGSLPASIGNFSSLNILLLNGNRFIGDIPSDIGR  513

Query  541  LANLQVLDLYNNNLTGDLPVEV  606
            L N+  LD+  NN +G +P E+
Sbjct  514  LKNIFKLDMSRNNFSGQIPAEI  535



>gb|EYU38789.1| hypothetical protein MIMGU_mgv1a000850mg [Erythranthe guttata]
Length=962

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 91/148 (61%), Gaps = 11/148 (7%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSW----------NISTSHCTWRRVTCdsllhvvsldls  354
            ++   LL IK++    S S L  W          + S++HC++  VTCD    V SL+++
Sbjct  23   SDLETLLDIKSSLVGPSGSGLHDWVGPSPSPPSASSSSAHCSFSGVTCDEDGRVTSLNVT  82

Query  355  glNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ-  531
            G  LSGVL P++G L  LVNL++AA  L+GP+P E+S +++L+ +NLS N+     P + 
Sbjct  83   GAPLSGVLPPEIGLLSKLVNLTLAAGNLTGPLPVEMSELTSLKHVNLSWNLLNGVIPGET  142

Query  532  LAQLANLQVLDLYNNNLTGDLPVEVYKM  615
            + +LA L+V D+YNNN TG LP E  K+
Sbjct  143  VLRLAELEVFDVYNNNFTGSLPAEFVKL  170


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL+G++  ++     L++L ++ N LSG +P   S +  L  +NL  N F    P  +  
Sbjct  257  NLTGLIPAELSGSTSLMSLDLSINNLSGEIPASFSELKNLTLINLFQNKFQGPLPGFIGD  316

Query  541  LANLQVLDLYNNNLTGDLP  597
            L NL+VL ++NNN T  LP
Sbjct  317  LPNLEVLQIWNNNFTLSLP  335



>gb|KJB29653.1| hypothetical protein B456_005G112100 [Gossypium raimondii]
Length=980

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 89/140 (64%), Gaps = 4/140 (3%)
 Frame = +1

Query  199  GVTEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLS  369
            G ++   LL +K++      S L +W  S+S   HC +  V CD    VV+L++S   L 
Sbjct  25   GSSDLEVLLLLKSSMIGPKGSGLENWEFSSSPSAHCRFSGVQCDEDFSVVALNVSFAPLF  84

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLA  546
            G + P++G L  LVNL+I+++ L+G +P E+  +++L+  N+SNN+F  +FP ++ A + 
Sbjct  85   GTIPPEIGLLNKLVNLTISSDSLTGRIPVEMGNLTSLKIFNISNNVFQGSFPGEIFAGMT  144

Query  547  NLQVLDLYNNNLTGDLPVEV  606
            +L++LD YNNN TG LP+EV
Sbjct  145  HLEILDAYNNNFTGVLPIEV  164


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 48/87 (55%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              SG +  ++  +  L  ++I+ N ++G +PP IS  ++L  ++ S N F    P  + +
Sbjct  491  KFSGEIPGEIFNIKLLSKMNISDNNITGEIPPSISRCTSLTSIDFSRNSFTGEIPDGIDE  550

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            L +L +L+   N LTG++P E+  M S
Sbjct  551  LKDLSILNFSRNQLTGEIPAEIRNMIS  577



>ref|XP_004955796.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Setaria italica]
Length=1053

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 89/141 (63%), Gaps = 4/141 (3%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll--hvvsldlsglNLSGVLS  381
            ++AAL++ KA  + DS   L+SWN STS+C+W  +TC       VV+LDLS   L+G +S
Sbjct  38   DEAALVAFKAKISGDS-GKLSSWNESTSYCSWEGITCSKRYPWRVVALDLSSQGLTGTIS  96

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            P VG L FL++L++++N L G +PP I ++S LR L+LS N+     P  +++  +L+V+
Sbjct  97   PAVGNLTFLLSLNLSSNALQGEIPPSIGSLSRLRILDLSENMLNGVIPSNISRCTSLRVM  156

Query  562  DL-YNNNLTGDLPVEVYKMTS  621
             +  N  + G +P E+  M S
Sbjct  157  MISRNKGVQGSIPAEIGNMPS  177


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 48/83 (58%), Gaps = 1/83 (1%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            N SG +   +G L   + +   AN L GP+PP I  +S L  L+LS N      P+++ +
Sbjct  432  NFSGRIPFSIGNLTESIGIGAYANSLEGPIPPSIGNLSKLLGLDLSMNKLTGLIPNEIMK  491

Query  541  LANLQV-LDLYNNNLTGDLPVEV  606
            L+++ + +DL NN L G LP+EV
Sbjct  492  LSSISIGIDLSNNMLEGSLPLEV  514



>emb|CDP04113.1| unnamed protein product [Coffea canephora]
Length=987

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 81/138 (59%), Gaps = 3/138 (2%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsglNLSGVLS  381
            + + L+S+K  F   S  SL SWN+S     C W  +TCD    VVSLD+S LNLSG LS
Sbjct  38   QASVLVSVKQKFQTSS-PSLDSWNMSNYMFLCMWNGITCDENRLVVSLDISNLNLSGSLS  96

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            P + +L  L+N+S+A N   G   PEI     LR LNLSNN+F      + + L  L+VL
Sbjct  97   PAITELRSLINISVAGNGFFGVFLPEIHKFENLRILNLSNNVFSGNLSWEFSHLQELEVL  156

Query  562  DLYNNNLTGDLPVEVYKM  615
            D YNNN +G LP  + ++
Sbjct  157  DGYNNNFSGPLPFGISQL  174


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L G +  ++G L  L  L +  NQL+G +PP++  +++L+ L+LSNN+     P +L+ L
Sbjct  260  LVGPIPAELGHLKMLDTLFLQTNQLNGSIPPQLGNLASLKSLDLSNNVLTGEIPAELSPL  319

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L +L+L+ N L G++P  V ++
Sbjct  320  QELTLLNLFMNRLHGEIPQFVEEL  343


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            N SG + P++G+   L  L ++ NQLSGP+P +I+ I  L + N+S N      P ++  
Sbjct  524  NFSGNIPPEIGKCLSLTYLDLSQNQLSGPIPVQIAQIHILNYFNISWNHLSQKLPKEIGS  583

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L   D  +NN +G +P
Sbjct  584  IKSLTSADFSHNNFSGSIP  602


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 47/81 (58%), Gaps = 0/81 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
              G +  ++G+L  LV+L +A   L GP+P E+  +  L  L L  N    + P QL  L
Sbjct  236  FDGGIPSELGKLINLVHLDLANCGLVGPIPAELGHLKMLDTLFLQTNQLNGSIPPQLGNL  295

Query  544  ANLQVLDLYNNNLTGDLPVEV  606
            A+L+ LDL NN LTG++P E+
Sbjct  296  ASLKSLDLSNNVLTGEIPAEL  316


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P +G L  L +L ++ N L+G +P E+S +  L  LNL  N      P  + +L
Sbjct  284  LNGSIPPQLGNLASLKSLDLSNNVLTGEIPAELSPLQELTLLNLFMNRLHGEIPQFVEEL  343

Query  544  ANLQVLDLYNNNLTGDLPVEV  606
              L+VL L+ NN TG +P ++
Sbjct  344  PQLEVLKLWQNNFTGSIPQKL  364


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 42/72 (58%), Gaps = 0/72 (0%)
 Frame = +1

Query  406  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  585
            L  L+++ N+LSGP+P  I   S L+ L L+ N F    P ++  L N+  LD+  NN +
Sbjct  467  LEGLNLSNNRLSGPLPISIGKFSGLKILLLNGNHFSGNIPSEIGSLGNMLRLDMSKNNFS  526

Query  586  GDLPVEVYKMTS  621
            G++P E+ K  S
Sbjct  527  GNIPPEIGKCLS  538


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 46/84 (55%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L   +G+   L  L +  N  SG +P EI ++  +  L++S N F    P ++ + 
Sbjct  477  LSGPLPISIGKFSGLKILLLNGNHFSGNIPSEIGSLGNMLRLDMSKNNFSGNIPPEIGKC  536

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
             +L  LDL  N L+G +PV++ ++
Sbjct  537  LSLTYLDLSQNQLSGPIPVQIAQI  560



>ref|XP_010943209.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Elaeis guineensis]
Length=995

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 80/149 (54%), Gaps = 27/149 (18%)
 Frame = +1

Query  163  RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHC-TWRRVTCdsllhvv  339
            R SA A  G+     E  AL+ +KAA   +   SL  W+ +  HC +W  V CD+     
Sbjct  15   RPSATAATGEGT-AAEHRALVELKAAI-GNPTGSLAGWDAAADHCRSWAGVACDAAGR--  70

Query  340  sldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  519
                                  +V+L I+   LSGP+PPE+S +S LR+LNLSNN+F  T
Sbjct  71   ----------------------VVSLDISNLNLSGPIPPELSLLSGLRYLNLSNNVFNGT  108

Query  520  FPHQLAQLANLQVLDLYNNNLTGDLPVEV  606
            FP  L++L NL+ LDLYNNNLT  LPV V
Sbjct  109  FPSDLSRLKNLRALDLYNNNLTDVLPVVV  137


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 48/84 (57%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L   +G  P L  L +  NQ SG +PPEI  +  L  ++ S N F    P ++++ 
Sbjct  441  LSGALPSSIGNFPGLQKLLLNQNQFSGCIPPEIGRLQQLSKMDFSGNRFSCPIPPEISKC  500

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              +  +DL  NNL+G++PVE+ +M
Sbjct  501  RLVTFIDLSRNNLSGEIPVEITEM  524


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG + P++G+L  L  +  + N+ S P+PPEIS    + F++LS N      P ++ ++
Sbjct  465  FSGCIPPEIGRLQQLSKMDFSGNRFSCPIPPEISKCRLVTFIDLSRNNLSGEIPVEITEM  524

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G++P  +  M S
Sbjct  525  RILNYLNLSRNHLEGEIPTSISTMQS  550


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG ++P++G+L  L ++ ++ N L+G +PP  + +  L  LNL  N      P  +  L
Sbjct  250  LSGEITPELGKLWGLKSMDLSNNALTGEIPPTFADLKNLTLLNLFRNKLHGAIPDFVGDL  309

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+VL L+ NN TG++P
Sbjct  310  PELEVLQLWENNFTGEIP  327


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G L  L  L +  N LSG + PE+  +  L+ ++LSNN      P   A L
Sbjct  226  LSGEIPPEMGDLQNLDTLFLQVNGLSGEITPELGKLWGLKSMDLSNNALTGEIPPTFADL  285

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL +L+L+ N L G +P
Sbjct  286  KNLTLLNLFRNKLHGAIP  303


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  540
             SG + P+ G+   +  L+I+ N+LSGP+PPE+  ++TLR L +   N +    P     
Sbjct  153  FSGAIPPEYGRWEHIEYLAISGNELSGPIPPELGNLTTLRELYIGYFNSYQGGLPAAFGN  212

Query  541  LANLQVLDLYNNNLTGDLPVEV  606
            L +L  LD  N  L+G++P E+
Sbjct  213  LTSLVRLDAANCGLSGEIPPEM  234



>gb|AAT64017.1| putative leucine-rich repeat transmembrane protein [Gossypium 
hirsutum]
Length=618

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 85/155 (55%), Gaps = 5/155 (3%)
 Frame = +1

Query  166  HSAGAGAG--KPLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllh  333
            HSA  G     P GV  E AAL+S+K     D Q  +  W+I S   CTW  V C +   
Sbjct  20   HSASDGDSLLSPKGVNYEVAALMSVKRELRDDKQV-MDGWDINSVDPCTWNMVACSAEGF  78

Query  334  vvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFG  513
            V+SL+++   LSG+LSP +G L  L  + +  NQLSGP+P EI  +S L+ L+LS N F 
Sbjct  79   VISLEMASTGLSGMLSPSIGNLSHLRTMLLQNNQLSGPIPDEIGKLSELQTLDLSGNHFV  138

Query  514  STFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMT  618
               P  L  L +L  L L  NNL+G +P  V  +T
Sbjct  139  GAIPSTLGSLTHLSYLRLSKNNLSGPIPRHVANLT  173



>ref|XP_001752668.1| CLL1B clavata1-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ82539.1| CLL1B clavata1-like receptor S/T protein kinase protein [Physcomitrella 
patens]
Length=992

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 90/136 (66%), Gaps = 3/136 (2%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  381
            E  ALL++K++F AD Q+ L +W  N + + C W  +TC +   VV L+LS +NL+G L 
Sbjct  12   EGLALLAMKSSF-ADPQNHLENWKLNGTATPCLWTGITCSNASSVVGLNLSNMNLTGTLP  70

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
             D+G+L  LVN+S+  N  +G +P EI  +  L+++N+SNN F   FP  +++L +L+VL
Sbjct  71   ADLGRLKNLVNISLDLNNFTGVLPAEIVTLLMLQYVNISNNRFNGAFPANVSRLQSLKVL  130

Query  562  DLYNNNLTGDLPVEVY  609
            D +NN+ +G LP +++
Sbjct  131  DCFNNDFSGSLPDDLW  146


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NLS  L   +G LP L +  IA N  SGP+PP+I  + +L  L+LS N      P +++ 
Sbjct  449  NLSSKLPESIGNLPTLQSFLIANNHFSGPIPPQICDMQSLNKLDLSGNELTGLIPQEMSN  508

Query  541  LANLQVLDLYNNNLTGDLPVEV  606
               L  LD   N LTG++P ++
Sbjct  509  CKKLGSLDFSRNGLTGEIPPQI  530


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L GV+   +G L  LV+L ++ N LSG +PP +  +  L  L+L +N F    P  +  +
Sbjct  258  LVGVIPVQIGNLVNLVSLDLSYNNLSGIIPPALIYLQKLELLSLMSNNFEGEIPDFIGDM  317

Query  544  ANLQVLDLYNNNLTGDLP  597
             NLQVL L+ N LTG +P
Sbjct  318  PNLQVLYLWANKLTGPIP  335


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G++  ++     L +L  + N L+G +PP+I  I  L  LNLS+N      P QL  L
Sbjct  498  LTGLIPQEMSNCKKLGSLDFSRNGLTGEIPPQIEYIPDLYLLNLSHNQLSGHIPPQLQML  557

Query  544  ANLQVLDLYNNNLTGDLP  597
              L V D   NNL+G +P
Sbjct  558  QTLNVFDFSYNNLSGPIP  575


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 39/75 (52%), Gaps = 0/75 (0%)
 Frame = +1

Query  397  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  576
            LP +  + I  NQ+ GP+P EI     L +L+ SNN   S  P  +  L  LQ   + NN
Sbjct  413  LPNITMVEIQMNQIMGPIPSEIIDSPKLSYLDFSNNNLSSKLPESIGNLPTLQSFLIANN  472

Query  577  NLTGDLPVEVYKMTS  621
            + +G +P ++  M S
Sbjct  473  HFSGPIPPQICDMQS  487



>ref|XP_007214567.1| hypothetical protein PRUPE_ppa000837mg [Prunus persica]
 gb|EMJ15766.1| hypothetical protein PRUPE_ppa000837mg [Prunus persica]
Length=986

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 85/144 (59%), Gaps = 5/144 (3%)
 Frame = +1

Query  196  LGVTEQAALL-SIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lN  363
            L +  QA++L S+K +F A S  SL SWN+S     C+W  + CD++   V        N
Sbjct  29   LSLRRQASILVSVKQSFEA-SNPSLNSWNVSNYMFICSWAGIHCDNMNISVVSLDISNYN  87

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG LSP + +L  LVNLS++ N  SG  PPEI  ++ L++LN+SNN F      + AQL
Sbjct  88   LSGSLSPAITELRTLVNLSVSGNGFSGIFPPEIHKLARLQYLNISNNGFSGNLSWEFAQL  147

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L +LD YNN+  G LP+ V ++
Sbjct  148  KELILLDAYNNDFNGSLPLGVTQI  171


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 49/81 (60%), Gaps = 0/81 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +   +G L  L +L ++ N L+G +P E SA+  L  LNL  N F    PH +A+L
Sbjct  281  LSGSIPAQLGNLSSLRSLDLSNNALTGDIPAEFSALRKLTLLNLFINKFHGEIPHAIAEL  340

Query  544  ANLQVLDLYNNNLTGDLPVEV  606
              L+VL L++NN TG +P ++
Sbjct  341  PKLEVLKLWHNNFTGAIPSKL  361


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            L+G L  +  ++P  L  L++++N+LSGP+P  I   S+L+ L LS N F    P  + +
Sbjct  449  LTGQLLEEASKVPSKLSQLNLSSNRLSGPLPTSIGNFSSLQNLLLSGNQFTGEIPSDIGR  508

Query  541  LANLQVLDLYNNNLTGDLPVEV  606
            L N+  LD   NN +G +P+EV
Sbjct  509  LVNVLKLDFSRNNFSGRIPLEV  530


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 45/84 (54%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L   +G    L NL ++ NQ +G +P +I  +  +  L+ S N F    P ++   
Sbjct  474  LSGPLPTSIGNFSSLQNLLLSGNQFTGEIPSDIGRLVNVLKLDFSRNNFSGRIPLEVGNC  533

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
             +L  LDL  N LTG +PV++ ++
Sbjct  534  LSLTYLDLSQNQLTGPIPVQIVQI  557


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
              G + P++G+L  L +L +A   L GP+PPE+  +  L  L L  N    + P QL  L
Sbjct  233  FEGGIPPEIGKLINLFHLDLANCGLEGPIPPELGNLKQLDTLFLQTNQLSGSIPAQLGNL  292

Query  544  ANLQVLDLYNNNLTGDLPVE  603
            ++L+ LDL NN LTGD+P E
Sbjct  293  SSLRSLDLSNNALTGDIPAE  312


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            N SG +  +VG    L  L ++ NQL+GP+P +I  I  L + N+S N    + P +L  
Sbjct  521  NFSGRIPLEVGNCLSLTYLDLSQNQLTGPIPVQIVQIHILNYFNVSWNHLNQSLPKELGS  580

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L   D  +N+ +G +P
Sbjct  581  MKSLTSADFSHNSFSGSIP  599



>ref|XP_008225951.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Prunus mume]
Length=986

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 85/144 (59%), Gaps = 5/144 (3%)
 Frame = +1

Query  196  LGVTEQAALL-SIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lN  363
            L +  QA++L S+K +F A S  SL SWN+S     C+W  + CD++   V        N
Sbjct  29   LSLRRQASILVSVKQSFEA-SNPSLNSWNVSNYMFLCSWAGIHCDNMNISVVSLDISNYN  87

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG LSP + +L  LVNLS++ N  SG  PPEI  ++ L++LN+SNN F      + AQL
Sbjct  88   LSGSLSPAITELRTLVNLSVSGNGFSGIFPPEIHKLARLQYLNISNNGFSGNLSWEFAQL  147

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L +LD YNN+  G LP+ V ++
Sbjct  148  KELILLDAYNNDFNGSLPLGVTQI  171


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            N SG + P+VG    L  L ++ NQL+GP+P +I  I  L + N+S N    + P +L  
Sbjct  521  NFSGRIPPEVGNCLSLTYLDLSQNQLTGPIPFQIVQIHILNYFNVSWNHLNQSLPRELGS  580

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L   D  +N+ +G +P
Sbjct  581  MKSLTSADFSHNSFSGSIP  599


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 49/81 (60%), Gaps = 0/81 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +   +G L  L +L ++ N L+G +P E SA+  L  LNL  N F    PH +A+L
Sbjct  281  LSGSIPAQLGNLSSLRSLDLSNNALTGDMPAEFSALRELTLLNLFINKFHGEIPHAIAEL  340

Query  544  ANLQVLDLYNNNLTGDLPVEV  606
              L+VL L++NN TG +P ++
Sbjct  341  PKLEVLKLWHNNFTGAIPSKL  361


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            L+G L  +  ++P  L  L++++N+LSGP+P  I   S+L+ L LS N F    P  + +
Sbjct  449  LTGQLLEEASKVPSKLSQLNLSSNRLSGPLPTSIGNFSSLQNLLLSGNQFTGEIPSDIGR  508

Query  541  LANLQVLDLYNNNLTGDLPVEV  606
            L N+  LD   NN +G +P EV
Sbjct  509  LVNVLKLDFSRNNFSGRIPPEV  530


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
              G + P++G+L  L +L +A   L GP+PPE+  +  L  L L  N    + P QL  L
Sbjct  233  FEGGIPPEIGKLINLFHLDLANCGLEGPIPPELGNLKQLDTLFLQTNQLSGSIPAQLGNL  292

Query  544  ANLQVLDLYNNNLTGDLPVE  603
            ++L+ LDL NN LTGD+P E
Sbjct  293  SSLRSLDLSNNALTGDMPAE  312


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 44/84 (52%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L   +G    L NL ++ NQ +G +P +I  +  +  L+ S N F    P ++   
Sbjct  474  LSGPLPTSIGNFSSLQNLLLSGNQFTGEIPSDIGRLVNVLKLDFSRNNFSGRIPPEVGNC  533

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
             +L  LDL  N LTG +P ++ ++
Sbjct  534  LSLTYLDLSQNQLTGPIPFQIVQI  557


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G +  D+G+L  ++ L  + N  SG +PPE+    +L +L+LS N      P Q+ Q+
Sbjct  498  FTGEIPSDIGRLVNVLKLDFSRNNFSGRIPPEVGNCLSLTYLDLSQNQLTGPIPFQIVQI  557

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L   ++  N+L   LP E+  M S
Sbjct  558  HILNYFNVSWNHLNQSLPRELGSMKS  583



>ref|XP_009108464.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Brassica rapa]
Length=995

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 83/143 (58%), Gaps = 5/143 (3%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsg-lNLSG  372
            V +   L SIK +F +    SL SW +    S C+W  V+CD+L   ++      LN+SG
Sbjct  36   VRQAKVLFSIKQSFDS-YDPSLDSWTVPNFNSLCSWTGVSCDNLNQSITRLDISNLNISG  94

Query  373  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIF-GSTFPHQLAQLAN  549
             LSP+V +LP LV LS+A+N  SG +P EI  +S L  LN+S N F G   P +  ++  
Sbjct  95   TLSPEVSRLPSLVFLSVASNSFSGKIPKEIHKLSNLEVLNISTNAFEGELAPLEFGEMTQ  154

Query  550  LQVLDLYNNNLTGDLPVEVYKMT  618
            L  LD YNNN TG LP+ + K+T
Sbjct  155  LTTLDAYNNNFTGSLPLSLTKLT  177


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NLSG L P+ G+   L  L ++ N++SG +P +IS I  L +LN+S N    + P +L  
Sbjct  528  NLSGKLPPEFGECQSLTYLDLSHNEISGQIPVQISRIRILNYLNVSWNSLNQSLPVELGS  587

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  +D  +NN +G +P
Sbjct  588  MKSLTSVDFSHNNFSGSVP  606


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            +  G +  D+G+L  LV+L +A   L G +P E+  +  L  L L  N    + P +L  
Sbjct  237  DFHGGIPADLGRLINLVHLDLANCSLKGSIPAELGFLKNLEILFLQTNELTGSVPRELGN  296

Query  541  LANLQVLDLYNNNLTGDLPVEV  606
            + +L+ LDL NN L G++P+E+
Sbjct  297  MTSLKTLDLSNNFLEGEIPLEL  318


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L G +  ++G L  L  L +  N+L+G VP E+  +++L+ L+LSNN      P +L+ L
Sbjct  262  LKGSIPAELGFLKNLEILFLQTNELTGSVPRELGNMTSLKTLDLSNNFLEGEIPLELSGL  321

Query  544  ANLQVLDLYNNNLTGDLP  597
              LQ+ +L+ N L G++P
Sbjct  322  QELQLFNLFFNRLHGEIP  339


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G +  ++G L  L+ + ++ N LSG +PPE     +L +L+LS+N      P Q++++
Sbjct  505  FTGQIPGEIGSLKSLLTIDMSRNNLSGKLPPEFGECQSLTYLDLSHNEISGQIPVQISRI  564

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L++  N+L   LPVE+  M S
Sbjct  565  RILNYLNVSWNSLNQSLPVELGSMKS  590


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G +  ++G +  L  L ++ N L G +P E+S +  L+  NL  N      P  +A L
Sbjct  286  LTGSVPRELGNMTSLKTLDLSNNFLEGEIPLELSGLQELQLFNLFFNRLHGEIPEFVAHL  345

Query  544  ANLQVLDLYNNNLTGDLPVEV  606
              LQ+L L++NN TG +P ++
Sbjct  346  PVLQILKLWHNNFTGKIPAKL  366



>gb|EEC68381.1| hypothetical protein OsI_36527 [Oryza sativa Indica Group]
Length=713

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 80/138 (58%), Gaps = 4/138 (3%)
 Frame = +1

Query  199  GVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl--lhvvsldlsglNLSG  372
            G+ ++ ALLS ++   +D    L SWN S+ +C+W  V C       VV+L +S  NLSG
Sbjct  34   GMADEPALLSFESMLLSDG--FLASWNASSHYCSWPGVVCGGRHPERVVALQMSSFNLSG  91

Query  373  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  552
             +SP +G L  L  L +  NQ +G +PPEI  ++ LR LNLS+N    + P  + + A L
Sbjct  92   RISPSLGNLSLLRELELGDNQFTGDIPPEIGQLTRLRMLNLSSNYLQGSIPASIGECAEL  151

Query  553  QVLDLYNNNLTGDLPVEV  606
              +DL NN L G++P E+
Sbjct  152  MSIDLGNNQLQGEIPAEL  169


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL G +  ++G L  LV     +N+LSG +P  +     L+ ++L NN    + P  L+Q
Sbjct  442  NLEGSIPQEIGGLKNLVQFYADSNKLSGEIPSTLGECQLLQNISLQNNFLSGSVPSLLSQ  501

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMT  618
            L  LQ+LDL NNNL+G +P  +  +T
Sbjct  502  LKGLQILDLSNNNLSGQIPTFLSNLT  527


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 46/84 (55%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G+L   +G+L  L  L I  N++SG +P  I  ++ L +  L  N F    P  L  L
Sbjct  346  FTGILPSSLGRLKNLQVLYIDHNKISGSIPLAIGNLTELNYFRLDVNAFTGRIPSALGNL  405

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
             NL  L L +NN TG +PVE++K+
Sbjct  406  TNLVELGLSSNNFTGSIPVEIFKI  429



>ref|XP_009334873.1| PREDICTED: receptor protein kinase CLAVATA1 [Pyrus x bretschneideri]
Length=973

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 83/137 (61%), Gaps = 1/137 (1%)
 Frame = +1

Query  199  GVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  378
            G  +  ALL +KAA      S L  WN S+SHC +  V CD    VVSL++S + L G +
Sbjct  26   GHRDLDALLKLKAAMVGPKGSGLEDWNSSSSHCFFSGVLCDRDSRVVSLNVSNIPLFGTI  85

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QLANLQ  555
               +G L  LVNL I  + L+G +P E++ ++ L+ LN+SNN F  +FP ++   + +L+
Sbjct  86   PAAIGLLDKLVNLKITDDNLTGRLPAEMANLTALKHLNISNNAFSGSFPGEIMLGMTDLE  145

Query  556  VLDLYNNNLTGDLPVEV  606
            VLD YNNN  G LPVE+
Sbjct  146  VLDAYNNNFNGTLPVEL  162


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL G +   +  L  L +L +  N+LSG +PP++SA++ L  L+LS N      P   ++
Sbjct  250  NLVGPIPTTLSLLKHLYSLFLQVNRLSGSIPPQLSALNRLMSLDLSINELTGEIPESFSE  309

Query  541  LANLQVLDLYNNNLTGDLP  597
            L NL +++LY NNL G +P
Sbjct  310  LKNLTLVNLYKNNLYGQIP  328


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 52/112 (46%), Gaps = 26/112 (23%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS--------------  498
            ++SG + P +G L  L  LS+  N+ SG +P EI  +  L  +N+S              
Sbjct  465  HISGKIPPAIGNLKSLQTLSLEMNRFSGEIPTEIFYLKLLSKINISANNLSSDISDSISR  524

Query  499  -----------NNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTS  621
                       NN+ G   P  +A+L  L +L+   N LTG++P E+  MTS
Sbjct  525  CSSLTSVDLSRNNLVGE-IPRGIAKLKVLSILNFSRNQLTGEIPAEIRYMTS  575



>ref|XP_009405747.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Musa acuminata subsp. malaccensis]
Length=984

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 83/142 (58%), Gaps = 6/142 (4%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSWNISTSH---CTWRRVTCdsllhvvsldlsg-lNLSGV  375
            + + LLSIK +F   SQS L SWN S++H   C W  V CD   H+V        N SG 
Sbjct  35   QASILLSIKRSFH-HSQSLLPSWN-SSAHAALCAWDGVRCDDSNHLVLALDVANSNFSGS  92

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  555
            LSP + +L  L +LS+A N LSGP P  IS +  LR+LN+SNN F  T     +  A L+
Sbjct  93   LSPAIAELKGLASLSVAGNSLSGPFPHAISELPRLRYLNISNNQFNGTLNWSFSDTAELE  152

Query  556  VLDLYNNNLTGDLPVEVYKMTS  621
            VLD Y+N+ +G LPV + ++T 
Sbjct  153  VLDAYDNDFSGPLPVGLPRLTK  174


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            N SG + P++G    L  L ++ NQL+GP+P  IS +  L +LNLS N      P ++A 
Sbjct  522  NFSGRIPPEIGDCSSLTYLDLSHNQLAGPIPARISQVRILSYLNLSWNRLSQRIPQEMAS  581

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L   D  +N+ +G +P
Sbjct  582  MKSLTSADFSHNDFSGKIP  600


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L G + P++G L  L  L +  NQL+G +P ++  +S+LR+L++SNN      P + ++L
Sbjct  258  LEGEIPPELGNLKNLDTLFLQTNQLTGAIPFQLGNLSSLRYLDISNNALTGEIPKEFSKL  317

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L +L ++ N L  ++P  V ++ S
Sbjct  318  HQLTLLHVFMNRLHSEIPGFVAELPS  343


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 47/84 (56%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
              G +  ++G L  L++L +++  L G +PPE+  +  L  L L  N      P QL  L
Sbjct  234  FDGGVPAEIGNLIGLLHLDLSSCGLEGEIPPELGNLKNLDTLFLQTNQLTGAIPFQLGNL  293

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
            ++L+ LD+ NN LTG++P E  K+
Sbjct  294  SSLRYLDISNNALTGEIPKEFSKL  317



>gb|KFK42020.1| hypothetical protein AALP_AA2G201900 [Arabis alpina]
Length=974

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 90/139 (65%), Gaps = 5/139 (4%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLSGV  375
            T+   LL++K++ T  + + L  W  STS   HC++  VTC+S   V+SL++S   L G 
Sbjct  30   TDMETLLNLKSSMTGPNGAGLHDWLHSTSPTSHCSFSGVTCNSQSRVISLNISFTPLFGT  89

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI-FGSTFPHQL-AQLAN  549
            +SP++G L  LVNL++AAN  SG +P  +  +++L+ LN+SNN     TFP ++   + N
Sbjct  90   ISPEIGNLNHLVNLTLAANNFSGNLPTSLKNLTSLKILNISNNGNLNGTFPGEIFIYMTN  149

Query  550  LQVLDLYNNNLTGDLPVEV  606
            L+VLD YNNN TG LP+++
Sbjct  150  LEVLDAYNNNFTGTLPLQI  168


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = +1

Query  394  QLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYN  573
            +L  L  ++I+ N L+G +P  IS  ++L  ++LS N  G   P ++ Q+ NL  L+L  
Sbjct  506  ELNHLTKVNISGNNLTGEIPGSISRCTSLNSVDLSRNRIGGEIPKEINQVINLGTLNLSG  565

Query  574  NNLTGDLPVEVYKMTS  621
            N LTG +P  +  MTS
Sbjct  566  NQLTGVIPTGIGNMTS  581



>ref|XP_006663536.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Oryza brachyantha]
Length=1062

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 76/135 (56%), Gaps = 2/135 (1%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl--lhvvsldlsglNLSGVLS  381
            ++ ALLS K+  ++ + S L SWN ST +C+W  V C       V +L +   NLSG +S
Sbjct  38   DELALLSFKSMLSSPATSPLASWNASTPYCSWPGVACSRRHPERVTALRVGSFNLSGQIS  97

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            P +  L FL  L ++ NQL+G VPPE+  +  L  LNL+ N    T P  +    NL VL
Sbjct  98   PVLANLSFLRELDLSENQLTGEVPPELGRLGRLESLNLAANTLQGTLPMAIGNCTNLVVL  157

Query  562  DLYNNNLTGDLPVEV  606
            DL +N L GD+P  V
Sbjct  158  DLSSNQLHGDIPSTV  172


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL G +  ++G L  LV     +N+LSG +PP +     L+   L NN    T P  L+Q
Sbjct  535  NLEGSIPQEIGHLINLVEFHAESNKLSGEIPPSLGECQLLQNFYLQNNFINGTIPSVLSQ  594

Query  541  LANLQVLDLYNNNLTGDLP  597
            L  L+ LDL NN L+G +P
Sbjct  595  LKGLENLDLSNNKLSGQIP  613



>ref|XP_008353615.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR [Malus domestica]
Length=197

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 83/143 (58%), Gaps = 4/143 (3%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTS-WNISTSH--CTWRRVTCdsllhvvsldl-sglNLSG  372
            T+Q+ALLS+KA  T+D Q+ LT+ W+ +++   C W  V+C +  H V+    S + L+G
Sbjct  14   TDQSALLSLKAHITSDPQNILTANWSSASNSNICNWVGVSCGAGHHRVTXLNLSHMGLAG  73

Query  373  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  552
            V+ P +G L FLV L +  N   GP+P E+S +  L+ +N  NN F  T P      A L
Sbjct  74   VIPPHLGNLSFLVELGLENNSFHGPLPQELSRLRRLKEINFGNNSFMGTIPSWFGSFAKL  133

Query  553  QVLDLYNNNLTGDLPVEVYKMTS  621
            Q + LY N  +G +P  ++ +++
Sbjct  134  QTIKLYGNGFSGFIPATIFNLSA  156



>ref|XP_010942232.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Elaeis guineensis]
Length=624

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 86/152 (57%), Gaps = 3/152 (2%)
 Frame = +1

Query  169  SAGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvs  342
            +  A A  P GV  E  AL++IKA+   D  ++L SW+  S   C+W  VTC     V+S
Sbjct  20   ACAAAALTPKGVNFEVQALMNIKASLK-DPHNALKSWDKDSVDPCSWAAVTCSPQDFVIS  78

Query  343  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  522
            L     NLSG LSP +G L  L  L +  N +SGP+P EI  +S LR L LSNN F    
Sbjct  79   LGTPSWNLSGTLSPSIGNLTNLETLLLQNNSISGPLPAEIGKLSKLRTLELSNNRFSGEI  138

Query  523  PHQLAQLANLQVLDLYNNNLTGDLPVEVYKMT  618
            P  L  L +LQ L L NN+L+G LP+ + K+T
Sbjct  139  PSSLGNLKSLQYLRLNNNSLSGPLPMSLAKIT  170



>emb|CDX73202.1| BnaC06g36500D [Brassica napus]
Length=987

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 89/139 (64%), Gaps = 5/139 (4%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLSGV  375
            T+   LL++K++    +   L  W  STS   HC++  V+CD    V+SL++S   L G 
Sbjct  33   TDMDHLLTLKSSMVGPNGHGLHDWVHSTSPSAHCSFSGVSCDGDARVISLNVSFTPLFGT  92

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI-FGSTFPHQ-LAQLAN  549
            +SP++G L  LVNL++AAN  SG +P E+ ++++L+ LN+SNN+    TFP + L  + +
Sbjct  93   ISPEIGMLDRLVNLTLAANNFSGMLPLEMKSLTSLKVLNISNNVNLNGTFPGEILTPMVD  152

Query  550  LQVLDLYNNNLTGDLPVEV  606
            L+VLD YNNN TG LP E+
Sbjct  153  LEVLDAYNNNFTGPLPPEI  171


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG +  +V +L  L  ++ +AN L+G +P  IS  ++L  ++LS N  G   P  +  +
Sbjct  499  FSGNIPREVFELKHLTKINTSANNLTGDIPDSISRCTSLISVDLSRNRIGGDIPKDIHDV  558

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
             NL  L+L  N LTG +P+ + KMTS
Sbjct  559  INLGTLNLSGNQLTGSIPIGIGKMTS  584



>ref|XP_008808401.1| PREDICTED: leucine-rich repeat receptor-like kinase protein FLORAL 
ORGAN NUMBER1 [Phoenix dactylifera]
Length=989

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 83/134 (62%), Gaps = 1/134 (1%)
 Frame = +1

Query  217  ALLSIKAAFTADSQSSLTSWNIST-SHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVG  393
            AL+ +K      + + L  W+ S  +HC++  VTCD+   VV+L++S +     L P++ 
Sbjct  31   ALMKLKEGLLGSAGNDLHDWDPSAPTHCSFSGVTCDADARVVALNVSHIRFHRPLPPEIS  90

Query  394  QLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYN  573
            +L  LVNL++A + L+G +PPEI+A+  LRFLN+SNN F   FP        L+VLD YN
Sbjct  91   RLDRLVNLTVACDSLAGRLPPEIAALPALRFLNISNNNFTGHFPDVDGGFLALEVLDAYN  150

Query  574  NNLTGDLPVEVYKM  615
            NN +G LP+ + K+
Sbjct  151  NNFSGPLPLGLAKL  164


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 49/85 (58%), Gaps = 1/85 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            +SG + P +G    L  LS+ +N++SG +PP+I  +  L  LNLS N      P  LA+ 
Sbjct  465  ISGPIPPAIGNFRGLQTLSLQSNRISGEIPPQIGDLKQLSNLNLSGNNLTGEIPSDLARC  524

Query  544  AN-LQVLDLYNNNLTGDLPVEVYKM  615
            A  L+ +DL  N LTG++P  + K+
Sbjct  525  AGTLEAVDLSRNRLTGEIPEAITKL  549


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            +L+G + P++G L  L +L ++ N+L+G +P   + +  L+ LNL  N F    P  +A 
Sbjct  273  HLAGSIPPELGGLDLLESLDLSINELTGELPESFAELKQLKLLNLFRNHFRGHIPPFIAD  332

Query  541  LANLQVLDLYNNNLTGDLP  597
            L NL+VL ++ NN T +LP
Sbjct  333  LPNLEVLQVWENNFTFELP  351


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 39/66 (59%), Gaps = 0/66 (0%)
 Frame = +1

Query  415  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  594
            L +A N++SGP+PP I     L+ L+L +N      P Q+  L  L  L+L  NNLTG++
Sbjct  458  LLLANNRISGPIPPAIGNFRGLQTLSLQSNRISGEIPPQIGDLKQLSNLNLSGNNLTGEI  517

Query  595  PVEVYK  612
            P ++ +
Sbjct  518  PSDLAR  523


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +1

Query  361  NLSGVLSPDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  537
            NL+G +  D+ +    L  + ++ N+L+G +P  I+ +  L  LNLS N      P  + 
Sbjct  512  NLTGEIPSDLARCAGTLEAVDLSRNRLTGEIPEAITKLQNLNTLNLSRNQLSGEIPADIQ  571

Query  538  QLANLQVLDLYNNNLTGDLPVE  603
            ++ +L  LDL  NNL+G++PVE
Sbjct  572  RMLSLTTLDLSYNNLSGEIPVE  593



>ref|XP_010257839.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Nelumbo nucifera]
Length=624

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 78/144 (54%), Gaps = 3/144 (2%)
 Frame = +1

Query  193  PLGVT-EQAALLSIKAAFTADSQSSLTSWN-ISTSHCTWRRVTCdsllhvvsldlsglNL  366
            P GV  E  AL+ IKA+   D    L +W+  S   C+W  VTC     V  L     NL
Sbjct  28   PKGVNFEVQALMGIKASL-VDPHGVLDNWDGDSVDPCSWTMVTCSPQSLVTGLGTPSQNL  86

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  546
            SG LSP +G L  L  + +  N +SGP+PPE+  +S LR L+LSNN F    P  L  + 
Sbjct  87   SGTLSPSIGNLTNLQIVLLQNNNISGPLPPELGRLSKLRTLDLSNNFFSGEIPTSLGHMK  146

Query  547  NLQVLDLYNNNLTGDLPVEVYKMT  618
            +LQ L L NN+L+G +P  +  MT
Sbjct  147  SLQYLRLNNNSLSGAIPSSLANMT  170



>ref|XP_010269666.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X2 [Nelumbo nucifera]
Length=976

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 75/139 (54%), Gaps = 1/139 (1%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsld-lsglNLSGVLS  381
            T++ ALL  K   T D   +L+SWN ST  C WR VTC      V    L   +L G++S
Sbjct  36   TDRLALLEFKEMITEDPLGALSSWNYSTHFCQWRGVTCSRRHQRVIALNLESQSLVGIVS  95

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            P +G L FL  +++  N   G +P EI  +  LR L LSNN F    P  L  L++L+ +
Sbjct  96   PHIGNLSFLRTITLQNNSFHGKIPQEIGRLFRLRSLTLSNNSFQGNIPPSLGNLSSLKQI  155

Query  562  DLYNNNLTGDLPVEVYKMT  618
             +  NNL G +P ++ ++T
Sbjct  156  SIATNNLEGSIPEDLGRLT  174


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G L  +VG L  LVNL I+ N+LSG +P  +     L  L + +N+F    P  L+ L
Sbjct  459  LTGSLPSEVGNLKNLVNLDISKNRLSGSIPDTLGNCLLLENLYMQDNLFEGMIPQSLSAL  518

Query  544  ANLQVLDLYNNNLTGDLP  597
              LQ LD+ +N L+G +P
Sbjct  519  RGLQDLDISHNKLSGKIP  536



>ref|XP_008797566.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Phoenix dactylifera]
Length=624

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 80/144 (56%), Gaps = 3/144 (2%)
 Frame = +1

Query  193  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  366
            P GV  E  AL+ IKA F  D  + L +W+  S   C+W  VTC S   V +L     NL
Sbjct  28   PKGVNFEVQALMGIKA-FLKDPHNVLENWDKDSVDPCSWTMVTCSSQKLVTTLGTPSQNL  86

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  546
            SG LSP +G L  L  + +  N +SGP+P EI  +S LR L LSNN F    P  L  L 
Sbjct  87   SGTLSPSIGNLTNLETVLLQNNNISGPLPAEIGRLSKLRTLELSNNYFSGEIPSSLGNLR  146

Query  547  NLQVLDLYNNNLTGDLPVEVYKMT  618
            +L+ L L NN+L+G  P+ + K+T
Sbjct  147  SLRYLMLNNNSLSGPFPMSLAKIT  170



>ref|XP_009345734.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Pyrus 
x bretschneideri]
Length=996

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 77/145 (53%), Gaps = 1/145 (1%)
 Frame = +1

Query  187  GKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN-  363
            G P    ++ +LL+ KA    D++  L+SWN S   C WR +TC      V++     + 
Sbjct  20   GLPGNEVDRLSLLAFKAEIVNDTRGILSSWNESLDFCEWRGITCGRRHRRVTVMDLRSSA  79

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L G LSP++G L FL  L +  N     +P EI  +  L+ + L NN F    P  +++ 
Sbjct  80   LEGQLSPNIGNLSFLRTLRLENNSFGHTIPSEIGRLFRLQRIRLHNNSFNGAIPSNISRC  139

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMT  618
            +NLQ L LY NNL+G LP E+  ++
Sbjct  140  SNLQYLLLYGNNLSGKLPTEIASLS  164


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 46/87 (53%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NLSG L  ++  L  L  L + +N  SG +PP    +S+L  L L +N      P+ L Q
Sbjct  151  NLSGKLPTEIASLSKLRVLDLGSNNFSGQIPPSFGNLSSLEKLYLDHNNLHGGIPNSLGQ  210

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            L NL  L L  NNL G +P  +Y ++S
Sbjct  211  LKNLAYLVLGTNNLNGTIPPSIYNLSS  237


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G +  +VG L  L +L ++ N+LSG +P  + + ++L  L LS N    T P  L+ L
Sbjct  462  LTGSIPAEVGNLVHLDSLIVSDNRLSGEIPRSLGSCTSLTTLYLSGNSLQGTIPESLSSL  521

Query  544  ANLQVLDLYNNNLTGDLP  597
              ++  D+  NNL+G +P
Sbjct  522  RGIENFDISRNNLSGRIP  539



>ref|XP_002305057.2| hypothetical protein POPTR_0004s05880g [Populus trichocarpa]
 gb|EEE85568.2| hypothetical protein POPTR_0004s05880g [Populus trichocarpa]
Length=1005

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 80/147 (54%), Gaps = 1/147 (1%)
 Frame = +1

Query  184  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-l  360
            A  P   T++ ALLS K+    D  ++L+SWN ++S C W RV C  +   V       L
Sbjct  28   AAVPGLFTDKEALLSFKSQVVVDPSNTLSSWNDNSSPCNWTRVDCSQVHQRVIGLDLSGL  87

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
             L+G +SP +G L FL +L +  NQ +G +P +I A+  L+ LN+S N      P  +  
Sbjct  88   RLTGSISPHIGNLSFLRSLHLQENQFTGVIPDQIGALFRLKVLNMSFNTINGPIPLNITN  147

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
              NLQ+LDL  N ++G +P E+  + S
Sbjct  148  CLNLQILDLMQNEISGAIPEELSNLKS  174


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            +SG +  ++  L  L  L +  N+L G +PP I+ IS+L  L+L  N  G   P  L +L
Sbjct  161  ISGAIPEELSNLKSLEILKLGGNKLWGMIPPVIANISSLLTLDLVTNNLGGMIPADLGRL  220

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
             NL+ LDL  NNLTGD+P+ +Y ++S
Sbjct  221  ENLKHLDLSINNLTGDVPLSLYNISS  246


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 48/87 (55%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            ++SG + P++G+L  L  L +AAN++SG +P  +  +  L  +NLS N      P     
Sbjct  408  HVSGEIPPEIGELTDLQELHLAANKISGRIPDSLGNLQKLIKINLSANELVGRLPTTFVN  467

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
               LQ +DL +N   G +P E++ ++S
Sbjct  468  FQQLQSMDLSSNRFNGSIPKEIFNLSS  494



>emb|CDY26403.1| BnaA02g23670D [Brassica napus]
Length=781

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 81/132 (61%), Gaps = 1/132 (1%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN-LSGVLS  381
            T++ ALLS ++  + + QS   SW+ +TS C W  VTCD+ +  V+      + LSG +S
Sbjct  31   TDREALLSFESQMSQNPQSLSFSWDPNTSPCNWTGVTCDTRIRRVASINLSGHGLSGSIS  90

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            P +G L FL +L +  NQL GP+P EI+ +  LR LNLS+N    + P  L++L  L+ L
Sbjct  91   PSIGNLSFLTSLQLQNNQLRGPIPKEITNLFRLRVLNLSSNSLDGSLPSNLSKLIELRAL  150

Query  562  DLYNNNLTGDLP  597
            DL +N +TG +P
Sbjct  151  DLTSNMITGIVP  162


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            ++G++   +G L  L  L++  N L GP+PP +S IS+L  L+L  N      P++L +L
Sbjct  157  ITGIVPNQLGDLKNLTILNLGKNLLHGPIPPSLSNISSLTVLSLGTNSLSGPVPNELGRL  216

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              LQVLDL  NNL+G +P  +Y M+S
Sbjct  217  QRLQVLDLTINNLSGTIPPSIYNMSS  242



>ref|XP_008225333.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Prunus mume]
Length=1522

 Score = 93.6 bits (231),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 86/153 (56%), Gaps = 2/153 (1%)
 Frame = +1

Query  169  SAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsld  348
            S G GA K    T+Q+ALL++++  T+D  + L +W+ STS C W  VTC +  H+  + 
Sbjct  19   SIGTGAAKTNITTDQSALLAMRSHITSDPHNILVNWSTSTSVCNWVGVTCGARRHLRVVS  78

Query  349  lsglNL--SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  522
            L+   +  +G + P +G L FLV LS   N   G +P E+S +  L+F++L  N F  + 
Sbjct  79   LNLSYMVFTGTIPPHLGNLSFLVALSFNNNSFYGTLPHELSYLRRLKFISLRFNNFMGSI  138

Query  523  PHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTS  621
            P        LQ LDLY N  +G +P+ ++ +++
Sbjct  139  PSWFGSFPKLQRLDLYGNQFSGTIPLTIFNLST  171


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            + G +   +G +  LV LS+  N+LSG +P  +  +  L+ LNL +N      P+QL QL
Sbjct  480  MRGNIPIGIGNISSLVTLSLGYNELSGSIPTSLGRLRNLQSLNLKDNKLRGYIPYQLCQL  539

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL  L L  N L+G +P
Sbjct  540  DNLFELYLGRNQLSGSIP  557


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            + G +   +G +  LV LS+  N+LSG +P  +  +  L+ LNL +N      P+QL QL
Sbjct  891  MRGNIPIGIGNISSLVTLSLGYNELSGSIPTSLGRLRNLQSLNLKDNKLRGYIPYQLCQL  950

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL  L L  N L+G +P
Sbjct  951  DNLFELYLGRNQLSGSIP  968



>ref|XP_010905760.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Elaeis guineensis]
Length=635

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 83/145 (57%), Gaps = 3/145 (2%)
 Frame = +1

Query  193  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  366
            P GV  E  AL+ IK +   D  S L +W+  S   C+W  VTC S   V+SL +   NL
Sbjct  39   PKGVNFEVQALMYIKDSL-KDPHSVLENWDRDSVDPCSWAMVTCSSENLVISLGIPSQNL  97

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  546
            SG LSP +G L  L  + +  N +SGP+PPEI  +S L+ L+LSNN F    P  + QL 
Sbjct  98   SGTLSPSIGNLTNLETVLLQNNNISGPIPPEIGKLSKLKTLDLSNNYFTGGIPTSIGQLE  157

Query  547  NLQVLDLYNNNLTGDLPVEVYKMTS  621
            +LQ L L NN+L+G  P+ +  +T 
Sbjct  158  SLQYLRLNNNSLSGACPLSLATLTE  182



>ref|XP_007214129.1| hypothetical protein PRUPE_ppa018020mg, partial [Prunus persica]
 gb|EMJ15328.1| hypothetical protein PRUPE_ppa018020mg, partial [Prunus persica]
Length=1216

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 86/148 (58%), Gaps = 1/148 (1%)
 Frame = +1

Query  181  GAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTC-dsllhvvsldlsg  357
            GA K    T+Q+ALL++++  T+D Q+ L +W+ STS C W  VTC    L VVSL+LS 
Sbjct  251  GAAKTNITTDQSALLAMRSHITSDPQNILVNWSTSTSVCNWVGVTCGARHLRVVSLNLSY  310

Query  358  lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  537
            +  +G + P VG L FLV LS   N   G +P E+S +  L+F++L  N F  + P    
Sbjct  311  MGFTGTIPPHVGNLSFLVALSFNNNSFYGTLPHELSYLRRLKFISLGFNNFMGSIPSWFG  370

Query  538  QLANLQVLDLYNNNLTGDLPVEVYKMTS  621
                LQ LDLY N  +G +P  ++ +++
Sbjct  371  SFPKLQRLDLYGNQFSGTIPSTIFNLST  398


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            +LSG++   +G L  LVNLS+A N L GP+P     + +L  L+LS N      P  L  
Sbjct  745  HLSGIMPSTIGGLQDLVNLSLANNNLEGPIPSAFDGLLSLEQLDLSRNNLSGVIPKSLEA  804

Query  541  LANLQVLDLYNNNLTGDLP  597
            L+ L+ +DL  N L G++P
Sbjct  805  LSLLKYMDLSFNRLKGEIP  823



>ref|XP_010050671.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Eucalyptus 
grandis]
Length=987

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 75/136 (55%), Gaps = 2/136 (1%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl--lhvvsldlsglNLSGVL  378
            T++  L+  + +   D   +L+SWN S  HC W+ V C       VVSL+L    L G+L
Sbjct  6    TDRLTLIYFRHSVDEDPLGALSSWNDSFHHCEWQGVICGGRHPERVVSLNLMSKGLGGLL  65

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  558
            SP VG L FL +L +  N   G +P  I  +  LR L LSNN FG   P  L+Q +NL+ 
Sbjct  66   SPHVGNLSFLRSLVLQNNSFCGEIPQSIGHLFCLRRLVLSNNSFGGQMPTNLSQCSNLEF  125

Query  559  LDLYNNNLTGDLPVEV  606
            LDL NN L G +P E+
Sbjct  126  LDLINNQLVGKIPDEI  141


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L   VG L  L  L ++ N+L GP+P  I     L  L+L+ N F    P  L+ L
Sbjct  474  LSGSLPSQVGSLINLGELDLSYNKLMGPIPNSICKCLVLGRLSLAFNSFHGEIPLALSTL  533

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              LQ LD+ +NNL+G++P  + ++T+
Sbjct  534  RGLQELDVSHNNLSGEIPSFLAQLTN  559


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L G +  ++G L  L  L +A N L G +P  I  +S L  L+L  N      P  L++L
Sbjct  133  LVGKIPDEIGSLSKLHTLGLAKNSLVGSIPHSIGNLSQLYTLSLMKNGLQGEIPKTLSKL  192

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L+ + L NN LTG++P  ++ M++
Sbjct  193  HGLRYVQLMNNQLTGEIPPAIFNMSN  218


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 47/86 (55%), Gaps = 1/86 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVN-LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            L G+L   +G L   V  +S+++  + G +PP I  +  L +L+LSNN+ G   P  +  
Sbjct  328  LEGLLPDSIGNLSNSVRVISMSSITMYGTIPPVIGNLFNLSYLDLSNNLLGGRVPSCIGA  387

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMT  618
            L NL  L L  N LTG++P  +  +T
Sbjct  388  LHNLHALSLSRNMLTGEIPSSIGNLT  413



>ref|XP_010471715.1| PREDICTED: receptor protein kinase CLAVATA1 isoform X1 [Camelina 
sativa]
 ref|XP_010471716.1| PREDICTED: receptor protein kinase CLAVATA1 isoform X2 [Camelina 
sativa]
Length=991

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 93/145 (64%), Gaps = 5/145 (3%)
 Frame = +1

Query  196  LGVTEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNL  366
            L  T+   LL++K++    +   L  W  S S   HC++  V+CD    V+SL++S   L
Sbjct  34   LAYTDMEVLLNLKSSMIGHNGDGLHDWIHSPSPAAHCSFTGVSCDGEARVISLNVSFTPL  93

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI-FGSTFPHQLAQ-  540
             G +SP++G L  LVNL++AAN  +G +P E+ ++++L+ LN+SNN+    +FP ++ + 
Sbjct  94   FGKISPEIGMLNRLVNLTLAANNFTGELPLEMKSLTSLKVLNISNNVNLSGSFPGEMVKA  153

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            + +L+VLD YNNN TG LP+E+ ++
Sbjct  154  MVDLEVLDAYNNNFTGTLPLEISEL  178



>ref|NP_001176614.1| Os11g0568800 [Oryza sativa Japonica Group]
 gb|ABA94319.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAH95342.1| Os11g0568800 [Oryza sativa Japonica Group]
Length=1133

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 79/137 (58%), Gaps = 4/137 (3%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl--lhvvsldlsglNLSGV  375
            + ++ ALLS K+   +D    L SWN S+ +C+W  V C       VV+L +S  NLSG 
Sbjct  35   MADEPALLSFKSMLLSDG--FLASWNASSHYCSWPGVVCGGRHPERVVALQMSSFNLSGR  92

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  555
            +SP +G L  L  L +  NQ +G +PPEI  ++ LR LNLS+N    + P  + + A L 
Sbjct  93   ISPSLGNLSLLRELELGDNQFTGDIPPEIGQLTRLRMLNLSSNYLQGSIPASIGECAELM  152

Query  556  VLDLYNNNLTGDLPVEV  606
             +DL NN L G++P E+
Sbjct  153  SIDLGNNQLQGEIPAEL  169


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL G +  ++G L  LV     +N+LSG +P  +     L+ ++L NN    + P  L+Q
Sbjct  529  NLEGSIPQEIGGLKNLVQFYADSNKLSGEIPSTLGECQLLQNISLQNNFLSGSVPSLLSQ  588

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMT  618
            L  LQ+LDL NNNL+G +P  +  +T
Sbjct  589  LKGLQILDLSNNNLSGQIPTFLSNLT  614


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 46/84 (55%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G+L   +G+L  L  L I  N++SG +P  I  ++ L +  L  N F    P  L  L
Sbjct  433  FTGILPSSLGRLKNLQVLYIDNNKISGSIPLAIGNLTELNYFRLDVNAFTGRIPSALGNL  492

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
             NL  L L +NN TG +PVE++K+
Sbjct  493  TNLVELGLSSNNFTGSIPVEIFKI  516


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 45/86 (52%), Gaps = 1/86 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              GVL   +  L  +L  L +  N +SG +P EI  +  L  L L NN F    P  L +
Sbjct  384  FEGVLPVSISNLSVYLEYLYLDFNAISGSLPEEIGNLVRLEALLLHNNSFTGILPSSLGR  443

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMT  618
            L NLQVL + NN ++G +P+ +  +T
Sbjct  444  LKNLQVLYIDNNKISGSIPLAIGNLT  469



>ref|XP_004291349.1| PREDICTED: receptor protein kinase CLAVATA1 [Fragaria vesca subsp. 
vesca]
Length=972

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 85/145 (59%), Gaps = 6/145 (4%)
 Frame = +1

Query  199  GVTEQAALLSIKAAFTADSQSSLTSWNIST-----SHCTWRRVTCdsllhvvsldlsglN  363
            G  +  ALL +KA+      S L  W  ++     +HC +  VTCD    VV+L++ GL 
Sbjct  22   GNGDLEALLKLKASMIGPKGSGLDDWKTTSLLSPSAHCGFAGVTCDRDFRVVALNVCGLP  81

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-  540
            L G +  ++G L  LVNL+IA N  +G +P EI  ++ LR LN+SNN+F   FP  + Q 
Sbjct  82   LFGKVGVEIGLLTKLVNLTIADNNFTGKLPEEIGNLTALRHLNISNNLFFGKFPGGITQR  141

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            +  L+VLD YNNN TG LPVE+  +
Sbjct  142  MMELEVLDAYNNNFTGPLPVELVDL  166


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL+G +   +  L  L +L +  NQL+G +PP++SA+++L  L+LS N+     P   ++
Sbjct  251  NLTGTIPISLSNLKHLHSLFLQINQLTGFIPPQLSALTSLMSLDLSINLLTGEIPATFSE  310

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMT  618
            L N+ +++LY NNL G +P  V + T
Sbjct  311  LKNITLINLYKNNLYGSIPRFVGEFT  336



>ref|XP_006856744.1| hypothetical protein AMTR_s00055p00012250 [Amborella trichopoda]
 gb|ERN18211.1| hypothetical protein AMTR_s00055p00012250 [Amborella trichopoda]
Length=1014

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 78/137 (57%), Gaps = 2/137 (1%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQ--SSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGV  375
            V +   LL +K     + Q  S L  W     HC W  VTC+    VV+L++  + L G 
Sbjct  59   VDDSEVLLKLKRGLILEPQKISFLKDWETGKDHCLWSGVTCNDEARVVALNICFIPLHGR  118

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  555
            +  D+G L  LVN++++++ L+G +PP+I  + +LRFLN+SNN      P   + L  L+
Sbjct  119  IFGDIGLLDKLVNVTLSSSNLTGNLPPQIGHLRSLRFLNISNNDLSGDIPTTFSGLQELE  178

Query  556  VLDLYNNNLTGDLPVEV  606
            VLD YNNN +G LP EV
Sbjct  179  VLDAYNNNFSGPLPHEV  195


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NLSG +   +GQL FL  L +  N+ SG +P E+S + +++ L+LSNN      P   ++
Sbjct  283  NLSGQIPATLGQLKFLDTLFLQMNRFSGEIPEELSGLKSVKSLDLSNNQLTGELPEGFSE  342

Query  541  LANLQVLDLYNNNLTGDLP  597
            L  L +L+L+ NNL G +P
Sbjct  343  LRELTLLNLFRNNLHGAVP  361


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG +   +G+L  L  L+++ N+ SG +P  +    +L  +++SNN    T P +LA L
Sbjct  524  FSGEIPQGIGELQQLSKLNLSNNKFSGKIPAALGRCFSLYSVDISNNQLAGTIPDELADL  583

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L VL+L  N+L+G++P ++  M S
Sbjct  584  HILNVLNLSGNHLSGEIPAKMKWMQS  609


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 41/81 (51%), Gaps = 0/81 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G +   +  L  L  LS+  NQ SG +P  I  +  L  LNLSNN F    P  L + 
Sbjct  500  FTGSIPSSISNLTGLQTLSLEGNQFSGEIPQGIGELQQLSKLNLSNNKFSGKIPAALGRC  559

Query  544  ANLQVLDLYNNNLTGDLPVEV  606
             +L  +D+ NN L G +P E+
Sbjct  560  FSLYSVDISNNQLAGTIPDEL  580


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 42/77 (55%), Gaps = 0/77 (0%)
 Frame = +1

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  546
            SG +  + G    LV L +A+  LSG +P  +  +  L  L L  N F    P +L+ L 
Sbjct  261  SGGIPSEFGLFAKLVRLDLASCNLSGQIPATLGQLKFLDTLFLQMNRFSGEIPEELSGLK  320

Query  547  NLQVLDLYNNNLTGDLP  597
            +++ LDL NN LTG+LP
Sbjct  321  SVKSLDLSNNQLTGELP  337



>ref|XP_008387933.1| PREDICTED: receptor protein kinase CLAVATA1 [Malus domestica]
Length=973

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 85/140 (61%), Gaps = 1/140 (1%)
 Frame = +1

Query  199  GVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  378
            G  +  ALL +KAA      S L  WN S+SHC +  V CD    VV+L++S + L G +
Sbjct  26   GHRDLDALLKLKAAMVGPKGSGLEDWNSSSSHCFFSGVLCDRDSRVVALNVSNIPLFGTI  85

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QLANLQ  555
               +G L  LVNL I  + L+G +P E++ +++L+ LN+SNN F  +FP ++   + +L+
Sbjct  86   PAAIGLLDKLVNLEITDDNLTGRLPAEMANLTSLKHLNISNNAFSGSFPGEIVLGMTDLE  145

Query  556  VLDLYNNNLTGDLPVEVYKM  615
            VLD YNNN  G LP+++  +
Sbjct  146  VLDAYNNNFNGTLPIQLVSL  165


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 48/85 (56%), Gaps = 0/85 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            ++SG + P +G L  L  LS+  N+ SG +P EI  +  L  +N+S N   S     +++
Sbjct  465  HISGKIPPAIGNLKSLQTLSLEMNRFSGEIPTEIFYLKLLSKINISANNLSSDISESISR  524

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
             ++L  +DL  NNL G++P  + K+
Sbjct  525  CSSLTSVDLSGNNLVGEIPRGIAKL  549


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  421  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLP  597
            +  N+LSG +PP++SA++ L  L+LS N      P   ++L NL +++LY NNL G +P
Sbjct  270  LQVNRLSGSIPPQLSALNMLMSLDLSINELTGEIPESFSELKNLTLVNLYKNNLYGPIP  328


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 47/86 (55%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG +  ++  L  L  ++I+AN LS  +   IS  S+L  ++LS N      P  +A+L
Sbjct  490  FSGEIPTEIFYLKLLSKINISANNLSSDISESISRCSSLTSVDLSGNNLVGEIPRGIAKL  549

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L +L+   N LTG++P E+  MTS
Sbjct  550  KVLSILNFSRNQLTGEIPAEMRSMTS  575


 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 46/79 (58%), Gaps = 2/79 (3%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNL-SNNIFGSTFPHQLAQ  540
            LSG + P +  L  L++L ++ N+L+G +P   S +  L  +NL  NN++G   P  +  
Sbjct  275  LSGSIPPQLSALNMLMSLDLSINELTGEIPESFSELKNLTLVNLYKNNLYGP-IPKFVGD  333

Query  541  LANLQVLDLYNNNLTGDLP  597
              +L+VL ++ NN T +LP
Sbjct  334  FPHLEVLQIWENNFTFELP  352



>ref|XP_007151443.1| hypothetical protein PHAVU_004G046800g [Phaseolus vulgaris]
 gb|ESW23437.1| hypothetical protein PHAVU_004G046800g [Phaseolus vulgaris]
Length=626

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 80/143 (56%), Gaps = 3/143 (2%)
 Frame = +1

Query  193  PLGVT-EQAALLSIKAAFTADSQSSLTSWN-ISTSHCTWRRVTCdsllhvvsldlsglNL  366
            P GV  E  AL+ IKA F  D    L +W+  +   C+W  VTC     V+SL +   NL
Sbjct  29   PKGVNFEVQALMGIKA-FLVDPHGILDNWDGDAVDPCSWNMVTCSPENLVISLGIPSQNL  87

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  546
            SG+LSP +G L +L  + +  N ++GP+P EI  +S L+ L+LS+N F    P  L  L 
Sbjct  88   SGILSPSIGNLTYLQTVVLQNNNITGPIPSEIGKLSKLQTLDLSDNFFNGEIPPSLGHLR  147

Query  547  NLQVLDLYNNNLTGDLPVEVYKM  615
            +LQ L L NN+  G+ PV +  M
Sbjct  148  SLQYLRLNNNSFDGECPVSLANM  170



>gb|EAZ18778.1| hypothetical protein OsJ_34305 [Oryza sativa Japonica Group]
Length=1047

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 79/137 (58%), Gaps = 4/137 (3%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl--lhvvsldlsglNLSGV  375
            + ++ ALLS K+   +D    L SWN S+ +C+W  V C       VV+L +S  NLSG 
Sbjct  35   MADEPALLSFKSMLLSDG--FLASWNASSHYCSWPGVVCGGRHPERVVALQMSSFNLSGR  92

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  555
            +SP +G L  L  L +  NQ +G +PPEI  ++ LR LNLS+N    + P  + + A L 
Sbjct  93   ISPSLGNLSLLRELELGDNQFTGDIPPEIGQLTRLRMLNLSSNYLQGSIPASIGECAELM  152

Query  556  VLDLYNNNLTGDLPVEV  606
             +DL NN L G++P E+
Sbjct  153  SIDLGNNQLQGEIPAEL  169


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL G +  ++G L  LV     +N+LSG +P  +     L+ ++L NN    + P  L+Q
Sbjct  529  NLEGSIPQEIGGLKNLVQFYADSNKLSGEIPSTLGECQLLQNISLQNNFLSGSVPSLLSQ  588

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMT  618
            L  LQ+LDL NNNL+G +P  +  +T
Sbjct  589  LKGLQILDLSNNNLSGQIPTFLSNLT  614


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 46/84 (55%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G+L   +G+L  L  L I  N++SG +P  I  ++ L +  L  N F    P  L  L
Sbjct  433  FTGILPSSLGRLKNLQVLYIDNNKISGSIPLAIGNLTELNYFRLDVNAFTGRIPSALGNL  492

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
             NL  L L +NN TG +PVE++K+
Sbjct  493  TNLVELGLSSNNFTGSIPVEIFKI  516


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 45/86 (52%), Gaps = 1/86 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
              GVL   +  L  +L  L +  N +SG +P EI  +  L  L L NN F    P  L +
Sbjct  384  FEGVLPVSISNLSVYLEYLYLDFNAISGSLPEEIGNLVRLEALLLHNNSFTGILPSSLGR  443

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMT  618
            L NLQVL + NN ++G +P+ +  +T
Sbjct  444  LKNLQVLYIDNNKISGSIPLAIGNLT  469



>gb|ACD56664.1| putative leucine-rich repeat transmembrane protein [Gossypium 
arboreum]
 gb|KHG23954.1| hypothetical protein F383_02006 [Gossypium arboreum]
Length=618

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 81/144 (56%), Gaps = 3/144 (2%)
 Frame = +1

Query  193  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  366
            P GV  E AAL+S+K     D Q  +  W+I S   CTW  V C +   V+SL+++   L
Sbjct  31   PKGVNYEVAALMSVKRELRDDKQV-MDGWDINSVDPCTWNMVACSAEGFVISLEMASTGL  89

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  546
            SG+LSP +G L  L  + +  NQLSGP+P EI  +S L+ L+LS N F    P  L  L 
Sbjct  90   SGMLSPSIGNLSHLRTMLLQNNQLSGPIPDEIGKLSELQTLDLSGNHFVGAIPSTLGSLT  149

Query  547  NLQVLDLYNNNLTGDLPVEVYKMT  618
            +L  L L  NNL+G +P  V  +T
Sbjct  150  HLSYLRLSKNNLSGPIPRHVANLT  173



>gb|KCW80214.1| hypothetical protein EUGRSUZ_C01568, partial [Eucalyptus grandis]
Length=969

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 75/136 (55%), Gaps = 2/136 (1%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl--lhvvsldlsglNLSGVL  378
            T++  L+  + +   D   +L+SWN S  HC W+ V C       VVSL+L    L G+L
Sbjct  6    TDRLTLIYFRHSVDEDPLGALSSWNDSFHHCEWQGVICGGRHPERVVSLNLMSKGLGGLL  65

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  558
            SP VG L FL +L +  N   G +P  I  +  LR L LSNN FG   P  L+Q +NL+ 
Sbjct  66   SPHVGNLSFLRSLVLQNNSFCGEIPQSIGHLFCLRRLVLSNNSFGGQMPTNLSQCSNLEF  125

Query  559  LDLYNNNLTGDLPVEV  606
            LDL NN L G +P E+
Sbjct  126  LDLINNQLVGKIPDEI  141


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L   VG L  L  L ++ N+L GP+P  I     L  L+L+ N F    P  L+ L
Sbjct  474  LSGSLPSQVGSLINLGELDLSYNKLMGPIPNSICKCLVLGRLSLAFNSFHGEIPLALSTL  533

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              LQ LD+ +NNL+G++P  + ++T+
Sbjct  534  RGLQELDVSHNNLSGEIPSFLAQLTN  559


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L G +  ++G L  L  L +A N L G +P  I  +S L  L+L  N      P  L++L
Sbjct  133  LVGKIPDEIGSLSKLHTLGLAKNSLVGSIPHSIGNLSQLYTLSLMKNGLQGEIPKTLSKL  192

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L+ + L NN LTG++P  ++ M++
Sbjct  193  HGLRYVQLMNNQLTGEIPPAIFNMSN  218


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 47/86 (55%), Gaps = 1/86 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVN-LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            L G+L   +G L   V  +S+++  + G +PP I  +  L +L+LSNN+ G   P  +  
Sbjct  328  LEGLLPDSIGNLSNSVRVISMSSITMYGTIPPVIGNLFNLSYLDLSNNLLGGRVPSCIGA  387

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMT  618
            L NL  L L  N LTG++P  +  +T
Sbjct  388  LHNLHALSLSRNMLTGEIPSSIGNLT  413



>ref|XP_004238370.1| PREDICTED: receptor protein kinase CLAVATA1 [Solanum lycopersicum]
Length=986

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 91/143 (64%), Gaps = 6/143 (4%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNIST-----SHCTWRRVTCdsllhvvsldlsglNLS  369
            ++  ALL +K +  A   S+L  WN +T     SHC++  +TC++  HV+S++++ + L 
Sbjct  25   SDLEALLKLKESMVAPGTSALLDWNNNTKNYPFSHCSFSGITCNNNSHVISINITNVPLF  84

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ-LAQLA  546
            G + P++G L  L NL+I  + L+G +P E+S +S+++ +NLS N F   FP + L  L 
Sbjct  85   GTIPPEIGLLQNLENLTIFGDNLTGTLPLEMSQLSSIKHVNLSYNNFSGPFPREILLGLI  144

Query  547  NLQVLDLYNNNLTGDLPVEVYKM  615
             L+  D+YNNN TG+LP+EV K+
Sbjct  145  KLESFDIYNNNFTGELPIEVVKL  167


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            ++G + P +G L  LV LS+  N+LSG +P EI++++ L  +NLS N      P  +A  
Sbjct  468  ITGNIPPSLGNLKNLVTLSLDVNRLSGEIPQEIASLNKLVTINLSGNNLTGEIPSSIALC  527

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
            + L ++DL  N L G++P E+ K+ S
Sbjct  528  SELTLVDLSRNQLVGEVPKEITKLNS  553



>ref|XP_011021146.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Populus 
euphratica]
Length=627

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 80/144 (56%), Gaps = 3/144 (2%)
 Frame = +1

Query  193  PLGVT-EQAALLSIKAAFTADSQSSLTSWN-ISTSHCTWRRVTCdsllhvvsldlsglNL  366
            P GV  E  AL+ IKA+   D    L +W+  +   C+W  VTC S   V+ L     NL
Sbjct  31   PKGVNFEVQALMGIKASLD-DPHGVLENWDGDAVDPCSWTMVTCSSESLVIGLGTPSQNL  89

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  546
            SG LSP +G L  L  + + +N ++GP+P EI  +S L  L+LSNN F    P  L  L 
Sbjct  90   SGTLSPTIGNLTNLQTVLLQSNNITGPIPAEIGKLSKLHTLDLSNNFFTGKIPSSLGHLR  149

Query  547  NLQVLDLYNNNLTGDLPVEVYKMT  618
            NL+ + L NN+L+G+ P+ +  MT
Sbjct  150  NLEYMRLNNNSLSGEFPMSLANMT  173



>ref|XP_002461427.1| hypothetical protein SORBIDRAFT_02g002450 [Sorghum bicolor]
 gb|EER97948.1| hypothetical protein SORBIDRAFT_02g002450 [Sorghum bicolor]
Length=1031

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 79/126 (63%), Gaps = 3/126 (2%)
 Frame = +1

Query  247  ADSQSSLTSWN--ISTSHCTWRRVTCdsllhvvsldlsglNLSG-VLSPDVGQLPFLVNL  417
            +D   +L SW    ST  C W  VTC++   V+ LDLSG NLSG V +  + +L  L  L
Sbjct  42   SDPAGALASWTNATSTGPCAWSGVTCNARGAVIGLDLSGRNLSGAVPAAALSRLAHLARL  101

Query  418  SIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLP  597
             +AAN LSGP+P  +S + +L  LNLSNN+   TFP   A+L  L+VLDLYNNNLTG LP
Sbjct  102  DLAANALSGPIPAPLSRLQSLTHLNLSNNVLNGTFPPPFARLRALRVLDLYNNNLTGPLP  161

Query  598  VEVYKM  615
            + V  +
Sbjct  162  LVVVAL  167


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A +
Sbjct  518  LDGGMPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNHLDGEIPATIAAM  577

Query  544  ANLQVLDLYNNNLTGDLP  597
             +L  +D   NNL+G +P
Sbjct  578  QSLTAVDFSYNNLSGLVP  595


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             SG + P+ GQ   L  L+++ N+LSG +PPE+  +++LR L +   N + S  P +   
Sbjct  180  FSGEIPPEYGQWRRLQYLAVSGNELSGKIPPELGGLTSLRELYIGYYNSYSSGIPPEFGN  239

Query  541  LANLQVLDLYNNNLTGDLPVEV  606
            + +L  LD  N  L+G++P E+
Sbjct  240  MTDLVRLDAANCGLSGEIPPEL  261


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 44/86 (51%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G   P   +L  L  L +  N L+GP+P  + A+  LR L+L  N F    P +  Q 
Sbjct  132  LNGTFPPPFARLRALRVLDLYNNNLTGPLPLVVVALPMLRHLHLGGNFFSGEIPPEYGQW  191

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              LQ L +  N L+G +P E+  +TS
Sbjct  192  RRLQYLAVSGNELSGKIPPELGGLTS  217


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G + P++G+L  L    ++ N L G +PPEI     L +L+LS N      P  ++ +
Sbjct  494  FTGAVPPEIGRLQQLSKADLSGNALDGGMPPEIGKCRLLTYLDLSRNNLSGEIPPAISGM  553

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G++P  +  M S
Sbjct  554  RILNYLNLSRNHLDGEIPATIAAMQS  579


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P++G+L  L +L ++ N L+G +P   +A+  L  LNL  N    + P  +  L
Sbjct  277  LTGAIPPELGRLRSLSSLDLSNNGLTGEIPASFAALKNLTLLNLFRNKLRGSIPELVGDL  336

Query  544  ANLQVLDLYNNNLTGDLP  597
             NL+VL L+ NN TG +P
Sbjct  337  PNLEVLQLWENNFTGGIP  354


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 41/84 (49%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G L   +G    L  L +  N  +G VPPEI  +  L   +LS N      P ++ + 
Sbjct  470  LTGALPASIGNFSGLQKLLLDQNAFTGAVPPEIGRLQQLSKADLSGNALDGGMPPEIGKC  529

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  LDL  NNL+G++P  +  M
Sbjct  530  RLLTYLDLSRNNLSGEIPPAISGM  553



>ref|XP_011021148.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Populus 
euphratica]
Length=626

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 80/144 (56%), Gaps = 3/144 (2%)
 Frame = +1

Query  193  PLGVT-EQAALLSIKAAFTADSQSSLTSWN-ISTSHCTWRRVTCdsllhvvsldlsglNL  366
            P GV  E  AL+ IKA+   D    L +W+  +   C+W  VTC S   V+ L     NL
Sbjct  31   PKGVNFEVQALMGIKASLD-DPHGVLENWDGDAVDPCSWTMVTCSSESLVIGLGTPSQNL  89

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  546
            SG LSP +G L  L  + + +N ++GP+P EI  +S L  L+LSNN F    P  L  L 
Sbjct  90   SGTLSPTIGNLTNLQTVLLQSNNITGPIPAEIGKLSKLHTLDLSNNFFTGKIPSSLGHLR  149

Query  547  NLQVLDLYNNNLTGDLPVEVYKMT  618
            NL+ + L NN+L+G+ P+ +  MT
Sbjct  150  NLEYMRLNNNSLSGEFPMSLANMT  173



>emb|CAH56437.1| somatic embryogenesis receptor-like kinase 1 [Poa pratensis]
Length=629

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 85/148 (57%), Gaps = 3/148 (2%)
 Frame = +1

Query  169  SAGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvs  342
            SAG     P G+  E AAL+++K+    D +  +  W+I S   CTW  VTC +   VVS
Sbjct  32   SAGDPPLSPKGLNYEVAALMAVKSRMR-DEKGVMAGWDINSVDPCTWSMVTCSADQFVVS  90

Query  343  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  522
            L ++   L+G LSP +G L +L  + +  N++SG +PPE+  ++ L+ L+LS N F    
Sbjct  91   LQMANNGLAGALSPSIGNLSYLQTMLLQNNRISGDIPPEVGKLAKLKALDLSGNQFLGEI  150

Query  523  PHQLAQLANLQVLDLYNNNLTGDLPVEV  606
            P+ L QL  L  L L  NNL+G +P+ V
Sbjct  151  PNSLGQLTQLNYLRLDRNNLSGQIPINV  178



>ref|XP_004138566.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Cucumis sativus]
 gb|KGN45786.1| hypothetical protein Csa_6G011610 [Cucumis sativus]
Length=1023

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 57/151 (38%), Positives = 79/151 (52%), Gaps = 4/151 (3%)
 Frame = +1

Query  169  SAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsld  348
            SA  GA +    T++ ALLS K+  T D      SWN S   C W  V C+    V  L+
Sbjct  31   SAAIGANE----TDRLALLSFKSEITVDPLGLFISWNESVHFCNWAGVICNPQRRVTELN  86

Query  349  lsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH  528
            L     +G LSP +G L FL  L++  N   G +P EI ++S L+ L+  NN F    P 
Sbjct  87   LPSYQFNGKLSPSIGNLSFLTTLNLPNNSFGGEIPQEIGSLSRLQELDFRNNYFVGEIPI  146

Query  529  QLAQLANLQVLDLYNNNLTGDLPVEVYKMTS  621
             ++  + LQ + L NNNLTG LP+E+  +T 
Sbjct  147  TISNCSQLQYIGLLNNNLTGVLPMELGLLTK  177


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G +  +VG+L  L  L I+ N L+G +P  +SA ++L  L L  N      P  L+ L
Sbjct  508  LTGSIPLEVGKLVNLGYLHISDNMLTGVIPSTLSACTSLEDLYLDGNFLEGPIPESLSSL  567

Query  544  ANLQVLDLYNNNLTGDLP  597
              ++ LDL  NNL+G +P
Sbjct  568  RGIEELDLSRNNLSGKIP  585


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 47/87 (54%), Gaps = 1/87 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +   +G L  L   ++  N L+G +PP +    +L  L LS N      P +L  +
Sbjct  435  LSGTIPKSLGNLSALGRCNLRLNNLTGAIPPSLGESQSLLMLALSQNQLSGAIPKELLSI  494

Query  544  ANLQV-LDLYNNNLTGDLPVEVYKMTS  621
            ++L + LDL  N LTG +P+EV K+ +
Sbjct  495  SSLSIALDLSENYLTGSIPLEVGKLVN  521



>ref|XP_007213538.1| hypothetical protein PRUPE_ppa019671mg, partial [Prunus persica]
 gb|EMJ14737.1| hypothetical protein PRUPE_ppa019671mg, partial [Prunus persica]
Length=249

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/149 (34%), Positives = 78/149 (52%), Gaps = 1/149 (1%)
 Frame = +1

Query  178  AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg  357
             GA K    T+Q+ALL++++  T+D  + L +W+ STS C W  VTC +    V      
Sbjct  22   TGAAKTNITTDQSALLAMRSHITSDPHNILVNWSTSTSVCNWVGVTCGARHLRVVSLNLS  81

Query  358  lN-LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  534
                +G + P +G L FLV LS   N   G +P E+S +  L+F++L  N F  + P   
Sbjct  82   YMVFTGTIPPHLGNLSFLVALSFNNNSFYGTLPHELSYLRRLKFISLGFNNFMGSIPSWF  141

Query  535  AQLANLQVLDLYNNNLTGDLPVEVYKMTS  621
                 LQ LDLY N  +G +P  ++ +++
Sbjct  142  GSFPKLQRLDLYGNQFSGTVPSTIFNLST  170



>ref|XP_009418700.1| PREDICTED: leucine-rich repeat receptor-like kinase protein FLORAL 
ORGAN NUMBER1 [Musa acuminata subsp. malaccensis]
Length=993

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 86/136 (63%), Gaps = 2/136 (1%)
 Frame = +1

Query  199  GVTEQAALLSIKAAFTADSQSSLTSWN-ISTSHCTWRRVTCdsllhvvsldlsglNLSGV  375
            G  +  AL+ +KAA  A   S+L +W+  S  +C++  V CD    VV+L+ +G+ L+G 
Sbjct  24   GDADLEALIKLKAALVAPGSSALGNWDPASADYCSFTGVACDENSRVVALNFTGVQLNGT  83

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH-QLAQLANL  552
            L P++G L  LVNL+++ + + GP+P E++A+ +LR LN+SNN F   FPH        L
Sbjct  84   LPPEIGILSGLVNLTVSCSGVVGPLPMELAALPSLRLLNVSNNNFSGAFPHVGPGGFPTL  143

Query  553  QVLDLYNNNLTGDLPV  600
            +V+D YNNN +G LP+
Sbjct  144  EVIDAYNNNFSGRLPL  159


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 51/81 (63%), Gaps = 0/81 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            ++G + P +G LP L NL++ +NQ+SG +PPEI  +  L  LNLS N      P  L + 
Sbjct  465  ITGSIPPAIGSLPALQNLALDSNQISGAIPPEIGQLKQLSKLNLSGNSLSGDIPVDLTRC  524

Query  544  ANLQVLDLYNNNLTGDLPVEV  606
            ++L ++DL  NNLTG +PV +
Sbjct  525  SSLVMIDLSRNNLTGAIPVRI  545


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            +SG + P++GQL  L  L+++ N LSG +P +++  S+L  ++LS N      P ++  L
Sbjct  489  ISGAIPPEIGQLKQLSKLNLSGNSLSGDIPVDLTRCSSLVMIDLSRNNLTGAIPVRIPAL  548

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N ++G +P E+ +M S
Sbjct  549  QILNTLNLSRNQISGVIPPEMQRMRS  574


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = +1

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  549
            G + P++G L  LV L +A   LSGP+P  + ++  L  L L  N    + P +L  L+ 
Sbjct  228  GGIPPELGMLSSLVRLDMAGCGLSGPIPASLGSLKHLDTLFLQINRLSGSIPPELGGLSM  287

Query  550  LQVLDLYNNNLTGDLP  597
            L+ LDL  N LTG++P
Sbjct  288  LESLDLSINELTGEVP  303



>emb|CDY63395.1| BnaCnng41990D, partial [Brassica napus]
Length=525

 Score = 91.7 bits (226),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 80/139 (58%), Gaps = 1/139 (1%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLSGVLSP  384
            ++ ALL IK+  + ++Q  L+SWN S+  C W+ VTC      V+    G   LSG++ P
Sbjct  25   DRKALLDIKSQVSEENQDVLSSWNNSSPLCNWKGVTCGLKHKRVTRLDLGGWQLSGMIPP  84

Query  385  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLD  564
             +G L FL++L ++ N + G +P E+  +  L++LN+S+N  G   P  L   + L  LD
Sbjct  85   SIGNLSFLISLDLSENSIGGTIPYEVGNLFRLKYLNMSSNFLGGEIPVNLFNCSRLLGLD  144

Query  565  LYNNNLTGDLPVEVYKMTS  621
            L +N+L G LP  +  +TS
Sbjct  145  LSDNHLGGGLPASLGNLTS  163


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 44/84 (52%), Gaps = 3/84 (4%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNL---SNNIFGSTFPHQ  531
            NL G +  D+ +L  LV L + +N+ SG  P  I   S L +LN+   SNN F  + P  
Sbjct  173  NLEGNIPDDLAKLTQLVRLVLGSNKFSGGFPLSIYNFSLLEYLNILDFSNNDFSGSIPGY  232

Query  532  LAQLANLQVLDLYNNNLTGDLPVE  603
                + L+ L+L  NN  G++P E
Sbjct  233  FGNFSLLEYLNLSINNFVGEVPTE  256



>ref|XP_004951350.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780-like [Setaria italica]
Length=630

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 79/137 (58%), Gaps = 2/137 (1%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNLSGVLSP  384
            E AAL+++K+    D +  +  W+I S   CTW  V C     VVSL ++   LSG LSP
Sbjct  47   EVAALMAVKSRLR-DEKGVMALWDINSVDPCTWSMVACSPDKFVVSLQMANNGLSGTLSP  105

Query  385  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLD  564
             +G L  L  +S+  N++SG +PPEI  ++ L  L+LS+N F    P  L QL  L  L 
Sbjct  106  SIGNLSHLQTMSLQNNKISGDIPPEIGKLTNLNALDLSSNEFVGDIPSSLGQLTRLNYLR  165

Query  565  LYNNNLTGDLPVEVYKM  615
            L  NNL+G +PV+V K+
Sbjct  166  LDRNNLSGQIPVDVAKL  182



>emb|CDX87661.1| BnaA07g32120D [Brassica napus]
Length=965

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 91/142 (64%), Gaps = 5/142 (4%)
 Frame = +1

Query  196  LGVTEQAALLSIKAAFTADSQSSLTSWNIS---TSHCTWRRVTCdsllhvvsldlsglNL  366
            L  T+   LL++K++    + + L  W  S   T+HC++  V+CD    V+SL++S   L
Sbjct  30   LASTDMDHLLTLKSSMVGPNGNGLHDWVHSPSPTAHCSFSGVSCDGDARVISLNVSFTPL  89

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI-FGSTFPHQ-LAQ  540
             G +SP++G L  LVNL++AAN  SG +P E+ ++++L+ LN+SNN+    TFP + L  
Sbjct  90   FGTISPEIGMLNRLVNLTLAANNFSGMLPLEMKSLTSLKVLNISNNVNLNGTFPGEILTP  149

Query  541  LANLQVLDLYNNNLTGDLPVEV  606
            + +L+VLD YNNN TG LP E+
Sbjct  150  MVDLEVLDAYNNNFTGPLPPEI  171


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG +  +V +L  L  ++ +AN L+G +P  IS  ++L  ++LS N  G   P  +  +
Sbjct  477  FSGNIPREVFELKHLTKINTSANNLTGDIPDSISRCTSLISVDLSRNRIGGDIPKDIHDV  536

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
             NL  L+L  N LTG +P+ + KMTS
Sbjct  537  MNLGTLNLSGNQLTGSIPIGIGKMTS  562



>gb|KEH33614.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=985

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 85/148 (57%), Gaps = 6/148 (4%)
 Frame = +1

Query  196  LGVTEQAALL-SIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldl---sg  357
            L +  QA++L S+K  F   S +SL+SWN+S   S CTW  + CD  +  +S+     S 
Sbjct  25   LSLKNQASILVSMKQDFEPSSNTSLSSWNMSNYMSLCTWYGIQCDHTITNMSIVSLDISN  84

Query  358  lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  537
            LN+SG  SP + +L  LVN+SI  N   G  P EI  +  L+ LN+SNN+F      +  
Sbjct  85   LNISGSFSPQITKLYNLVNVSIQGNSFYGEFPTEIHKLQRLKCLNISNNMFSGNLSWEFN  144

Query  538  QLANLQVLDLYNNNLTGDLPVEVYKMTS  621
            +L  L+VLD+YNN   G LP  V +++S
Sbjct  145  KLKELEVLDIYNNGFNGSLPRGVTQVSS  172


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 48/81 (59%), Gaps = 0/81 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P++G L  L  L ++ N L+G +P E S +  L  LNL  N F S  P  +++L
Sbjct  280  LTGFIPPELGNLSRLNALDLSLNNLTGGIPNEFSNLRELSLLNLFINKFHSEIPDFISEL  339

Query  544  ANLQVLDLYNNNLTGDLPVEV  606
              L+VL L+ NN TG +P ++
Sbjct  340  PKLEVLKLWRNNFTGVIPSKL  360


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 47/84 (56%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L   +G  P L  L ++ N+ SG +P +I  +  +  L++S+N F  T P ++ + 
Sbjct  474  LSGSLPTSIGNFPNLQTLQLSGNRFSGQIPSDIGKLKKILKLDISSNNFSGTIPSEIGKC  533

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  LDL  N  +G +P+++ ++
Sbjct  534  TLLTYLDLSQNQFSGPIPIQLAQI  557



>ref|XP_002264952.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Vitis vinifera]
Length=988

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 84/139 (60%), Gaps = 4/139 (3%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllh-vvsldlsglNLSGVL  378
            + + L+++K AF A    SL SW +S   S C+W  V CD     VVSLD+S  N+SG L
Sbjct  36   QASTLVALKQAFEA-PHPSLNSWKVSNYRSLCSWTGVQCDDTSTWVVSLDISNSNISGAL  94

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  558
            SP + +L  L NLS+  N L+G  PPEI  +S L++LN+SNN F  +   +  QL  L V
Sbjct  95   SPAIMELGSLRNLSVCGNNLAGSFPPEIHKLSRLQYLNISNNQFNGSLNWEFHQLKELAV  154

Query  559  LDLYNNNLTGDLPVEVYKM  615
            LD Y+NN  G LPV V ++
Sbjct  155  LDAYDNNFLGSLPVGVTQL  173


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            N SG++ P++G    L  L ++ NQ+SGP+P +I+ I  L +LNLS N      P ++  
Sbjct  523  NFSGIIPPEIGHCLSLTYLDLSQNQISGPIPVQIAQIHILNYLNLSWNHMNQNLPKEIGF  582

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  +D  +NN +G +P
Sbjct  583  MKSLTSVDFSHNNFSGWIP  601


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G +  ++GQL  ++ L +  N  SG +PPEI    +L +L+LS N      P Q+AQ+
Sbjct  500  FTGNIPSEIGQLISILKLDMRRNNFSGIIPPEIGHCLSLTYLDLSQNQISGPIPVQIAQI  559

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N++  +LP E+  M S
Sbjct  560  HILNYLNLSWNHMNQNLPKEIGFMKS  585


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
              G + P++G+L  LV+L +++  L GP+PPE+  +  L  L L  N    + P QL  L
Sbjct  235  FDGGIPPELGKLVNLVHLDLSSCGLEGPIPPELGNLKHLDTLFLQTNQLSGSIPPQLGNL  294

Query  544  ANLQVLDLYNNNLTGDLPVE  603
            ++L+ LDL NN LTG++P+E
Sbjct  295  SSLKSLDLSNNGLTGEIPLE  314



>gb|EYU30632.1| hypothetical protein MIMGU_mgv1a022995mg, partial [Erythranthe 
guttata]
Length=326

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 91/141 (65%), Gaps = 4/141 (3%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLT-SWNISTSHCTWRRVTCdsll---hvvsldlsglNLSG  372
            T+Q+ LL +K+   +D    L+ +W  S+S C+W  VTC S      V +LD+SG++LSG
Sbjct  5    TDQSTLLVLKSHIVSDPYQILSENWTDSSSPCSWIGVTCGSRRHRDRVTALDISGMSLSG  64

Query  373  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  552
             + P +G L FLV+L++  N  SG +P ++S++  L+FL+L NN F    P+ L+ L+N+
Sbjct  65   TIPPQIGNLSFLVSLNLGDNLFSGVIPQQLSSLRRLKFLSLQNNGFTGFVPNSLSNLSNI  124

Query  553  QVLDLYNNNLTGDLPVEVYKM  615
            QV+DL  N L G++P ++ K+
Sbjct  125  QVVDLSTNYLKGNIPRDLGKL  145



>ref|XP_004981595.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Setaria italica]
Length=1029

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 78/127 (61%), Gaps = 8/127 (6%)
 Frame = +1

Query  259  SSLTSWN-ISTSHCTWRRVTCd------sllhvvsldlsglNLSGVLSPDVGQLPFLVNL  417
             +L SWN  S  HC W  VTC           VV LD+SGLNLSG L   + +L  L  L
Sbjct  40   GALRSWNATSPDHCAWAGVTCAPPGGGRGGGIVVGLDVSGLNLSGALPQALSRLHGLQRL  99

Query  418  SIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT-GDL  594
            S+AAN L GP+PP ++ +  L  LNLSNN F  +FP  LA+L  L+VLDLYNNNLT   L
Sbjct  100  SVAANALYGPIPPSLARLQQLVHLNLSNNAFNGSFPPALARLRGLRVLDLYNNNLTSATL  159

Query  595  PVEVYKM  615
            P+EV +M
Sbjct  160  PLEVTQM  166


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
               G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  516  KFEGGVPPEIGKCRLLTYLDMSQNNLSGKIPPAISGMWILNYLNLSRNHLDGEIPPSIAT  575

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  +D   NNL+G +P
Sbjct  576  MQSLTAVDFSYNNLSGLVP  594


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG + P++G+L  L    +++N+  G VPPEI     L +L++S N      P  ++ +
Sbjct  493  FSGAVPPEIGRLQQLSKADLSSNKFEGGVPPEIGKCRLLTYLDMSQNNLSGKIPPAISGM  552

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  L+L  N+L G++P  +  M S
Sbjct  553  WILNYLNLSRNHLDGEIPPSIATMQS  578


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN      P   ++L
Sbjct  252  LSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGHLKSLSSLDLSNNALTGEIPESFSEL  311

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
             NL +L+L+ N L GD+P  V  M S
Sbjct  312  KNLTLLNLFRNKLRGDIPDFVGDMPS  337


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 44/86 (51%), Gaps = 1/86 (1%)
 Frame = +1

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  546
            S  L  +V Q+P L +L +  N  SG +PPE      L++L +S N      P +L  L 
Sbjct  156  SATLPLEVTQMPMLRHLHLGGNFFSGEIPPEYGRWPRLQYLAVSGNELSGRIPPELGNLT  215

Query  547  NLQVLDL-YNNNLTGDLPVEVYKMTS  621
             L+ L + Y N+ TG LP E+  +T 
Sbjct  216  TLRELYIGYYNSYTGGLPPELGNLTE  241


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 42/84 (50%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G L   +G    +  L +  N  SG VPPEI  +  L   +LS+N F    P ++ + 
Sbjct  469  LTGALPASLGSFSGIQKLLLDRNSFSGAVPPEIGRLQQLSKADLSSNKFEGGVPPEIGKC  528

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L  LD+  NNL+G +P  +  M
Sbjct  529  RLLTYLDMSQNNLSGKIPPAISGM  552



>ref|XP_011019593.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790 [Populus euphratica]
 ref|XP_011019594.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790 [Populus euphratica]
Length=971

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 86/138 (62%), Gaps = 3/138 (2%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPD  387
            E   LLS K++   D    L++WN+S + C W+ +TC +   +  ++LSG N+SG +S  
Sbjct  36   ELELLLSFKSSLN-DPLKYLSNWNLSATFCKWQGITCTTSSRITVIELSGKNISGKISSS  94

Query  388  VGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDL  567
            + QLP++  + +++NQLSG +P ++ + S+LRFLNLSNN F    P+    L  L+ LDL
Sbjct  95   IFQLPYIQTIDLSSNQLSGKLPDDVFSSSSLRFLNLSNNNFTGPIPNGSKFL--LETLDL  152

Query  568  YNNNLTGDLPVEVYKMTS  621
             NN L+G +P E+   +S
Sbjct  153  SNNMLSGKIPQEIGSFSS  170


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL+G +   +G L  L  L +  N+L+GP+P  I  ++ L  L+LS+N      P  + +
Sbjct  252  NLTGQIPSSLGNLSNLQYLFLYQNKLAGPIPKSIFGLTKLISLDLSDNSLSGEIPELIIK  311

Query  541  LANLQVLDLYNNNLTGDLPV  600
            L NL++L L++NN TG +PV
Sbjct  312  LKNLEILHLFSNNFTGKIPV  331


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 0/85 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G +  ++GQ+  L  + +  N LSG +P E+  +++L  L+L  N      P  L  L
Sbjct  205  LAGQIPSELGQMRSLKWIYLGYNNLSGEIPIELGQLTSLNHLDLVYNNLTGQIPSSLGNL  264

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMT  618
            +NLQ L LY N L G +P  ++ +T
Sbjct  265  SNLQYLFLYQNKLAGPIPKSIFGLT  289


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 45/77 (58%), Gaps = 7/77 (9%)
 Frame = +1

Query  388  VGQLPFLVN-------LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  546
            VG++P  V        L++A+NQL+G +P E+  + +L+++ L  N      P +L QL 
Sbjct  182  VGKIPLSVTNLTSLQVLTLASNQLAGQIPSELGQMRSLKWIYLGYNNLSGEIPIELGQLT  241

Query  547  NLQVLDLYNNNLTGDLP  597
            +L  LDL  NNLTG +P
Sbjct  242  SLNHLDLVYNNLTGQIP  258


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 0/85 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NLSG +  ++GQL  L +L +  N L+G +P  +  +S L++L L  N      P  +  
Sbjct  228  NLSGEIPIELGQLTSLNHLDLVYNNLTGQIPSSLGNLSNLQYLFLYQNKLAGPIPKSIFG  287

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L  L  LDL +N+L+G++P  + K+
Sbjct  288  LTKLISLDLSDNSLSGEIPELIIKL  312


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G +   +  L  L++L ++ N LSG +P  I  +  L  L+L +N F    P  L+ L
Sbjct  277  LAGPIPKSIFGLTKLISLDLSDNSLSGEIPELIIKLKNLEILHLFSNNFTGKIPVALSSL  336

Query  544  ANLQVLDLYNNNLTGDLPVEVYK  612
              LQ+L L++N L+G++P ++ K
Sbjct  337  PRLQILQLWSNKLSGEIPKDLGK  359



>gb|EYU26654.1| hypothetical protein MIMGU_mgv1a001213mg [Erythranthe guttata]
Length=864

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 76/138 (55%), Gaps = 1/138 (1%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsld-lsglNLSGVLS  381
            T++ ALL+IKA  T D     TSWN S+  C W  VTC      V+   LS L L G LS
Sbjct  32   TDKLALLAIKAQITHDPNGIFTSWNDSSHFCAWPGVTCGRRHQRVTALNLSSLGLVGTLS  91

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            P V  L FL  L++  N   G +PPEI A+  LR LNL+NN F    P  L+  ++L ++
Sbjct  92   PYVSNLTFLTGLNVELNTFHGVIPPEIGALFRLRHLNLTNNSFSGEIPANLSGCSSLVLI  151

Query  562  DLYNNNLTGDLPVEVYKM  615
                N LTG LP ++ K+
Sbjct  152  RFGWNRLTGSLPFQLGKL  169


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L  +VGQL  L    ++ N LSG +P  + +  TL  LN++ N F    P     L
Sbjct  400  LSGSLPYEVGQLINLGYFDVSENLLSGEIPSTLGSCVTLERLNMAANSFEGAIPSSFTSL  459

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+ L+L  NNL+G +P
Sbjct  460  RGLEYLNLSRNNLSGQIP  477



>ref|XP_009396215.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009396224.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
Length=621

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 81/144 (56%), Gaps = 3/144 (2%)
 Frame = +1

Query  193  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  366
            P GV  E  AL+ IKA+   D  S L +W+  S   C+W  +TC S   VV L   G +L
Sbjct  28   PKGVNYEVQALMGIKASLV-DPHSVLENWDKDSVDPCSWTMITCSSENLVVGLGTPGQDL  86

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  546
            SG LSP +G L  L  + +  N +SGPVPPEI  +S L  L+LSNN F    P  L+ L 
Sbjct  87   SGTLSPSIGNLTNLEIVLLQNNNISGPVPPEIGKLSKLHTLDLSNNKFSGRIPASLSNLK  146

Query  547  NLQVLDLYNNNLTGDLPVEVYKMT  618
             LQ L L NN+L+G  P+ +  +T
Sbjct  147  GLQYLRLNNNSLSGSFPLPLIDIT  170



>ref|XP_007025341.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY27963.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma 
cacao]
Length=614

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 86/155 (55%), Gaps = 5/155 (3%)
 Frame = +1

Query  166  HSAGAGAG--KPLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllh  333
            HS  AG     P GV  E AAL+S+K     D+++ +  W+I S   CTW  V C +   
Sbjct  15   HSVSAGDSLLSPKGVNYEVAALMSVKREMI-DARNVMDGWDINSVDPCTWNMVACSAEGF  73

Query  334  vvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFG  513
            V+SL+++   LSG+LSP +G L  L  + +  NQLSGP+P EI   S L+ L+LS N F 
Sbjct  74   VISLEMASTGLSGLLSPSIGNLSHLRTMLLQNNQLSGPIPDEIGKFSELQTLDLSGNQFV  133

Query  514  STFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMT  618
               P  L  L +L  L L  NNL+G +P  +  +T
Sbjct  134  GVIPSSLGSLTHLSYLRLSKNNLSGPIPRLIANLT  168



>ref|XP_009106236.1| PREDICTED: receptor protein kinase CLAVATA1 [Brassica rapa]
Length=987

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 90/142 (63%), Gaps = 5/142 (4%)
 Frame = +1

Query  196  LGVTEQAALLSIKAAFTADSQSSLTSWNIS---TSHCTWRRVTCdsllhvvsldlsglNL  366
            L  T+   LL++K++    +   L  W  S   T+HC++  V+CD    V+SL++S   L
Sbjct  30   LASTDMDHLLNLKSSMVGPNGHGLHDWVHSPSPTAHCSFSGVSCDGDARVISLNVSFTPL  89

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI-FGSTFPHQ-LAQ  540
             G +SP++G L  LVNL++AAN  SG +P E+ ++++L+ LN+SNN+    TFP + L  
Sbjct  90   FGTISPEIGMLNRLVNLTLAANNFSGTLPLEMKSLTSLKVLNISNNVNLNGTFPGEILTP  149

Query  541  LANLQVLDLYNNNLTGDLPVEV  606
            + +L+VLD YNNN TG LP E+
Sbjct  150  MVDLEVLDAYNNNFTGPLPPEI  171


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG +  +V +L  L  ++ +AN L+G +P  IS  ++L  ++LS N  G   P  +  +
Sbjct  499  FSGNIPREVFELKHLTKINTSANNLTGDIPDSISRCTSLISVDLSRNRIGGDIPKDIHDV  558

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
             NL  L+L  N LTG +P+ + KMTS
Sbjct  559  INLGTLNLSGNQLTGSIPIGIGKMTS  584


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL+G + P++  L  L +L ++ NQL+G +P    ++  +  +NL  N      P  +  
Sbjct  283  NLTGNIPPELSGLISLKSLDLSINQLTGEIPQSFISLGNITLINLFRNNLHGPIPDFIGD  342

Query  541  LANLQVLDLYNNNLTGDLP  597
            + NLQVL ++ NN T +LP
Sbjct  343  MPNLQVLQVWENNFTLELP  361



>ref|XP_007040964.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOX96795.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=986

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 83/144 (58%), Gaps = 6/144 (4%)
 Frame = +1

Query  196  LGVTEQAALL-SIKAAFTADSQSSLTSWNIS--TSHCTWRRVTCdsllhvvsldlsg-lN  363
            L + +QA++L S+K  F  DS + L SWN+S   S C+W  V CD L   +        N
Sbjct  30   LSLEKQASILVSLKQEF--DSSTPLRSWNVSHHLSVCSWTGVQCDVLNRSIVSLDISNSN  87

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            +SG LSP + QL  L NLS++ N  SG  P EI  ++ L+FLN+SNN+F        +Q+
Sbjct  88   ISGSLSPVITQLRSLANLSVSGNSFSGDFPQEIHKLTRLQFLNISNNMFSGEPNWDFSQM  147

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              L VLD Y+NN  G LP+ V K+
Sbjct  148  KELVVLDAYDNNFNGSLPLGVTKL  171


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 48/81 (59%), Gaps = 0/81 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
              G + P+ G+L  LV+L +A   L GP+PPE+  +  L  L L  N    + P  +  L
Sbjct  233  FDGGIPPEFGKLVNLVHLDLANCSLEGPIPPELGNLKKLDTLFLQTNEISGSIPPHIGNL  292

Query  544  ANLQVLDLYNNNLTGDLPVEV  606
            +NL+ LDL NN +TGD+P+E+
Sbjct  293  SNLKSLDLSNNMITGDIPLEL  313


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 0/81 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            +SG + P +G L  L +L ++ N ++G +P E+S +  L  LNL  N F    P  +A+L
Sbjct  281  ISGSIPPHIGNLSNLKSLDLSNNMITGDIPLELSGLCELILLNLFVNRFHGEIPQFIAEL  340

Query  544  ANLQVLDLYNNNLTGDLPVEV  606
              L+VL L++NN TG +P ++
Sbjct  341  PKLEVLKLWHNNFTGSIPSKL  361


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L G + P++G L  L  L +  N++SG +PP I  +S L+ L+LSNN+     P +L+ L
Sbjct  257  LEGPIPPELGNLKKLDTLFLQTNEISGSIPPHIGNLSNLKSLDLSNNMITGDIPLELSGL  316

Query  544  ANLQVLDLYNNNLTGDLP  597
              L +L+L+ N   G++P
Sbjct  317  CELILLNLFVNRFHGEIP  334


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            N SG +   +G    L  L ++ NQLSGP+P +I+ I  L +LN+S N    + P ++  
Sbjct  521  NFSGTIPSKIGNCILLTYLDLSQNQLSGPIPVQIAQIHILNYLNVSWNHLNQSLPKEIGS  580

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L   D  +NN +G +P
Sbjct  581  IKSLTSADFSHNNFSGSIP  599



>ref|XP_002317696.2| hypothetical protein POPTR_0012s04160g [Populus trichocarpa]
 gb|EEE95916.2| hypothetical protein POPTR_0012s04160g [Populus trichocarpa]
Length=1025

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 80/135 (59%), Gaps = 1/135 (1%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTC-dsllhvvsldlsglNLSGVLS  381
            T++ ALL++K    +D   +L+SWN S   CTW  V C      V++L+LS L L+G LS
Sbjct  41   TDREALLAMKHLVLSDPFRALSSWNASLHFCTWHGVACGSKHQRVIALNLSSLQLAGFLS  100

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            P +G L FL  + ++ N   G +P E+  +  L++L+LSNN F    P  L+  +NL+ L
Sbjct  101  PHIGNLTFLRRIDLSKNNFHGTIPEEVGQLFRLQYLSLSNNSFQDELPGNLSHCSNLRFL  160

Query  562  DLYNNNLTGDLPVEV  606
             +  NNLTG +P E+
Sbjct  161  GMEGNNLTGKIPSEL  175


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G L   +G+L  L    +  N++SG +P  +  IS L  L+L  N+   T P  LA  
Sbjct  415  LTGRLPESIGKLVMLKEFYVHLNKISGEIPSALGNISGLLKLDLGVNLLEGTIPVSLANC  474

Query  544  ANLQVLDLYNNNLTGDLPVEVY  609
             +L +LD+ +N+L+G +P +++
Sbjct  475  TSLNLLDISHNHLSGFIPEKIF  496


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L   V  +  L+ L I+ N++ G +P  +     L  LN+S N    T P    +L
Sbjct  512  LSGRLPSQVVNMRNLIQLDISRNKICGEIPSTLETCLMLETLNMSGNFLRGTIPSSFKKL  571

Query  544  ANLQVLDLYNNNLTGDLP  597
             +++VLD+  NNL+G +P
Sbjct  572  RSIRVLDVSCNNLSGQIP  589



>ref|XP_010927978.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Elaeis 
guineensis]
Length=635

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 85/153 (56%), Gaps = 3/153 (2%)
 Frame = +1

Query  169  SAGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWN-ISTSHCTWRRVTCdsllhvvs  342
            ++ AG   P GV  E  AL+ IK +   D  S L +W+  S   C+W  VTC     V+S
Sbjct  31   ASAAGLLSPKGVNFEVQALIDIKVSLK-DPHSVLENWDQDSVDPCSWAMVTCSPDNLVIS  89

Query  343  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  522
            L     +LSG LS  +G L  L  + +  N +SGP+PPEI  +S L+ L+LSNN F    
Sbjct  90   LGSPSQSLSGTLSSSIGNLTNLETVLLQNNNISGPIPPEIGRLSKLKTLDLSNNYFTGEI  149

Query  523  PHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTS  621
            P  + Q+ +LQ L L NN+L+G  P+ + K+T 
Sbjct  150  PTSIGQMESLQYLRLNNNSLSGAFPLSLAKLTE  182



>ref|XP_007025340.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY27962.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=616

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 86/155 (55%), Gaps = 5/155 (3%)
 Frame = +1

Query  166  HSAGAGAG--KPLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllh  333
            HS  AG     P GV  E AAL+S+K     D+++ +  W+I S   CTW  V C +   
Sbjct  15   HSVSAGDSLLSPKGVNYEVAALMSVKREMI-DARNVMDGWDINSVDPCTWNMVACSAEGF  73

Query  334  vvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFG  513
            V+SL+++   LSG+LSP +G L  L  + +  NQLSGP+P EI   S L+ L+LS N F 
Sbjct  74   VISLEMASTGLSGLLSPSIGNLSHLRTMLLQNNQLSGPIPDEIGKFSELQTLDLSGNQFV  133

Query  514  STFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMT  618
               P  L  L +L  L L  NNL+G +P  +  +T
Sbjct  134  GVIPSSLGSLTHLSYLRLSKNNLSGPIPRLIANLT  168



>ref|XP_008351784.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Malus 
domestica]
Length=1081

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 77/138 (56%), Gaps = 1/138 (1%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTC-dsllhvvsldlsglNLSGVLSP  384
            ++ +LL+ KA    D+   L+SWN S   C W  +TC      V  LDL    L+G LSP
Sbjct  83   DRLSLLAFKAEIVTDTLGILSSWNESLHFCHWPGITCGRRHQRVTVLDLQSSGLAGHLSP  142

Query  385  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLD  564
             +G L FL  L++A N  S  +PPEI  +  L  L L NN FG   P  +++ +NLQ +D
Sbjct  143  HIGNLSFLRALNLANNSFSHTIPPEIGRLFRLVRLGLHNNSFGGHIPFNISRCSNLQHID  202

Query  565  LYNNNLTGDLPVEVYKMT  618
            L+ N L+G LP E+  ++
Sbjct  203  LFGNTLSGKLPTEIASLS  220


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G +  +VG +  LV+L ++ N+LSG +P  + + ++L  L+L  N+   T P  L+ L
Sbjct  553  LTGSIPMEVGNIEHLVSLDVSENKLSGEIPQSLGSCTSLSTLSLRENLLQGTIPKSLSSL  612

Query  544  ANLQVLDLYNNNLTGDLP  597
              ++  DL  NNL+G +P
Sbjct  613  RGIEDFDLSRNNLSGIIP  630


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (52%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            N  G   P  G L  L  LS + N L G +P  +  + +L F +LS N    T P  +  
Sbjct  231  NFYGKFPPSFGNLSSLEILSASQNNLHGGIPNSLGQLKSLTFFSLSTNYLNGTIPPSIYH  290

Query  541  LANLQVLDLYNNNLTGDLP  597
            L++++V+ ++ NNL G LP
Sbjct  291  LSSIKVIYMHRNNLHGTLP  309



>ref|XP_001754727.1| CLL1A clavata1-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ80697.1| CLL1A clavata1-like receptor S/T protein kinase protein [Physcomitrella 
patens]
Length=1017

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 88/140 (63%), Gaps = 3/140 (2%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSWNI--STSHCTWRRVTCdsllhvvsldlsglNLSGVLS  381
            E+ AL+++KA    D +S L  W +  ++S C W  V C++   VV L LSG+NLSG +S
Sbjct  34   ERLALIALKATID-DPESHLADWEVNGTSSPCLWTGVDCNNSSSVVGLYLSGMNLSGTIS  92

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
             ++G L  LVNLS+  N  +  +P +I  ++ L++LN+S N FG   P   +QL  LQVL
Sbjct  93   SELGNLKNLVNLSLDRNNFTEDLPADIVTLTQLKYLNVSTNSFGGALPSNFSQLQLLQVL  152

Query  562  DLYNNNLTGDLPVEVYKMTS  621
            D +NN  +G LP +++K+++
Sbjct  153  DCFNNFFSGPLPPDLWKIST  172


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NLS  +   +G LP +++  I+ N  +GP+PP+I  +  L  L++S N    + P +++ 
Sbjct  471  NLSSSIPESIGNLPSIMSFFISDNHFTGPIPPQICDMPNLNKLDMSGNNLSGSIPAEMSN  530

Query  541  LANLQVLDLYNNNLTGDLPVEV  606
               L +LD+ +N+LTG +PV++
Sbjct  531  CKKLGLLDVSHNSLTGVIPVQM  552


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NLSG +  ++     L  L ++ N L+G +P ++  I  L +LNLS+N      P +LA 
Sbjct  519  NLSGSIPAEMSNCKKLGLLDVSHNSLTGVIPVQMQFIPDLYYLNLSHNELSGAIPSKLAD  578

Query  541  LANLQVLDLYNNNLTGDLPV  600
            L  L + D   NNL+G +P+
Sbjct  579  LPTLSIFDFSYNNLSGPIPL  598



>emb|CDY36706.1| BnaC02g31270D [Brassica napus]
Length=956

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 80/132 (61%), Gaps = 1/132 (1%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN-LSGVLS  381
            T+  ALLS ++  +   QS   SW+ +TS C W  VTCD+ +  V+      + L+G +S
Sbjct  31   TDSEALLSFESQMSQSPQSLSFSWDPNTSPCNWTGVTCDTRIRRVASINLSGHGLTGSIS  90

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            P +G L FL +L +  NQL GP+P EI+ +  LR LNLS+N    + P  L++L  L+VL
Sbjct  91   PSIGNLSFLTSLQLQNNQLRGPIPKEITNLFRLRVLNLSSNSLDGSLPSNLSKLIELRVL  150

Query  562  DLYNNNLTGDLP  597
            DL +N +TG +P
Sbjct  151  DLTSNMITGIVP  162


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            ++G++   +G L  L  L++  N L GP+PP +S IS+L  L+L  N      P++L +L
Sbjct  157  ITGIVPNQLGDLKNLTILNLGKNLLHGPIPPSLSNISSLTVLSLGTNSLSGPVPNELGRL  216

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              LQVLDL  NNL+G +P  +Y ++S
Sbjct  217  QRLQVLDLTINNLSGTIPPSIYNISS  242


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG +  D+ +L  LV+L +++N  SG +P  I    +L  LN++ N      P  LA++
Sbjct  482  FSGPIPQDISRLESLVSLDLSSNNFSGHIPSSIKDCQSLERLNMAGNNLDGPIPDALAEV  541

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+ LDL +N L+G +P
Sbjct  542  KGLEFLDLSSNQLSGVIP  559



>ref|NP_001042048.1| Os01g0152800 [Oryza sativa Japonica Group]
 dbj|BAD61117.1| putative protein kinase Xa21 [Oryza sativa Japonica Group]
 dbj|BAD61339.1| putative protein kinase Xa21 [Oryza sativa Japonica Group]
 dbj|BAF03962.1| Os01g0152800 [Oryza sativa Japonica Group]
 dbj|BAG95699.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1051

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 77/135 (57%), Gaps = 2/135 (1%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls--glNLSGVLS  381
            ++A LL+ KAAF   S S+L SWN STS C+W  VTCD         L+    NL+G L 
Sbjct  34   DEATLLAFKAAFRGSSSSALASWNSSTSFCSWEGVTCDRRTPARVAALTLPSGNLAGGLP  93

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            P +G L FL +L++++N+L G +PP +  +  L  L++  N F    P  L+   +++ L
Sbjct  94   PVIGNLSFLQSLNLSSNELYGEIPPSLGRLRRLEILDIGGNSFSGELPANLSSCISMKNL  153

Query  562  DLYNNNLTGDLPVEV  606
             L  N L G +PVE+
Sbjct  154  GLAFNQLGGRIPVEL  168


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG++   +G L  L  L      L GP+P  +  + TL  L+LS N    + P ++ +L
Sbjct  433  LSGLIPSSIGNLTNLNRLYAYYTNLEGPIPASLGKLKTLFVLDLSTNRLNGSIPKEILEL  492

Query  544  ANLQ-VLDLYNNNLTGDLPVEV  606
             +L   LDL  N+L+G LP+EV
Sbjct  493  PSLSWYLDLSYNSLSGPLPIEV  514



>ref|XP_007021767.1| Leucine-rich repeat protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY13292.1| Leucine-rich repeat protein kinase family protein, putative [Theobroma 
cacao]
Length=1142

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 81/140 (58%), Gaps = 3/140 (2%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLS  381
            T+Q ALL++KA   +D  +  T+W+ +TS C W  VTC S  H V+       NL G + 
Sbjct  34   TDQLALLALKAHVNSDLLA--TNWSTATSICNWVGVTCGSRHHRVTALDLFGTNLVGTIP  91

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            PD+G L FL +L I  N L G +P E++ +  L+ L LSNN F    P  L  L+ L+VL
Sbjct  92   PDIGNLSFLASLDIGNNSLHGSLPIELANLHRLKSLILSNNNFNGEIPSSLCSLSKLEVL  151

Query  562  DLYNNNLTGDLPVEVYKMTS  621
             LYNNNL G +P  +  ++S
Sbjct  152  SLYNNNLQGHIPEVIGNLSS  171


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 44/84 (52%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L G L  D+G+   + N+  + NQLSG +P  I  +  L +L+LS N    + P     L
Sbjct  645  LRGALPIDIGKWKVVYNIDFSKNQLSGEIPRSIGDLKDLTYLSLSGNRLQGSIPESFGGL  704

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              LQ LDL  NN +G +P  + K+
Sbjct  705  KGLQFLDLSRNNFSGIIPKPLEKL  728


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 42/81 (52%), Gaps = 0/81 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L G +  ++G L  L  L + +N L G +P +I  +  L +L+L         P  +  L
Sbjct  279  LEGAIPKEIGNLTMLKILYLGSNNLKGEIPQQIDNLLNLEYLSLPECQLTGAIPSVIGNL  338

Query  544  ANLQVLDLYNNNLTGDLPVEV  606
              L+ LD  +NNLTG +P+++
Sbjct  339  TMLETLDFNDNNLTGKIPLQI  359



>gb|EAY72573.1| hypothetical protein OsI_00439 [Oryza sativa Indica Group]
Length=1051

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 77/135 (57%), Gaps = 2/135 (1%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls--glNLSGVLS  381
            ++A LL+ KAAF   S S+L SWN STS C+W  VTCD         L+    NL+G L 
Sbjct  34   DEATLLAFKAAFRGSSSSALASWNSSTSFCSWEGVTCDRRTPARVAALTLPSGNLAGGLP  93

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            P +G L FL +L++++N+L G +PP +  +  L  L++  N F    P  L+   +++ L
Sbjct  94   PVIGNLSFLQSLNLSSNELYGEIPPSLGRLRRLEILDIGGNSFSGELPANLSSCISMKNL  153

Query  562  DLYNNNLTGDLPVEV  606
             L  N L G +PVE+
Sbjct  154  GLAFNQLGGRIPVEL  168


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG++   +G L  L  L      L GP+P  +  + TL  L+LS N    + P ++ +L
Sbjct  433  LSGLIPSSIGNLTNLNRLYAYYTNLEGPIPASLGKLKTLFVLDLSTNRLNGSIPKEILEL  492

Query  544  ANLQ-VLDLYNNNLTGDLPVEV  606
             +L   LDL  N L+G LP+EV
Sbjct  493  PSLSWYLDLSYNYLSGPLPIEV  514



>ref|XP_009417563.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=542

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 83/152 (55%), Gaps = 3/152 (2%)
 Frame = +1

Query  169  SAGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvs  342
            S  A    P GV  E  AL+ +KA+   D  S L +W+  S   C+W  VTC     V+ 
Sbjct  31   SPAAAVLSPKGVNYEVQALMGVKASL-KDPHSVLENWDQDSVDPCSWTMVTCSPENLVIG  89

Query  343  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  522
            L     NLSG LSP +G L  L  + +  N +SGP+P EI  +S LR L+LS+N F    
Sbjct  90   LGSPSQNLSGTLSPSIGNLTNLEIILLQNNNISGPIPQEIGRLSKLRTLDLSSNYFTGDI  149

Query  523  PHQLAQLANLQVLDLYNNNLTGDLPVEVYKMT  618
            P  +  L++LQ L L NN+L+G+ PV +  +T
Sbjct  150  PTSITHLSSLQYLRLNNNSLSGEFPVSLTNLT  181



>ref|XP_010675938.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Beta vulgaris subsp. vulgaris]
Length=838

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 83/142 (58%), Gaps = 4/142 (3%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSWNISTSHCTW----RRVTCdsllhvvsldlsglNLSGV  375
            E+ ALLSIK+A T D  +SL+SW  +T HC+W       +  S   V+SLD+S L L+G+
Sbjct  53   EEKALLSIKSAITYDPSNSLSSWKNTTHHCSWPYIICSSSSSSSSSVISLDISDLELTGI  112

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  555
            LSPD+G L  L NLSI  N  SG +PPE+  ++ L  L   N  F    P +L +L  L+
Sbjct  113  LSPDIGFLTNLQNLSIEGNYFSGGIPPELGNLTKLTKLYGDNCNFSGEIPMELGKLKKLE  172

Query  556  VLDLYNNNLTGDLPVEVYKMTS  621
            +L    N L+G LP E+  M S
Sbjct  173  ILIFSGNTLSGGLPFELGSMKS  194


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 43/83 (52%), Gaps = 0/83 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSGV+      L  +   ++  N+L G +P  I  +  L +L L +N F  + P +L   
Sbjct  205  LSGVIPKSYSLLQNITYFNLVENKLHGSIPDFIGDLPELEYLYLDSNNFTGSIPPKLGTN  264

Query  544  ANLQVLDLYNNNLTGDLPVEVYK  612
              LQ + ++ NNLTG LPV + K
Sbjct  265  GRLQFVSIFGNNLTGSLPVSLCK  287



>ref|XP_006382632.1| hypothetical protein POPTR_0005s03970g [Populus trichocarpa]
 gb|ERP60429.1| hypothetical protein POPTR_0005s03970g [Populus trichocarpa]
Length=1060

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 79/135 (59%), Gaps = 1/135 (1%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLS  381
            T++ ALLS+K+  T D  ++L+SWN S+S C W RV+C+ +   V       L L+G +S
Sbjct  68   TDKEALLSLKSQVTTDPSNTLSSWNNSSSPCNWTRVSCNQVNQRVIGLDLSGLRLTGSIS  127

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            P++G L  L +L +  NQ +G +P +I A+S L  LN+S N      P       NLQ+L
Sbjct  128  PNIGNLSLLRSLHLQGNQFTGLIPDQIGALSRLSVLNISFNSINGPIPLNTTMCLNLQIL  187

Query  562  DLYNNNLTGDLPVEV  606
            DL  N ++G +P E+
Sbjct  188  DLMQNEISGAIPEEL  202


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            +SG +  ++  L  L  L++  N+L G +PP  + IS+L  LNL+ N  G   P    + 
Sbjct  194  ISGAIPEELSSLKNLEILNLGGNKLWGTIPPSFANISSLLTLNLATNNLGGMIPDDFGRF  253

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
             NL+ LDL  NNLTG++P+ +Y ++S
Sbjct  254  KNLKHLDLSINNLTGNVPLSLYNISS  279


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            +SG + P++G+L  L  L +AAN++SG +P  +  +  L  ++LS+N    + P      
Sbjct  442  VSGEIPPEIGELTNLQELHLAANKISGRIPNSLGKLQKLNEIDLSSNDLVGSLPTTFVNF  501

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  +DL +N L G +P  ++ ++S
Sbjct  502  QQLVSMDLSSNRLNGSIPKAIFSLSS  527


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = +1

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  549
            G +   +  L  L  L+I+ N +SG +PPEI  ++ L+ L+L+ N      P+ L +L  
Sbjct  420  GRIPASIRHLRSLALLNISYNYVSGEIPPEIGELTNLQELHLAANKISGRIPNSLGKLQK  479

Query  550  LQVLDLYNNNLTGDLP  597
            L  +DL +N+L G LP
Sbjct  480  LNEIDLSSNDLVGSLP  495



>ref|XP_009417562.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=638

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 83/152 (55%), Gaps = 3/152 (2%)
 Frame = +1

Query  169  SAGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvs  342
            S  A    P GV  E  AL+ +KA+   D  S L +W+  S   C+W  VTC     V+ 
Sbjct  31   SPAAAVLSPKGVNYEVQALMGVKASL-KDPHSVLENWDQDSVDPCSWTMVTCSPENLVIG  89

Query  343  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  522
            L     NLSG LSP +G L  L  + +  N +SGP+P EI  +S LR L+LS+N F    
Sbjct  90   LGSPSQNLSGTLSPSIGNLTNLEIILLQNNNISGPIPQEIGRLSKLRTLDLSSNYFTGDI  149

Query  523  PHQLAQLANLQVLDLYNNNLTGDLPVEVYKMT  618
            P  +  L++LQ L L NN+L+G+ PV +  +T
Sbjct  150  PTSITHLSSLQYLRLNNNSLSGEFPVSLTNLT  181



>ref|XP_006338306.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Solanum tuberosum]
Length=626

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 85/152 (56%), Gaps = 3/152 (2%)
 Frame = +1

Query  169  SAGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWN-ISTSHCTWRRVTCdsllhvvs  342
            S+ AG   P GV  E  AL++IK A   D    L +W+  S   C+W  VTC S   V+ 
Sbjct  22   SSAAGLLSPKGVNFEVQALMAIKVALK-DPHGVLDNWDSTSVDPCSWAMVTCSSESLVIG  80

Query  343  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  522
            L     NLSG  SP +G L  L  + +  N ++GP+P EI  +S L+ L+LS+N F    
Sbjct  81   LGAPSQNLSGTFSPSIGNLTNLQIILLQNNNITGPIPKEIGRLSKLQTLDLSDNFFTGDI  140

Query  523  PHQLAQLANLQVLDLYNNNLTGDLPVEVYKMT  618
            P  L  L++L+ + L NN+L+G++PV +  M+
Sbjct  141  PVSLGHLSDLKYMRLNNNSLSGEIPVSLANMS  172



>ref|XP_010064788.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Eucalyptus 
grandis]
Length=989

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 76/136 (56%), Gaps = 2/136 (1%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl--lhvvsldlsglNLSGVL  378
            T+Q AL+  K +   DS   L+SWN S+ HC W  + C       VVSL+L    L G+L
Sbjct  10   TDQLALIYFKDSVDKDSLGILSSWNDSSHHCEWPGIVCGGRHPERVVSLNLMSKGLGGLL  69

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  558
            SP VG L FL +L +  N   G +P  I  +  LR L LSNN F    P  L+Q +NL+V
Sbjct  70   SPHVGNLSFLRSLVLQNNSFRGKIPQSIGHLFRLRRLVLSNNSFSGQMPTNLSQCSNLEV  129

Query  559  LDLYNNNLTGDLPVEV  606
            L+L +N L G +P E+
Sbjct  130  LNLIDNQLVGKIPHEL  145


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L   VG L  LV L ++ N+L+GP+P  IS    L  LNL+ N F    P  L  L
Sbjct  478  LSGSLPSQVGSLTNLVELDLSYNKLTGPIPSSISKCLLLGRLNLAVNSFYGEIPPALGTL  537

Query  544  ANLQVLDLYNNNLTGDLP  597
              LQ LD+ +N+L+G++P
Sbjct  538  RGLQELDVSHNDLSGEIP  555


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL-NLSNNIFGSTFPHQLA  537
            N  G +   +G    L+ L ++ N LSGP+P E+ ++ST+  + NL++N    + P Q+ 
Sbjct  428  NFYGEIPQSLGNCRQLIELELSNNNLSGPIPREVLSLSTISIIFNLAHNQLSGSLPSQVG  487

Query  538  QLANLQVLDLYNNNLTGDLPVEVYK  612
             L NL  LDL  N LTG +P  + K
Sbjct  488  SLTNLVELDLSYNKLTGPIPSSISK  512


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 47/87 (54%), Gaps = 1/87 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISA-ISTLRFLNLSNNIFGSTFPHQLAQ  540
            L+G + P +  +  ++  S   NQL G +PP I A + +L +L+ S N+F    P  L+ 
Sbjct  209  LTGKIPPAIFNMSSIIYFSAGDNQLRGSIPPNIGATLPSLDYLDFSRNLFTGVIPPSLSN  268

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
             +NLQ +   +NN  G +P  + ++ +
Sbjct  269  ASNLQYISFDHNNFHGPMPTNLGRLKA  295



>gb|KJB73883.1| hypothetical protein B456_011G2584002, partial [Gossypium raimondii]
Length=244

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 69/132 (52%), Gaps = 1/132 (1%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTC-dsllhvvsldlsglNLSGVLS  381
            T+Q ALL  KA  T D  + + SWN S   C W  VTC      V  L L  L LSG LS
Sbjct  45   TDQQALLQYKAKITGDQLNIMESWNSSIHFCQWIGVTCGRKHQRVTKLKLRFLKLSGSLS  104

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            P +G L FL  L +AAN     +P EI  +  L  L+LSNN      P  L+  + L  +
Sbjct  105  PYIGNLSFLRELDLAANSFHNQIPQEIGGLRRLETLDLSNNSISGEIPSNLSACSKLIFV  164

Query  562  DLYNNNLTGDLP  597
            D+ NN LTG++P
Sbjct  165  DMTNNQLTGEIP  176



>ref|XP_002269902.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Vitis vinifera]
 emb|CBI27432.3| unnamed protein product [Vitis vinifera]
Length=625

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 81/144 (56%), Gaps = 3/144 (2%)
 Frame = +1

Query  193  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  366
            P GV  E  AL+SIK +   D +S L +W+  +   C+W  +TC     V+SL     NL
Sbjct  28   PKGVNFEVQALMSIKNSLI-DPRSVLENWDKDAVDPCSWNMITCSDDKLVISLGTPSQNL  86

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  546
            SG LSP +G L  L  + +  N +SGP+P E+  +S L  L+LSNN F    P  L+ L 
Sbjct  87   SGTLSPSIGNLTNLQTVLLQDNSISGPIPSELGKLSKLHLLDLSNNFFNGEIPTSLSHLK  146

Query  547  NLQVLDLYNNNLTGDLPVEVYKMT  618
            +LQ L L NN+L+G +P  +  MT
Sbjct  147  SLQYLRLNNNSLSGAIPSSLANMT  170



>ref|XP_006300675.1| hypothetical protein CARUB_v10019714mg [Capsella rubella]
 gb|EOA33573.1| hypothetical protein CARUB_v10019714mg [Capsella rubella]
Length=990

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 87/142 (61%), Gaps = 5/142 (4%)
 Frame = +1

Query  196  LGVTEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNL  366
            L  T+   LL++K++        L  W  S S   HC++  V+CD    V+SL++S   L
Sbjct  33   LAYTDMDVLLTLKSSMIGPKGDGLHDWTHSPSPAAHCSFSGVSCDGERRVISLNVSFTPL  92

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI-FGSTFPHQ-LAQ  540
             G +SP++G L  LVNL++AAN  SG +P E+ ++++L+ LN+SNN      FP + L  
Sbjct  93   FGTISPEIGMLNRLVNLTLAANNFSGELPLEMKSLTSLKVLNISNNANLNGRFPGEILKA  152

Query  541  LANLQVLDLYNNNLTGDLPVEV  606
            + +L+VLD YNNN TG LP+E+
Sbjct  153  MVDLEVLDAYNNNFTGTLPLEI  174


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            N++GV+   V +   L+++ ++ N+++G +P EI+ +  L  LNLS N    + P  +  
Sbjct  525  NITGVIPDSVSRCTTLISVDLSRNRINGEIPKEINNVINLGTLNLSGNQLTGSIPTGIGN  584

Query  541  LANLQVLDLYNNNLTGDLPV  600
            + +L  LDL  N+L+G +P+
Sbjct  585  MTSLTTLDLSYNDLSGRVPL  604



>gb|KCW69037.1| hypothetical protein EUGRSUZ_F02592, partial [Eucalyptus grandis]
Length=993

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 76/136 (56%), Gaps = 2/136 (1%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl--lhvvsldlsglNLSGVL  378
            T+Q AL+  K +   DS   L+SWN S+ HC W  + C       VVSL+L    L G+L
Sbjct  6    TDQLALIYFKDSVDKDSLGILSSWNDSSHHCEWPGIVCGGRHPERVVSLNLMSKGLGGLL  65

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  558
            SP VG L FL +L +  N   G +P  I  +  LR L LSNN F    P  L+Q +NL+V
Sbjct  66   SPHVGNLSFLRSLVLQNNSFRGKIPQSIGHLFRLRRLVLSNNSFSGQMPTNLSQCSNLEV  125

Query  559  LDLYNNNLTGDLPVEV  606
            L+L +N L G +P E+
Sbjct  126  LNLIDNQLVGKIPHEL  141


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG L   VG L  LV L ++ N+L+GP+P  IS    L  LNL+ N F    P  L  L
Sbjct  474  LSGSLPSQVGSLTNLVELDLSYNKLTGPIPSSISKCLLLGRLNLAVNSFYGEIPPALGTL  533

Query  544  ANLQVLDLYNNNLTGDLP  597
              LQ LD+ +N+L+G++P
Sbjct  534  RGLQELDVSHNDLSGEIP  551


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL-NLSNNIFGSTFPHQLA  537
            N  G +   +G    L+ L ++ N LSGP+P E+ ++ST+  + NL++N    + P Q+ 
Sbjct  424  NFYGEIPQSLGNCRQLIELELSNNNLSGPIPREVLSLSTISIIFNLAHNQLSGSLPSQVG  483

Query  538  QLANLQVLDLYNNNLTGDLPVEVYK  612
             L NL  LDL  N LTG +P  + K
Sbjct  484  SLTNLVELDLSYNKLTGPIPSSISK  508


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 47/87 (54%), Gaps = 1/87 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISA-ISTLRFLNLSNNIFGSTFPHQLAQ  540
            L+G + P +  +  ++  S   NQL G +PP I A + +L +L+ S N+F    P  L+ 
Sbjct  205  LTGKIPPAIFNMSSIIYFSAGDNQLRGSIPPNIGATLPSLDYLDFSRNLFTGVIPPSLSN  264

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
             +NLQ +   +NN  G +P  + ++ +
Sbjct  265  ASNLQYISFDHNNFHGPMPTNLGRLKA  291



>ref|XP_010428620.1| PREDICTED: receptor protein kinase CLAVATA1-like [Camelina sativa]
Length=993

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 91/142 (64%), Gaps = 5/142 (4%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLSGV  375
            T+   LL++K++    +   L  W  S S   HC++  V+CD    V+SL++S   L G 
Sbjct  39   TDMDVLLTLKSSMIGPNGDGLHDWIHSPSPAAHCSFTGVSCDGEARVISLNVSFTPLFGK  98

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI-FGSTFPHQLA-QLAN  549
            +SP++G L  LVNL++AAN  +G +P E+ ++++L+ LN+SNN+    +FP ++   + +
Sbjct  99   ISPEIGMLNRLVNLTLAANNFTGELPLEMKSLTSLKVLNISNNVNLSGSFPGEIVIAMVD  158

Query  550  LQVLDLYNNNLTGDLPVEVYKM  615
            L+VLD YNNN TG LP+E+ K+
Sbjct  159  LEVLDAYNNNFTGTLPLEIAKL  180



>ref|XP_009588501.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Nicotiana tomentosiformis]
Length=800

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 76/135 (56%), Gaps = 1/135 (1%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldl-sglNLSGVLS  381
            T++ ALLSIK   T D    + SWN S  HC+W+ VTC +    V+L   S   L G + 
Sbjct  32   TDRLALLSIKGQITYDPFGIMYSWNNSFHHCSWQGVTCSTRHQRVTLLDLSSKQLVGTIV  91

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            P +G + FL  L++  N ++G +P EI  +  L+ L L+NN F    P +L+  + L  L
Sbjct  92   PQIGNMSFLRKLTLRNNTINGEIPQEIGRLFRLQNLELANNSFNGEIPVELSNCSRLIYL  151

Query  562  DLYNNNLTGDLPVEV  606
            DL  N LTG +PVE+
Sbjct  152  DLDGNRLTGKIPVEL  166



>ref|XP_010999778.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Populus euphratica]
Length=1041

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 80/147 (54%), Gaps = 1/147 (1%)
 Frame = +1

Query  184  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-l  360
            A +P   T++ ALLS K+    D  ++L+SWN ++S C W  V C  +   V       L
Sbjct  42   AAEPGLFTDKEALLSFKSQVIVDPSNTLSSWNDNSSPCNWTHVDCSQVHQRVVGLDLSGL  101

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
             L+G +SP +G L FL +L +  NQ +G +P +I A+  L+ LN+S N      P  +  
Sbjct  102  GLTGSISPHIGNLSFLRSLYLQENQFTGVIPDQIGALFRLKVLNMSFNTINGPIPLNITN  161

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
              NLQ+LDL  N ++G +P E+  + S
Sbjct  162  CLNLQILDLMQNEISGAIPEELSNLKS  188


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            +SG +  ++  L  L  L +  N+L G +PP I+ IS+L  L+L  N  G   P  L +L
Sbjct  175  ISGAIPEELSNLKSLEILKLGGNKLWGMIPPVIANISSLLTLDLVTNNLGGMIPADLGRL  234

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
             NL+ LDL  NNLTGD+P+ +Y ++S
Sbjct  235  ENLKHLDLSINNLTGDVPLSLYNISS  260


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 49/87 (56%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            ++SG + P++G+L  L  L +AAN++SG +P  +  +  L  ++LS N      P     
Sbjct  422  HVSGEIPPEIGELTDLQELHLAANKISGRIPDSLGNLQKLNKIDLSANELVGRLPTTFVN  481

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
               LQ +DL +N L G +P E++ ++S
Sbjct  482  FQQLQSMDLSSNRLNGSIPKEIFNLSS  508



>ref|XP_009123620.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Brassica 
rapa]
Length=1001

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 81/132 (61%), Gaps = 1/132 (1%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN-LSGVLS  381
            T++ ALLS ++  + + QS   SW+ +TS C W  VTCD+ +  V+      + L+G +S
Sbjct  31   TDREALLSFESQMSQNPQSLSFSWDPNTSPCNWTGVTCDTRIRRVTSINLSGHGLTGSIS  90

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            P +G L FL +L +  NQL GP+P EI+ +  LR LNLS+N    + P  L++L  L+ L
Sbjct  91   PSIGNLSFLTSLQLQNNQLRGPIPKEITNLFRLRVLNLSSNSLDGSLPSNLSKLIELRAL  150

Query  562  DLYNNNLTGDLP  597
            DL +N +TG +P
Sbjct  151  DLTSNMITGIVP  162


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            ++G++   +G L  L  L++  N L GP+PP +S IS+L  L+L  N      P++L +L
Sbjct  157  ITGIVPNQLGDLKNLTILNLGKNLLHGPIPPSLSNISSLTVLSLGTNSLSGPVPNELGRL  216

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              LQVLDL  NNL+G +P  +Y M+S
Sbjct  217  QRLQVLDLTINNLSGTIPPSIYNMSS  242


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 42/79 (53%), Gaps = 1/79 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            L GV+   +G LP  L  L +  N+ +G +P  I  ++ L   N+S+N      P  + +
Sbjct  357  LEGVIPVSIGNLPKNLSKLFMGGNRFTGIIPESIGDLTGLTLFNISDNSLTGEIPQDIGK  416

Query  541  LANLQVLDLYNNNLTGDLP  597
            L  LQVL+L  N LTG +P
Sbjct  417  LKGLQVLELARNQLTGRIP  435


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG +  D+ +L  LV+L +++N  SG +P  I    +L  LN++ N      P  LA++
Sbjct  503  FSGPIPQDISRLESLVSLDLSSNNFSGHIPSSIKDCQSLEKLNMAGNNLDGPIPDALAEV  562

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+ LDL +N L+G +P
Sbjct  563  KGLEFLDLSSNQLSGVIP  580



>ref|XP_004979517.1| PREDICTED: putative receptor-like protein kinase At3g47110-like 
[Setaria italica]
Length=1040

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 82/135 (61%), Gaps = 3/135 (2%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl--lhvvsldlsglNLSGVLS  381
            ++ ALLS K+  +  S + L SWN ST++CTW  V C     + VVSL ++  NLSG +S
Sbjct  34   DELALLSFKSMLSGPS-ALLASWNTSTNYCTWPGVACSRRPPVRVVSLLMNSFNLSGKIS  92

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            P VG L FL  L++  NQL G +PPE+  ++ L+ LNLS N    + P  + +   L++L
Sbjct  93   PFVGNLSFLEKLNLGNNQLIGEIPPELGRLAKLQLLNLSANSLEGSIPATIGRCTELKLL  152

Query  562  DLYNNNLTGDLPVEV  606
             L NN L G++P E+
Sbjct  153  CLTNNKLQGEIPTEI  167


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG +   + +LP +V+L+   N+LSG +P  +S ++ L+FL L  N+   + P  L  L
Sbjct  183  FSGEIPQSLTELPSMVHLTFYDNKLSGEIPASLSNLTNLQFLGLGKNMLTGSIPSSLGLL  242

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  LDL  NNL+G +P  ++ ++S
Sbjct  243  PTLSWLDLGFNNLSGVIPTSLWNISS  268


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 41/79 (52%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL G +  ++G L  LV      N+LSG +P  +     L+ L L NN      P  L Q
Sbjct  527  NLEGDIPQEIGNLKNLVQFHAEFNKLSGQIPSTLGDCQLLQSLYLQNNFLSGNIPSLLGQ  586

Query  541  LANLQVLDLYNNNLTGDLP  597
            L  L+ LDL +NNL+G +P
Sbjct  587  LKGLENLDLSSNNLSGQIP  605



>ref|XP_010910648.1| PREDICTED: putative receptor-like protein kinase At3g47110, partial 
[Elaeis guineensis]
Length=383

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 84/134 (63%), Gaps = 4/134 (3%)
 Frame = +1

Query  217  ALLSIKA-AFTADSQSSLTSWNISTSHCTWRRVTCdsl---lhvvsldlsglNLSGVLSP  384
            ALLSIKA  + ++S SS  S N +  +C W  V C SL     V +LDL  LNL+G +SP
Sbjct  9    ALLSIKAHLYPSESLSSWGSKNQTVHYCKWLGVKCGSLQYPKRVTALDLDSLNLTGKISP  68

Query  385  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLD  564
            D+G L FL  L+++ NQL G +P E+  +S L+FLNL +N  G T P   A  +NL ++ 
Sbjct  69   DIGNLTFLQKLNLSGNQLQGYIPQELGRLSNLQFLNLMDNALGGTIPTSFANCSNLVLIW  128

Query  565  LYNNNLTGDLPVEV  606
            L +N L G++PVE+
Sbjct  129  LDSNKLIGEIPVEL  142



>ref|XP_004232118.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Solanum lycopersicum]
Length=626

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 85/152 (56%), Gaps = 3/152 (2%)
 Frame = +1

Query  169  SAGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWN-ISTSHCTWRRVTCdsllhvvs  342
            S+ AG   P GV  E  AL++IK A   D    L +W+  S   C+W  VTC S   V+ 
Sbjct  22   SSAAGLLSPKGVNFEVQALMAIKVALK-DPHGVLDNWDSTSVDPCSWAMVTCSSESLVIG  80

Query  343  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  522
            L     NLSG  SP +G L  L  + +  N ++GP+P EI  +S L+ L+LS+N F    
Sbjct  81   LGAPSQNLSGTFSPSIGNLTNLQIILLQNNNITGPIPKEIGRLSKLQTLDLSDNFFTGDI  140

Query  523  PHQLAQLANLQVLDLYNNNLTGDLPVEVYKMT  618
            P  L  L++L+ + L NN+L+G++PV +  M+
Sbjct  141  PVPLGHLSDLKYMRLNNNSLSGEIPVSLANMS  172



>gb|KJB69703.1| hypothetical protein B456_011G038400 [Gossypium raimondii]
Length=620

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 81/144 (56%), Gaps = 3/144 (2%)
 Frame = +1

Query  193  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  366
            P GV  E AAL+S+K     D +  +  W+I S   CTW  V C +   V+SL+++   L
Sbjct  31   PKGVNYEVAALMSVKRELR-DYKQVMDGWDINSVDPCTWNMVACSAEGFVISLEMASTGL  89

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  546
            SG+LSP +G L  L  + +  NQLSGP+P EI  +S L+ L+LS N F    P  L  L 
Sbjct  90   SGLLSPSIGNLSHLRTMLLQNNQLSGPIPDEIGKLSELQTLDLSGNHFVGAIPSTLGSLT  149

Query  547  NLQVLDLYNNNLTGDLPVEVYKMT  618
            +L  L L  NNL+G +P  V  +T
Sbjct  150  HLSYLRLSKNNLSGPIPRHVANLT  173



>ref|XP_010939071.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Elaeis guineensis]
Length=1014

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 73/141 (52%), Gaps = 2/141 (1%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN--LSGVL  378
            ++  ALL+ K   T D   +L+SWN +   C W  +TC          L   +  L G L
Sbjct  38   SDHLALLAFKDQITHDHLGALSSWNDTVHFCKWEGITCSKKHQQRVTALELRSWGLGGSL  97

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  558
             P +G L FL  L +  N  +  +PPE+  +  L++LNLS N F   FP  L   + L+ 
Sbjct  98   PPSIGNLTFLQKLILDNNNFNNKIPPELGRLRRLKYLNLSGNSFQGAFPMNLTHCSKLRT  157

Query  559  LDLYNNNLTGDLPVEVYKMTS  621
            L L++N L G++PVE+  +++
Sbjct  158  LSLFSNQLVGNVPVEIDSLST  178


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L G L  ++G L  L +L ++ N LSG +P  +     L  L ++NN+F    P  L+ +
Sbjct  510  LVGSLPQEIGALKNLGSLHVSRNMLSGNIPSTLGNCEILEILEMNNNLFQGIIPQALSNI  569

Query  544  ANLQVLDLYNNNLTGDLP  597
              LQ LDL  NNLTG +P
Sbjct  570  KGLQQLDLSYNNLTGSIP  587


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L G +   +G+L  L    ++ N+L+G +P  +  ++ ++ L L NN    + P  L  L
Sbjct  413  LIGSIPESIGKLARLELFGLSGNKLTGQIPSSVGNLTYMKRLFLFNNYLEGSIPRSLGNL  472

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
             +L +LDL +N+LTG +P E+  ++S
Sbjct  473  QHLFLLDLSHNHLTGTIPKEIISLSS  498



>gb|KJB59753.1| hypothetical protein B456_009G269700 [Gossypium raimondii]
Length=607

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 85/140 (61%), Gaps = 4/140 (3%)
 Frame = +1

Query  199  GVTEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLS  369
            G ++   LL +K++      S L  W  S+S   HC +  V CD    VV+L++S   L 
Sbjct  12   GYSDLEVLLKLKSSMIGPKASGLDDWEFSSSPSAHCHFSGVKCDEDHRVVALNVSFTPLY  71

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ-LAQLA  546
            G +SP++G L  LVNL+I+  +L+G +P ++  +++L+  N+SNN F  +FP + L  + 
Sbjct  72   GTISPEIGLLNKLVNLTISKVELTGNIPTDMRNLTSLKTFNISNNYFRGSFPGEILTGMT  131

Query  547  NLQVLDLYNNNLTGDLPVEV  606
             L++LD YNNN TG LPVE+
Sbjct  132  QLEILDAYNNNFTGLLPVEL  151


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            +SG + P +G L  L  L +A N+LSG +PP IS  ++L  ++ S N      P  + +L
Sbjct  448  ISGEIPPAIGNLRSLQVLELARNKLSGEIPPSISRCTSLTSIDFSQNSLSGEIPKGINKL  507

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
             +L  L++  N LTG++P E+  MTS
Sbjct  508  EHLSNLNVSRNRLTGEIPAEIENMTS  533



>gb|KJB69702.1| hypothetical protein B456_011G038400 [Gossypium raimondii]
Length=618

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 81/144 (56%), Gaps = 3/144 (2%)
 Frame = +1

Query  193  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  366
            P GV  E AAL+S+K     D +  +  W+I S   CTW  V C +   V+SL+++   L
Sbjct  31   PKGVNYEVAALMSVKRELR-DYKQVMDGWDINSVDPCTWNMVACSAEGFVISLEMASTGL  89

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  546
            SG+LSP +G L  L  + +  NQLSGP+P EI  +S L+ L+LS N F    P  L  L 
Sbjct  90   SGLLSPSIGNLSHLRTMLLQNNQLSGPIPDEIGKLSELQTLDLSGNHFVGAIPSTLGSLT  149

Query  547  NLQVLDLYNNNLTGDLPVEVYKMT  618
            +L  L L  NNL+G +P  V  +T
Sbjct  150  HLSYLRLSKNNLSGPIPRHVANLT  173



>gb|ADD64789.1| CLAVATA1 [Brassica napus]
Length=987

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 88/139 (63%), Gaps = 5/139 (4%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLSGV  375
            T+   LL++K++    +   L  W  S S   HC++  V+CD    V+SL++S   L G 
Sbjct  33   TDMDHLLTLKSSMVGPNGHGLHDWVRSPSPSAHCSFSGVSCDGDARVISLNVSFTPLFGT  92

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI-FGSTFPHQ-LAQLAN  549
            +SP++G L  LVNL++AAN  SG +P E+ ++++L+ LN+SNN+    TFP + L  + +
Sbjct  93   ISPEIGMLDRLVNLTLAANNFSGMLPLEMKSLTSLKVLNISNNVNLNGTFPGEILTPMVD  152

Query  550  LQVLDLYNNNLTGDLPVEV  606
            L+VLD YNNN TG LP E+
Sbjct  153  LEVLDAYNNNFTGPLPPEI  171


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG +  +V +L  L  ++ +AN L+G +P  IS  ++L  ++LS N  G   P  +  +
Sbjct  499  FSGNIPREVFELKHLTKINTSANNLTGDIPDSISRCTSLISVDLSRNRIGGDIPKDIHDV  558

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
             NL  L+L  N LTG +P+ + KMTS
Sbjct  559  INLGTLNLSGNQLTGSIPIGIGKMTS  584



>ref|NP_001238576.1| receptor protein kinase-like protein precursor [Glycine max]
 gb|AAF59905.1|AF197946_1 receptor protein kinase-like protein [Glycine max]
Length=981

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 89/139 (64%), Gaps = 6/139 (4%)
 Frame = +1

Query  205  TEQAALLSIKAAFTAD--SQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLS  369
            ++  ALL +K +   D     +L  W  STS   HC +  V+CD  L VV++++S + L 
Sbjct  27   SDMDALLKLKESMKGDRAKDDALHDWKFSTSLSAHCFFSGVSCDQELRVVAINVSFVPLF  86

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QLA  546
            G + P++G+L  L NL+I+ N L+G +P E++A+++L+ LN+S+N+F   FP ++   + 
Sbjct  87   GHVPPEIGELDKLENLTISQNNLTGELPKELAALTSLKHLNISHNVFSGYFPGKIILPMT  146

Query  547  NLQVLDLYNNNLTGDLPVE  603
             L+VLD+Y+NN TG LP E
Sbjct  147  ELEVLDVYDNNFTGSLPEE  165



>gb|AAT64032.1| putative leucine-rich repeat transmembrane protein [Gossypium 
hirsutum]
Length=618

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 81/144 (56%), Gaps = 3/144 (2%)
 Frame = +1

Query  193  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  366
            P GV  E AAL+S+K     D +  +  W+I S   CTW  V C +   V+SL+++   L
Sbjct  31   PKGVNYEVAALMSVKRELR-DYKQVMDGWDINSVDPCTWNMVACSAEGFVISLEMASTGL  89

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  546
            SG+LSP +G L  L  + +  NQLSGP+P EI  +S L+ L+LS N F    P  L  L 
Sbjct  90   SGLLSPSIGNLSHLRTMLLQNNQLSGPIPDEIGKLSELQTLDLSGNHFVGAIPSTLGSLT  149

Query  547  NLQVLDLYNNNLTGDLPVEVYKMT  618
            +L  L L  NNL+G +P  V  +T
Sbjct  150  HLSYLRLSKNNLSGPIPRHVANLT  173



>gb|AAP49010.1| CLV1-like receptor kinase [Brassica napus]
Length=978

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 88/139 (63%), Gaps = 5/139 (4%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLSGV  375
            T+   LL++K++    +   L  W  S S   HC++  V+CD    V+SL++S   L G 
Sbjct  33   TDMDHLLTLKSSMVGPNGHGLHDWVRSPSPSAHCSFSGVSCDGDARVISLNVSFTPLFGT  92

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI-FGSTFPHQ-LAQLAN  549
            +SP++G L  LVNL++AAN  SG +P E+ ++++L+ LN+SNN+    TFP + L  + +
Sbjct  93   ISPEIGMLDRLVNLTLAANNFSGMLPLEMKSLTSLKVLNISNNVNLNGTFPGEILTPMVD  152

Query  550  LQVLDLYNNNLTGDLPVEV  606
            L+VLD YNNN TG LP E+
Sbjct  153  LEVLDAYNNNFTGPLPPEI  171


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             SG +  +V +L  L  ++ +AN L+G +P  IS  ++L  ++LS N  G   P  +  +
Sbjct  499  FSGNIPREVFELKHLTKINTSANNLTGDIPDSISRCTSLISVDLSRNRIGGDIPKDIHDV  558

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
             NL  L+L  N LTG +P+ + KMTS
Sbjct  559  INLGTLNLSGNQLTGSIPIGIGKMTS  584



>ref|XP_002510557.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF52744.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=985

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 90/144 (63%), Gaps = 5/144 (3%)
 Frame = +1

Query  199  GVTEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglN-L  366
            G ++   LL +K++  A + S L  W  S S   HC++  VTCD    VVSL+L+  +  
Sbjct  25   GYSDAELLLKLKSSMIARNGSGLQDWEPSPSPSAHCSFSGVTCDKDSRVVSLNLTSRHGF  84

Query  367  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QL  543
             G + P++G L  LVNLSIA+  L+G +P E++ +++LR  N+SNN F   FP ++   +
Sbjct  85   FGFIPPEIGLLNKLVNLSIASLNLTGRLPLELAQLTSLRIFNISNNAFIGNFPGEITLVM  144

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
              LQ+LD+YNNN +G LP+E+ K+
Sbjct  145  TQLQILDIYNNNFSGLLPLELIKL  168


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NLSG + P +GQL  L +L +  N+LSG +PPE+S + +L+ L+LS N      P   ++
Sbjct  253  NLSGEIPPSLGQLKNLNSLFLQMNRLSGHIPPELSDLISLQSLDLSINSLKGEIPASFSK  312

Query  541  LANLQVLDLYNNNLTGDLP  597
            L N+ ++ L+ NNL G++P
Sbjct  313  LKNITLIHLFQNNLGGEIP  331


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +  ++  L +L  ++ +AN LSG +PP IS  ++L  ++ S N      P ++A L
Sbjct  493  LSGEIPNEIFNLKYLTAINFSANNLSGDIPPSISHCTSLTSVDFSRNNLHGQIPVEIANL  552

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
             +L +L++  N+LTG +P ++  MTS
Sbjct  553  KDLSILNVSQNHLTGQIPGDIRIMTS  578



>ref|XP_009614227.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Nicotiana tomentosiformis]
Length=1022

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 76/135 (56%), Gaps = 1/135 (1%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvsldlsglNLSGVLS  381
            T++ ALLSIK   T D    + SWN S  HC+W+ VTC      V  LDLS   L G + 
Sbjct  32   TDRLALLSIKGQITYDPFGVMYSWNDSFHHCSWQGVTCSKRHQRVTLLDLSSKQLVGTIV  91

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            P +G + FL  L++  N ++G +P EI  +  L+ L L+NN F    P +L+  + L  L
Sbjct  92   PHIGNMSFLRKLTLRNNTINGEIPQEIGRLFRLQNLELANNSFTGEIPVELSNCSRLIYL  151

Query  562  DLYNNNLTGDLPVEV  606
            DL  N LTG +PVE+
Sbjct  152  DLDGNRLTGKIPVEL  166


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 45/80 (56%), Gaps = 1/80 (1%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRF-LNLSNNIFGSTFPHQLA  537
            NL G +   +G    L  L ++ N+LSG +P E+ +IS L   L+LS N    T P ++ 
Sbjct  453  NLEGTIPSVLGNCQLLQMLYLSGNRLSGAIPKEVLSISALSIQLDLSGNQLSGTLPLEIG  512

Query  538  QLANLQVLDLYNNNLTGDLP  597
             L NL  LD+ +N L+G LP
Sbjct  513  SLVNLGYLDISDNKLSGKLP  532



>ref|XP_010054700.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Eucalyptus 
grandis]
Length=1018

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 76/140 (54%), Gaps = 2/140 (1%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll--hvvsldlsglNLSGVL  378
            T++  L S+K A   D   +L+SWN ST HC W+ V C       V SL L    L G L
Sbjct  31   TDRLVLTSLKNAIHKDPFGALSSWNDSTHHCEWQGVLCSKRHPGRVTSLVLRSQGLEGFL  90

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  558
            SP VG L FL  + +  N   G +PP+I  +  LR L LSNN FG   P  L+  +NL++
Sbjct  91   SPHVGNLSFLRVIFLQNNSFHGEIPPQIGNLLRLRVLILSNNSFGGPIPSNLSHCSNLEI  150

Query  559  LDLYNNNLTGDLPVEVYKMT  618
            L+L +N L G +  ++  +T
Sbjct  151  LNLIDNQLEGGIHSDLGSLT  170


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+  +   +G+L  L  L +  N+ +G +P  I  I++L  LNL++NIF    P  L   
Sbjct  402  LTDCIPHSIGELSNLHQLFLGGNRFTGEIPSSIGNITSLYGLNLASNIFQGHIPQSLGNC  461

Query  544  ANLQVLDLYNNNLTGDLPVEV  606
              L VLDL NNNL G +P+E+
Sbjct  462  RQLIVLDLSNNNLIGSIPIEI  482



>ref|XP_009391272.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=646

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 86/151 (57%), Gaps = 3/151 (2%)
 Frame = +1

Query  172  AGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsl  345
            + AG   P GV  E  AL+ +KA+   D  S L +W+  S   C+W  VTC     V+ L
Sbjct  42   SAAGVLSPKGVNYEVQALMGVKASL-KDPHSVLENWDQDSVDPCSWTMVTCSPENLVIGL  100

Query  346  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  525
                 NLSG LSP +G L  L  + +  N +SGP+P EI+ +S L+ L+LSNN F    P
Sbjct  101  GTPSQNLSGTLSPSIGNLTNLQIILLQNNNISGPIPQEIARLSNLKTLDLSNNNFNGEIP  160

Query  526  HQLAQLANLQVLDLYNNNLTGDLPVEVYKMT  618
              ++ L++LQ L L NN+L+G +P+ +  +T
Sbjct  161  TSISYLSSLQYLRLNNNSLSGAVPLSLTNLT  191



>ref|XP_008345324.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Malus 
domestica]
Length=1564

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 74/138 (54%), Gaps = 1/138 (1%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN-LSGVLSP  384
            ++ +LL+ KA    DS   L+SWN S   C W  +TC      V++     + L+G LSP
Sbjct  565  DRLSLLAFKAEIVTDSLGILSSWNESLHFCHWXGITCGRRHQRVTVLDLQSSXLAGHLSP  624

Query  385  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLD  564
             +G L FL  L +  N  S  + PEI  +  L  L L NN FG   P  ++  +NLQ LD
Sbjct  625  HIGNLSFLRALYLQNNSFSHTIXPEIGRLFRLEELFLHNNSFGGHIPFNISXCSNLQYLD  684

Query  565  LYNNNLTGDLPVEVYKMT  618
            LY N L+G+LP E+  ++
Sbjct  685  LYGNTLSGELPTEIASLS  702


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 49/86 (57%), Gaps = 2/86 (2%)
 Frame = +1

Query  364   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             L+G +   +G   F+++L ++ N LSGP+P ++  I+    LNLS N    + P +   L
Sbjct  986   LNGSIPQSLGDCRFMLDLDLSHNNLSGPIPKQV--INLPXHLNLSGNQLTESIPMEGGNL  1043

Query  544   ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              +L +LD+  N L+G++P  +   TS
Sbjct  1044  QHLVILDVSENKLSGEIPQSLGSCTS  1069


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 43/84 (51%), Gaps = 7/84 (8%)
 Frame = +1

Query  361  NLSGVLSPDVGQ--LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  534
            NL G L P +G    P L      +NQ +GPVP  IS  S L   ++S+N F    P  L
Sbjct  785  NLHGTLPPGLGHTIFPNLETFIFDSNQFTGPVPASISNASNLLVFSISSNKFTGKVP-SL  843

Query  535  AQLANLQVLDLYNNNL----TGDL  594
            A+L+NL    L+ NNL     GDL
Sbjct  844  ARLSNLYRFSLFKNNLGNNEEGDL  867



>ref|XP_011462029.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Fragaria vesca subsp. vesca]
Length=1114

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 81/141 (57%), Gaps = 2/141 (1%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSL-TSWNISTSHCTWRRVTC-dsllhvvsldlsglNLSGVL  378
            T+Q+ALL++K   T+D  + + T+W+ +T  C W  +TC      V  L++S   L+G +
Sbjct  30   TDQSALLALKPRITSDHHNMIFTNWSTTTPVCNWVGITCGARHHRVTHLNISYFGLAGTV  89

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  558
             P++G L FLV+L    N   G +P E++ +  L+F+N+ NN+F    P     LA LQ 
Sbjct  90   PPELGNLSFLVDLDFTNNSFYGSLPQELARLQRLKFINMGNNVFTGIIPSWFGSLAKLQA  149

Query  559  LDLYNNNLTGDLPVEVYKMTS  621
            L LY N  +G +P  ++ +++
Sbjct  150  LYLYGNKFSGSIPAAIFNLSA  170


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG++  + G L  LVNLS+A N+L GP+P  +    +L  L+LS N      P  L +L
Sbjct  648  LSGIIPNNFGSLQNLVNLSLANNKLEGPIPSSLGNALSLERLDLSKNNLYGVIPKSLEEL  707

Query  544  ANLQVLDLYNNNLTGDLP  597
            + L+ +++  N L G++P
Sbjct  708  SYLKYMNVSFNKLRGEIP  725


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            N+ G +  D+G L  L   ++  NQLSG +P  +  +  L+ L+LS N      P +L Q
Sbjct  502  NMRGEIPSDIGNLSSLTVFALGTNQLSGSIPTSMGRVQNLQALDLSYNKLQGHIPGELCQ  561

Query  541  LANLQVLDLYNNNLTGDLP  597
            L +L +LDL  N L+  +P
Sbjct  562  LQSLAILDLSGNQLSSSIP  580



>ref|XP_008791706.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Phoenix 
dactylifera]
Length=994

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 81/135 (60%), Gaps = 0/135 (0%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  381
            +T+Q ALLS K   T+D    L+SWN ST+ C W RV C++   V +LDL GL LSG +S
Sbjct  18   ITDQEALLSFKTLITSDPSDVLSSWNDSTTVCQWSRVLCNNKRRVSTLDLKGLGLSGSIS  77

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            P +G L  L  L +  N  +G +P ++  ++ L+ LN S+N+ G   P  +++ +NL  L
Sbjct  78   PHIGNLSALQFLYLQDNHFTGDLPDQLGNLARLQILNASSNLIGGAIPPNISKCSNLNTL  137

Query  562  DLYNNNLTGDLPVEV  606
            DL  N + G +P ++
Sbjct  138  DLALNTIYGKIPTDL  152


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 45/84 (54%), Gaps = 0/84 (0%)
 Frame = +1

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  549
            G +  D+G L  L  L +  N L+G +PP I  +S+L  LNL  N      P  L +L N
Sbjct  146  GKIPTDLGLLSELRVLKLGQNLLTGNIPPSIGNLSSLTTLNLGTNNLSGPIPSDLGRLQN  205

Query  550  LQVLDLYNNNLTGDLPVEVYKMTS  621
            LQ L +  N LTG +P  +Y ++S
Sbjct  206  LQELQISVNKLTGTVPPVLYNISS  229


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G L  D+G L  L+ L ++ N LSG +   I    ++  L++S+N F    P+ +  L
Sbjct  489  LTGPLPDDIGGLENLIALDLSNNLLSGKISDSIGNCRSMEVLSMSDNSFTGLIPNTIGNL  548

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              LQ LDL +N L+G +P  + K+ S
Sbjct  549  KGLQSLDLSSNKLSGSIPESMGKLRS  574


 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 45/87 (52%), Gaps = 1/87 (1%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-  537
            NLSG +  D+G+L  L  L I+ N+L+G VPP +  IS+L     ++N     FP  L  
Sbjct  191  NLSGPIPSDLGRLQNLQELQISVNKLTGTVPPVLYNISSLETFAFASNELHGEFPSDLGF  250

Query  538  QLANLQVLDLYNNNLTGDLPVEVYKMT  618
            +L  L V     N  TG  P  ++ +T
Sbjct  251  RLPKLLVFHFCFNKFTGQYPPSLHNIT  277


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 43/86 (50%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            +SG +  ++G+L  L  L +A N+L G +P     +S L  L L  N    T P   ++ 
Sbjct  392  ISGEIPAEIGRLKELRILGLAGNKLLGEIPAAFGNLSMLIHLELYGNELEGTIPATFSEF  451

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L  LDL  N L G +P E + +TS
Sbjct  452  QKLLSLDLSTNRLNGSIPREPFTLTS  477



>ref|XP_003571896.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 [Brachypodium distachyon]
Length=625

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 84/155 (54%), Gaps = 7/155 (5%)
 Frame = +1

Query  169  SAGAGAGKP----LGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsll  330
            + G  AG P     G+  E AAL+++K     D +  +  W+I S   CTW  V C    
Sbjct  24   AGGVAAGDPPLSPKGLNYEVAALMAVKNRMR-DEKGVMAGWDINSVDPCTWSMVACSPEG  82

Query  331  hvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIF  510
             VVSL ++   LSG LSP +G L +L  + +  N++SG +PPEI  ++ L+ L++S N F
Sbjct  83   FVVSLQMANNGLSGALSPSIGNLSYLQTMLLQNNKISGGIPPEIGKLANLKALDISGNQF  142

Query  511  GSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKM  615
                P  L QL  L  L L  NNL+G +P +V K+
Sbjct  143  VGEIPSSLGQLTRLNYLRLDKNNLSGQIPTDVAKL  177



>gb|EEC66712.1| hypothetical protein OsI_33040 [Oryza sativa Indica Group]
Length=964

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 70/138 (51%), Gaps = 3/138 (2%)
 Frame = +1

Query  202  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN---LSG  372
            V ++ ALLS K+  +  S   L SWN S  +C W  V C        +    +N   LSG
Sbjct  32   VVDELALLSFKSMLSGPSDGLLASWNTSIHYCDWTGVVCSGRRQPERVVALLMNSSSLSG  91

Query  373  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  552
             +SP +G L FL  L +  N   G +P E+  +S LR LNLS N    + P  L +  NL
Sbjct  92   RISPFLGNLSFLNRLDLHGNGFIGQIPSELGHLSRLRVLNLSTNSLDGSIPVALGRCTNL  151

Query  553  QVLDLYNNNLTGDLPVEV  606
             VLDL +N L G +P EV
Sbjct  152  TVLDLSSNKLRGKIPTEV  169


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL G +  ++G L  LV     +N+LSG +P  +     LR L L NN    + P  L+Q
Sbjct  450  NLEGPIPQEIGNLKNLVEFHAYSNRLSGEIPSTLGECKLLRNLYLQNNDLTGSIPSLLSQ  509

Query  541  LANLQVLDLYNNNLTGDLP  597
            L  L+ LDL +NNL+G +P
Sbjct  510  LKGLENLDLSSNNLSGQVP  528


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L G +  +VG L  LV+L +  N LSG +P  IS + ++ +L L +N F    P  L  L
Sbjct  161  LRGKIPTEVGALENLVDLRLHKNGLSGEIPLHISNLLSVEYLYLRDNWFSGEIPPALGNL  220

Query  544  ANLQVLDLYNNNLTGDLP  597
              L+ LDL +N L+G +P
Sbjct  221  TKLRYLDLASNKLSGSIP  238


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  421  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPV  600
            ++ N+++G +P +I  + +L+ ++LSNN F  T P  L++L  LQ L +Y+NN++G +P 
Sbjct  325  LSVNEITGSIPKDIGNLISLQQIDLSNNYFIGTLPSSLSRLNKLQALSVYSNNISGLVPS  384

Query  601  EVYKMT  618
             +  +T
Sbjct  385  TIGNLT  390


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = +1

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  549
            G L   + +L  L  LS+ +N +SG VP  I  ++ + +L+L +N F  + P  L  + N
Sbjct  356  GTLPSSLSRLNKLQALSVYSNNISGLVPSTIGNLTEMNYLDLDSNAFSGSIPSTLGNMTN  415

Query  550  LQVLDLYNNNLTGDLPVEV  606
            L  L L +NN  G +P+ +
Sbjct  416  LLALGLSDNNFIGRIPIGI  434



>ref|XP_009391273.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=642

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 86/151 (57%), Gaps = 3/151 (2%)
 Frame = +1

Query  172  AGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsl  345
            + AG   P GV  E  AL+ +KA+   D  S L +W+  S   C+W  VTC     V+ L
Sbjct  42   SAAGVLSPKGVNYEVQALMGVKASL-KDPHSVLENWDQDSVDPCSWTMVTCSPENLVIGL  100

Query  346  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  525
                 NLSG LSP +G L  L  + +  N +SGP+P EI+ +S L+ L+LSNN F    P
Sbjct  101  GTPSQNLSGTLSPSIGNLTNLQIILLQNNNISGPIPQEIARLSNLKTLDLSNNNFNGEIP  160

Query  526  HQLAQLANLQVLDLYNNNLTGDLPVEVYKMT  618
              ++ L++LQ L L NN+L+G +P+ +  +T
Sbjct  161  TSISYLSSLQYLRLNNNSLSGAVPLSLTNLT  191



>ref|XP_010907375.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Elaeis guineensis]
Length=1146

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 76/139 (55%), Gaps = 2/139 (1%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLS--GVLS  381
            E+ ALL+ KAA T D + SL SWN + S C W  V+C        + L   ++S  G +S
Sbjct  37   ERLALLAFKAAITHDPKGSLKSWNGTKSICRWAGVSCSPRHQERVVALVLDSMSLGGSIS  96

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            P VG L FL  L +  N L G +P +I  +  L+ LNLS N  G   P  L+Q  NL  L
Sbjct  97   PSVGNLTFLARLHLPGNSLGGVIPSDIGRLRHLKDLNLSFNALGGPIPPSLSQCRNLLHL  156

Query  562  DLYNNNLTGDLPVEVYKMT  618
            DL  N L G++P+++  ++
Sbjct  157  DLTENLLLGNIPIQLGSLS  175


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L G + P +G L  LV L+++ N L G +PP  + + +LR+L+LS+N      P  L ++
Sbjct  211  LIGEMPPSLGNLSSLVYLNLSTNSLVGAIPPSFTDLLSLRYLDLSSNGLAGGIPSSLGRI  270

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
              L VL L +NNLTG +P  V  + S
Sbjct  271  QALSVLILASNNLTGIIPPSVGALKS  296


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 48/84 (57%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G + P +G L  L  L +++N+L G +PP +  +S+L +LNLS N      P     L
Sbjct  187  LAGAIPPSLGNLSSLQQLDLSSNRLIGEMPPSLGNLSSLVYLNLSTNSLVGAIPPSFTDL  246

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
             +L+ LDL +N L G +P  + ++
Sbjct  247  LSLRYLDLSSNGLAGGIPSSLGRI  270


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 40/78 (51%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L G L   VG+L  L  L+I+ N+LSG +P  I     L +L L  N F    P  L  L
Sbjct  628  LDGPLPTSVGKLQNLQLLNISHNRLSGEIPTTIGDCQVLEYLYLEGNFFQGFIPSSLDHL  687

Query  544  ANLQVLDLYNNNLTGDLP  597
              + VLDL  NNL+G  P
Sbjct  688  KGITVLDLSLNNLSGPFP  705


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 43/77 (56%), Gaps = 1/77 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQ-LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            LSG +S D+G  LP L+ L++  NQL GP+P  ++  S L+ ++L  N F    P  L  
Sbjct  379  LSGTVSLDIGNALPNLLQLNLVRNQLEGPIPISLANASGLQLIDLGGNKFSGGIPENLGS  438

Query  541  LANLQVLDLYNNNLTGD  591
            L +L  L L+ N L  +
Sbjct  439  LQHLSWLSLWGNRLKAE  455



>ref|XP_010935096.1| PREDICTED: leucine-rich repeat receptor-like kinase protein FLORAL 
ORGAN NUMBER1 [Elaeis guineensis]
Length=987

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 80/133 (60%), Gaps = 1/133 (1%)
 Frame = +1

Query  220  LLSIKAAFTADSQSSLTSWNIST-SHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQ  396
            L+ +K      + + L  W+ S  +HC++  VTCD+   VV+L++S +     L P++G 
Sbjct  30   LMKLKDGLHGPAGNDLHDWDPSGPTHCSFSGVTCDADARVVALNVSYIRFHRPLPPEIGL  89

Query  397  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  576
            L  LVNL++A N L+G +PPEI A+  LRFLN+SNN F   FP        L VLD YNN
Sbjct  90   LDRLVNLTVACNFLTGQLPPEIGALPALRFLNISNNNFTGRFPDVDGGFPALVVLDAYNN  149

Query  577  NLTGDLPVEVYKM  615
            N +G LP+ + K+
Sbjct  150  NFSGPLPLGLAKL  162


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            +L+G + PD+G L  L +L ++ N+L+G +P   + +  L+ LNL  N F    P  +A 
Sbjct  271  HLTGSIPPDLGGLDRLQSLDLSINELTGELPESFAGLKQLKLLNLFRNHFRGRIPPFIAD  330

Query  541  LANLQVLDLYNNNLTGDLP  597
            L NL+VL L+ NN T +LP
Sbjct  331  LPNLEVLQLWENNFTFELP  349


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NLSG +   +GQL  L +L +  N L+G +PP++  +  L+ L+LS N      P   A 
Sbjct  247  NLSGRIPASLGQLKLLDSLFLQWNHLTGSIPPDLGGLDRLQSLDLSINELTGELPESFAG  306

Query  541  LANLQVLDLYNNNLTGDLP  597
            L  L++L+L+ N+  G +P
Sbjct  307  LKQLKLLNLFRNHFRGRIP  325



>ref|XP_010064793.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Eucalyptus 
grandis]
Length=665

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 75/136 (55%), Gaps = 2/136 (1%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl--lhvvsldlsglNLSGVL  378
            T++ AL+  K +   DS   L+SWN S+ HC W  + C       V SL+L    L G+L
Sbjct  29   TDRLALIYFKDSVDEDSLEVLSSWNDSSHHCEWPGIVCGGRHPKRVTSLNLMSKGLGGLL  88

Query  379  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  558
            SP VG L FL +L +  N   G +P  I  +  LR L LSNN F    P  L+Q +NL+V
Sbjct  89   SPHVGNLSFLRSLVLQNNSFHGKIPQSIGHLFRLRHLVLSNNSFSGQMPTNLSQCSNLEV  148

Query  559  LDLYNNNLTGDLPVEV  606
            L+L +N L G +P E+
Sbjct  149  LNLIDNQLVGKIPDEL  164


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG LS  VG L  L+ L ++ N+L GP+P  I+    L  L+L+ N F    P  L  L
Sbjct  497  LSGSLSSQVGSLTDLLELDLSYNKLMGPIPSSINECLLLGRLSLAVNSFHGEIPSALGTL  556

Query  544  ANLQVLDLYNNNLTGDLP  597
              LQ LD+ +N+L+G++P
Sbjct  557  QGLQELDVSHNDLSGEIP  574



>emb|CDP10862.1| unnamed protein product [Coffea canephora]
Length=677

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 71/134 (53%), Gaps = 1/134 (1%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldl-sglNLSGVLS  381
            T++ ALL  K     D    L SWN S  HC W+ VTC +L   V+       +LSG +S
Sbjct  43   TDRLALLEFKRQIYDDPFGVLNSWNHSQHHCQWQGVTCSTLHQRVTALTLRDKHLSGTIS  102

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            P VG L F+  + +A NQ  G +P E   +  LR LNLS+N  G   P  L+  + + V+
Sbjct  103  PHVGNLSFMRFIHLAENQFQGEIPKEFGRLFRLRVLNLSSNALGGKIPANLSYCSEMIVI  162

Query  562  DLYNNNLTGDLPVE  603
             L +N L G +P++
Sbjct  163  SLESNRLEGKIPID  176


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 43/77 (56%), Gaps = 0/77 (0%)
 Frame = +1

Query  385  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLD  564
            D+  L  LV+  ++ NQ SG +P   +    L  L +  N F  T P  LA L ++Q LD
Sbjct  346  DLDFLKNLVDFVVSRNQFSGDIPISFADCKNLENLYMQANFFQGTIPPNLASLKSIQQLD  405

Query  565  LYNNNLTGDLPVEVYKM  615
            L +NNLTG +P E+ K+
Sbjct  406  LSSNNLTGPIPKELEKL  422



>ref|NP_001238004.1| receptor protein kinase-like protein precursor [Glycine max]
 gb|AAF59906.1|AF197947_1 receptor protein kinase-like protein [Glycine max]
 gb|AAN74865.1| nodule autoregulation receptor-like protein kinase precursor 
[Glycine max]
Length=987

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 87/139 (63%), Gaps = 6/139 (4%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADS--QSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLS  369
            T+  +LL +K +   D     +L  W    S   HC +  V CD  L VV++++S + L 
Sbjct  27   TDMESLLKLKDSMKGDKAKDDALHDWKFFPSLSAHCFFSGVKCDRELRVVAINVSFVPLF  86

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QLA  546
            G L P++GQL  L NL+++ N L+G +P E++A+++L+ LN+S+N+F   FP Q+   + 
Sbjct  87   GHLPPEIGQLDKLENLTVSQNNLTGVLPKELAALTSLKHLNISHNVFSGHFPGQIILPMT  146

Query  547  NLQVLDLYNNNLTGDLPVE  603
             L+VLD+Y+NN TG LPVE
Sbjct  147  KLEVLDVYDNNFTGPLPVE  165


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 46/87 (53%), Gaps = 1/87 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQ-LSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            LSG +   + +L  L  L +  N    G +PPE  ++ +LR+L+LS+       P  LA 
Sbjct  206  LSGKIPKSLSKLKTLRYLKLGYNNAYEGGIPPEFGSMKSLRYLDLSSCNLSGEIPPSLAN  265

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            L NL  L L  NNLTG +P E+  M S
Sbjct  266  LTNLDTLFLQINNLTGTIPSELSAMVS  292


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             SG +     +   L  LS++ N LSG +P  +S + TLR+L L  NN +    P +   
Sbjct  182  FSGSIPESYSEFKSLEFLSLSTNSLSGKIPKSLSKLKTLRYLKLGYNNAYEGGIPPEFGS  241

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            + +L+ LDL + NL+G++P  +  +T+
Sbjct  242  MKSLRYLDLSSCNLSGEIPPSLANLTN  268



>dbj|BAC41332.1| LRR receptor-like kinase [Glycine max]
Length=1001

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 87/139 (63%), Gaps = 6/139 (4%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADS--QSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLS  369
            T+  +LL +K +   D     +L  W    S   HC +  V CD  L VV++++S + L 
Sbjct  41   TDMESLLKLKDSMKGDKAKDDALHDWKFFPSLSAHCFFSGVKCDRELRVVAINVSFVPLF  100

Query  370  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QLA  546
            G L P++GQL  L NL+++ N L+G +P E++A+++L+ LN+S+N+F   FP Q+   + 
Sbjct  101  GHLPPEIGQLDKLENLTVSQNNLTGVLPKELAALTSLKHLNISHNVFSGHFPGQIILPMT  160

Query  547  NLQVLDLYNNNLTGDLPVE  603
             L+VLD+Y+NN TG LPVE
Sbjct  161  KLEVLDVYDNNFTGPLPVE  179


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 46/87 (53%), Gaps = 1/87 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQ-LSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            LSG +   + +L  L  L +  N    G +PPE  ++ +LR+L+LS+       P  LA 
Sbjct  220  LSGKIPKSLSKLKTLRYLKLGYNNAYEGGIPPEFGSMKSLRYLDLSSCNLSGEIPPSLAN  279

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            L NL  L L  NNLTG +P E+  M S
Sbjct  280  LTNLDTLFLQINNLTGTIPSELSAMVS  306


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  540
             SG +     +   L  LS++ N LSG +P  +S + TLR+L L  NN +    P +   
Sbjct  196  FSGSIPESYSEFKSLEFLSLSTNSLSGKIPKSLSKLKTLRYLKLGYNNAYEGGIPPEFGS  255

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            + +L+ LDL + NL+G++P  +  +T+
Sbjct  256  MKSLRYLDLSSCNLSGEIPPSLANLTN  282



>emb|CCF03508.1| receptor kinase [Arabidopsis lyrata]
Length=1162

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 79/137 (58%), Gaps = 2/137 (1%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSWNISTS--HCTWRRVTCdsllhvvsldlsglNLSGVLS  381
            E  AL S K+  ++D    L+ W I+ S  HC W  +TCDS  HVVS+ L    L GVLS
Sbjct  30   EIEALRSFKSGISSDPLGVLSDWTITGSVRHCNWTGITCDSTGHVVSVSLLEKQLEGVLS  89

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            P +  L +L  L + +N  +G +P EI  ++ L  L+L  N F  + P+++ +L NL  L
Sbjct  90   PAIANLTYLQVLDLTSNNFTGEIPAEIGKLTELNELSLYLNYFSGSIPYEIWELKNLMSL  149

Query  562  DLYNNNLTGDLPVEVYK  612
            DL NN LTGD+P  + K
Sbjct  150  DLRNNLLTGDVPKAICK  166


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            LSG +   VG L  L NL ++ NQL+G +P EI  +  ++ L L +N+     P ++   
Sbjct  204  LSGSIPVTVGTLVNLTNLDLSGNQLTGRIPREIGNLLNIQALVLFDNLLEGEIPAEIGNC  263

Query  544  ANLQVLDLYNNNLTGDLPVEV  606
              L  L+LY N LTG +P E+
Sbjct  264  TTLIDLELYGNQLTGRIPAEL  284


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 50/87 (57%), Gaps = 0/87 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL+  L   + +L  L  L ++ NQL GP+P EI ++ +L+ L L +N     FP  +  
Sbjct  299  NLNSSLPSSLFRLTRLRYLGLSENQLVGPIPEEIGSLKSLQVLTLHSNNLTGEFPQSITN  358

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            L NL V+ +  N ++G+LP ++  +T+
Sbjct  359  LRNLTVMTMGFNYISGELPADLGLLTN  385


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            +SG L  D+G L  L NLS   N L+GP+P  IS  + L+ L+LS N      P  L  L
Sbjct  372  ISGELPADLGLLTNLRNLSAHDNHLTGPIPSSISNCTGLKLLDLSFNKMTGKIPWGLGSL  431

Query  544  ANLQVLDLYNNNLTGDLPVEVY  609
             NL  L L  N  TG++P +++
Sbjct  432  -NLTALSLGPNRFTGEIPDDIF  452


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 47/84 (56%), Gaps = 0/84 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G +  ++G L  L  L +  N L+  +P  +  ++ LR+L LS N      P ++  L
Sbjct  276  LTGRIPAELGNLVQLEALRLYGNNLNSSLPSSLFRLTRLRYLGLSENQLVGPIPEEIGSL  335

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
             +LQVL L++NNLTG+ P  +  +
Sbjct  336  KSLQVLTLHSNNLTGEFPQSITNL  359


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 39/66 (59%), Gaps = 0/66 (0%)
 Frame = +1

Query  415  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  594
            L+ + N L+G +P E+  +  ++ ++ SNN+F  + P  L    N+  LD   NNL+G +
Sbjct  630  LNFSNNLLTGTIPNELGKLEMVQEIDFSNNLFSGSIPRSLQACKNVFTLDFSRNNLSGQI  689

Query  595  PVEVYK  612
            P EV++
Sbjct  690  PDEVFQ  695



>ref|XP_006435205.1| hypothetical protein CICLE_v10000156mg [Citrus clementina]
 gb|ESR48445.1| hypothetical protein CICLE_v10000156mg [Citrus clementina]
Length=982

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 88/143 (62%), Gaps = 4/143 (3%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLSGV  375
            ++   LL +K++      S L +W  S+S   HC++  VTCD    VVSL++S + L G 
Sbjct  27   SDMDVLLKLKSSMIGPKGSGLKNWEPSSSPSAHCSFSGVTCDQDSRVVSLNVSFMPLFGS  86

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANL  552
            + P++G L  LVNL+I+   L+G +P E++ +++L+  N+S N+F   F  Q+ + +  L
Sbjct  87   IPPEIGLLTKLVNLTISNVNLTGRLPSEMALLTSLKVFNISGNVFQGNFAGQIVRGMTEL  146

Query  553  QVLDLYNNNLTGDLPVEVYKMTS  621
            QVLD YNNN TG LPVE+  + S
Sbjct  147  QVLDAYNNNFTGPLPVEIASLKS  169


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            N+SG +   + +L  L +L +  N+L+G +PP++S + +L+ L+LS N      P   A 
Sbjct  252  NISGEIPTSLSRLKLLHSLFLQMNKLTGHIPPQLSGLISLKSLDLSLNYLTGEIPESFAA  311

Query  541  LANLQVLDLYNNNLTGDLP  597
            L NL +L L+ NNL G +P
Sbjct  312  LKNLTLLQLFKNNLRGPIP  330


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            N+SG +   + Q   L ++ ++ N L G +PP IS +  L  LNLS N    + P+++  
Sbjct  515  NISGEIPYSISQCHSLTSVDLSRNSLYGKIPPGISKLLDLSILNLSRNGITGSIPNEMRN  574

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  LDL  NNL G++P
Sbjct  575  MMSLTTLDLSYNNLIGNIP  593



>ref|XP_002308597.2| hypothetical protein POPTR_0006s25380g [Populus trichocarpa]
 ref|XP_006382045.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE92120.2| hypothetical protein POPTR_0006s25380g [Populus trichocarpa]
 gb|ERP59842.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=971

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 85/138 (62%), Gaps = 3/138 (2%)
 Frame = +1

Query  208  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPD  387
            E   LLS K++   D    L++WN S + C W+ +TC +   +  ++LSG N+SG +S  
Sbjct  36   ELELLLSFKSSLN-DPLKYLSNWNPSATFCKWQGITCTNSSRITVIELSGKNISGKISSS  94

Query  388  VGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDL  567
            + QLP++  + +++NQLSG +P +I + S+LRFLNLSNN F    P+    +  L+ LDL
Sbjct  95   IFQLPYIQTIDLSSNQLSGKLPDDIFSSSSLRFLNLSNNNFTGPIPN--GSIFLLETLDL  152

Query  568  YNNNLTGDLPVEVYKMTS  621
             NN L+G +P E+   +S
Sbjct  153  SNNMLSGKIPQEIGSFSS  170


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL+G +   +G L  L  L +  N L+GP+P  I  ++ L  L+LS+N      P  + +
Sbjct  252  NLTGQIPSSLGNLSNLQYLFLYQNMLAGPIPKSIFGLTKLISLDLSDNSLSGEIPELIIK  311

Query  541  LANLQVLDLYNNNLTGDLPV  600
            L NL++L L++NN TG +PV
Sbjct  312  LKNLEILHLFSNNFTGKIPV  331


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NLSG +  ++GQL  L +L +  N L+G +P  +  +S L++L L  N+     P  +  
Sbjct  228  NLSGEIPIELGQLTSLNHLDLVYNNLTGQIPSSLGNLSNLQYLFLYQNMLAGPIPKSIFG  287

Query  541  LANLQVLDLYNNNLTGDLPVEVYKM  615
            L  L  LDL +N+L+G++P  + K+
Sbjct  288  LTKLISLDLSDNSLSGEIPELIIKL  312


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 46/85 (54%), Gaps = 0/85 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L G +  ++GQ+  L  + +  N LSG +P E+  +++L  L+L  N      P  L  L
Sbjct  205  LVGQIPSELGQMRSLKWIYLGYNNLSGEIPIELGQLTSLNHLDLVYNNLTGQIPSSLGNL  264

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMT  618
            +NLQ L LY N L G +P  ++ +T
Sbjct  265  SNLQYLFLYQNMLAGPIPKSIFGLT  289


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 44/77 (57%), Gaps = 7/77 (9%)
 Frame = +1

Query  388  VGQLPFLVN-------LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  546
            VG++P  V        L++A+NQL G +P E+  + +L+++ L  N      P +L QL 
Sbjct  182  VGKIPLSVTNLTSLEVLTLASNQLVGQIPSELGQMRSLKWIYLGYNNLSGEIPIELGQLT  241

Query  547  NLQVLDLYNNNLTGDLP  597
            +L  LDL  NNLTG +P
Sbjct  242  SLNHLDLVYNNLTGQIP  258


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G +   +  L  L++L ++ N LSG +P  I  +  L  L+L +N F    P  L+ L
Sbjct  277  LAGPIPKSIFGLTKLISLDLSDNSLSGEIPELIIKLKNLEILHLFSNNFTGKIPVALSSL  336

Query  544  ANLQVLDLYNNNLTGDLPVEVYK  612
              LQ+L L++N L+G++P ++ K
Sbjct  337  PRLQILQLWSNKLSGEIPKDLGK  359



>ref|XP_011074693.1| PREDICTED: receptor protein kinase CLAVATA1-like [Sesamum indicum]
Length=976

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = +1

Query  292  HCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAI  471
            HC++  VTCD+   V SL+++ L L G L P++G L  LVNL++A N L+GP+P E+S +
Sbjct  58   HCSFSGVTCDADFRVTSLNVTNLPLLGTLPPEIGLLDKLVNLTLAGNNLTGPLPKELSKL  117

Query  472  STLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNNNLTGDLPVE  603
              L+++NLS N+F  TFP ++   L+ L+V D+YNNN +G+LPV+
Sbjct  118  IALKYVNLSWNMFNGTFPGEIVVNLSELEVFDVYNNNFSGELPVQ  162


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL+G +  ++  L  L++L ++ N LSG +P + + +  L  LNL  N F    P  +  
Sbjct  275  NLTGEIPSELSGLVSLMSLDLSINYLSGEIPAKFAELKNLTLLNLFQNKFQGPLPGFIGD  334

Query  541  LANLQVLDLYNNNLTGDLP  597
            L NL+VL ++NNN T +LP
Sbjct  335  LPNLEVLQIWNNNFTLELP  353


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 44/86 (51%), Gaps = 1/86 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
             +G +     +LP L  L +  N  +G +P EISA S L  + LSNN      P  +  L
Sbjct  420  FNGTIPAGFFRLPSLDMLELNDNYFTGELPKEISA-SMLGNIALSNNWIMGRIPKAIGNL  478

Query  544  ANLQVLDLYNNNLTGDLPVEVYKMTS  621
             NLQ+L L  N L GD+P E++ +  
Sbjct  479  TNLQILSLDMNKLYGDIPSEIFTLKK  504


 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 45/87 (52%), Gaps = 1/87 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            L+G +   + ++P L  L +   N   G +PPE  +ISTLR L+L         P  L  
Sbjct  203  LTGKIPSSLARIPNLQELYLGYYNTYEGGIPPEFGSISTLRLLDLGMCNLTGEIPASLGN  262

Query  541  LANLQVLDLYNNNLTGDLPVEVYKMTS  621
            L +L  L L  NNLTG++P E+  + S
Sbjct  263  LKHLHSLFLQVNNLTGEIPSELSGLVS  289



>emb|CDX92460.1| BnaA10g14990D [Brassica napus]
Length=838

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 76/140 (54%), Gaps = 1/140 (1%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldl-sglNLSGVLS  381
            T+  ALL  K+    ++   L+SWN S+  C+W  VTC      V      G  L+GV+S
Sbjct  29   TDMKALLEFKSQAAENNTEVLSSWNSSSPLCSWTGVTCGRKRERVVSLDLGGFKLAGVIS  88

Query  382  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  561
            P +G L FL  L++A N  +  +P E+  +  L++LN+S N+     PH+L  L+ L +L
Sbjct  89   PSIGNLSFLRVLNLADNSFTSTIPGEVGMLFRLQYLNMSFNLLQGRIPHKLGSLSKLVIL  148

Query  562  DLYNNNLTGDLPVEVYKMTS  621
             L  NNLTG  P  +  +TS
Sbjct  149  SLATNNLTGKFPASLGNLTS  168


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 44/81 (54%), Gaps = 0/81 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            NL+G     +G L  L  L  A N++ G +P +++ +  L F  +S N F   FPH L  
Sbjct  154  NLTGKFPASLGNLTSLQKLDFAYNEMEGEIPYDVARLRQLVFFQISQNGFSGVFPHALYN  213

Query  541  LANLQVLDLYNNNLTGDLPVE  603
            +++L+ L L  N+ TG+L  +
Sbjct  214  ISSLESLSLGGNSFTGNLRAD  234


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
              G +   +G    L++L I  N+L+G +P EI  I +L FL+LSNN+   +FP ++ +L
Sbjct  340  FQGRIPKSIGGCRNLLDLWIDTNKLNGSIPREILQIPSLAFLDLSNNVLTGSFPEEVGKL  399

Query  544  ANLQVLDLYNNNLTGDLP  597
              L  L   +N L+G +P
Sbjct  400  ELLVGLAASDNKLSGRIP  417


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 46/84 (55%), Gaps = 1/84 (1%)
 Frame = +1

Query  364  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  543
            L+G    +VG+L  LV L+ + N+LSG +P  +    +L FL L  N F    P  +++L
Sbjct  388  LTGSFPEEVGKLELLVGLAASDNKLSGRIPQTLGGFLSLEFLYLQGNSFEGAVP-DISRL  446

Query  544  ANLQVLDLYNNNLTGDLPVEVYKM  615
             +L  +D   NNL+G +P  + K 
Sbjct  447  VSLSNVDFSRNNLSGRIPQYLAKF  470



>ref|XP_006473681.1| PREDICTED: receptor protein kinase CLAVATA1-like [Citrus sinensis]
Length=982

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 88/143 (62%), Gaps = 4/143 (3%)
 Frame = +1

Query  205  TEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLSGV  375
            ++   LL +K++      S L +W  S+S   HC++  VTCD    VVSL++S + L G 
Sbjct  27   SDMDVLLKLKSSMIGPKGSGLKNWEPSSSPSAHCSFSGVTCDQDSRVVSLNVSFMPLFGS  86

Query  376  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANL  552
            + P++G L  LVNL+I+   L+G +P E++ +++L+  N+S N+F   F  Q+ + +  L
Sbjct  87   IPPEIGLLTKLVNLTISNVNLTGRLPSEMALLTSLKVFNISGNVFQGNFAGQIVRGMTEL  146

Query  553  QVLDLYNNNLTGDLPVEVYKMTS  621
            QVLD YNNN TG LPVE+  + S
Sbjct  147  QVLDAYNNNFTGPLPVEIASLKS  169


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            N+SG +   + QL  L +L +  N+L+G +PP++S + +L+ L+LS N      P   A 
Sbjct  252  NISGEIPTSLSQLKLLHSLFLQMNKLTGHIPPQLSGLISLKSLDLSLNYLTGEIPESFAA  311

Query  541  LANLQVLDLYNNNLTGDLP  597
            L NL +L L+ NNL G +P
Sbjct  312  LKNLTLLQLFKNNLRGPIP  330


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +1

Query  361  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  540
            N+SG +   + Q   L ++ ++ N L G +PP IS +  L  LNLS N    + P+++  
Sbjct  515  NISGEIPYSISQCHSLTSVDLSRNSLYGKIPPGISKLIDLSILNLSRNGITGSIPNEMRN  574

Query  541  LANLQVLDLYNNNLTGDLP  597
            + +L  LDL  NNL G++P
Sbjct  575  MMSLTTLDLSYNNLIGNIP  593



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950