BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS033F04

Length=620
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010323248.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    253   1e-76   
gb|AAB37246.1|  calmodulin-binding protein                              248   3e-75   Nicotiana tabacum [American tobacco]
emb|CDP02958.1|  unnamed protein product                                226   4e-66   Coffea canephora [robusta coffee]
ref|XP_006453423.1|  hypothetical protein CICLE_v10007720mg             224   2e-65   
ref|XP_011079310.1|  PREDICTED: uncharacterized protein LOC105162855    222   1e-64   Sesamum indicum [beniseed]
gb|KDP22927.1|  hypothetical protein JCGZ_01764                         220   4e-64   Jatropha curcas
gb|KDO62470.1|  hypothetical protein CISIN_1g006542mg                   218   4e-63   Citrus sinensis [apfelsine]
ref|XP_007014160.1|  Calmodulin-binding protein isoform 1               215   4e-62   
ref|XP_002526232.1|  calmodulin binding protein, putative               211   8e-62   
gb|KDO62471.1|  hypothetical protein CISIN_1g006542mg                   213   3e-61   Citrus sinensis [apfelsine]
ref|XP_007014163.1|  Calmodulin-binding protein isoform 4               213   3e-61   
ref|XP_010047003.1|  PREDICTED: uncharacterized protein LOC104435...    209   4e-60   Eucalyptus grandis [rose gum]
gb|KJB83411.1|  hypothetical protein B456_013G246400                    209   6e-60   Gossypium raimondii
gb|KHG27572.1|  Cytochrome P450                                         204   6e-58   Gossypium arboreum [tree cotton]
ref|XP_006366189.1|  PREDICTED: uncharacterized protein LOC102581064    203   1e-57   
ref|XP_010103014.1|  hypothetical protein L484_022898                   202   3e-57   Morus notabilis
ref|XP_002325070.1|  calmodulin-binding family protein                  198   1e-55   Populus trichocarpa [western balsam poplar]
ref|XP_010259794.1|  PREDICTED: uncharacterized protein LOC104599111    197   3e-55   
ref|XP_011044001.1|  PREDICTED: uncharacterized protein LOC105139309    195   1e-54   Populus euphratica
ref|XP_011018189.1|  PREDICTED: uncharacterized protein LOC105121292    193   5e-54   Populus euphratica
ref|XP_010265460.1|  PREDICTED: uncharacterized protein LOC104603...    189   6e-53   Nelumbo nucifera [Indian lotus]
ref|XP_010265459.1|  PREDICTED: uncharacterized protein LOC104603...    189   7e-53   Nelumbo nucifera [Indian lotus]
ref|XP_010265458.1|  PREDICTED: uncharacterized protein LOC104603...    190   7e-53   
ref|XP_010265456.1|  PREDICTED: uncharacterized protein LOC104603...    190   8e-53   Nelumbo nucifera [Indian lotus]
ref|XP_008453624.1|  PREDICTED: uncharacterized protein LOC103494282    189   1e-52   Cucumis melo [Oriental melon]
gb|KJB22129.1|  hypothetical protein B456_004G031000                    189   2e-52   Gossypium raimondii
ref|XP_004146305.1|  PREDICTED: uncharacterized protein LOC101216741    186   3e-51   Cucumis sativus [cucumbers]
gb|KHG10046.1|  Protein very KIND                                       185   3e-51   Gossypium arboreum [tree cotton]
ref|XP_004507834.1|  PREDICTED: uncharacterized protein LOC101488...    181   9e-50   
ref|XP_004507832.1|  PREDICTED: uncharacterized protein LOC101488...    181   9e-50   Cicer arietinum [garbanzo]
emb|CBI17793.3|  unnamed protein product                                181   2e-49   Vitis vinifera
ref|XP_007225676.1|  hypothetical protein PRUPE_ppa002789mg             181   2e-49   Prunus persica
ref|XP_004507831.1|  PREDICTED: uncharacterized protein LOC101488...    181   2e-49   Cicer arietinum [garbanzo]
ref|XP_002270522.1|  PREDICTED: uncharacterized protein LOC100264...    181   2e-49   Vitis vinifera
ref|XP_010656822.1|  PREDICTED: uncharacterized protein LOC100264...    180   2e-49   
ref|XP_007154785.1|  hypothetical protein PHAVU_003G147800g             180   3e-49   Phaseolus vulgaris [French bean]
gb|KHN22715.1|  hypothetical protein glysoja_027603                     176   1e-47   Glycine soja [wild soybean]
ref|XP_003542171.1|  PREDICTED: uncharacterized protein LOC100790...    175   1e-47   Glycine max [soybeans]
ref|XP_011457401.1|  PREDICTED: uncharacterized protein LOC101314910    170   9e-46   Fragaria vesca subsp. vesca
ref|XP_003549493.1|  PREDICTED: uncharacterized protein LOC100803...    170   1e-45   Glycine max [soybeans]
gb|KHN17575.1|  hypothetical protein glysoja_005772                     170   1e-45   Glycine soja [wild soybean]
gb|EYU20920.1|  hypothetical protein MIMGU_mgv1a002870mg                167   8e-45   Erythranthe guttata [common monkey flower]
ref|XP_003610155.1|  Calmodulin-binding protein                         167   1e-44   Medicago truncatula
ref|XP_010914125.1|  PREDICTED: uncharacterized protein LOC105039615    166   4e-44   Elaeis guineensis
ref|XP_010536924.1|  PREDICTED: uncharacterized protein LOC104811802    165   7e-44   Tarenaya hassleriana [spider flower]
ref|XP_010913644.1|  PREDICTED: uncharacterized protein LOC105039256    163   2e-43   Elaeis guineensis
ref|XP_008800271.1|  PREDICTED: uncharacterized protein LOC103714689    163   4e-43   Phoenix dactylifera
ref|XP_008805417.1|  PREDICTED: uncharacterized protein LOC103718396    158   2e-41   Phoenix dactylifera
ref|XP_010929241.1|  PREDICTED: uncharacterized protein LOC105050...    158   2e-41   Elaeis guineensis
ref|XP_010929240.1|  PREDICTED: uncharacterized protein LOC105050...    157   3e-41   Elaeis guineensis
ref|XP_008808337.1|  PREDICTED: uncharacterized protein LOC103720426    154   4e-40   Phoenix dactylifera
ref|XP_010688497.1|  PREDICTED: uncharacterized protein LOC104902420    149   2e-38   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU20919.1|  hypothetical protein MIMGU_mgv1a002870mg                147   2e-37   Erythranthe guttata [common monkey flower]
ref|XP_006401191.1|  hypothetical protein EUTSA_v10012939mg             145   6e-37   Eutrema salsugineum [saltwater cress]
ref|XP_009794879.1|  PREDICTED: uncharacterized protein LOC104241635    145   9e-37   Nicotiana sylvestris
ref|XP_010092630.1|  hypothetical protein L484_006392                   144   3e-36   Morus notabilis
ref|XP_009589610.1|  PREDICTED: uncharacterized protein LOC104086953    142   5e-36   Nicotiana tomentosiformis
emb|CAB71126.1|  calmodulin-binding protein                             138   8e-36   Cicer arietinum [garbanzo]
gb|KDP20890.1|  hypothetical protein JCGZ_21361                         142   1e-35   Jatropha curcas
ref|XP_006384008.1|  hypothetical protein POPTR_0004s03510g             142   1e-35   
ref|XP_010646160.1|  PREDICTED: uncharacterized protein LOC100256775    141   1e-35   Vitis vinifera
emb|CBI23322.3|  unnamed protein product                                141   2e-35   Vitis vinifera
emb|CAN66517.1|  hypothetical protein VITISV_001611                     141   2e-35   Vitis vinifera
ref|XP_006845603.1|  hypothetical protein AMTR_s00019p00206980          141   2e-35   Amborella trichopoda
ref|XP_002866219.1|  calmodulin-binding protein                         141   2e-35   
ref|XP_011001128.1|  PREDICTED: uncharacterized protein LOC105108501    141   2e-35   Populus euphratica
ref|XP_008224944.1|  PREDICTED: uncharacterized protein LOC103324...    139   2e-34   Prunus mume [ume]
ref|XP_008224946.1|  PREDICTED: uncharacterized protein LOC103324...    139   2e-34   Prunus mume [ume]
emb|CDY69506.1|  BnaCnng63910D                                          138   3e-34   Brassica napus [oilseed rape]
emb|CDY49721.1|  BnaA10g11510D                                          138   3e-34   Brassica napus [oilseed rape]
ref|XP_007213593.1|  hypothetical protein PRUPE_ppa002740mg             138   3e-34   Prunus persica
ref|XP_009120276.1|  PREDICTED: uncharacterized protein LOC103845193    138   3e-34   Brassica rapa
ref|XP_006281432.1|  hypothetical protein CARUB_v10027506mg             137   5e-34   Capsella rubella
ref|XP_004485707.1|  PREDICTED: uncharacterized protein LOC101498971    137   6e-34   Cicer arietinum [garbanzo]
ref|XP_011043288.1|  PREDICTED: uncharacterized protein LOC105138...    137   9e-34   Populus euphratica
ref|XP_004293506.1|  PREDICTED: uncharacterized protein LOC101308261    136   1e-33   Fragaria vesca subsp. vesca
ref|XP_010539448.1|  PREDICTED: uncharacterized protein LOC104813528    135   3e-33   Tarenaya hassleriana [spider flower]
gb|KEH36516.1|  calmodulin-binding protein                              134   7e-33   Medicago truncatula
gb|ABK95891.1|  unknown                                                 131   7e-33   Populus trichocarpa [western balsam poplar]
ref|XP_010452498.1|  PREDICTED: uncharacterized protein LOC104734591    134   1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_007025783.1|  Calmodulin-binding protein isoform 2               134   1e-32   
ref|XP_007025782.1|  Calmodulin-binding protein isoform 1               133   1e-32   
ref|XP_009394895.1|  PREDICTED: uncharacterized protein LOC103980282    133   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002316655.1|  calmodulin-binding protein 60-C                    133   1e-32   Populus trichocarpa [western balsam poplar]
gb|EYU42432.1|  hypothetical protein MIMGU_mgv1a025463mg                133   3e-32   Erythranthe guttata [common monkey flower]
ref|XP_008383819.1|  PREDICTED: uncharacterized protein LOC103446473    132   3e-32   
ref|XP_006449222.1|  hypothetical protein CICLE_v10014600mg             132   3e-32   Citrus clementina [clementine]
gb|KDO75734.1|  hypothetical protein CISIN_1g006875mg                   132   3e-32   Citrus sinensis [apfelsine]
ref|XP_006467892.1|  PREDICTED: uncharacterized protein LOC102626942    132   3e-32   Citrus sinensis [apfelsine]
ref|XP_006449221.1|  hypothetical protein CICLE_v10014600mg             132   3e-32   
gb|KDO75730.1|  hypothetical protein CISIN_1g006875mg                   132   3e-32   Citrus sinensis [apfelsine]
ref|XP_004232807.1|  PREDICTED: uncharacterized protein LOC101255950    132   4e-32   Solanum lycopersicum
ref|XP_010443447.1|  PREDICTED: uncharacterized protein LOC104726314    132   4e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010483282.1|  PREDICTED: uncharacterized protein LOC104761843    132   4e-32   Camelina sativa [gold-of-pleasure]
ref|XP_009376054.1|  PREDICTED: uncharacterized protein LOC103964...    132   4e-32   Pyrus x bretschneideri [bai li]
ref|XP_009375849.1|  PREDICTED: uncharacterized protein LOC103964...    132   5e-32   Pyrus x bretschneideri [bai li]
ref|XP_009398635.1|  PREDICTED: uncharacterized protein LOC103983171    132   7e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002524676.1|  calmodulin binding protein, putative               130   8e-32   
ref|XP_004504984.1|  PREDICTED: uncharacterized protein LOC101509425    130   2e-31   Cicer arietinum [garbanzo]
ref|XP_004952753.1|  PREDICTED: uncharacterized protein LOC101756...    130   2e-31   Setaria italica
ref|XP_003529298.1|  PREDICTED: uncharacterized protein LOC100812605    130   3e-31   Glycine max [soybeans]
ref|XP_004952755.1|  PREDICTED: uncharacterized protein LOC101756...    130   3e-31   Setaria italica
gb|KHN07315.1|  hypothetical protein glysoja_027405                     128   9e-31   Glycine soja [wild soybean]
ref|XP_008364144.1|  PREDICTED: uncharacterized protein LOC103427...    128   1e-30   
ref|XP_009606926.1|  PREDICTED: uncharacterized protein LOC104101...    127   1e-30   
ref|XP_008364142.1|  PREDICTED: uncharacterized protein LOC103427...    128   1e-30   Malus domestica [apple tree]
ref|XP_010525739.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    127   2e-30   Tarenaya hassleriana [spider flower]
ref|XP_010696620.1|  PREDICTED: uncharacterized protein LOC104909...    127   2e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010696621.1|  PREDICTED: uncharacterized protein LOC104909...    127   2e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009606927.1|  PREDICTED: uncharacterized protein LOC104101...    127   2e-30   Nicotiana tomentosiformis
ref|XP_006347126.1|  PREDICTED: uncharacterized protein LOC102591443    127   2e-30   Solanum tuberosum [potatoes]
ref|NP_200566.1|  Calmodulin-binding protein                            127   3e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009388351.1|  PREDICTED: uncharacterized protein LOC103975166    122   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO75731.1|  hypothetical protein CISIN_1g006875mg                   124   3e-29   Citrus sinensis [apfelsine]
ref|XP_011043290.1|  PREDICTED: uncharacterized protein LOC105138...    124   5e-29   Populus euphratica
ref|XP_011043289.1|  PREDICTED: uncharacterized protein LOC105138...    123   5e-29   Populus euphratica
ref|XP_003532556.1|  PREDICTED: uncharacterized protein LOC100806393    122   1e-28   Glycine max [soybeans]
gb|KHN00110.1|  hypothetical protein glysoja_028638                     122   2e-28   Glycine soja [wild soybean]
ref|XP_003545838.1|  PREDICTED: uncharacterized protein LOC100802...    122   2e-28   Glycine max [soybeans]
ref|XP_008678706.1|  PREDICTED: uncharacterized protein LOC103653644    122   2e-28   Zea mays [maize]
ref|XP_008645829.1|  PREDICTED: uncharacterized protein LOC103627...    121   3e-28   Zea mays [maize]
ref|XP_007148242.1|  hypothetical protein PHAVU_006G191900g             121   5e-28   Phaseolus vulgaris [French bean]
gb|AGT16661.1|  hypothetical protein SHCRBa_107_F16_R_30                120   7e-28   Saccharum hybrid cultivar R570
ref|XP_002316656.1|  calmodulin-binding protein 60-C                    120   9e-28   Populus trichocarpa [western balsam poplar]
gb|KJB57646.1|  hypothetical protein B456_009G173400                    120   1e-27   Gossypium raimondii
emb|CDO99627.1|  unnamed protein product                                120   1e-27   Coffea canephora [robusta coffee]
ref|XP_007159256.1|  hypothetical protein PHAVU_002G222600g             119   1e-27   Phaseolus vulgaris [French bean]
ref|XP_008645828.1|  PREDICTED: uncharacterized protein LOC103627...    119   2e-27   Zea mays [maize]
ref|NP_001047151.1|  Os02g0562300                                       119   3e-27   
ref|XP_011096210.1|  PREDICTED: uncharacterized protein LOC105175464    118   4e-27   Sesamum indicum [beniseed]
gb|KHG24590.1|  eukaryotic translation initiation factor 3 subunit m    117   7e-27   Gossypium arboreum [tree cotton]
gb|EYU27904.1|  hypothetical protein MIMGU_mgv1a0037712mg               116   7e-27   Erythranthe guttata [common monkey flower]
ref|XP_010414641.1|  PREDICTED: uncharacterized protein LOC104700762    117   9e-27   Camelina sativa [gold-of-pleasure]
dbj|BAJ94992.1|  predicted protein                                      117   9e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010467708.1|  PREDICTED: uncharacterized protein LOC104747723    117   1e-26   Camelina sativa [gold-of-pleasure]
ref|XP_006297211.1|  hypothetical protein CARUB_v10013220mg             117   1e-26   Capsella rubella
gb|EEC73417.1|  hypothetical protein OsI_07682                          117   2e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_010057559.1|  PREDICTED: uncharacterized protein LOC104445366    116   2e-26   Eucalyptus grandis [rose gum]
ref|XP_006361013.1|  PREDICTED: uncharacterized protein LOC102605248    116   2e-26   Solanum tuberosum [potatoes]
ref|XP_009761692.1|  PREDICTED: uncharacterized protein LOC104213...    115   3e-26   Nicotiana sylvestris
ref|XP_002452291.1|  hypothetical protein SORBIDRAFT_04g023100          116   3e-26   Sorghum bicolor [broomcorn]
ref|XP_010235560.1|  PREDICTED: uncharacterized protein LOC100846...    115   4e-26   Brachypodium distachyon [annual false brome]
ref|XP_009761691.1|  PREDICTED: uncharacterized protein LOC104213...    115   4e-26   Nicotiana sylvestris
ref|XP_010489590.1|  PREDICTED: uncharacterized protein LOC104767243    115   5e-26   Camelina sativa [gold-of-pleasure]
ref|XP_003608224.1|  Calmodulin-binding protein                         115   5e-26   Medicago truncatula
ref|XP_006647388.1|  PREDICTED: uncharacterized protein LOC102720...    115   7e-26   Oryza brachyantha
ref|XP_003575160.1|  PREDICTED: uncharacterized protein LOC100846...    115   7e-26   Brachypodium distachyon [annual false brome]
ref|XP_006647389.1|  PREDICTED: uncharacterized protein LOC102720...    114   2e-25   Oryza brachyantha
emb|CDY02746.1|  BnaC02g11430D                                          112   6e-25   
gb|AAL11615.1|AF424622_1  At2g18750/MSF3.13                             109   6e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002886266.1|  calmodulin-binding protein                         112   7e-25   Arabidopsis lyrata subsp. lyrata
ref|XP_009126828.1|  PREDICTED: uncharacterized protein LOC103851701    110   2e-24   Brassica rapa
ref|XP_010327019.1|  PREDICTED: uncharacterized protein LOC101268...    109   4e-24   
ref|XP_010327020.1|  PREDICTED: uncharacterized protein LOC101268...    109   4e-24   
ref|XP_004248099.1|  PREDICTED: uncharacterized protein LOC101268...    109   4e-24   Solanum lycopersicum
ref|XP_004248098.1|  PREDICTED: uncharacterized protein LOC101268...    109   5e-24   Solanum lycopersicum
ref|NP_565441.2|  Calmodulin-binding protein                            108   8e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869655.1|  calmodulin-binding protein                         108   1e-23   
ref|XP_010433589.1|  PREDICTED: uncharacterized protein LOC104717678    107   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_002446536.1|  hypothetical protein SORBIDRAFT_06g017740          107   2e-23   Sorghum bicolor [broomcorn]
emb|CDY59992.1|  BnaA02g35270D                                          107   3e-23   Brassica napus [oilseed rape]
ref|XP_010438831.1|  PREDICTED: uncharacterized protein LOC104722380    105   2e-22   Camelina sativa [gold-of-pleasure]
gb|ACN34699.1|  unknown                                                 102   2e-22   Zea mays [maize]
emb|CDY29246.1|  BnaA06g25110D                                          104   3e-22   Brassica napus [oilseed rape]
emb|CDY30302.1|  BnaA09g09750D                                          104   4e-22   Brassica napus [oilseed rape]
ref|NP_001130446.1|  uncharacterized protein LOC100191543               103   4e-22   
ref|XP_009112562.1|  PREDICTED: uncharacterized protein LOC103837921    104   4e-22   Brassica rapa
ref|XP_009150716.1|  PREDICTED: uncharacterized protein LOC103874061    103   7e-22   
ref|XP_008667039.1|  PREDICTED: uncharacterized protein LOC100191...    103   8e-22   
emb|CDY59605.1|  BnaC03g74590D                                          103   1e-21   Brassica napus [oilseed rape]
ref|XP_008667040.1|  PREDICTED: uncharacterized protein LOC100191...    103   1e-21   Zea mays [maize]
gb|EMS66476.1|  hypothetical protein TRIUR3_28909                       102   2e-21   Triticum urartu
tpg|DAA37640.1|  TPA: hypothetical protein ZEAMMB73_428755              100   2e-21   
gb|EAY94271.1|  hypothetical protein OsI_16040                          101   5e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_009414724.1|  PREDICTED: uncharacterized protein LOC103995757    100   6e-21   
gb|EMT06125.1|  hypothetical protein F775_27254                         100   7e-21   
gb|EAZ30858.1|  hypothetical protein OsJ_14930                          100   1e-20   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001052891.1|  Os04g0444200                                     99.8    1e-20   
ref|XP_010448369.1|  PREDICTED: uncharacterized protein LOC104730...  98.6    4e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010448367.1|  PREDICTED: uncharacterized protein LOC104730...  98.6    4e-20   Camelina sativa [gold-of-pleasure]
ref|XP_006282572.1|  hypothetical protein CARUB_v10004387mg           98.2    5e-20   Capsella rubella
ref|XP_004975724.1|  PREDICTED: uncharacterized protein LOC101760...  96.7    2e-19   Setaria italica
ref|XP_004975725.1|  PREDICTED: uncharacterized protein LOC101760...  95.5    4e-19   Setaria italica
ref|NP_194310.3|  Calmodulin-binding protein                          93.6    2e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CAB39601.1|  putative calmodulin-binding protein                  93.2    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008349259.1|  PREDICTED: uncharacterized protein LOC103412486  88.6    8e-18   
gb|EMT33137.1|  hypothetical protein F775_28653                       91.7    1e-17   
gb|EMS55488.1|  hypothetical protein TRIUR3_12862                     90.9    2e-17   Triticum urartu
emb|CDY52577.1|  BnaCnng22620D                                        90.9    2e-17   Brassica napus [oilseed rape]
ref|XP_006409114.1|  hypothetical protein EUTSA_v10022604mg           89.4    5e-17   Eutrema salsugineum [saltwater cress]
gb|KJB68601.1|  hypothetical protein B456_010G254300                  89.0    6e-17   Gossypium raimondii
gb|ACJ85726.1|  unknown                                               83.2    9e-17   Medicago truncatula
ref|XP_002532196.1|  hypothetical protein RCOM_0445820                58.5    4e-16   
gb|EEC72606.1|  hypothetical protein OsI_06079                        86.7    5e-16   Oryza sativa Indica Group [Indian rice]
gb|KDO62472.1|  hypothetical protein CISIN_1g006542mg                 85.5    6e-16   Citrus sinensis [apfelsine]
ref|XP_003570530.1|  PREDICTED: uncharacterized protein LOC100822237  85.9    8e-16   Brachypodium distachyon [annual false brome]
ref|NP_001046071.1|  Os02g0177800                                     84.7    2e-15   
gb|AFW62647.1|  hypothetical protein ZEAMMB73_771415                  81.3    2e-15   
ref|XP_002535531.1|  hypothetical protein RCOM_2098470                60.8    3e-15   
gb|EEE56432.1|  hypothetical protein OsJ_05602                        84.3    4e-15   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ96828.1|  predicted protein                                    82.8    9e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW71858.1|  hypothetical protein ZEAMMB73_193945                  79.0    1e-14   
gb|EPS57962.1|  calmodulin-binding protein                            78.2    1e-14   Genlisea aurea
dbj|BAK04468.1|  predicted protein                                    82.0    2e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002532915.1|  hypothetical protein RCOM_1318360                60.5    3e-14   
ref|XP_006646962.1|  PREDICTED: uncharacterized protein LOC102709708  81.3    3e-14   Oryza brachyantha
gb|AFW70388.1|  calmodulin binding protein                            80.9    4e-14   
gb|AFW66308.1|  hypothetical protein ZEAMMB73_910550                  78.6    5e-14   
ref|NP_001150045.1|  calmodulin binding protein                       79.0    1e-13   Zea mays [maize]
gb|ACG47634.1|  calmodulin binding protein                            78.6    2e-13   Zea mays [maize]
ref|NP_001152440.1|  LOC100286080                                     78.6    2e-13   Zea mays [maize]
gb|KHG17962.1|  Insulin-like receptor                                 77.8    3e-13   Gossypium arboreum [tree cotton]
ref|XP_002453396.1|  hypothetical protein SORBIDRAFT_04g005240        77.4    5e-13   Sorghum bicolor [broomcorn]
ref|XP_002531478.1|  conserved hypothetical protein                   62.4    1e-12   
gb|EMT26442.1|  hypothetical protein F775_27587                       74.7    4e-12   
ref|XP_004951715.1|  PREDICTED: uncharacterized protein LOC101768423  74.3    6e-12   Setaria italica
gb|KDO75736.1|  hypothetical protein CISIN_1g006875mg                 72.0    2e-11   Citrus sinensis [apfelsine]
gb|EMS66803.1|  hypothetical protein TRIUR3_04882                     71.6    4e-11   Triticum urartu
ref|XP_011043291.1|  PREDICTED: uncharacterized protein LOC105138...  71.2    5e-11   Populus euphratica
emb|CDX94414.1|  BnaC01g17700D                                        71.2    5e-11   
emb|CDX89394.1|  BnaA01g14990D                                        71.2    5e-11   
ref|XP_009139545.1|  PREDICTED: uncharacterized protein LOC103863555  70.9    7e-11   Brassica rapa
gb|AAA33446.1|  calmodulin-binding protein                            67.0    7e-11   Zea mays [maize]
emb|CAD40976.1|  OSJNBa0027P08.1                                      66.6    1e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002530779.1|  conserved hypothetical protein                   58.5    1e-10   
gb|KJB69416.1|  hypothetical protein B456_011G022600                  68.6    4e-10   Gossypium raimondii
ref|XP_002535201.1|  hypothetical protein RCOM_0245460                62.4    5e-10   
ref|XP_002532912.1|  conserved hypothetical protein                   60.5    5e-10   
gb|KFK39129.1|  hypothetical protein AALP_AA3G204700                  66.2    8e-10   Arabis alpina [alpine rockcress]
ref|XP_006453636.1|  hypothetical protein CICLE_v10008603mg           66.6    2e-09   Citrus clementina [clementine]
gb|KDO59436.1|  hypothetical protein CISIN_1g007350mg                 65.5    4e-09   Citrus sinensis [apfelsine]
gb|KDO59439.1|  hypothetical protein CISIN_1g007350mg                 65.5    4e-09   Citrus sinensis [apfelsine]
gb|AAN65369.1|  calmodulin-binding protein 60-C                       61.6    5e-09   Phaseolus vulgaris [French bean]
gb|AAN65367.1|  calmodulin-binding protein 60-A                       60.8    6e-09   Phaseolus vulgaris [French bean]
ref|XP_006473988.1|  PREDICTED: uncharacterized protein LOC102629839  64.3    9e-09   Citrus sinensis [apfelsine]
gb|ABA27028.1|  TO69-3                                                58.5    2e-08   Taraxacum officinale [dandelion]
gb|KDP38647.1|  hypothetical protein JCGZ_04000                       61.6    6e-08   Jatropha curcas
ref|NP_001291237.1|  uncharacterized LOC105121148                     61.2    1e-07   Populus euphratica
ref|XP_011017983.1|  PREDICTED: uncharacterized protein LOC105121148  60.8    1e-07   Populus euphratica
gb|AFK38635.1|  unknown                                               56.6    3e-07   Medicago truncatula
ref|XP_009366145.1|  PREDICTED: uncharacterized protein LOC103955955  59.3    4e-07   Pyrus x bretschneideri [bai li]
ref|XP_008336916.1|  PREDICTED: uncharacterized protein LOC103400014  58.5    7e-07   
ref|XP_006384007.1|  hypothetical protein POPTR_0004s03500g           58.2    8e-07   
emb|CDY20299.1|  BnaC04g36570D                                        57.8    1e-06   Brassica napus [oilseed rape]
gb|AAA33447.1|  calmodulin-binding protein                            55.8    4e-06   Zea mays [maize]
ref|XP_001767931.1|  predicted protein                                55.1    1e-05   
dbj|BAJ96886.1|  predicted protein                                    54.3    2e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002531050.1|  hypothetical protein RCOM_0518120                36.6    1e-04   
ref|XP_001758879.1|  predicted protein                                49.7    7e-04   



>ref|XP_010323248.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101245373 
[Solanum lycopersicum]
Length=632

 Score =   253 bits (647),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 160/210 (76%), Gaps = 7/210 (3%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            KVYVDSLVKKAY+NW    EYDGK+ L+ K  +    +RNELP+G VDY N+L NQL Q 
Sbjct  359  KVYVDSLVKKAYDNWNQVVEYDGKSFLNIKQNQNPSSSRNELPVGPVDYPNTLVNQLPQS  418

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
            R P PVQSE S++DP +LIGGS YN+NM AR   QS +M+S+SR Q+E+T FAP  Q   
Sbjct  419  RHPVPVQSEQSSMDPNLLIGGSGYNDNMVARMPTQSPMMNSNSRSQFESTPFAPQHQITS  478

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  528
             +  Q     RYDNNVGLALGPPQSS F T+ SS+ QTNLN F+DWS+ RDKGV+E+LSE
Sbjct  479  SHQLQS---TRYDNNVGLALGPPQSSSFQTITSSLPQTNLNPFDDWSHNRDKGVDEFLSE  535

Query  529  EEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            EEIR+RS+E+L N+DMQHLL+LFSMGGH S
Sbjct  536  EEIRMRSNEILENDDMQHLLRLFSMGGHGS  565



>gb|AAB37246.1| calmodulin-binding protein [Nicotiana tabacum]
Length=551

 Score =   248 bits (632),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 161/211 (76%), Gaps = 8/211 (4%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFK-NKKA---RNELPMGQVDYSNSLNNQLQQP  168
            KVYVDSLVKKAY+NW    EYDGK+ L+ K N+KA   RNELP+G VDY N++ NQL Q 
Sbjct  277  KVYVDSLVKKAYDNWNQVVEYDGKSFLNIKQNQKAGSSRNELPVGPVDYPNNMVNQLPQS  336

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
            RLP  VQSE S++DP +LIGGS YN+++ AR  NQS +M+SSSR Q+E+T FAP  Q   
Sbjct  337  RLPVSVQSEQSSMDPNLLIGGSGYNDSIVARMPNQSQMMNSSSRSQFESTPFAPQQQITN  396

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  528
             +  Q      YDNNVGLALGPPQSS F T+ SS+ QTNLN FEDW + RDKGV+E+LSE
Sbjct  397  THQLQS---TSYDNNVGLALGPPQSSSFQTMTSSLPQTNLNPFEDWPHNRDKGVDEFLSE  453

Query  529  EEIRLRSHEML*NEDMQHLLQLFSM-GGHAS  618
            EEIR+RSHE+L N+DMQHLL+LFSM GGH S
Sbjct  454  EEIRMRSHEILENDDMQHLLRLFSMGGGHGS  484



>emb|CDP02958.1| unnamed protein product [Coffea canephora]
Length=631

 Score =   226 bits (575),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 138/212 (65%), Positives = 164/212 (77%), Gaps = 10/212 (5%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFK-NKKA---RNELPMGQVDYSNSLNNQLQQP  168
            K+YVD LVKKAY+NW    EYDGK+LL+FK NKK+   R+ELP+G VDY N+L+NQL  P
Sbjct  357  KLYVDGLVKKAYDNWNLVIEYDGKSLLNFKQNKKSSASRDELPVGPVDYPNALDNQLSDP  416

Query  169  -RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqq  345
             RLP PV SEPS +DP MLIGG  YN+NM  RY+NQS I++SSSR QY +T +      Q
Sbjct  417  PRLPVPVPSEPSPVDPNMLIGG--YNDNMATRYANQSQILNSSSRNQYGSTSYG--LPDQ  472

Query  346  lmnnsqqmqnARYDNNVGLALGPPQSSC-FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  522
             ++NS Q+QN RYDN   LAL PPQSS  F TVGSSVQ +NLN FEDW+  RDK V+++L
Sbjct  473  QISNSHQIQNTRYDNRAALALAPPQSSSSFQTVGSSVQPSNLNPFEDWTQNRDKSVDDFL  532

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            SEEEIRLRSHEML NEDMQHLL+LFSMGGHA+
Sbjct  533  SEEEIRLRSHEMLENEDMQHLLRLFSMGGHAA  564



>ref|XP_006453423.1| hypothetical protein CICLE_v10007720mg [Citrus clementina]
 ref|XP_006453424.1| hypothetical protein CICLE_v10007720mg [Citrus clementina]
 ref|XP_006474152.1| PREDICTED: uncharacterized protein LOC102625149 isoform X1 [Citrus 
sinensis]
 ref|XP_006474153.1| PREDICTED: uncharacterized protein LOC102625149 isoform X2 [Citrus 
sinensis]
 gb|ESR66663.1| hypothetical protein CICLE_v10007720mg [Citrus clementina]
 gb|ESR66664.1| hypothetical protein CICLE_v10007720mg [Citrus clementina]
 gb|KDO62468.1| hypothetical protein CISIN_1g006542mg [Citrus sinensis]
 gb|KDO62469.1| hypothetical protein CISIN_1g006542mg [Citrus sinensis]
Length=641

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 127/213 (60%), Positives = 160/213 (75%), Gaps = 9/213 (4%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            KVYVDS VKKAY+NW    EYDGK+LLS K  K    ++NE  +GQ+D+SN+L+NQLQ  
Sbjct  370  KVYVDSQVKKAYDNWNQVVEYDGKSLLSLKQNKRSNASKNEPQIGQIDFSNALDNQLQLS  429

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
            RLPA V +E S+   G  IGGS Y +NM  RY +Q  I++S+SR Q++ T F      QL
Sbjct  430  RLPAAVPTEQSSAHSGHPIGGSGYADNMATRYPSQPQIVNSNSRAQFDGTSFV--SNDQL  487

Query  349  mnnsqqmqnARYDNN-VGLALGPPQSS--CFPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  519
            ++NS Q+Q+ RY N+ VGLALGPPQSS   F  +GSSVQQ+NLN F+DWS+ RDKGVE++
Sbjct  488  VDNSHQIQSTRYGNSTVGLALGPPQSSNSGFQAIGSSVQQSNLNPFDDWSHNRDKGVEDF  547

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
             SEEEIR+RS+EML N+DMQHLL+LFSMGGHAS
Sbjct  548  FSEEEIRMRSNEMLENDDMQHLLRLFSMGGHAS  580



>ref|XP_011079310.1| PREDICTED: uncharacterized protein LOC105162855 [Sesamum indicum]
Length=643

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 153/209 (73%), Gaps = 5/209 (2%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            KVYVD+ VKKAY+NW    EYDGK+LL+FK  K  + LP+G V+YS+S+ +QL   RLP 
Sbjct  370  KVYVDAWVKKAYDNWNQVVEYDGKSLLNFKQTKKSSALPLGPVNYSHSVESQLPPQRLPV  429

Query  181  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  360
             V SEPS++D  MLIGG  YN+NM ARYS QS +++SSSR Q+E   F      Q +N  
Sbjct  430  SVPSEPSSIDQSMLIGGLGYNDNMTARYSTQSQLINSSSRTQFEPASFT--QHDQQVNQP  487

Query  361  qqmqnARYDNNVGLALGPP---QSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEE  531
             Q+ +A YD+ VGLALGPP    SS F    +S+QQ +LN FEDWS  RDKGV+++LSEE
Sbjct  488  NQIDSAPYDSRVGLALGPPQSSSSSSFQASNASLQQASLNPFEDWSTNRDKGVDDFLSEE  547

Query  532  EIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            EIR+RSHEML NEDMQHLL+LFSMGGHAS
Sbjct  548  EIRMRSHEMLENEDMQHLLRLFSMGGHAS  576



>gb|KDP22927.1| hypothetical protein JCGZ_01764 [Jatropha curcas]
Length=631

 Score =   220 bits (561),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 120/212 (57%), Positives = 152/212 (72%), Gaps = 13/212 (6%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            KVYVD+LVKKAYENW    EYDGK+LL+FK  K     RN+  +GQ+ Y NSL +Q+Q P
Sbjct  362  KVYVDTLVKKAYENWDQVVEYDGKSLLNFKQSKRSNAVRNDFQIGQMGYPNSLEHQMQIP  421

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
            RLPA V  E  ++  G+ +GGSS  +NMG  +S+QS +M+ +SR Q+ +  F P++    
Sbjct  422  RLPASVLIEQPSVHSGLQVGGSS--DNMGTGFSSQSQLMNPNSRTQF-DISFTPHELITN  478

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  522
             + +      R DN+VGLALGPPQSS   F  VGSS+Q +NLN F+DW+N RDKGV+EY 
Sbjct  479  SHQTS----MRNDNSVGLALGPPQSSMSGFQAVGSSMQPSNLNPFDDWANNRDKGVDEYF  534

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            +EEEIRLRSHEML NEDMQHLL+LFSMG HAS
Sbjct  535  AEEEIRLRSHEMLENEDMQHLLRLFSMGAHAS  566



>gb|KDO62470.1| hypothetical protein CISIN_1g006542mg [Citrus sinensis]
Length=639

 Score =   218 bits (554),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 126/213 (59%), Positives = 159/213 (75%), Gaps = 11/213 (5%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            KVYVDS VKKAY+NW    EYDGK+LLS K  K    ++NE  +GQ+D+SN+L+NQLQ  
Sbjct  370  KVYVDSQVKKAYDNWNQVVEYDGKSLLSLKQNKRSNASKNEPQIGQIDFSNALDNQLQLS  429

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
            RLPA V +E S+   G  IGG  Y +NM  RY +Q  I++S+SR Q++ T F      QL
Sbjct  430  RLPAAVPTEQSSAHSGHPIGG--YADNMATRYPSQPQIVNSNSRAQFDGTSFV--SNDQL  485

Query  349  mnnsqqmqnARYDNN-VGLALGPPQSS--CFPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  519
            ++NS Q+Q+ RY N+ VGLALGPPQSS   F  +GSSVQQ+NLN F+DWS+ RDKGVE++
Sbjct  486  VDNSHQIQSTRYGNSTVGLALGPPQSSNSGFQAIGSSVQQSNLNPFDDWSHNRDKGVEDF  545

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
             SEEEIR+RS+EML N+DMQHLL+LFSMGGHAS
Sbjct  546  FSEEEIRMRSNEMLENDDMQHLLRLFSMGGHAS  578



>ref|XP_007014160.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
 ref|XP_007014161.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
 ref|XP_007014162.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
 gb|EOY31779.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
 gb|EOY31780.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
 gb|EOY31781.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
Length=642

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 153/212 (72%), Gaps = 12/212 (6%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK---ARNELPMGQVDYSNSLNNQLQQPR  171
            KVYVD+LVKKAY+NW    EYDGK+LL+F+  +   ARNEL MG +DY N+L+ QLQ PR
Sbjct  369  KVYVDTLVKKAYDNWNKVIEYDGKSLLNFRQNRRSSARNELQMGAIDYPNALDQQLQLPR  428

Query  172  LPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlm  351
            LP  V +E   +  G+ + G  YN+N   +YS QS  ++S+S  Q+++TQ+ P+DQ    
Sbjct  429  LPVSVPTE--QVHSGLQVEG--YNDNQSTKYSGQSQHVNSNSHNQFDSTQYLPHDQLINN  484

Query  352  nnsqqmqnARYDNNV-GLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  522
            +   Q    R DNNV GLALGPPQSS   F  VGSS+Q +NLN F+DW+N RDKGVE+  
Sbjct  485  SQQPQS--LRNDNNVVGLALGPPQSSALGFQNVGSSMQSSNLNPFDDWTNNRDKGVEDLF  542

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            SEEEIR+RSHEML NEDMQHLL+LFSMGGHAS
Sbjct  543  SEEEIRIRSHEMLENEDMQHLLRLFSMGGHAS  574



>ref|XP_002526232.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF36173.1| calmodulin binding protein, putative [Ricinus communis]
Length=466

 Score =   211 bits (536),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 155/211 (73%), Gaps = 10/211 (5%)
 Frame = +1

Query  4    VYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA----RNELPMGQVDYSNSLNNQLQQPR  171
            VYVD+LVKKAYENW    EYDGK+LL+FK  K     +NE  +GQ+ Y N+ ++Q+Q PR
Sbjct  194  VYVDTLVKKAYENWNEVIEYDGKSLLNFKQSKRSNTYQNEPQIGQIGYPNASDHQMQLPR  253

Query  172  LPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlm  351
            LPA V +E ++   G+ +GG  +N++MGA +S QS +++ +SR Q+++T F     + L+
Sbjct  254  LPASVTTEQASGHSGLQVGG--FNDSMGAGFSAQSQLVNPNSRTQFDSTSFT--VHEPLI  309

Query  352  nnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLS  525
            +NS   Q  R DN+VGLALGPPQSS   F  +GSS+Q + LN F+DW+N RDKGV+EY +
Sbjct  310  SNSHHAQGMRNDNSVGLALGPPQSSSSGFQALGSSMQPSGLNPFDDWTNNRDKGVDEYFT  369

Query  526  EEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            EEEIR+RSHEML NEDMQHLL+LFSMGGH +
Sbjct  370  EEEIRIRSHEMLENEDMQHLLRLFSMGGHGA  400



>gb|KDO62471.1| hypothetical protein CISIN_1g006542mg [Citrus sinensis]
Length=635

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 154/206 (75%), Gaps = 9/206 (4%)
 Frame = +1

Query  22   VKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQPRLPAPVQ  189
            VKKAY+NW    EYDGK+LLS K  K    ++NE  +GQ+D+SN+L+NQLQ  RLPA V 
Sbjct  371  VKKAYDNWNQVVEYDGKSLLSLKQNKRSNASKNEPQIGQIDFSNALDNQLQLSRLPAAVP  430

Query  190  SEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnnsqqm  369
            +E S+   G  IGGS Y +NM  RY +Q  I++S+SR Q++ T F      QL++NS Q+
Sbjct  431  TEQSSAHSGHPIGGSGYADNMATRYPSQPQIVNSNSRAQFDGTSFV--SNDQLVDNSHQI  488

Query  370  qnARYDNN-VGLALGPPQSS--CFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEEEIR  540
            Q+ RY N+ VGLALGPPQSS   F  +GSSVQQ+NLN F+DWS+ RDKGVE++ SEEEIR
Sbjct  489  QSTRYGNSTVGLALGPPQSSNSGFQAIGSSVQQSNLNPFDDWSHNRDKGVEDFFSEEEIR  548

Query  541  LRSHEML*NEDMQHLLQLFSMGGHAS  618
            +RS+EML N+DMQHLL+LFSMGGHAS
Sbjct  549  MRSNEMLENDDMQHLLRLFSMGGHAS  574



>ref|XP_007014163.1| Calmodulin-binding protein isoform 4 [Theobroma cacao]
 gb|EOY31782.1| Calmodulin-binding protein isoform 4 [Theobroma cacao]
Length=643

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 152/212 (72%), Gaps = 11/212 (5%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK---ARNELPMGQVDYSNSLNNQLQQPR  171
            KVYVD+LVKKAY+NW    EYDGK+LL+F+  +   ARNEL MG +DY N+L+ QLQ PR
Sbjct  369  KVYVDTLVKKAYDNWNKVIEYDGKSLLNFRQNRRSSARNELQMGAIDYPNALDQQLQLPR  428

Query  172  LPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlm  351
            LP  V +E   +  G+ +    YN+N   +YS QS  ++S+S  Q+++TQ+ P+DQ    
Sbjct  429  LPVSVPTE--QVHSGLQVE-EGYNDNQSTKYSGQSQHVNSNSHNQFDSTQYLPHDQLINN  485

Query  352  nnsqqmqnARYDNNV-GLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  522
            +   Q    R DNNV GLALGPPQSS   F  VGSS+Q +NLN F+DW+N RDKGVE+  
Sbjct  486  SQQPQS--LRNDNNVVGLALGPPQSSALGFQNVGSSMQSSNLNPFDDWTNNRDKGVEDLF  543

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            SEEEIR+RSHEML NEDMQHLL+LFSMGGHAS
Sbjct  544  SEEEIRIRSHEMLENEDMQHLLRLFSMGGHAS  575



>ref|XP_010047003.1| PREDICTED: uncharacterized protein LOC104435977 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010047005.1| PREDICTED: uncharacterized protein LOC104435977 isoform X1 [Eucalyptus 
grandis]
 gb|KCW78744.1| hypothetical protein EUGRSUZ_C00185 [Eucalyptus grandis]
Length=635

 Score =   209 bits (533),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 145/209 (69%), Gaps = 9/209 (4%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFK--NKKARNELPMGQVDYSNSLNNQLQQPRL  174
            KVYVD+LVKKAY+NW    EYDGK+LLSFK   + +RNE  M  ++YSN+L++QLQ PRL
Sbjct  370  KVYVDTLVKKAYDNWNQVVEYDGKSLLSFKQVRRSSRNEPQMAALEYSNALDHQLQLPRL  429

Query  175  PAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmn  354
            P P  SE  + D G+ +GG  YN +M ARYS QS + ++++R Q+ +T + P D      
Sbjct  430  PVPFTSEQPSADSGLTVGG--YNGDMVARYSAQSQLANANARSQFTSTSYMPEDPLANNQ  487

Query  355  nsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVE-EYLSEE  531
                   +R +N+VGLALGPP S+ F   G S+Q   LN F+DWS  RDKG + E+L+EE
Sbjct  488  AQS----SRNNNSVGLALGPPLSAGFSATGPSIQTPGLNPFDDWSGNRDKGGDIEFLTEE  543

Query  532  EIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            EIR+RSHEML NEDMQ LL+LFSMGGH S
Sbjct  544  EIRMRSHEMLENEDMQQLLRLFSMGGHTS  572



>gb|KJB83411.1| hypothetical protein B456_013G246400 [Gossypium raimondii]
 gb|KJB83412.1| hypothetical protein B456_013G246400 [Gossypium raimondii]
 gb|KJB83413.1| hypothetical protein B456_013G246400 [Gossypium raimondii]
Length=644

 Score =   209 bits (533),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 155/212 (73%), Gaps = 12/212 (6%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK---ARNELPMGQVDYSNSLNNQLQQPR  171
            KVYVDSLVKKAY+NW    EYDGK+LL+FK  +   ARNEL + ++DY++S++NQ+Q PR
Sbjct  369  KVYVDSLVKKAYDNWNQVIEYDGKSLLNFKQNRWSSARNELQIDELDYTSSVDNQMQLPR  428

Query  172  LPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlm  351
            +P P+ +E   +  G+ +GG  YN+N  A YS QS IM+ +S  Q+ NTQF P DQ    
Sbjct  429  VPVPIPTE--QVHSGLQVGG--YNDNQSAGYSGQSQIMNPNSHNQFGNTQFVPQDQLIDN  484

Query  352  nnsqqmqnARYDNNV-GLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  522
            +   Q   ++ D NV GLALGPPQSS   F  +GSS+Q +NLN F DW+N  DKGVE++L
Sbjct  485  SQQPQS--SKNDTNVVGLALGPPQSSIIGFQNIGSSMQPSNLNPFNDWTNNHDKGVEDFL  542

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            SEEEIR+RS+EML NE+MQHLL+LF+MGG+AS
Sbjct  543  SEEEIRVRSNEMLENEEMQHLLRLFNMGGNAS  574



>gb|KHG27572.1| Cytochrome P450 [Gossypium arboreum]
Length=643

 Score =   204 bits (519),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 154/212 (73%), Gaps = 12/212 (6%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK---ARNELPMGQVDYSNSLNNQLQQPR  171
            KVYVDS VKKAY+NW    EYDGK+LL+FK  +   AR+EL +G++DY++++++Q+Q PR
Sbjct  369  KVYVDSQVKKAYDNWNQVIEYDGKSLLNFKQNRWSSARDELQIGELDYTSAVDHQMQLPR  428

Query  172  LPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlm  351
            +P PV +E   +  G+ +GG  YN+N    YS QS IM+ +S  Q+ NTQF P DQ    
Sbjct  429  VPVPVPTE--QVHSGLQVGG--YNDNQSTGYSGQSQIMNPNSHNQFGNTQFVPQDQLIDN  484

Query  352  nnsqqmqnARYDNNV-GLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  522
            +   Q   ++ D NV GLALGPPQSS   F  +GSS+Q +NLN F DW+N  DKGVE++L
Sbjct  485  SQQPQS--SKNDTNVVGLALGPPQSSIIGFQNIGSSMQPSNLNPFNDWTNNHDKGVEDFL  542

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            SEEEIR+RS+EML NE+MQHLL+LF+MGG+AS
Sbjct  543  SEEEIRVRSNEMLENEEMQHLLRLFNMGGNAS  574



>ref|XP_006366189.1| PREDICTED: uncharacterized protein LOC102581064 [Solanum tuberosum]
Length=618

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 143/210 (68%), Gaps = 28/210 (13%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            KVYVDSLVKKAY+NW    EYDGK+ LS K  +    +RNELP+G +DY N+L NQL   
Sbjct  366  KVYVDSLVKKAYDNWNQVVEYDGKSFLSIKQNQNPSSSRNELPVGPMDYPNTLVNQL---  422

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
                          P  LI G  YN+NM  R   QS +M+S+SR Q+E+T +AP  Q   
Sbjct  423  --------------PQSLIDG--YNDNM--RMPTQSPMMNSNSRSQFESTPYAPQHQITS  464

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  528
             +  Q     RYDNNVGLALGPPQSS F T+ SS+ QTNLN F+DWS+ RDKGV+E+LSE
Sbjct  465  SHQLQS---TRYDNNVGLALGPPQSSSFQTITSSLPQTNLNPFDDWSHNRDKGVDEFLSE  521

Query  529  EEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            EEIR+RS+E+L N+DMQ LL+LFSMGGH S
Sbjct  522  EEIRMRSNEILENDDMQQLLRLFSMGGHGS  551



>ref|XP_010103014.1| hypothetical protein L484_022898 [Morus notabilis]
 gb|EXB94581.1| hypothetical protein L484_022898 [Morus notabilis]
Length=641

 Score =   202 bits (514),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 151/213 (71%), Gaps = 10/213 (5%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            K+YVD+LVKKAY+NW    EYDGK+LLSFK  K    +RNEL MG  +YSN  +NQLQ  
Sbjct  366  KIYVDTLVKKAYDNWDQVVEYDGKSLLSFKQNKRPNASRNELQMGPSNYSNPSDNQLQLS  425

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LP    SE ++L+ G+ I    YN+++  R+SNQ  +++SSSR Q+++  F      Q 
Sbjct  426  HLPVH-PSEQTSLNTGLPIAAPGYNDDVSTRFSNQVPMVNSSSRNQFDSASFV--QNDQF  482

Query  349  mnnsqqmqnARYDNN-VGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  519
            + NS + Q  R DN+ VGLALGPPQSS   F TV S++QQ+ LN F+DWS  RDKGV+++
Sbjct  483  IGNSHEAQTIRNDNSSVGLALGPPQSSTAGFQTVNSTMQQSTLNPFDDWSQHRDKGVDDF  542

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
             SEEEIR++SHEML NEDMQHLL++FSMGGH S
Sbjct  543  FSEEEIRIKSHEMLENEDMQHLLRIFSMGGHPS  575



>ref|XP_002325070.1| calmodulin-binding family protein [Populus trichocarpa]
 gb|EEF03635.1| calmodulin-binding family protein [Populus trichocarpa]
Length=648

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 145/212 (68%), Gaps = 11/212 (5%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            K+YVD+LVKKAY+NW    EYDGK+LL+F   +    ++NE  + Q+ YSN   +Q+Q P
Sbjct  375  KIYVDTLVKKAYDNWDMVVEYDGKSLLNFNQNRRVSVSQNEHQINQIGYSNPSGHQVQLP  434

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
            RLPA + +E S++   +  GG  YN+N+ + YS QS +++  SR Q  +  FAP+ Q   
Sbjct  435  RLPASIPTEQSSVHSALQAGG--YNDNLVSGYSMQSQLVNPDSRTQLGSNSFAPHQQLIS  492

Query  349  mnnsqqmqnARYDNN-VGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  519
                      R DN+ VGLALGPPQSS   F T+GSS+Q TNLN F+DW++ RDK  +E+
Sbjct  493  NPQQLLS--TRNDNSAVGLALGPPQSSTSGFQTIGSSMQPTNLNPFDDWTSNRDKSADEF  550

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
             SEEEIR+RSHEML NEDMQHLL+LFSMGGHA
Sbjct  551  FSEEEIRIRSHEMLENEDMQHLLRLFSMGGHA  582



>ref|XP_010259794.1| PREDICTED: uncharacterized protein LOC104599111 [Nelumbo nucifera]
 ref|XP_010259795.1| PREDICTED: uncharacterized protein LOC104599111 [Nelumbo nucifera]
 ref|XP_010259796.1| PREDICTED: uncharacterized protein LOC104599111 [Nelumbo nucifera]
Length=644

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 150/213 (70%), Gaps = 13/213 (6%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            KVYVD+LVKKAY+NW    EYDGK LLS+K  K    +R+ELPMG  +YSNS + Q+  P
Sbjct  371  KVYVDTLVKKAYDNWGHVIEYDGKALLSYKQNKRPSSSRSELPMGP-EYSNSFDQQISVP  429

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
            RLP P  SE  ++D G+ +G S YN+N+  RY  QS + +S+S +Q++   FAP +Q   
Sbjct  430  RLPVP--SEQPSMDSGLNVGVSGYNDNLATRYPAQSQV-NSNSHVQFDGNSFAPQNQMIS  486

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKG-VEEY  519
             ++  Q    R +N VGLALGPPQSS   F  VG S+Q +N++S++DWS++R+ G V+ +
Sbjct  487  TSHQTQF--PRNENIVGLALGPPQSSTPGFQNVGPSIQASNVSSYDDWSHSRENGGVDGF  544

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
             SEEEIR+RSHEML NEDMQHLL++FSMGG  +
Sbjct  545  FSEEEIRMRSHEMLENEDMQHLLRIFSMGGQTA  577



>ref|XP_011044001.1| PREDICTED: uncharacterized protein LOC105139309 [Populus euphratica]
 ref|XP_011044002.1| PREDICTED: uncharacterized protein LOC105139309 [Populus euphratica]
 ref|XP_011044003.1| PREDICTED: uncharacterized protein LOC105139309 [Populus euphratica]
 ref|XP_011044004.1| PREDICTED: uncharacterized protein LOC105139309 [Populus euphratica]
Length=647

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/212 (51%), Positives = 144/212 (68%), Gaps = 11/212 (5%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            K+YVD+LVKKAY+NW    EYDGK+LL+F   +    ++NE  + Q+ YSN   +Q+Q P
Sbjct  374  KIYVDTLVKKAYDNWDMVIEYDGKSLLNFNQNRRVSVSQNEHQINQIGYSNPSGHQVQLP  433

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
            RLP  + +E S++   +  GG  YN+N+ + Y  QS +++  SR Q  +  FAP++Q   
Sbjct  434  RLPGSIPTEQSSVHSALQAGG--YNDNLVSGYPMQSQLVNPDSRTQLGSNSFAPHEQLIS  491

Query  349  mnnsqqmqnARYDNN-VGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  519
                      R DN+ VGLALGPPQSS   F T+GSS+Q TNLN F+DW+N RDK  +E+
Sbjct  492  NPQQLLS--TRNDNSAVGLALGPPQSSTSGFQTIGSSMQPTNLNPFDDWTNNRDKSADEF  549

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
             SEEEIR+RSHEML NEDMQHLL+LFSMGGHA
Sbjct  550  FSEEEIRVRSHEMLENEDMQHLLRLFSMGGHA  581



>ref|XP_011018189.1| PREDICTED: uncharacterized protein LOC105121292 [Populus euphratica]
 ref|XP_011018190.1| PREDICTED: uncharacterized protein LOC105121292 [Populus euphratica]
 ref|XP_011018191.1| PREDICTED: uncharacterized protein LOC105121292 [Populus euphratica]
 ref|XP_011018192.1| PREDICTED: uncharacterized protein LOC105121292 [Populus euphratica]
Length=647

 Score =   193 bits (491),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 108/212 (51%), Positives = 143/212 (67%), Gaps = 11/212 (5%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            K+YVD+LVKKAY+NW    EYDGK+LL+F   +    ++NE  + Q+ YSN   +Q+Q P
Sbjct  374  KIYVDTLVKKAYDNWDMVIEYDGKSLLNFNQNRRVSVSQNEHQINQIGYSNPSGHQVQLP  433

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
            RLP  + +E S++   +  GG  YN+N+ + Y  QS +++  SR Q  +  FAP++Q   
Sbjct  434  RLPGSIPTEQSSVHSALQAGG--YNDNLVSGYPMQSQLVNPDSRTQLGSNSFAPHEQLIS  491

Query  349  mnnsqqmqnARYDNN-VGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  519
                      R DN+ VGLALGPPQSS   F T+GSS+Q  NLN F+DW+N RDK  +E+
Sbjct  492  NPQQLLS--TRNDNSAVGLALGPPQSSTSGFQTIGSSMQPANLNPFDDWTNNRDKSADEF  549

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
             SEEEIR+RSHEML NEDMQHLL+LFSMGGHA
Sbjct  550  FSEEEIRVRSHEMLENEDMQHLLRLFSMGGHA  581



>ref|XP_010265460.1| PREDICTED: uncharacterized protein LOC104603183 isoform X4 [Nelumbo 
nucifera]
Length=592

 Score =   189 bits (481),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 150/213 (70%), Gaps = 15/213 (7%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK---ARNELPMGQVDYSNSLNNQLQQPR  171
            KV+VDSLVKKAYENW    EYDGK LLS+K  K   +RNELPM   DY+NS + Q+  PR
Sbjct  321  KVFVDSLVKKAYENWGQVIEYDGKALLSYKQNKRSSSRNELPMAPTDYANSFDQQVSVPR  380

Query  172  LPAPVQSEPSALDPGMLIGGSSYNEN-MGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
            LP P  SE S++D G+ +GG  YN+N +   Y  QS + +SS+ +Q+++  FA   Q Q+
Sbjct  381  LPVP--SEQSSMDSGLNVGG--YNDNHLVTGYPTQSQV-NSSAHIQFDSNSFA--TQSQM  433

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKG-VEEY  519
            ++ S Q Q  R D+ VGLALGPPQSS   F  VG S+Q +N  +++DW + R+ G VE +
Sbjct  434  ISTSHQAQIPRNDDIVGLALGPPQSSTTGFENVGPSIQASNA-TYDDWPHNRENGGVEGF  492

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
             SEEEIR+RSHEML NEDMQHLL++FSMGGHA+
Sbjct  493  FSEEEIRMRSHEMLENEDMQHLLRIFSMGGHAA  525



>ref|XP_010265459.1| PREDICTED: uncharacterized protein LOC104603183 isoform X3 [Nelumbo 
nucifera]
Length=595

 Score =   189 bits (481),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 150/213 (70%), Gaps = 15/213 (7%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK---ARNELPMGQVDYSNSLNNQLQQPR  171
            KV+VDSLVKKAYENW    EYDGK LLS+K  K   +RNELPM   DY+NS + Q+  PR
Sbjct  324  KVFVDSLVKKAYENWGQVIEYDGKALLSYKQNKRSSSRNELPMAPTDYANSFDQQVSVPR  383

Query  172  LPAPVQSEPSALDPGMLIGGSSYNEN-MGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
            LP P  SE S++D G+ +GG  YN+N +   Y  QS + +SS+ +Q+++  FA   Q Q+
Sbjct  384  LPVP--SEQSSMDSGLNVGG--YNDNHLVTGYPTQSQV-NSSAHIQFDSNSFA--TQSQM  436

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKG-VEEY  519
            ++ S Q Q  R D+ VGLALGPPQSS   F  VG S+Q +N  +++DW + R+ G VE +
Sbjct  437  ISTSHQAQIPRNDDIVGLALGPPQSSTTGFENVGPSIQASNA-TYDDWPHNRENGGVEGF  495

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
             SEEEIR+RSHEML NEDMQHLL++FSMGGHA+
Sbjct  496  FSEEEIRMRSHEMLENEDMQHLLRIFSMGGHAA  528



>ref|XP_010265458.1| PREDICTED: uncharacterized protein LOC104603183 isoform X2 [Nelumbo 
nucifera]
Length=642

 Score =   190 bits (482),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 150/213 (70%), Gaps = 15/213 (7%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK---ARNELPMGQVDYSNSLNNQLQQPR  171
            KV+VDSLVKKAYENW    EYDGK LLS+K  K   +RNELPM   DY+NS + Q+  PR
Sbjct  371  KVFVDSLVKKAYENWGQVIEYDGKALLSYKQNKRSSSRNELPMAPTDYANSFDQQVSVPR  430

Query  172  LPAPVQSEPSALDPGMLIGGSSYNEN-MGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
            LP P  SE S++D G+ +GG  YN+N +   Y  QS + +SS+ +Q+++  FA   Q Q+
Sbjct  431  LPVP--SEQSSMDSGLNVGG--YNDNHLVTGYPTQSQV-NSSAHIQFDSNSFA--TQSQM  483

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKG-VEEY  519
            ++ S Q Q  R D+ VGLALGPPQSS   F  VG S+Q +N  +++DW + R+ G VE +
Sbjct  484  ISTSHQAQIPRNDDIVGLALGPPQSSTTGFENVGPSIQASNA-TYDDWPHNRENGGVEGF  542

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
             SEEEIR+RSHEML NEDMQHLL++FSMGGHA+
Sbjct  543  FSEEEIRMRSHEMLENEDMQHLLRIFSMGGHAA  575



>ref|XP_010265456.1| PREDICTED: uncharacterized protein LOC104603183 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010265457.1| PREDICTED: uncharacterized protein LOC104603183 isoform X1 [Nelumbo 
nucifera]
Length=645

 Score =   190 bits (482),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 150/213 (70%), Gaps = 15/213 (7%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK---ARNELPMGQVDYSNSLNNQLQQPR  171
            KV+VDSLVKKAYENW    EYDGK LLS+K  K   +RNELPM   DY+NS + Q+  PR
Sbjct  374  KVFVDSLVKKAYENWGQVIEYDGKALLSYKQNKRSSSRNELPMAPTDYANSFDQQVSVPR  433

Query  172  LPAPVQSEPSALDPGMLIGGSSYNEN-MGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
            LP P  SE S++D G+ +GG  YN+N +   Y  QS + +SS+ +Q+++  FA   Q Q+
Sbjct  434  LPVP--SEQSSMDSGLNVGG--YNDNHLVTGYPTQSQV-NSSAHIQFDSNSFA--TQSQM  486

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKG-VEEY  519
            ++ S Q Q  R D+ VGLALGPPQSS   F  VG S+Q +N  +++DW + R+ G VE +
Sbjct  487  ISTSHQAQIPRNDDIVGLALGPPQSSTTGFENVGPSIQASNA-TYDDWPHNRENGGVEGF  545

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
             SEEEIR+RSHEML NEDMQHLL++FSMGGHA+
Sbjct  546  FSEEEIRMRSHEMLENEDMQHLLRIFSMGGHAA  578



>ref|XP_008453624.1| PREDICTED: uncharacterized protein LOC103494282 [Cucumis melo]
 ref|XP_008453625.1| PREDICTED: uncharacterized protein LOC103494282 [Cucumis melo]
 ref|XP_008453626.1| PREDICTED: uncharacterized protein LOC103494282 [Cucumis melo]
Length=637

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 148/213 (69%), Gaps = 14/213 (7%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            KVYVD+LV KAYENW    EYDGK+LLS K  K    +RN+   G +D SN+L++     
Sbjct  368  KVYVDTLVNKAYENWNQVVEYDGKSLLSSKQPKKSNASRNDFQGGHLDLSNTLDHG-SLA  426

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
            R+P  VQ +   +DPG+ + G  YN++   RYS Q   ++S+SR Q++N+   P    +L
Sbjct  427  RMPVSVQPQQPVVDPGLSVAG--YNDSTATRYSTQPQFVNSTSRPQFDNS---PYTSNEL  481

Query  349  mnnsqqmqnARYDNN-VGLALGPPQ--SSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  519
            + NS Q+  AR DN+  GLALGPPQ  SS F  +GSS+Q++NLN F DWSN RDKGV+++
Sbjct  482  VGNSNQVHVARNDNSSFGLALGPPQASSSGFQALGSSMQESNLNPF-DWSNNRDKGVDDF  540

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
             SE+EIR+RSHEML NEDMQ LL++FSMGGHAS
Sbjct  541  FSEDEIRMRSHEMLENEDMQQLLRMFSMGGHAS  573



>gb|KJB22129.1| hypothetical protein B456_004G031000 [Gossypium raimondii]
 gb|KJB22130.1| hypothetical protein B456_004G031000 [Gossypium raimondii]
 gb|KJB22131.1| hypothetical protein B456_004G031000 [Gossypium raimondii]
Length=640

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 149/210 (71%), Gaps = 15/210 (7%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK---ARNELPMGQVDYSNSLNNQLQQPR  171
            KVYVD+LVKKAY+NW    EYDGK+LL+FK  +   ARNE     + Y N+L++QLQ   
Sbjct  367  KVYVDTLVKKAYDNWHQVIEYDGKSLLNFKQNRRSSARNEAQTDAIGYPNALDHQLQ---  423

Query  172  LPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlm  351
            LP  V +E   +  G   GG  +N+N   RY  QS +++S+SR Q+++TQF      QL+
Sbjct  424  LPVAVPTE--QVHSGPQAGG--FNDNQSTRYPGQSELVNSNSRSQFDSTQFL--QYDQLV  477

Query  352  nnsqqmqnARYDNN-VGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  522
            NNS+Q Q++R +NN VGLALGPPQSS   F    SS+Q +NLN F+DWSN RDKGVE+  
Sbjct  478  NNSEQPQSSRTNNNAVGLALGPPQSSTLGFHNAISSMQPSNLNPFDDWSNNRDKGVEDLF  537

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGGH  612
            SEEEIRLRSHEML NEDMQHLL+LFSMGGH
Sbjct  538  SEEEIRLRSHEMLENEDMQHLLRLFSMGGH  567



>ref|XP_004146305.1| PREDICTED: uncharacterized protein LOC101216741 [Cucumis sativus]
 ref|XP_004165695.1| PREDICTED: uncharacterized LOC101216741 [Cucumis sativus]
 gb|KGN65434.1| hypothetical protein Csa_1G422430 [Cucumis sativus]
Length=636

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 147/213 (69%), Gaps = 14/213 (7%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            KVYVD+LV KAYENW    EYDGK+LLS K  K    +RN+   G +D SN+L++     
Sbjct  367  KVYVDTLVNKAYENWNQVVEYDGKSLLSSKQPKKSTASRNDFQGGHLDLSNTLDHG-SLA  425

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
            R+P  VQ +   +D G+ + G  YN++   RYS Q   ++S+SR Q++N+   P    +L
Sbjct  426  RMPVSVQPQQPVVDSGLSVAG--YNDSTATRYSTQPQFVNSTSRPQFDNS---PYTSNEL  480

Query  349  mnnsqqmqnARYDNNV-GLALGPPQ--SSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  519
            M NS Q+  AR DN+  GLALGPPQ  SS F  +GSS+Q++NLN F DWSN RDKGV+++
Sbjct  481  MGNSNQVHIARNDNSTFGLALGPPQASSSGFQALGSSMQESNLNPF-DWSNNRDKGVDDF  539

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
             SE+EIR+RSHEML NEDMQ LL++FSMGGHAS
Sbjct  540  FSEDEIRMRSHEMLENEDMQQLLRMFSMGGHAS  572



>gb|KHG10046.1| Protein very KIND [Gossypium arboreum]
Length=640

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 146/210 (70%), Gaps = 15/210 (7%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK---ARNELPMGQVDYSNSLNNQLQQPR  171
            KVYVD+LVKKAY+NWL   EYDGK+L +FK  +   ARNE     + Y N   +QLQ PR
Sbjct  367  KVYVDTLVKKAYDNWLQVIEYDGKSLSNFKQNRRSSARNEPQTDAICYPN---HQLQLPR  423

Query  172  LPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlm  351
            LP  V +E   +  G   GG  +N+N   RYS Q  +++S+SR Q++ TQF      QL+
Sbjct  424  LPVAVPTE--QVHSGPQAGG--FNDNQSMRYSGQPELVNSNSRSQFDGTQFL--QYDQLV  477

Query  352  nnsqqmqnARYDNN-VGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  522
            +NS+Q Q++R +NN VGLALGPPQSS   F    SS+Q +NLN F+ WSN RDKGVE+  
Sbjct  478  DNSEQPQSSRTNNNAVGLALGPPQSSTLGFHNASSSMQPSNLNPFDYWSNNRDKGVEDMF  537

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGGH  612
            SEEEIRLRSHEML NEDMQHLL+LFSMGGH
Sbjct  538  SEEEIRLRSHEMLENEDMQHLLRLFSMGGH  567



>ref|XP_004507834.1| PREDICTED: uncharacterized protein LOC101488801 isoform X4 [Cicer 
arietinum]
Length=625

 Score =   181 bits (460),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 144/213 (68%), Gaps = 11/213 (5%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSF----KNKKARNELPMGQVDYSNSLNNQLQQP  168
            K+YVDSLVKKAY+NW    EYDGK+L+      K+ ++ NEL +  +DY   L++QLQ P
Sbjct  354  KIYVDSLVKKAYDNWDQVVEYDGKSLVDAEQVNKSVESENELHVESIDYDVGLDHQLQMP  413

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSN-QSHIMSSSSRMQYENTQFAPndqqq  345
             +P  V S    ++ GM +GG  YN NM  RY N Q+ I +SSSR Q+E + + P DQ  
Sbjct  414  VIPMSVTS-GQQMNSGMPVGG--YNNNMVTRYPNHQALIGNSSSRSQFEGSLYLPTDQLV  470

Query  346  lmnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  519
               +  Q  +  + + VGLALGPPQSS   F    SS+Q + LN F+DWS+ RDKGV+++
Sbjct  471  SNAHQSQSSSNDH-STVGLALGPPQSSTSGFHAGSSSIQPSALNPFDDWSHNRDKGVDDF  529

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
             SE+EIR+RS+E+L NEDMQHLL+LFSMGGHAS
Sbjct  530  FSEDEIRVRSNEILENEDMQHLLRLFSMGGHAS  562



>ref|XP_004507832.1| PREDICTED: uncharacterized protein LOC101488801 isoform X2 [Cicer 
arietinum]
 ref|XP_004507833.1| PREDICTED: uncharacterized protein LOC101488801 isoform X3 [Cicer 
arietinum]
Length=635

 Score =   181 bits (460),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 144/213 (68%), Gaps = 11/213 (5%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSF----KNKKARNELPMGQVDYSNSLNNQLQQP  168
            K+YVDSLVKKAY+NW    EYDGK+L+      K+ ++ NEL +  +DY   L++QLQ P
Sbjct  364  KIYVDSLVKKAYDNWDQVVEYDGKSLVDAEQVNKSVESENELHVESIDYDVGLDHQLQMP  423

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSN-QSHIMSSSSRMQYENTQFAPndqqq  345
             +P  V S    ++ GM +GG  YN NM  RY N Q+ I +SSSR Q+E + + P DQ  
Sbjct  424  VIPMSVTS-GQQMNSGMPVGG--YNNNMVTRYPNHQALIGNSSSRSQFEGSLYLPTDQLV  480

Query  346  lmnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  519
               +  Q  +  + + VGLALGPPQSS   F    SS+Q + LN F+DWS+ RDKGV+++
Sbjct  481  SNAHQSQSSSNDH-STVGLALGPPQSSTSGFHAGSSSIQPSALNPFDDWSHNRDKGVDDF  539

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
             SE+EIR+RS+E+L NEDMQHLL+LFSMGGHAS
Sbjct  540  FSEDEIRVRSNEILENEDMQHLLRLFSMGGHAS  572



>emb|CBI17793.3| unnamed protein product [Vitis vinifera]
Length=628

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 146/210 (70%), Gaps = 9/210 (4%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFK----NKKARNELPMGQVDYSNSLNNQLQQP  168
            KVYVD+LVKKAYENW    EYDGK+L SFK    +  +RNE  +G +DY  +L   L  P
Sbjct  356  KVYVDNLVKKAYENWNQVEEYDGKSL-SFKQIIRSSTSRNEHMIGSMDYPTALEPLLPLP  414

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
            R P    SE S +DPG+ +GGS YN+ +  RY+ Q  +++SSSR Q++   F      QL
Sbjct  415  RPPVAGPSEQSLMDPGISVGGSGYNDGLATRYTAQPQLVNSSSRAQFDGPSFP--SHDQL  472

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  522
            +NNS Q+Q+ R D++VGLALGPPQSS   F  + SS+Q +NLN F D  N RDKGV++Y 
Sbjct  473  VNNSHQIQSTRNDSSVGLALGPPQSSTMGFQALNSSIQHSNLNPFSDLLNNRDKGVDDYF  532

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGGH  612
            +EEEIRLRSHEML ++DMQ LL++FSMGGH
Sbjct  533  TEEEIRLRSHEMLESDDMQQLLRVFSMGGH  562



>ref|XP_007225676.1| hypothetical protein PRUPE_ppa002789mg [Prunus persica]
 gb|EMJ26875.1| hypothetical protein PRUPE_ppa002789mg [Prunus persica]
Length=633

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 141/211 (67%), Gaps = 15/211 (7%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK--ARNELPMGQVDYSNSLNNQLQQPRL  174
            KVYVD+LVKKAYENW    +YDGK+LL+FK  K   R E   G + YS++ ++QLQ PRL
Sbjct  368  KVYVDTLVKKAYENWDQVIQYDGKSLLNFKQNKRSTRTEFQTGPISYSDASDHQLQVPRL  427

Query  175  PAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmn  354
               V SE   LDP + IGG  YN+N+  RY  Q  +++S+SR Q++ T FA     QL++
Sbjct  428  TNSVPSEQPPLDPALPIGG--YNDNLSTRYLTQP-LVNSNSRTQFDGTGFA--LDDQLIS  482

Query  355  nsqqmqnARYDNN-VGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLS  525
            NS + Q+ R D N VGL L PPQSS   F T+ SS Q + LN  +DW+  RD     + S
Sbjct  483  NSHEAQSTRSDANAVGLVLAPPQSSTSGFQTINSSSQPSTLNPLDDWTTNRD-----FFS  537

Query  526  EEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            EE+IR+RSHEML NEDMQHLL++FSMGGH S
Sbjct  538  EEDIRIRSHEMLENEDMQHLLRIFSMGGHGS  568



>ref|XP_004507831.1| PREDICTED: uncharacterized protein LOC101488801 isoform X1 [Cicer 
arietinum]
Length=694

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 144/213 (68%), Gaps = 11/213 (5%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSF----KNKKARNELPMGQVDYSNSLNNQLQQP  168
            K+YVDSLVKKAY+NW    EYDGK+L+      K+ ++ NEL +  +DY   L++QLQ P
Sbjct  423  KIYVDSLVKKAYDNWDQVVEYDGKSLVDAEQVNKSVESENELHVESIDYDVGLDHQLQMP  482

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSN-QSHIMSSSSRMQYENTQFAPndqqq  345
             +P  V S    ++ GM +GG  YN NM  RY N Q+ I +SSSR Q+E + + P DQ  
Sbjct  483  VIPMSVTS-GQQMNSGMPVGG--YNNNMVTRYPNHQALIGNSSSRSQFEGSLYLPTDQLV  539

Query  346  lmnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  519
               +  Q  +  + + VGLALGPPQSS   F    SS+Q + LN F+DWS+ RDKGV+++
Sbjct  540  SNAHQSQSSSNDH-STVGLALGPPQSSTSGFHAGSSSIQPSALNPFDDWSHNRDKGVDDF  598

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
             SE+EIR+RS+E+L NEDMQHLL+LFSMGGHAS
Sbjct  599  FSEDEIRVRSNEILENEDMQHLLRLFSMGGHAS  631



>ref|XP_002270522.1| PREDICTED: uncharacterized protein LOC100264980 isoform X1 [Vitis 
vinifera]
Length=642

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 146/210 (70%), Gaps = 9/210 (4%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFK----NKKARNELPMGQVDYSNSLNNQLQQP  168
            KVYVD+LVKKAYENW    EYDGK+L SFK    +  +RNE  +G +DY  +L   L  P
Sbjct  370  KVYVDNLVKKAYENWNQVEEYDGKSL-SFKQIIRSSTSRNEHMIGSMDYPTALEPLLPLP  428

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
            R P    SE S +DPG+ +GGS YN+ +  RY+ Q  +++SSSR Q++   F      QL
Sbjct  429  RPPVAGPSEQSLMDPGISVGGSGYNDGLATRYTAQPQLVNSSSRAQFDGPSFP--SHDQL  486

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  522
            +NNS Q+Q+ R D++VGLALGPPQSS   F  + SS+Q +NLN F D  N RDKGV++Y 
Sbjct  487  VNNSHQIQSTRNDSSVGLALGPPQSSTMGFQALNSSIQHSNLNPFSDLLNNRDKGVDDYF  546

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGGH  612
            +EEEIRLRSHEML ++DMQ LL++FSMGGH
Sbjct  547  TEEEIRLRSHEMLESDDMQQLLRVFSMGGH  576



>ref|XP_010656822.1| PREDICTED: uncharacterized protein LOC100264980 isoform X2 [Vitis 
vinifera]
Length=573

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 146/210 (70%), Gaps = 9/210 (4%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFK----NKKARNELPMGQVDYSNSLNNQLQQP  168
            KVYVD+LVKKAYENW    EYDGK+L SFK    +  +RNE  +G +DY  +L   L  P
Sbjct  301  KVYVDNLVKKAYENWNQVEEYDGKSL-SFKQIIRSSTSRNEHMIGSMDYPTALEPLLPLP  359

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
            R P    SE S +DPG+ +GGS YN+ +  RY+ Q  +++SSSR Q++   F      QL
Sbjct  360  RPPVAGPSEQSLMDPGISVGGSGYNDGLATRYTAQPQLVNSSSRAQFDGPSFP--SHDQL  417

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  522
            +NNS Q+Q+ R D++VGLALGPPQSS   F  + SS+Q +NLN F D  N RDKGV++Y 
Sbjct  418  VNNSHQIQSTRNDSSVGLALGPPQSSTMGFQALNSSIQHSNLNPFSDLLNNRDKGVDDYF  477

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGGH  612
            +EEEIRLRSHEML ++DMQ LL++FSMGGH
Sbjct  478  TEEEIRLRSHEMLESDDMQQLLRVFSMGGH  507



>ref|XP_007154785.1| hypothetical protein PHAVU_003G147800g [Phaseolus vulgaris]
 gb|ESW26779.1| hypothetical protein PHAVU_003G147800g [Phaseolus vulgaris]
Length=637

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 148/214 (69%), Gaps = 13/214 (6%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSF----KNKKARNELPMGQVDYSNSLNNQLQQP  168
            KVYVDSLVKKAYENW    +YDGK+L++     ++  + NEL +  +DY + L++QLQ P
Sbjct  365  KVYVDSLVKKAYENWEQVVDYDGKSLVNGNQNNRSIASENELRVESIDYGSGLDHQLQLP  424

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LP  V SE   ++ GM +GG  YN+++  RY  QS + +S+SR Q++ + +      QL
Sbjct  425  GLPVSVPSE-QQMNSGMSVGG--YNDSVVTRYPTQSLVSNSNSRSQFDGSLYL--SNDQL  479

Query  349  mnnsqqmqnARYDN-NVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  519
            ++N+ Q  N R D+  VGLALGPPQSS   F    SS+Q + LN F+DWS+ RDKGV+E+
Sbjct  480  ISNTHQTPNTRNDHGTVGLALGPPQSSTSGFHAGSSSIQPSTLNPFDDWSHNRDKGVDEF  539

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSM-GGHAS  618
             SEEEIRLRSHEML NEDMQHLL+LFSM GGH S
Sbjct  540  FSEEEIRLRSHEMLENEDMQHLLRLFSMGGGHGS  573



>gb|KHN22715.1| hypothetical protein glysoja_027603 [Glycine soja]
Length=631

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 141/209 (67%), Gaps = 8/209 (4%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            KVYVDSLVKKAYENW    +YDGK+L++ K   + NEL +  +DY + L++QLQ P LP 
Sbjct  364  KVYVDSLVKKAYENWDQVVDYDGKSLVNAK-IASENELRVESIDYGSGLDHQLQLPALPV  422

Query  181  PVQSEPSALDPGMLIGGSSYNEN-MGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnn  357
             V SE   ++ GM +GG  YN+N +  RY  QS I +SSSR Q++++ +  ++ Q + N 
Sbjct  423  SVPSE-QQINSGMPVGG--YNDNNIVIRYPTQSLIPNSSSRTQFDSSLYV-SNDQLISNA  478

Query  358  sqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEE  531
             Q    +     +GLALGPPQSS   F    SS+Q + +N F+DWS+ RDKG +E+ SEE
Sbjct  479  HQTQSTSNDRGPIGLALGPPQSSTSGFHAGSSSIQPSTINPFDDWSHNRDKGADEFFSEE  538

Query  532  EIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            EIR RSHEML NEDMQ LL+LFSMGG+ S
Sbjct  539  EIRFRSHEMLENEDMQQLLRLFSMGGNGS  567



>ref|XP_003542171.1| PREDICTED: uncharacterized protein LOC100790087 isoform X1 [Glycine 
max]
 ref|XP_006593544.1| PREDICTED: uncharacterized protein LOC100790087 isoform X2 [Glycine 
max]
Length=631

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 141/209 (67%), Gaps = 8/209 (4%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            KVYVDSLVKKAYENW    +YDGK+L++ K   + NEL +  +DY + L++QLQ P LP 
Sbjct  364  KVYVDSLVKKAYENWDQVVDYDGKSLVNAK-IASENELRVESIDYGSGLDHQLQLPALPV  422

Query  181  PVQSEPSALDPGMLIGGSSYNEN-MGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnn  357
             V SE   ++ GM +GG  YN+N +  RY  QS I +SSSR Q++++ +  ++ Q + N 
Sbjct  423  SVPSE-QQINSGMPVGG--YNDNNIVIRYPTQSLIPNSSSRTQFDSSLYV-SNDQLISNA  478

Query  358  sqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEE  531
             Q    +     +GLALGPPQSS   F    SS+Q + +N F+DWS+ RDKG +E+ SEE
Sbjct  479  HQTQSTSNDRGPIGLALGPPQSSTSGFHAGSSSIQPSTINPFDDWSHNRDKGADEFFSEE  538

Query  532  EIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            EIR RSHEML NEDMQ LL+LFSMGG+ S
Sbjct  539  EIRFRSHEMLENEDMQQLLRLFSMGGNGS  567



>ref|XP_011457401.1| PREDICTED: uncharacterized protein LOC101314910 [Fragaria vesca 
subsp. vesca]
Length=639

 Score =   170 bits (431),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 139/213 (65%), Gaps = 13/213 (6%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSF-KNKKA---RNELPMGQVDYSNSLNNQLQQP  168
            K+YVD+LVKKAYENW    EYDGK+LLS  KNK++    NE  M  + Y +S +   QQP
Sbjct  368  KLYVDTLVKKAYENWDQVIEYDGKSLLSNNKNKRSAADHNEFHMRSISYPSSSD---QQP  424

Query  169  RLPAPVQSEPSALDPGML-IGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqq  345
            RL   + SE + L    L IGG  YN+N+  RY  Q  I++S+SR Q+E T FA  D Q 
Sbjct  425  RLTNSIPSEQTLLSNSPLPIGG--YNDNLSTRYLTQQPIVNSNSRAQFEGTSFA-LDGQL  481

Query  346  lmnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  519
            + ++ Q    A   N VGLALG PQSS   F  + +SVQ + LN  +DW   R+KG +++
Sbjct  482  INSSHQPQNIANDANAVGLALGLPQSSTSGFQAINASVQPSTLNPLDDWGTNREKGGDDF  541

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
             SEE+IR+RSHEML NEDMQHLL++FSMGGH S
Sbjct  542  FSEEDIRIRSHEMLENEDMQHLLRIFSMGGHGS  574



>ref|XP_003549493.1| PREDICTED: uncharacterized protein LOC100803029 isoform X1 [Glycine 
max]
 ref|XP_006600498.1| PREDICTED: uncharacterized protein LOC100803029 isoform X2 [Glycine 
max]
Length=627

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 139/208 (67%), Gaps = 10/208 (5%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            KVYVDSLVKKAYENW    +YDGK+L++ K   + NEL +  +DY + L++QLQ P LP 
Sbjct  364  KVYVDSLVKKAYENWDQVVDYDGKSLVNAK-ISSENELHVESIDYGSGLDHQLQLPVLPV  422

Query  181  PVQSEPSALDPGMLIGGSSYNEN-MGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnn  357
             V SE   ++ G+ +GG  YN+N +  RY  QS I +SSSR Q++++ +  NDQ     +
Sbjct  423  SVPSE-QQINSGIPVGG--YNDNNIVTRYPTQSLIPNSSSRNQFDSSLYVSNDQLISNAH  479

Query  358  sqqmqnARYDNNVGLALGPPQSSCFPT-VGSSVQQTNLNSFEDWSNTRDKGVEEYLSEEE  534
              Q  +  +   VGLALGPPQSS      GSS   + +N F+DWS+ RDKG +E+ SEEE
Sbjct  480  QTQSTSNDH-GTVGLALGPPQSSTSGFHAGSS---SAINPFDDWSHNRDKGADEFFSEEE  535

Query  535  IRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            IR RSHEML NEDMQ LL+LFSMGGH S
Sbjct  536  IRFRSHEMLENEDMQQLLRLFSMGGHGS  563



>gb|KHN17575.1| hypothetical protein glysoja_005772 [Glycine soja]
Length=627

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 139/208 (67%), Gaps = 10/208 (5%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            KVYVDSLVKKAYENW    +YDGK+L++ K   + NEL +  +DY + L++QLQ P LP 
Sbjct  364  KVYVDSLVKKAYENWDQVVDYDGKSLVNAK-IASENELRVESIDYGSGLDHQLQLPVLPV  422

Query  181  PVQSEPSALDPGMLIGGSSYNEN-MGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnn  357
             V SE   ++ G+ +GG  YN+N +  RY  QS I +SSSR Q++++ +  NDQ     +
Sbjct  423  SVPSE-QQINSGIPVGG--YNDNNIVTRYPTQSLIPNSSSRNQFDSSLYVSNDQLISNAH  479

Query  358  sqqmqnARYDNNVGLALGPPQSSCFPT-VGSSVQQTNLNSFEDWSNTRDKGVEEYLSEEE  534
              Q  +  +   VGLALGPPQSS      GSS   + +N F+DWS+ RDKG +E+ SEEE
Sbjct  480  QTQSTSNDH-GTVGLALGPPQSSTSGFHAGSS---SAINPFDDWSHNRDKGADEFFSEEE  535

Query  535  IRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            IR RSHEML NEDMQ LL+LFSMGGH S
Sbjct  536  IRFRSHEMLENEDMQQLLRLFSMGGHGS  563



>gb|EYU20920.1| hypothetical protein MIMGU_mgv1a002870mg [Erythranthe guttata]
Length=629

 Score =   167 bits (424),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 135/210 (64%), Gaps = 27/210 (13%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFK----NKKARNELPMGQVDYS-NSLNNQLQQ  165
            K YVDS VKKAYENW    EYDGK+LL+ K    +  +R++  +GQVDYS +S++N L  
Sbjct  371  KGYVDSWVKKAYENWSQVVEYDGKSLLNLKQITNSSTSRSDFTLGQVDYSPHSVDNHLLP  430

Query  166  PRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqq  345
             RLP  V SEPS +D  MLIGG  YN+++ ARYS Q  +++S+SR  +E + F  ++ Q 
Sbjct  431  QRLPLSVPSEPSPVDQSMLIGGLGYNDDLTARYSTQPQLINSNSRNHFELSSFT-HNNQP  489

Query  346  lmnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWS-NTRDKGVEEYL  522
            + + +Q      YDN VGLAL P                     EDWS N  +KG++++L
Sbjct  490  IDHTNQIQDPTTYDNKVGLALSP--------------------LEDWSTNHNNKGIDDFL  529

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGGH  612
            SE+EIR+RSHEML NEDMQHLL+LFSMGG+
Sbjct  530  SEDEIRMRSHEMLENEDMQHLLRLFSMGGN  559



>ref|XP_003610155.1| Calmodulin-binding protein [Medicago truncatula]
 gb|AES92352.1| calmodulin-binding protein [Medicago truncatula]
Length=636

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 104/213 (49%), Positives = 143/213 (67%), Gaps = 12/213 (6%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNK----KARNELPMGQVDYSNSLNNQLQQP  168
            KVYVDSLVKKAY+NW    EYDGK+L+  +      ++ NEL +  +DY   L++QL  P
Sbjct  366  KVYVDSLVKKAYDNWEQVVEYDGKSLVDAEQNNNTVESENELHVESIDYDGGLDHQLLMP  425

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LP  V SE   ++  M +GG  +N +M  RY +Q+ I +SSSR  ++++ +       L
Sbjct  426  SLPMSVASE-QQINSAMPVGG--FNNSMVTRYPSQALIGNSSSRSHFDDSLYL--SNDHL  480

Query  349  mnnsqqmqnARYDNN-VGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  519
            + N+ Q Q++R D++ VGLALGPPQSS   F    SS+Q    N F+DWSN RDKGV+++
Sbjct  481  LGNAHQSQSSRNDHSTVGLALGPPQSSTSGFHAGSSSMQPPAPNPFDDWSNNRDKGVDDF  540

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
             SE+EIR+RS+E+L NEDMQHLL+LFSMGGH S
Sbjct  541  FSEDEIRVRSNEILENEDMQHLLRLFSMGGHPS  573



>ref|XP_010914125.1| PREDICTED: uncharacterized protein LOC105039615 [Elaeis guineensis]
 ref|XP_010914126.1| PREDICTED: uncharacterized protein LOC105039615 [Elaeis guineensis]
Length=638

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 135/215 (63%), Gaps = 12/215 (6%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            KV+VD+LVKKAY+NW+   EYDGK LLSF+  K     RNE      +Y  S + Q  Q 
Sbjct  361  KVFVDTLVKKAYDNWMHVIEYDGKALLSFRQSKKTIATRNEPSSASTNYPASYDQQSSQQ  420

Query  169  RLPAPVQSEPSALDPGMLIGGSS-YNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqq  345
             +   V  E SA+D G+++G S+ YN N   RY   S  + S+  MQYE+  FAP  Q  
Sbjct  421  HMSTAVPMEHSAVDGGVVVGASAGYNGNQVTRYVAHSQHVDSNVHMQYESNSFAPQSQLN  480

Query  346  lmnnsqqmqnARYDNNVGLALGPPQSS--CFPTVGSSVQQTNLNSFEDWSNTRD-KGVEE  516
              +   Q+     +++ GLALGPPQ +   F  +G SV  TNLNS++DWS  RD + VE+
Sbjct  481  GSSQQTQVTR---NDSTGLALGPPQQANLGFQPLGQSVLSTNLNSYDDWSRQRDIQAVED  537

Query  517  Y-LSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            + LSEEEIR+RSHE+L NE+MQ LL++FSMGG ++
Sbjct  538  FNLSEEEIRMRSHEILENEEMQQLLRVFSMGGASA  572



>ref|XP_010536924.1| PREDICTED: uncharacterized protein LOC104811802 [Tarenaya hassleriana]
Length=646

 Score =   165 bits (417),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 97/211 (46%), Positives = 133/211 (63%), Gaps = 10/211 (5%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            KVYVD LVKKAYENW    EYDGK+L+SFK  K    +R +L M   +YS ++++ +Q  
Sbjct  364  KVYVDGLVKKAYENWNQVIEYDGKSLMSFKQPKKSGISRTDLAMAPANYSTTIDHSMQFH  423

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LPA V +  +++   + IGG  +N+++  RYS Q+ +++S+ R Q+E    AP DQ   
Sbjct  424  ELPASVPANQASVHSELAIGG--FNQSLATRYSTQNQLLNSNPRTQFEFASSAPQDQFVD  481

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSC---FPTVGSSVQQTNLNSFEDWSNTRDKGV-EE  516
              +  Q          GLALGPP SS    +  + +S Q  NLN FE+WSN R++G  ++
Sbjct  482  SLHQTQSNINDQSAAAGLALGPPHSSTGGGYQNMSTSNQTENLNPFEEWSNHRERGGGDD  541

Query  517  YLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            + SEEEIR RSHEML NEDMQ LL+LFSMGG
Sbjct  542  FFSEEEIRSRSHEMLENEDMQQLLRLFSMGG  572



>ref|XP_010913644.1| PREDICTED: uncharacterized protein LOC105039256 [Elaeis guineensis]
 ref|XP_010913645.1| PREDICTED: uncharacterized protein LOC105039256 [Elaeis guineensis]
 ref|XP_010913646.1| PREDICTED: uncharacterized protein LOC105039256 [Elaeis guineensis]
Length=651

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/211 (46%), Positives = 134/211 (64%), Gaps = 19/211 (9%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFK-NKKARNELPMGQVDYSNSLNNQLQQPRLP  177
            KV+ D+LVKKAY+NWL   EYDGK LL+FK NKKA         +Y  S + Q+ Q  + 
Sbjct  374  KVFADTLVKKAYDNWLHVLEYDGKALLNFKQNKKAT------AANYPVSYDQQISQTNMS  427

Query  178  APVQSEPSALDPGMLIGGSS----YNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqq  345
             PV  E  A+D GM +GGS+    Y+ N   R S+    +SS + + +E+  F P +Q  
Sbjct  428  VPVPLEQPAVDAGMGVGGSTISAGYSVNQVTRCSSHPQNVSSDAHIHFESAPFIPQNQYV  487

Query  346  lmnnsqqmqnARYDNNVGLALGPPQ--SSCFPTVGSSVQQTNLNSFEDWSNTRD-KGVEE  516
              ++       + +++VGL LGPPQ  S  F  +GSS+Q +NLNS++DWS  RD +G+++
Sbjct  488  GSSHQ-----TQRNDSVGLELGPPQQESIGFQQIGSSMQPSNLNSYDDWSRQRDSRGIDD  542

Query  517  YLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            + SEEEIR RSHEML NEDMQ LL++FSMGG
Sbjct  543  FFSEEEIRTRSHEMLENEDMQQLLRVFSMGG  573



>ref|XP_008800271.1| PREDICTED: uncharacterized protein LOC103714689 [Phoenix dactylifera]
Length=641

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 135/211 (64%), Gaps = 19/211 (9%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFK-NKKARNELPMGQVDYSNSLNNQLQQPRLP  177
            KV+ D+LVKKAY+NW+   EYDGK LL+ K NKKA         +Y    + Q+ Q  L 
Sbjct  374  KVFADALVKKAYDNWVHVIEYDGKALLNSKQNKKAT------AANYPVLYDQQISQTNLS  427

Query  178  APVQSEPSALDPGMLIGGSS----YNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqq  345
             PV  E  ++D  M IGGS+    Y+ N G RYS+    +S+++ +Q+E+T F P +Q  
Sbjct  428  VPVPLEQPSVDAEMAIGGSTISAGYSGNQGTRYSSHPQNVSTNAHIQFESTSFIPENQYV  487

Query  346  lmnnsqqmqnARYDNNVGLALGPPQ--SSCFPTVGSSVQQTNLNSFEDWSNTRD-KGVEE  516
              ++       + ++ VGL LGPPQ  S  F  +GSS+Q +NLNS++DWS  RD + +++
Sbjct  488  GSSHQ-----TQRNDGVGLELGPPQQESIGFQQIGSSIQPSNLNSYDDWSRQRDSRRIDD  542

Query  517  YLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            + SEEEIR+RSHEML NEDMQ LL++FSMGG
Sbjct  543  FFSEEEIRMRSHEMLENEDMQQLLRVFSMGG  573



>ref|XP_008805417.1| PREDICTED: uncharacterized protein LOC103718396 [Phoenix dactylifera]
 ref|XP_008805418.1| PREDICTED: uncharacterized protein LOC103718396 [Phoenix dactylifera]
 ref|XP_008805420.1| PREDICTED: uncharacterized protein LOC103718396 [Phoenix dactylifera]
Length=654

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 96/218 (44%), Positives = 133/218 (61%), Gaps = 15/218 (7%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            KV+VD+LVKKAY+NW+   EYDGK LLSF+  K     RNE P    +Y    + Q  Q 
Sbjct  374  KVFVDTLVKKAYDNWMHVIEYDGKALLSFRQCKKTTATRNEPPSSSTNYPALYDQQSSQQ  433

Query  169  RLPAPVQSEPSALDPGMLIGG----SSYNENMGARYSNQSHIMSSSSRMQYENTQFAPnd  336
             +   V +E  A+D G+++GG    + YN N   RY+       S+  M YE+  FAP  
Sbjct  434  HMSTTVPTELPAVDRGVVVGGDAASAGYNGNQVNRYAAHPQHADSNVHMHYESNSFAPQS  493

Query  337  qqqlmnnsqqmqnARYDNNVGLALGPPQSS--CFPTVGSSVQQTNLNSFEDWSNTRD-KG  507
            Q    +   Q+     +++ GLALGPPQ +   F  +G S+  TNL+S++DWS  RD + 
Sbjct  494  QLNGSSQQTQVTR---NDSTGLALGPPQQANLGFQPLGQSILSTNLHSYDDWSRQRDVQA  550

Query  508  VEEY-LSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            VE++ LSEEEIR+RSHE+L NE+MQ LL++FSMGG +S
Sbjct  551  VEDFNLSEEEIRMRSHEILENEEMQQLLRVFSMGGASS  588



>ref|XP_010929241.1| PREDICTED: uncharacterized protein LOC105050786 isoform X2 [Elaeis 
guineensis]
Length=640

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 134/217 (62%), Gaps = 14/217 (6%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK---ARNELPMGQVDYSNSLNNQLQQPR  171
            KV+ D+LVKKAY+NW+   EYDG+ LL+F+  K    RNE P    +   S + Q  Q  
Sbjct  361  KVFADALVKKAYDNWMHVIEYDGEALLNFRQSKKTATRNEHPSASKNCPASYDQQACQQH  420

Query  172  LPAPVQSEPSALDPGMLIGGSS----YNENMGARYSNQSHIMSSSSRMQYENTQFAPndq  339
            +   V  E  A+D G++ GG++    YNEN   RYS     + SS+ MQYE+  FAP  Q
Sbjct  421  MSTTVPGEHPAVDRGVVAGGNAASAGYNENQVNRYSAHPQHVDSSTHMQYESNSFAPQSQ  480

Query  340  qqlmnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRD-KGV  510
                +   Q+     +++ GLALGPPQ +   F  +G S+   NLN+++DWS  RD + V
Sbjct  481  FNGSSQQMQITR---NDSTGLALGPPQQATLGFQPLGQSILSANLNTYDDWSRQRDVQAV  537

Query  511  EEY-LSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            E++ LSEEEIR+RSHE+L NE+MQ LL++FSMGG ++
Sbjct  538  EDFNLSEEEIRMRSHEILENEEMQQLLRVFSMGGAST  574



>ref|XP_010929240.1| PREDICTED: uncharacterized protein LOC105050786 isoform X1 [Elaeis 
guineensis]
Length=653

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 134/217 (62%), Gaps = 14/217 (6%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK---ARNELPMGQVDYSNSLNNQLQQPR  171
            KV+ D+LVKKAY+NW+   EYDG+ LL+F+  K    RNE P    +   S + Q  Q  
Sbjct  374  KVFADALVKKAYDNWMHVIEYDGEALLNFRQSKKTATRNEHPSASKNCPASYDQQACQQH  433

Query  172  LPAPVQSEPSALDPGMLIGGSS----YNENMGARYSNQSHIMSSSSRMQYENTQFAPndq  339
            +   V  E  A+D G++ GG++    YNEN   RYS     + SS+ MQYE+  FAP  Q
Sbjct  434  MSTTVPGEHPAVDRGVVAGGNAASAGYNENQVNRYSAHPQHVDSSTHMQYESNSFAPQSQ  493

Query  340  qqlmnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRD-KGV  510
                +   Q+     +++ GLALGPPQ +   F  +G S+   NLN+++DWS  RD + V
Sbjct  494  FNGSSQQMQITR---NDSTGLALGPPQQATLGFQPLGQSILSANLNTYDDWSRQRDVQAV  550

Query  511  EEY-LSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            E++ LSEEEIR+RSHE+L NE+MQ LL++FSMGG ++
Sbjct  551  EDFNLSEEEIRMRSHEILENEEMQQLLRVFSMGGAST  587



>ref|XP_008808337.1| PREDICTED: uncharacterized protein LOC103720426 [Phoenix dactylifera]
Length=641

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 94/218 (43%), Positives = 132/218 (61%), Gaps = 15/218 (7%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNS----LNNQLQQP  168
            KV+ D+LVKKAY+NW+   EYDGK+LLSF+  K       GQ   S +     + +  Q 
Sbjct  361  KVFADTLVKKAYDNWMHVIEYDGKSLLSFRQSKKTTATRSGQPSASKTHTALYDQEACQQ  420

Query  169  RLPAPVQSEPSALDPGMLIGG----SSYNENMGARYSNQSHIMSSSSRMQYENTQFAPnd  336
             +   V +E  A+D G++ GG    + YN N   RYS     + S+  MQYE++ FAP  
Sbjct  421  HMSTTVPAEHPAVDRGVVAGGDAASAGYNGNQVNRYSAHPQHVDSNIHMQYESSSFAPQS  480

Query  337  qqqlmnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRD-KG  507
                 +   Q+     +++ GLALGPPQ +   F  +G S+  TNLNS++DWS  RD + 
Sbjct  481  LLNGSSQQTQITR---NDSTGLALGPPQQATLGFQPLGQSILSTNLNSYDDWSRQRDVQA  537

Query  508  VEEY-LSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            VE++ LSEEEIR+RSHE+L NE+MQ LL++FSMGG +S
Sbjct  538  VEDFNLSEEEIRMRSHEILENEEMQQLLRVFSMGGASS  575



>ref|XP_010688497.1| PREDICTED: uncharacterized protein LOC104902420 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010688498.1| PREDICTED: uncharacterized protein LOC104902420 [Beta vulgaris 
subsp. vulgaris]
Length=645

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 91/212 (43%), Positives = 131/212 (62%), Gaps = 19/212 (9%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFK----NKKARNELPMGQVDYSNSLN-NQLQQ  165
            KVY+D+LVKKAY+NW    EYDGK L++ K     + ++N+L M  + YSN ++ NQL  
Sbjct  379  KVYIDTLVKKAYDNWHQVIEYDGKALMNSKQTRRTRSSQNDLSMNTISYSNHIDDNQLAL  438

Query  166  PRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqq  345
            PRLP  V +E + ++  +   G  YN N+  R+ NQS +MSS+S  Q+E+T ++ +    
Sbjct  439  PRLPVAVPTEQALVENSVAAPG--YNNNLANRFPNQSQLMSSNSHNQFESTSYSQHGLIS  496

Query  346  lmnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  519
              +    +     DN  GLALGPPQS+   F  +  S Q  N+N F+DWS+ +       
Sbjct  497  SSSEQTHIIGN--DNRAGLALGPPQSAVPGFQVMQQS-QPPNINPFDDWSHNQ-------  546

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
            +SE+EIR RSHE+L ++DMQ LL+LFSMGGH 
Sbjct  547  ISEDEIRNRSHELLESDDMQQLLRLFSMGGHV  578



>gb|EYU20919.1| hypothetical protein MIMGU_mgv1a002870mg [Erythranthe guttata]
Length=611

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 121/208 (58%), Gaps = 43/208 (21%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFK----NKKARNELPMGQVDYS-NSLNNQLQQ  165
            K YVDS VKKAYENW    EYDGK+LL+ K    +  +R++  +GQVDYS +S++N L  
Sbjct  371  KGYVDSWVKKAYENWSQVVEYDGKSLLNLKQITNSSTSRSDFTLGQVDYSPHSVDNHLLP  430

Query  166  PRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqq  345
             RLP  V SEPS +D  MLIGG  YN+++ ARYS Q  +++S+SR  +E + F       
Sbjct  431  QRLPLSVPSEPSPVDQSMLIGGLGYNDDLTARYSTQPQLINSNSRNHFELSSFT------  484

Query  346  lmnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLS  525
                          NN                   +  T  N  +D +   +KG++++LS
Sbjct  485  -------------HNN-----------------QPIDHT--NQIQDPTTYDNKGIDDFLS  512

Query  526  EEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            E+EIR+RSHEML NEDMQHLL+LFSMGG
Sbjct  513  EDEIRMRSHEMLENEDMQHLLRLFSMGG  540



>ref|XP_006401191.1| hypothetical protein EUTSA_v10012939mg [Eutrema salsugineum]
 gb|ESQ42644.1| hypothetical protein EUTSA_v10012939mg [Eutrema salsugineum]
Length=642

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 123/214 (57%), Gaps = 19/214 (9%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQP-RLP  177
            KV+VD LVKKAYENW    EYDGK+LL  K  K    L + Q + +N     +  P ++ 
Sbjct  364  KVFVDGLVKKAYENWNLVIEYDGKSLLDLKQPK---RLAITQTEPANYSTVAIDHPMQMA  420

Query  178  APVQSEPSALDPGML---IGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
                S P+   P +    IGG  Y++ M  RY+ Q  +++S++R Q+E    AP    Q 
Sbjct  421  GHSSSVPANQCPVLSDYPIGG--YDQAMVTRYTPQPQLLNSNARAQFE---VAPGTTTQD  475

Query  349  mnnsqqmqnARYDNNVG----LALGPPQSSC--FPTV-GSSVQQTNLNSFEDWSNTRDKG  507
                   Q     NN      LALGPPQSS   F  +  SSV Q NLN FEDWSN R++G
Sbjct  476  QLMGNLHQTQSIINNQNVTGLLALGPPQSSTSGFQDINSSSVHQANLNPFEDWSNHRERG  535

Query  508  VEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
             EE+ SEEEIRLRSHEML NEDMQ  L+LFSMGG
Sbjct  536  AEEFFSEEEIRLRSHEMLENEDMQQFLRLFSMGG  569



>ref|XP_009794879.1| PREDICTED: uncharacterized protein LOC104241635 [Nicotiana sylvestris]
Length=621

 Score =   145 bits (365),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 127/211 (60%), Gaps = 23/211 (11%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            KVYVD+LVKKAY+NW+   EYDGK+LLS    K    ++N+L +G  ++S S + Q+  P
Sbjct  361  KVYVDTLVKKAYDNWMHVVEYDGKSLLSLGQNKTSVASQNDLTIGSQNHSTSFDQQINLP  420

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LPA + SE  A++ G+ +GG  YNE++ +RY+ Q   M+ +  MQ     F P +    
Sbjct  421  SLPASISSEQPAMNTGLNMGG--YNESLSSRYTMQPQHMNLNGSMQLNGASFPPQNHLLG  478

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  528
             +   Q     + +   LAL PPQ    P++ S    +  N +        KG E++L+E
Sbjct  479  TSQQAQP----HGSESMLALRPPQ----PSMSSYFAASTPNPY--------KGAEDFLTE  522

Query  529  EEIRLRSHEML*NEDMQHLLQLFSMG-GHAS  618
            EEIR+RSHEML NEDMQHLL++FSMG GHAS
Sbjct  523  EEIRMRSHEMLENEDMQHLLRIFSMGQGHAS  553



>ref|XP_010092630.1| hypothetical protein L484_006392 [Morus notabilis]
 gb|EXB51819.1| hypothetical protein L484_006392 [Morus notabilis]
Length=650

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 95/211 (45%), Positives = 127/211 (60%), Gaps = 26/211 (12%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFK--NKKARNEL--PMGQVDYSNSLNNQLQQP  168
            KVYVD+LVKKAY+NW+   EYDGK+LLS +  N    +E+  P+   DYSNS + Q   P
Sbjct  390  KVYVDTLVKKAYDNWMHVIEYDGKSLLSSQSHNSSCASEMITPIASQDYSNSFDQQFTLP  449

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LP  V SE   +DPG+    + YN+ M   +S  S   + ++ + +  + FA  +Q   
Sbjct  450  ALPVAVPSEQPTIDPGL----TGYNDGMATSFSIPSQNANLNAPVSFVGSSFALQNQLPS  505

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  522
             +N  Q+Q +    NV L LGPPQSS   F  VG+S    NL SF        +GV+++ 
Sbjct  506  TSNQTQLQRS---ENV-LTLGPPQSSTSGFQNVGAS----NLTSF--------RGVDDFF  549

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
            SEEEIR+RSHEML NEDMQHLL +F+MGGH 
Sbjct  550  SEEEIRMRSHEMLENEDMQHLLHIFNMGGHG  580



>ref|XP_009589610.1| PREDICTED: uncharacterized protein LOC104086953 [Nicotiana tomentosiformis]
Length=619

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 127/211 (60%), Gaps = 26/211 (12%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            KVYVD+LVKKAYENW+   EYDGK+LLS    K    ++N+L +G  ++S S + Q+  P
Sbjct  361  KVYVDTLVKKAYENWMHVVEYDGKSLLSLGQNKPSVTSQNDLTIGSQNHSTSFDQQINLP  420

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LPA + SE  A++ G+ +GG  YN+++ +RY+ Q H+   +  MQ     F P +    
Sbjct  421  SLPASISSEQPAMNTGLNMGG--YNDSLSSRYTMQPHL---NGNMQVNGASFPPQNHLLG  475

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  528
             +   Q     + +   LAL PPQ    P++ S    +  N +        +G E++L+E
Sbjct  476  TSQQAQP----HGSESMLALRPPQ----PSMSSYFAASTPNPY--------RGAEDFLTE  519

Query  529  EEIRLRSHEML*NEDMQHLLQLFSMG-GHAS  618
            EEIR+RSHEML NEDMQHLL++FSMG GHAS
Sbjct  520  EEIRMRSHEMLENEDMQHLLRIFSMGQGHAS  550



>emb|CAB71126.1| calmodulin-binding protein [Cicer arietinum]
Length=282

 Score =   138 bits (347),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 126/213 (59%), Gaps = 27/213 (13%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYS--NSLNNQLQ  162
            KVYVD+LVKKAYENW+   EYDGK+LL++   +    ++ ++P+G  DYS  NSL+ Q+ 
Sbjct  17   KVYVDTLVKKAYENWMHVIEYDGKSLLNYNQNRNLGMSQPQVPVGSHDYSISNSLDQQIS  76

Query  163  QPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqq  342
             P LP PV +   ++DP   +GG  Y+      +S Q H  + +S +Q+ NT F   +  
Sbjct  77   IPSLPVPVPTGQPSMDPSATVGG--YHHGTTTGFSIQPHNSNLNSSIQFGNTAFPLQNLL  134

Query  343  qlmnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEE  516
               ++  Q+      N+  L+LGPPQS+   F TVG              S+   +G E+
Sbjct  135  TSASHQSQLPT----NDNELSLGPPQSATPGFQTVG-------------ISDPTYRGFED  177

Query  517  YLSEEEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
            +  EE+IR+RSHEML NEDMQHLL++F+MGG +
Sbjct  178  FFPEEDIRMRSHEMLENEDMQHLLRIFNMGGQS  210



>gb|KDP20890.1| hypothetical protein JCGZ_21361 [Jatropha curcas]
Length=623

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 125/209 (60%), Gaps = 20/209 (10%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            KV+VD LVKKAYENW+   EYDGKTLL FK  +    ++ ++P  Q DY NS ++Q+  P
Sbjct  359  KVHVDELVKKAYENWMHVIEYDGKTLLDFKENENIAASQIDIPTSQQDYLNSYDHQVTLP  418

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             +  PV  E  A+D G  +GG  YNE+M AR+S Q H  + +   Q++        Q  L
Sbjct  419  TISVPVPPEQPAMDSGPTVGG--YNESMAARFSMQPHTGNQNMPFQFDAASLP--LQNPL  474

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  528
             + SQQ Q  R DN    ALGPPQSS     G  V   NL S+        +G E++L E
Sbjct  475  GSTSQQAQLPRSDNIP--ALGPPQSSTSSFQG--VCAPNLTSY--------RGAEDFLQE  522

Query  529  EEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
            E+IR+RSHEML +EDMQHLL++F+MGG  
Sbjct  523  EDIRMRSHEMLESEDMQHLLRIFNMGGQG  551



>ref|XP_006384008.1| hypothetical protein POPTR_0004s03510g [Populus trichocarpa]
 gb|ERP61805.1| hypothetical protein POPTR_0004s03510g [Populus trichocarpa]
Length=640

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 126/211 (60%), Gaps = 24/211 (11%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA----RNELPMGQVDYSNSLNNQLQQP  168
            KVYVDSLVKKAY+NW+   EYDGK+LL FK  +     +NE+P  Q ++ NS ++Q+  P
Sbjct  376  KVYVDSLVKKAYDNWMHAIEYDGKSLLDFKMNQGIDALQNEVPSVQQEFLNSYDHQVTLP  435

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             +  PV SE   +D G+ +GG  YN++M  R+S      + ++  Q++ T     +    
Sbjct  436  TISVPVPSEQPVMDSGLAVGG--YNDDMATRFSMHPQNGNFNTSFQFDATSLPSQNPLVH  493

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  522
             +   Q+  +  DN   LALG PQ+S   F + GSS    NLNS+        KG E++ 
Sbjct  494  TSQQIQVPGS--DNL--LALGRPQTSTPGFQSFGSS----NLNSY--------KGTEDFF  537

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
            SEEEIR RSHEML N+DMQHLL++F+MGG  
Sbjct  538  SEEEIRTRSHEMLENDDMQHLLRIFNMGGQG  568



>ref|XP_010646160.1| PREDICTED: uncharacterized protein LOC100256775 [Vitis vinifera]
Length=631

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 131/214 (61%), Gaps = 28/214 (13%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA----RNELPMGQVDYSNSLNNQLQQP  168
            KV+VD+LVKKAY+NW+S  EYDGK+LL+F   K+    + E+ MG  DY NS ++QL  P
Sbjct  369  KVFVDTLVKKAYDNWISVVEYDGKSLLNFNQSKSSGSSQTEVAMGPQDYPNSFDHQLTLP  428

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LP  V  +  ++ P + +GG  YN+NM  RY  QS  ++ ++ MQ++ T F P   Q +
Sbjct  429  SLPVSVPPQQPSVGPSITVGG--YNDNMPTRYPIQSQNVNLNAPMQFDGTSF-PLQNQLI  485

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  522
             N  Q    +   N   LALGPP ++   F +VG+S    NLN            V+++ 
Sbjct  486  GNPHQVQLPS---NESMLALGPPPATTPGFQSVGTS----NLNY----------RVDDFF  528

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMG--GHAS  618
             E+EIR+RSHEML N+DMQHLL++F+MG  GHAS
Sbjct  529  PEDEIRMRSHEMLENDDMQHLLRIFNMGNHGHAS  562



>emb|CBI23322.3| unnamed protein product [Vitis vinifera]
Length=636

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 131/214 (61%), Gaps = 28/214 (13%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA----RNELPMGQVDYSNSLNNQLQQP  168
            KV+VD+LVKKAY+NW+S  EYDGK+LL+F   K+    + E+ MG  DY NS ++QL  P
Sbjct  369  KVFVDTLVKKAYDNWISVVEYDGKSLLNFNQSKSSGSSQTEVAMGPQDYPNSFDHQLTLP  428

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LP  V  +  ++ P + +GG  YN+NM  RY  QS  ++ ++ MQ++ T F P   Q +
Sbjct  429  SLPVSVPPQQPSVGPSITVGG--YNDNMPTRYPIQSQNVNLNAPMQFDGTSF-PLQNQLI  485

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  522
             N  Q    +   N   LALGPP ++   F +VG+S    NLN            V+++ 
Sbjct  486  GNPHQVQLPS---NESMLALGPPPATTPGFQSVGTS----NLNY----------RVDDFF  528

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMG--GHAS  618
             E+EIR+RSHEML N+DMQHLL++F+MG  GHAS
Sbjct  529  PEDEIRMRSHEMLENDDMQHLLRIFNMGNHGHAS  562



>emb|CAN66517.1| hypothetical protein VITISV_001611 [Vitis vinifera]
Length=637

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 131/214 (61%), Gaps = 28/214 (13%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA----RNELPMGQVDYSNSLNNQLQQP  168
            KV+VD+LVKKAY+NW+S  EYDGK+LL+F   K+    + E+ MG  DY NS ++QL  P
Sbjct  369  KVFVDTLVKKAYDNWISVVEYDGKSLLNFNQSKSSGSSQTEVAMGPQDYPNSFDHQLTLP  428

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LP  V  +  ++ P + +GG  YN+NM  RY  QS  ++ ++ MQ++ T F P   Q +
Sbjct  429  SLPVSVPPQQPSVGPSITVGG--YNDNMPTRYPIQSQNVNLNAPMQFDGTSF-PLQNQLI  485

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  522
             N  Q    +   N   LALGPP ++   F +VG+S    NLN            V+++ 
Sbjct  486  GNPHQVQLPS---NESMLALGPPPATTPGFQSVGTS----NLNY----------RVDDFF  528

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMG--GHAS  618
             E+EIR+RSHEML N+DMQHLL++F+MG  GHAS
Sbjct  529  PEDEIRMRSHEMLENDDMQHLLRIFNMGNHGHAS  562



>ref|XP_006845603.1| hypothetical protein AMTR_s00019p00206980 [Amborella trichopoda]
 gb|ERN07278.1| hypothetical protein AMTR_s00019p00206980 [Amborella trichopoda]
Length=630

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 90/210 (43%), Positives = 131/210 (62%), Gaps = 20/210 (10%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFK-NKKARNELPMGQVDYSNSLNNQLQQPRLP  177
            K++VD+LVK+AY+NW+   EYDGK LL++K ++KA +       +YS +L+ Q    R P
Sbjct  374  KLHVDTLVKRAYDNWMHVVEYDGKALLNYKQSRKASSS------NYSIALDQQPSITRAP  427

Query  178  APVQSEPSALDPGMLIGG---SSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
              V  E S+++    +GG   SSY EN   RYS+Q   +++++++Q+ N  FA     Q 
Sbjct  428  VQVPMEQSSVNAMSAVGGASISSYGENPATRYSSQPDQLTANNQVQFNNNHFA----TQQ  483

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRD-KGVEEYLS  525
                    +A     VGLALGPP S+ F T+  +V QT     +DW+  RD +G+++Y +
Sbjct  484  NQLVSTSHHAPQGPQVGLALGPPLSTGFQTM--NVGQT---PADDWARHRDARGLDDYFT  538

Query  526  EEEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
            EEEIR+RS EML NEDMQHLL+LFSMGG+ 
Sbjct  539  EEEIRMRSSEMLENEDMQHLLRLFSMGGNT  568



>ref|XP_002866219.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42478.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata]
Length=646

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 118/210 (56%), Gaps = 12/210 (6%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            KVYVD LVKKAYE+W    EYDGK+LL  K  +    L +   D  N     +  P   A
Sbjct  365  KVYVDGLVKKAYESWNLVIEYDGKSLLDLKQPQ---RLSITHTDLENYSTAAIDHPMQMA  421

Query  181  PVQSEPSALDPGML----IGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
               S   A  P +L    IGG  Y++ +  RY +Q  +++S+ R Q+E    +    Q +
Sbjct  422  GHSSSMPANQPPVLSDFAIGG--YDQTLATRYHSQPQLLNSNPRAQFEVASCSTAQDQFM  479

Query  349  mnnsqqmqnARYDNNVGLALGPPQ--SSCFPTVGSS-VQQTNLNSFEDWSNTRDKGVEEY  519
             N           N  GLALGPPQ  +S +  + SS V Q NLN  EDWSN R++G E++
Sbjct  480  GNLHHTQSTIHNQNMNGLALGPPQPSTSGYQNINSSTVHQANLNHLEDWSNPRERGPEDF  539

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
             SEEEIRLRSHEML +EDMQ  L+LFSMGG
Sbjct  540  FSEEEIRLRSHEMLESEDMQQFLRLFSMGG  569



>ref|XP_011001128.1| PREDICTED: uncharacterized protein LOC105108501 [Populus euphratica]
Length=637

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 125/211 (59%), Gaps = 24/211 (11%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA----RNELPMGQVDYSNSLNNQLQQP  168
            KVYVDSLVKKAY+NW+   EYDGK+LL FK  +     +NE+P  Q ++ NS ++Q+  P
Sbjct  373  KVYVDSLVKKAYDNWMHVIEYDGKSLLDFKMNQGIDALKNEVPSVQQEFLNSYDHQVTLP  432

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             +P PV SE   +D G+ +GG  YN++M  R+S      + ++  Q++ T     +    
Sbjct  433  TIPVPVPSEQPVMDSGLTVGG--YNDDMATRFSMHPQNGNLNTPFQFDATSLPSQNPMVH  490

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  522
             +   Q+  +  DN   LALGP Q+S   F + GSS     LN +        KG E++ 
Sbjct  491  TSQQIQVPGS--DNL--LALGPGQTSIPGFQSFGSS----TLNPY--------KGTEDFF  534

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
            SEEEIR RSHEML N+DMQHLL++F+MGG  
Sbjct  535  SEEEIRTRSHEMLENDDMQHLLRIFNMGGQG  565



>ref|XP_008224944.1| PREDICTED: uncharacterized protein LOC103324639 isoform X1 [Prunus 
mume]
 ref|XP_008224945.1| PREDICTED: uncharacterized protein LOC103324639 isoform X1 [Prunus 
mume]
Length=639

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/208 (43%), Positives = 121/208 (58%), Gaps = 29/208 (14%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  168
            KVYVD LVKKAY+NW+   EYDGK+LL+FK +K+      E+P+   DY NS + Q   P
Sbjct  370  KVYVDGLVKKAYDNWMHVMEYDGKSLLNFKQQKSPEASLPEVPLATQDYPNSFD-QFTLP  428

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LP  V +E   +D G+ +GG  YN++M  R+S Q+  ++ S+ +Q +   F        
Sbjct  429  SLPVSVSAERPTMDSGLSVGG--YNDDMATRFSTQN--VNLSAPIQLDGLAFP-----LQ  479

Query  349  mnnsqqmqnARYDNNVG-LALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  519
                     A +  N   LALGPPQSS   F  +G+S    NL S+        +GVE+ 
Sbjct  480  NQLPSTSNQAHFQRNENMLALGPPQSSTSGFQNIGTS----NLTSY--------RGVEDL  527

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSM  603
              EEEIR+RSHEML NEDMQHLL++F+M
Sbjct  528  FPEEEIRMRSHEMLENEDMQHLLRIFNM  555



>ref|XP_008224946.1| PREDICTED: uncharacterized protein LOC103324639 isoform X2 [Prunus 
mume]
 ref|XP_008224947.1| PREDICTED: uncharacterized protein LOC103324639 isoform X2 [Prunus 
mume]
Length=638

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/208 (43%), Positives = 121/208 (58%), Gaps = 29/208 (14%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  168
            KVYVD LVKKAY+NW+   EYDGK+LL+FK +K+      E+P+   DY NS + Q   P
Sbjct  369  KVYVDGLVKKAYDNWMHVMEYDGKSLLNFKQQKSPEASLPEVPLATQDYPNSFD-QFTLP  427

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LP  V +E   +D G+ +GG  YN++M  R+S Q+  ++ S+ +Q +   F        
Sbjct  428  SLPVSVSAERPTMDSGLSVGG--YNDDMATRFSTQN--VNLSAPIQLDGLAFP-----LQ  478

Query  349  mnnsqqmqnARYDNNVG-LALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  519
                     A +  N   LALGPPQSS   F  +G+S    NL S+        +GVE+ 
Sbjct  479  NQLPSTSNQAHFQRNENMLALGPPQSSTSGFQNIGTS----NLTSY--------RGVEDL  526

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSM  603
              EEEIR+RSHEML NEDMQHLL++F+M
Sbjct  527  FPEEEIRMRSHEMLENEDMQHLLRIFNM  554



>emb|CDY69506.1| BnaCnng63910D [Brassica napus]
Length=654

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 119/206 (58%), Gaps = 7/206 (3%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNS-LNNQLQQPRLP  177
            KVYVD LVKKAY+NW    EYDGK+L+  K  +        + +YS + +N+ +Q     
Sbjct  372  KVYVDGLVKKAYDNWNLVIEYDGKSLIDMKQPQRSGITQADEANYSTAAINHPMQMAGHS  431

Query  178  APVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnn  357
            + V +    +     IGG  Y++ M  RY     ++ S+ R Q+E    A    Q + N 
Sbjct  432  SSVPANQPPVLSDFAIGG--YDQTMATRYPLHPQLVVSNPRAQFEVASGATTQDQLMGNL  489

Query  358  sqqmqnARYDNNVG-LALGPPQSSC--FPTV-GSSVQQTNLNSFEDWSNTRDKGVEEYLS  525
             Q   +    N  G LALGPPQ+S   +  +  SSVQQ NLN FEDWSN R++G EE+ S
Sbjct  490  HQGQSSMNNQNMNGMLALGPPQASTSGYQNINSSSVQQANLNPFEDWSNHRERGAEEFFS  549

Query  526  EEEIRLRSHEML*NEDMQHLLQLFSM  603
            EEEIRLRSHEML NEDMQ  L+LFSM
Sbjct  550  EEEIRLRSHEMLENEDMQQFLRLFSM  575



>emb|CDY49721.1| BnaA10g11510D [Brassica napus]
Length=654

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 118/209 (56%), Gaps = 13/209 (6%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            KVYVD LVKKAY+NW    EYDGK+L+  K  +    L + Q D +N     +  P   A
Sbjct  372  KVYVDGLVKKAYDNWNLVIEYDGKSLIDMKQPQ---RLGITQADEANYSTAAINHPMQMA  428

Query  181  PVQSEPSALDPGML----IGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
               S   A  P +L    IGG  Y++ M  RY     ++ S+ R Q+E         Q +
Sbjct  429  GQSSSVPANQPPVLSDFAIGG--YDQTMATRYPPYPQLLVSNPRAQFEVASGGTAQDQLM  486

Query  349  mnnsqqmqnARYDNNVG-LALGPPQSSC--FPTV-GSSVQQTNLNSFEDWSNTRDKGVEE  516
             N  Q   +    N  G LALGPPQ+S   +  +  SSVQQ NLN FEDWSN R++G EE
Sbjct  487  GNLHQGQSSMNNQNMNGMLALGPPQASTSGYQNINSSSVQQANLNPFEDWSNHRERGAEE  546

Query  517  YLSEEEIRLRSHEML*NEDMQHLLQLFSM  603
            + SEEEIRLRSHEML NEDMQ  L+LFSM
Sbjct  547  FFSEEEIRLRSHEMLENEDMQQFLRLFSM  575



>ref|XP_007213593.1| hypothetical protein PRUPE_ppa002740mg [Prunus persica]
 gb|EMJ14792.1| hypothetical protein PRUPE_ppa002740mg [Prunus persica]
Length=638

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 89/208 (43%), Positives = 120/208 (58%), Gaps = 29/208 (14%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  168
            KVYVD LVKKAY+NW+   EYDGK+LL+FK +K+      E+P+   DY NS + Q   P
Sbjct  369  KVYVDGLVKKAYDNWMHVMEYDGKSLLNFKQQKSPEASLPEVPLATQDYPNSFD-QFTLP  427

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LP  V +E   +D G+ +GG  YN+ M  R+S Q+  ++ S+ +Q +   F        
Sbjct  428  SLPISVSAEQPTMDSGLSVGG--YNDGMATRFSTQN--VNLSAPIQLDGLAFP-----LQ  478

Query  349  mnnsqqmqnARYDNNVG-LALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  519
                     A +  N   LALGPPQSS   F  +G+S    NL S+        +GVE+ 
Sbjct  479  NQLPSTSNQAHFQRNENMLALGPPQSSTSGFQNIGTS----NLTSY--------RGVEDL  526

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSM  603
              EEEIR+RSHEML NEDMQHLL++F+M
Sbjct  527  FPEEEIRMRSHEMLENEDMQHLLRIFNM  554



>ref|XP_009120276.1| PREDICTED: uncharacterized protein LOC103845193 [Brassica rapa]
Length=654

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 118/209 (56%), Gaps = 13/209 (6%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            KVYVD LVKKAY+NW    EYDGK+L+  K  +    L + Q D +N     +  P   A
Sbjct  372  KVYVDGLVKKAYDNWNLVIEYDGKSLIDMKQPQ---RLGITQADEANYSTAAINHPMQMA  428

Query  181  PVQSEPSALDPGML----IGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
               S   A  P +L    IGG  Y++ M  RY     ++ S+ R Q+E         Q +
Sbjct  429  GQSSSVPANQPPVLSDFAIGG--YDQTMATRYPPYPQLLVSNPRAQFEVASGGTAQDQLM  486

Query  349  mnnsqqmqnARYDNNVG-LALGPPQSSC--FPTV-GSSVQQTNLNSFEDWSNTRDKGVEE  516
             N  Q   +    N  G LALGPPQ+S   +  +  SSVQQ NLN FEDWSN R++G EE
Sbjct  487  GNLHQGQSSMNNQNMNGMLALGPPQASTSGYQNINSSSVQQANLNPFEDWSNHRERGAEE  546

Query  517  YLSEEEIRLRSHEML*NEDMQHLLQLFSM  603
            + SEEEIRLRSHEML NEDMQ  L+LFSM
Sbjct  547  FFSEEEIRLRSHEMLENEDMQQFLRLFSM  575



>ref|XP_006281432.1| hypothetical protein CARUB_v10027506mg [Capsella rubella]
 gb|EOA14330.1| hypothetical protein CARUB_v10027506mg [Capsella rubella]
Length=651

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 90/217 (41%), Positives = 123/217 (57%), Gaps = 20/217 (9%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSN----SLNNQLQQP  168
            KVYVD LVKKAYENW    EYDGK+L+  K     N L + Q D +N    ++++ +Q  
Sbjct  365  KVYVDGLVKKAYENWNLVIEYDGKSLIELKQP---NRLSITQNDLANYSTAAIDHPMQMT  421

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYE-------NTQFA  327
               + + +  S +     I G  Y++ +  RY +Q  +++S+ R Q+E         QF 
Sbjct  422  GHSSSIPANQSPVLSDFAIAG--YDQPLATRYHSQPQLLNSNPRAQFEVASCSNPRAQFD  479

Query  328  PndqqqlmnnsqqmqnARYDNNVGLALGPPQSSC--FPTV-GSSVQQTNLNSFEDWSNTR  498
                    +      +   + N GLALGPPQSS   +  +  SSV Q NLN  EDWSN R
Sbjct  480  VASCSTTQDQLMGNLHQTQNMN-GLALGPPQSSTSGYQNINSSSVHQANLNHLEDWSNHR  538

Query  499  DKGVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            ++G E++ SEEEIRLRSHEML +EDMQ  L+LFSMGG
Sbjct  539  ERGPEDFFSEEEIRLRSHEMLESEDMQQFLRLFSMGG  575



>ref|XP_004485707.1| PREDICTED: uncharacterized protein LOC101498971 [Cicer arietinum]
Length=634

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 126/213 (59%), Gaps = 27/213 (13%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYS--NSLNNQLQ  162
            KVYVD+LVKKAYENW+   EYDGK+LL++   +    ++ ++P+G  DYS  NSL+ Q+ 
Sbjct  369  KVYVDTLVKKAYENWMHVIEYDGKSLLNYNQNRNLGMSQPQVPVGSHDYSISNSLDQQIS  428

Query  163  QPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqq  342
             P LP PV +   ++DP   +GG  +    G  +S Q H  + +S +Q+ NT F   +  
Sbjct  429  IPSLPVPVPTGQPSMDPSATVGGYHHGTTTG--FSIQPHNSNLNSSIQFGNTAFPLQNLL  486

Query  343  qlmnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEE  516
               ++  Q+      N+  L+LGPPQS+   F TVG              S+   +G E+
Sbjct  487  TSASHQSQLPT----NDNELSLGPPQSATPGFQTVG-------------ISDPTYRGFED  529

Query  517  YLSEEEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
            +  EE+IR+RSHEML NEDMQHLL++F+MGG +
Sbjct  530  FFPEEDIRMRSHEMLENEDMQHLLRIFNMGGQS  562



>ref|XP_011043288.1| PREDICTED: uncharacterized protein LOC105138780 isoform X1 [Populus 
euphratica]
Length=637

 Score =   137 bits (344),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 125/211 (59%), Gaps = 24/211 (11%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            KVYVDSLVKKAY+NW+   EYDGK+LL FK+ +    ++N++P  Q ++ NS ++Q+  P
Sbjct  375  KVYVDSLVKKAYDNWMHVVEYDGKSLLDFKHNQGIVASQNDVPSSQQEFLNSYDHQVTLP  434

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             +  PV SE   +D G + GG  YN +M AR+S  S   + ++  Q++ T     +    
Sbjct  435  IMSVPVPSEQPVMDSGPIAGG--YNNDMAARFSIHSQNGNLNTPFQFDATSITLQNPMVS  492

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  522
             +   Q+     DN   LALGPPQSS   F + G+     NLNS+         G E+Y 
Sbjct  493  TSQQIQVPGT--DNL--LALGPPQSSMSGFQSFGT----LNLNSY--------GGTEDYF  536

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
            SEEEIR RSHEML NEDMQ+LL+ F+MGG  
Sbjct  537  SEEEIRTRSHEMLENEDMQNLLRGFNMGGQG  567



>ref|XP_004293506.1| PREDICTED: uncharacterized protein LOC101308261 [Fragaria vesca 
subsp. vesca]
 ref|XP_011460292.1| PREDICTED: uncharacterized protein LOC101308261 [Fragaria vesca 
subsp. vesca]
Length=636

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 131/211 (62%), Gaps = 28/211 (13%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            KVYVDSLVKKAYENW+   EYDGK+LL+FK +K    ++ E+PM   +Y+NS N Q   P
Sbjct  370  KVYVDSLVKKAYENWMHVMEYDGKSLLNFKQQKDPVTSQLEVPMASQEYTNSFNQQFTVP  429

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LP P  SE   +DPG + GG  YN+ M  ++S   ++ + +  +Q++ + F P +Q   
Sbjct  430  SLPVP--SEQHIMDPGFIAGG--YNDGMATQFSIPQNV-NLNPPIQFDGSSFPPPNQLPN  484

Query  349  mnnsqqmqnARYDNNVGLALGPPQ--SSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  522
             ++  ++Q  R +N   LALGP Q  +S F  V +S    NL S+        +G+ ++ 
Sbjct  485  TSHPHEIQ--RSENM--LALGPSQLSTSGFQNVDTS----NLASY--------RGL-DFF  527

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
             EEEIR RSHE+L NEDMQHLL++F+MGGH 
Sbjct  528  PEEEIRTRSHEILENEDMQHLLRMFNMGGHG  558



>ref|XP_010539448.1| PREDICTED: uncharacterized protein LOC104813528 [Tarenaya hassleriana]
Length=632

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 126/206 (61%), Gaps = 12/206 (6%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            KVYVD L+KKAYENW    EYDGK+L++FK  K    ++ +L +   +YS +++N +Q  
Sbjct  358  KVYVDGLMKKAYENWNQVIEYDGKSLMNFKQPKNSVISQTDLEVAPANYSTAIDNPMQLL  417

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LP+ + +  S++   + I G  ++++  + YS Q  +++S+ + Q+E     P   Q +
Sbjct  418  GLPSSLSANQSSVHSEIAIKG--FHQSPPSTYSTQHQLLNSNPQAQFEAGLCTPQQDQFM  475

Query  349  mnnsqqmqnARYDNNVG-LALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLS  525
             N  Q         N G LALGPP    +    SS Q  +L ++E+WSN R+KG EE+ S
Sbjct  476  GNLHQTQS-----TNAGRLALGPPGGYQYQNSSSSAQPASLPTYENWSNHREKGPEEFFS  530

Query  526  EEEIRLRSHEML*NEDMQHLLQLFSM  603
            EEEIRLRS+EML NEDMQ LL+LFSM
Sbjct  531  EEEIRLRSNEMLENEDMQQLLRLFSM  556



>gb|KEH36516.1| calmodulin-binding protein [Medicago truncatula]
Length=634

 Score =   134 bits (337),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 88/211 (42%), Positives = 126/211 (60%), Gaps = 27/211 (13%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYS--NSLNNQLQ  162
            KV+VD+LVKKAYENW+   EYDGK+LL++   +    +++++P+   DYS  NSL+ Q+ 
Sbjct  369  KVHVDTLVKKAYENWMHVIEYDGKSLLNYNQNRTLGMSQHQVPVSSHDYSISNSLDQQIS  428

Query  163  QPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqq  342
             P LP  V +   ++DPG  +GG  Y+     R+S Q      +S +Q+ NT F    Q 
Sbjct  429  TPSLPVHVPTGQHSMDPGATVGG--YHHGTATRFSMQPQNADVNSALQFGNTAFP--LQN  484

Query  343  qlmnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEE  516
             L + S Q Q  R +N   L+LGPPQS+   F TVG              S+   +G E+
Sbjct  485  LLTSVSHQSQLPRNENE--LSLGPPQSATPGFQTVG-------------LSDPTYRGFED  529

Query  517  YLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            +  E++IR+RSHEML NEDMQHLL++F+MGG
Sbjct  530  FFPEDDIRIRSHEMLENEDMQHLLRIFNMGG  560



>gb|ABK95891.1| unknown [Populus trichocarpa]
Length=326

 Score =   131 bits (329),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 124/211 (59%), Gaps = 24/211 (11%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            KVYVDSLVKKAY+NW+   EYDGK+LL FK  +    ++N++P  Q ++ NS ++Q+  P
Sbjct  63   KVYVDSLVKKAYDNWMHVIEYDGKSLLDFKQNQGIVASQNDVPSSQQEFLNSYDHQVTLP  122

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             +  PV SE   +D G ++ G  YN +M AR+S  S   + ++  Q++    A    Q  
Sbjct  123  IMSVPVPSEQPVMDSGPIVAG--YNNDMAARFSIHSQNGNLNTPFQFDA---ASITLQNP  177

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  522
            M N+ Q       +N+ LAL PPQSS   F + G+     NLNS+         G E+Y 
Sbjct  178  MVNTSQQIQVPGTDNL-LALAPPQSSMSGFQSFGT----LNLNSY--------GGTEDYF  224

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
            SEEEIR RSHEML NEDMQ+LL+ F MGG  
Sbjct  225  SEEEIRTRSHEMLENEDMQNLLRGFHMGGQG  255



>ref|XP_010452498.1| PREDICTED: uncharacterized protein LOC104734591 [Camelina sativa]
 ref|XP_010452506.1| PREDICTED: uncharacterized protein LOC104734591 [Camelina sativa]
Length=659

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 96/223 (43%), Positives = 125/223 (56%), Gaps = 25/223 (11%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQP-RLP  177
            KVYV+ LVKKAYENW    EY GK+LL  K     N L + Q D +N     L  P ++ 
Sbjct  366  KVYVEGLVKKAYENWTQVIEYGGKSLLDLKQP---NRLSITQTDLANYSTAALDHPIQMT  422

Query  178  APVQSEPSALDPGM---LIGGSSYNENMGARYSNQSHIMSSSSRMQYE-------NTQF-  324
                S P+   P +    IGG  Y++++  RY +Q  +++S+ R Q++         QF 
Sbjct  423  GHSSSMPANQSPVLSDFAIGG--YDQSLATRYHSQPQLLNSNPRAQFDIASCSNPRAQFD  480

Query  325  ----APndqqqlmnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGS-SVQQTNLNSFED  483
                +    Q L N  Q        N  GLALGPPQSS   +  + S SV Q NLN  ED
Sbjct  481  VASCSTTQDQLLGNLHQTQSTINSQNMNGLALGPPQSSTNGYQNINSASVHQANLNHLED  540

Query  484  WSNTRDK-GVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            WSN+R++ G E++ SEEEIRLRSHEML +EDMQ  L+LFSMGG
Sbjct  541  WSNSRERVGPEDFFSEEEIRLRSHEMLESEDMQQFLRLFSMGG  583



>ref|XP_007025783.1| Calmodulin-binding protein isoform 2 [Theobroma cacao]
 gb|EOY28405.1| Calmodulin-binding protein isoform 2 [Theobroma cacao]
Length=632

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 121/211 (57%), Gaps = 24/211 (11%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNK----KARNELPMGQVDYSNSLNNQLQQP  168
            KVYVD+LVKKAYENW+   EYDGK+LL  K       ++  +PM    Y NS+N Q   P
Sbjct  368  KVYVDALVKKAYENWMHVVEYDGKSLLGSKEDDNAGASQANVPMDLQGYPNSINQQQTLP  427

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             L  PV SE   +D G+ +GG  Y+++M AR S QS  +  +++ Q     F   +    
Sbjct  428  SLSVPVPSEQPPMDSGLNVGG--YDDSMAARLSLQSQNVHLNAQTQLNGASFTLQNHLVS  485

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  522
             +   Q+      N+  LALG  QSS   F  VG+S    N+ ++        +GVE++ 
Sbjct  486  ASQQVQLPG----NDNELALGSSQSSMPDFHGVGTS----NIPTY--------RGVEDFF  529

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
            SEEEIR+RSHEML NEDMQHLL++F+MG H 
Sbjct  530  SEEEIRMRSHEMLENEDMQHLLRIFNMGSHG  560



>ref|XP_007025782.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
 gb|EOY28404.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
Length=635

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 121/211 (57%), Gaps = 24/211 (11%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNK----KARNELPMGQVDYSNSLNNQLQQP  168
            KVYVD+LVKKAYENW+   EYDGK+LL  K       ++  +PM    Y NS+N Q   P
Sbjct  371  KVYVDALVKKAYENWMHVVEYDGKSLLGSKEDDNAGASQANVPMDLQGYPNSINQQQTLP  430

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             L  PV SE   +D G+ +GG  Y+++M AR S QS  +  +++ Q     F   +    
Sbjct  431  SLSVPVPSEQPPMDSGLNVGG--YDDSMAARLSLQSQNVHLNAQTQLNGASFTLQNHLVS  488

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  522
             +   Q+      N+  LALG  QSS   F  VG+S    N+ ++        +GVE++ 
Sbjct  489  ASQQVQLPG----NDNELALGSSQSSMPDFHGVGTS----NIPTY--------RGVEDFF  532

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
            SEEEIR+RSHEML NEDMQHLL++F+MG H 
Sbjct  533  SEEEIRMRSHEMLENEDMQHLLRIFNMGSHG  563



>ref|XP_009394895.1| PREDICTED: uncharacterized protein LOC103980282 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394896.1| PREDICTED: uncharacterized protein LOC103980282 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394897.1| PREDICTED: uncharacterized protein LOC103980282 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394898.1| PREDICTED: uncharacterized protein LOC103980282 [Musa acuminata 
subsp. malaccensis]
Length=633

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 89/210 (42%), Positives = 126/210 (60%), Gaps = 12/210 (6%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFK-NKKA---RNELPMGQVDYSNSLNNQLQQP  168
            KV+ D+LVKKAY+NW    EYDGK LLS   NKK    R+E      ++S+S +    Q 
Sbjct  358  KVFADTLVKKAYDNWACVIEYDGKALLSLTSNKKTITTRSE-SRALANFSDSYDCPPSQQ  416

Query  169  RLPAPVQSEPSALDPGMLI-GGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqq  345
            +L  P  +  S  D GM+  G S Y +N   R S+   ++ S++++ YE+T   P +Q  
Sbjct  417  QLSVPALTVQSLTDTGMVSEGDSGYGDNQMTRCSSHPQLVISNAQLHYEDTSLTPQNQFC  476

Query  346  lmnnsqqmqnARYDNNVGLALGPPQ--SSCFPTVGSSVQQTNLNSFEDWSNTRDK-GVEE  516
              +   Q+     +++ GLALGP Q  SS F  VG  +  +NLNS+ DWSN R   GV++
Sbjct  477  ESSGLAQVSR---NDSFGLALGPSQHSSSEFQLVGQPMLSSNLNSYYDWSNQRQSHGVDD  533

Query  517  YLSEEEIRLRSHEML*NEDMQHLLQLFSMG  606
            YL+EEEIR+RSHE+L NE+MQ LL+ F +G
Sbjct  534  YLTEEEIRMRSHEILENEEMQQLLRHFMVG  563



>ref|XP_002316655.1| calmodulin-binding protein 60-C [Populus trichocarpa]
 gb|EEE97267.1| calmodulin-binding protein 60-C [Populus trichocarpa]
Length=637

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 125/211 (59%), Gaps = 24/211 (11%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            KVYVDSLVKKAY+NW+   EYDGK+LL FK  +    ++N++P  Q ++ NS ++Q+  P
Sbjct  374  KVYVDSLVKKAYDNWMHVIEYDGKSLLDFKQNQGIVASQNDVPSSQQEFLNSYDHQVTLP  433

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             +  PV SE   +D G ++GG  YN +M AR+S  S   + ++  Q++    A    Q  
Sbjct  434  IMSVPVPSEQPVMDSGPIVGG--YNNDMAARFSIHSQNGNLNTPFQFDA---ASITLQNP  488

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  522
            M N+ Q       +N+ LAL PPQSS   F + G+     NLNS+         G E+Y 
Sbjct  489  MVNTSQQIQVPGTDNL-LALAPPQSSMSGFQSFGT----LNLNSY--------GGTEDYF  535

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
            SEEEIR RSHEML NEDMQ+LL+ F MGG  
Sbjct  536  SEEEIRTRSHEMLENEDMQNLLRGFHMGGQG  566



>gb|EYU42432.1| hypothetical protein MIMGU_mgv1a025463mg [Erythranthe guttata]
Length=648

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 99/224 (44%), Positives = 131/224 (58%), Gaps = 32/224 (14%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKN-KKARNELPMG-QVDYSNSLNNQLQQPRL  174
            KVYVD LVK AY+NW    EYDGK+LL+ K  KK+R ++P+G  ++Y NSL+ Q+   RL
Sbjct  372  KVYVDKLVKTAYDNWNQVVEYDGKSLLNSKQIKKSREDIPVGPTINYPNSLDIQIPH-RL  430

Query  175  PAPVQSEPSALDPGMLIGGSS-YNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlm  351
               + SEPS +D  +L G S  Y +N+ A Y  QSH  S    + + + +  P++Q Q  
Sbjct  431  SVSIPSEPS-MDQSVLSGDSGGYTDNISASYLTQSH--SQFDTVSFTHHEVNPHNQFQSQ  487

Query  352  nnsqqmqnARYDNNVGLALGPPQSSCFPTV--GSSV---------QQTNLNSF--EDWSN  492
                      Y   V LAL PPQSS   +   G+S          Q  N+N F  E+W  
Sbjct  488  T---------YSEKVNLALAPPQSSPQSSFQHGNSSSSSVSSLHHQSNNVNPFLSEEWPT  538

Query  493  TRD---KGVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
             RD   KG  ++LSEE+IRLRSHE+L NEDMQHLL+LFSMGG+ 
Sbjct  539  NRDDNNKGGIDFLSEEDIRLRSHEILENEDMQHLLRLFSMGGNV  582



>ref|XP_008383819.1| PREDICTED: uncharacterized protein LOC103446473 [Malus domestica]
 ref|XP_008358694.1| PREDICTED: uncharacterized protein LOC103422407 [Malus domestica]
Length=636

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 93/208 (45%), Positives = 123/208 (59%), Gaps = 21/208 (10%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKAR-NELPMGQVDYSNSLNNQLQQPRLP  177
            KV VD LVKKAY+NW+   EYDGK+LLS KN      E+PM   DY NS + Q   P LP
Sbjct  369  KVCVDGLVKKAYDNWMHVMEYDGKSLLSXKNPDVSLPEVPMASQDYPNSCDQQFTLPSLP  428

Query  178  APVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnn  357
            A V S+P  +D G+ +GG  Y + M AR+S QS   + +  +Q +   F    Q QL + 
Sbjct  429  ASVSSQPPPMDSGLNVGG--YXDGMAARFSIQSQNGNLNXPIQLDGLSFP--QQNQLPSI  484

Query  358  sqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEE  531
            S Q    R +N   L+LGP QSS   F  +G+S    NL+S+        +GVE+   EE
Sbjct  485  SXQXHFQRNENM--LSLGPLQSSTSGFQNIGTS----NLSSY--------RGVEDLFPEE  530

Query  532  EIRLRSHEML*NEDMQHLLQLFSMGGHA  615
            EIR+RS+E+L NEDMQHLL++ +MGG  
Sbjct  531  EIRMRSNEILENEDMQHLLRVINMGGQG  558



>ref|XP_006449222.1| hypothetical protein CICLE_v10014600mg [Citrus clementina]
 gb|ESR62462.1| hypothetical protein CICLE_v10014600mg [Citrus clementina]
Length=628

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 88/210 (42%), Positives = 127/210 (60%), Gaps = 23/210 (11%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELP----MGQVDYSNSLNNQLQQP  168
            KV+VD+LVKKAY+NW+   EYDGK+LL F   K+ +  P     G  +Y+N  + QL  P
Sbjct  365  KVHVDTLVKKAYDNWMHVIEYDGKSLLGFTQNKSVDAPPTDFQTGPPNYTNPFSQQLALP  424

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             L  PV  E  ++D G+ +GG  YN+ + +R+S QS  ++ +S  Q++ T F    Q  L
Sbjct  425  TLSVPVPPEQPSMDSGLTVGG--YNDGIPSRFSLQSQNVNINS--QFDGTSFP--QQNPL  478

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  528
            ++  Q+    R +N   LALGPPQSS    V  ++  +N   +        +G+E++ SE
Sbjct  479  VSVPQEAHIPRSENV--LALGPPQSSSL--VSQTIGTSNPAPY--------RGIEDFFSE  526

Query  529  EEIRLRSHEML*NEDM-QHLLQLFSMGGHA  615
            EEIR+RSHEML NEDM QHLL++F+MGG  
Sbjct  527  EEIRMRSHEMLENEDMQQHLLRIFNMGGQG  556



>gb|KDO75734.1| hypothetical protein CISIN_1g006875mg [Citrus sinensis]
 gb|KDO75735.1| hypothetical protein CISIN_1g006875mg [Citrus sinensis]
Length=588

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 87/210 (41%), Positives = 126/210 (60%), Gaps = 23/210 (11%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELP----MGQVDYSNSLNNQLQQP  168
            KV+VD+LVKKAY+NW+   EYDGK+LL F   K+ +  P     G  +Y+N  + QL  P
Sbjct  325  KVHVDTLVKKAYDNWMHVIEYDGKSLLGFTQNKSVDAPPTDFQTGPPNYTNPFSQQLALP  384

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             L  PV  E  ++D G+ +GG  YN+ + +R+S QS  ++ +S  Q++ T F    Q  L
Sbjct  385  TLSVPVPPEQPSMDSGLTVGG--YNDGIPSRFSLQSQNVNINS--QFDGTSFP--QQNPL  438

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  528
            ++   +    R +N   LALGPPQSS    V  ++  +N   +        +G+E++ SE
Sbjct  439  VSVPHEAHIPRSENV--LALGPPQSSSL--VSQTIGTSNPAPY--------RGIEDFFSE  486

Query  529  EEIRLRSHEML*NEDM-QHLLQLFSMGGHA  615
            EEIR+RSHEML NEDM QHLL++F+MGG  
Sbjct  487  EEIRMRSHEMLENEDMQQHLLRIFNMGGQG  516



>ref|XP_006467892.1| PREDICTED: uncharacterized protein LOC102626942 [Citrus sinensis]
 gb|KDO75732.1| hypothetical protein CISIN_1g006875mg [Citrus sinensis]
 gb|KDO75733.1| hypothetical protein CISIN_1g006875mg [Citrus sinensis]
Length=628

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 87/210 (41%), Positives = 126/210 (60%), Gaps = 23/210 (11%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELP----MGQVDYSNSLNNQLQQP  168
            KV+VD+LVKKAY+NW+   EYDGK+LL F   K+ +  P     G  +Y+N  + QL  P
Sbjct  365  KVHVDTLVKKAYDNWMHVIEYDGKSLLGFTQNKSVDAPPTDFQTGPPNYTNPFSQQLALP  424

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             L  PV  E  ++D G+ +GG  YN+ + +R+S QS  ++ +S  Q++ T F    Q  L
Sbjct  425  TLSVPVPPEQPSMDSGLTVGG--YNDGIPSRFSLQSQNVNINS--QFDGTSFP--QQNPL  478

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  528
            ++   +    R +N   LALGPPQSS    V  ++  +N   +        +G+E++ SE
Sbjct  479  VSVPHEAHIPRSENV--LALGPPQSSSL--VSQTIGTSNPAPY--------RGIEDFFSE  526

Query  529  EEIRLRSHEML*NEDM-QHLLQLFSMGGHA  615
            EEIR+RSHEML NEDM QHLL++F+MGG  
Sbjct  527  EEIRMRSHEMLENEDMQQHLLRIFNMGGQG  556



>ref|XP_006449221.1| hypothetical protein CICLE_v10014600mg [Citrus clementina]
 gb|ESR62461.1| hypothetical protein CICLE_v10014600mg [Citrus clementina]
Length=588

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 88/210 (42%), Positives = 127/210 (60%), Gaps = 23/210 (11%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELP----MGQVDYSNSLNNQLQQP  168
            KV+VD+LVKKAY+NW+   EYDGK+LL F   K+ +  P     G  +Y+N  + QL  P
Sbjct  325  KVHVDTLVKKAYDNWMHVIEYDGKSLLGFTQNKSVDAPPTDFQTGPPNYTNPFSQQLALP  384

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             L  PV  E  ++D G+ +GG  YN+ + +R+S QS  ++ +S  Q++ T F    Q  L
Sbjct  385  TLSVPVPPEQPSMDSGLTVGG--YNDGIPSRFSLQSQNVNINS--QFDGTSFP--QQNPL  438

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  528
            ++  Q+    R +N   LALGPPQSS    V  ++  +N   +        +G+E++ SE
Sbjct  439  VSVPQEAHIPRSENV--LALGPPQSSSL--VSQTIGTSNPAPY--------RGIEDFFSE  486

Query  529  EEIRLRSHEML*NEDM-QHLLQLFSMGGHA  615
            EEIR+RSHEML NEDM QHLL++F+MGG  
Sbjct  487  EEIRMRSHEMLENEDMQQHLLRIFNMGGQG  516



>gb|KDO75730.1| hypothetical protein CISIN_1g006875mg [Citrus sinensis]
Length=627

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 87/210 (41%), Positives = 126/210 (60%), Gaps = 23/210 (11%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELP----MGQVDYSNSLNNQLQQP  168
            KV+VD+LVKKAY+NW+   EYDGK+LL F   K+ +  P     G  +Y+N  + QL  P
Sbjct  364  KVHVDTLVKKAYDNWMHVIEYDGKSLLGFTQNKSVDAPPTDFQTGPPNYTNPFSQQLALP  423

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             L  PV  E  ++D G+ +GG  YN+ + +R+S QS  ++ +S  Q++ T F    Q  L
Sbjct  424  TLSVPVPPEQPSMDSGLTVGG--YNDGIPSRFSLQSQNVNINS--QFDGTSFP--QQNPL  477

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  528
            ++   +    R +N   LALGPPQSS    V  ++  +N   +        +G+E++ SE
Sbjct  478  VSVPHEAHIPRSENV--LALGPPQSSSL--VSQTIGTSNPAPY--------RGIEDFFSE  525

Query  529  EEIRLRSHEML*NEDM-QHLLQLFSMGGHA  615
            EEIR+RSHEML NEDM QHLL++F+MGG  
Sbjct  526  EEIRMRSHEMLENEDMQQHLLRIFNMGGQG  555



>ref|XP_004232807.1| PREDICTED: uncharacterized protein LOC101255950 [Solanum lycopersicum]
Length=621

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 85/211 (40%), Positives = 124/211 (59%), Gaps = 24/211 (11%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA----RNELPMGQVDYSNSLNNQLQQP  168
            K+YVD+LVKKAY+NW+   EYDGK+LLS    KA    +N+  +G  +++ S + Q   P
Sbjct  361  KIYVDTLVKKAYDNWMQVVEYDGKSLLSLGQNKAAVSSQNDPTIGSQNHTISFDQQTNLP  420

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LPA + SE  +++ G+ +GG  YN+++  RY+ Q   M+ +  MQ     F  N     
Sbjct  421  SLPASISSEQPSMNSGLNMGG--YNDSLSGRYTMQPQNMNLNGNMQLNGASFPQNHLLGT  478

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  528
               +Q      + ++  LAL PPQ    P++ S    +  N +        KG E++L+E
Sbjct  479  SQQAQP-----HGSDSMLALRPPQ----PSMSSYFAASTPNPY--------KGAEDFLTE  521

Query  529  EEIRLRSHEML*NEDMQHLLQLFSMG-GHAS  618
            EEIR++SHEML NEDMQHLL++FSMG GHAS
Sbjct  522  EEIRMKSHEMLENEDMQHLLRMFSMGQGHAS  552



>ref|XP_010443447.1| PREDICTED: uncharacterized protein LOC104726314 [Camelina sativa]
 ref|XP_010443448.1| PREDICTED: uncharacterized protein LOC104726314 [Camelina sativa]
 ref|XP_010443449.1| PREDICTED: uncharacterized protein LOC104726314 [Camelina sativa]
Length=659

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 94/223 (42%), Positives = 124/223 (56%), Gaps = 25/223 (11%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQP-RLP  177
            KVYVD LVK+AYENW    EYDGK++L  K     N L + Q D +N     +  P ++ 
Sbjct  366  KVYVDGLVKRAYENWTQVIEYDGKSILDLKQP---NRLSITQTDLANYSTAPIDHPIQMV  422

Query  178  APVQSEPSALDPGM---LIGGSSYNENMGARYSNQSHIMSSSSRMQYE-------NTQF-  324
                S P+   P +    IGG  Y++++  RY +Q  +++S+ R  ++         QF 
Sbjct  423  GHSSSMPANQSPVLSDFAIGG--YDQSLATRYHSQPQLLNSNPRAHFDVAACSNPRAQFD  480

Query  325  ----APndqqqlmnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGS-SVQQTNLNSFED  483
                +    Q L N  Q        N  GLALGPPQSS   +  + S SV Q NLN  ED
Sbjct  481  VASCSTTQDQLLGNLHQTQSTINSQNMNGLALGPPQSSTNGYQNINSASVHQANLNHLED  540

Query  484  WSNTRDKG-VEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            WSN R++G  E++ SEEEIRLRSHEML +EDMQ  L+LFSMGG
Sbjct  541  WSNPRERGGPEDFFSEEEIRLRSHEMLESEDMQQFLRLFSMGG  583



>ref|XP_010483282.1| PREDICTED: uncharacterized protein LOC104761843 [Camelina sativa]
 ref|XP_010483283.1| PREDICTED: uncharacterized protein LOC104761843 [Camelina sativa]
 ref|XP_010483284.1| PREDICTED: uncharacterized protein LOC104761843 [Camelina sativa]
 ref|XP_010483285.1| PREDICTED: uncharacterized protein LOC104761843 [Camelina sativa]
 ref|XP_010483286.1| PREDICTED: uncharacterized protein LOC104761843 [Camelina sativa]
 ref|XP_010483287.1| PREDICTED: uncharacterized protein LOC104761843 [Camelina sativa]
Length=659

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 94/223 (42%), Positives = 124/223 (56%), Gaps = 25/223 (11%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQP-RLP  177
            KVYVD LVK+AYENW    EYDGK++L  K     N L + Q D +N     +  P ++ 
Sbjct  366  KVYVDGLVKRAYENWTQVIEYDGKSILDLKQP---NRLSITQTDLANYSTAPIDHPIQMV  422

Query  178  APVQSEPSALDPGM---LIGGSSYNENMGARYSNQSHIMSSSSRMQYE-------NTQF-  324
                S P+   P +    IGG  Y++++  RY +Q  +++S+ R  ++         QF 
Sbjct  423  GHSSSMPANQSPVLSDFAIGG--YDQSLATRYHSQPQLLNSNPRAHFDVAACSNPRAQFD  480

Query  325  ----APndqqqlmnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGS-SVQQTNLNSFED  483
                +    Q L N  Q        N  GLALGPPQSS   +  + S SV Q NLN  ED
Sbjct  481  VASCSTTQDQLLGNLHQSQSTINSQNMNGLALGPPQSSTNGYQNINSASVHQANLNHLED  540

Query  484  WSNTRDKG-VEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            WSN R++G  E++ SEEEIRLRSHEML +EDMQ  L+LFSMGG
Sbjct  541  WSNPRERGGPEDFFSEEEIRLRSHEMLESEDMQQFLRLFSMGG  583



>ref|XP_009376054.1| PREDICTED: uncharacterized protein LOC103964603 isoform X2 [Pyrus 
x bretschneideri]
Length=637

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 115/208 (55%), Gaps = 29/208 (14%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  168
            KVYVD LV KAYENW+   EYDGK+LL  K +K+ +    E+P    DY NS + Q   P
Sbjct  369  KVYVDGLVTKAYENWMHVMEYDGKSLL--KQQKSPDVSLPEVPTASQDYPNSFDQQFTLP  426

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LPA V SEP  +D G+ +GG  Y ++M  R+S +S  ++ S+  Q +   F        
Sbjct  427  SLPASVSSEPPTMDSGLNVGG--YTDSMANRFSVESQNINLSAPSQLDGLSFP-----LQ  479

Query  349  mnnsqqmqnARYDNNVG-LALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  519
                     A++  N   LALGPPQSS   F  +G+S             N   +G E+ 
Sbjct  480  NQQPITSHQAQFQGNENMLALGPPQSSTSGFQNIGTS-------------NPSYRGAEDL  526

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSM  603
              EEEIR+RSHE+L NEDMQHLL++F+M
Sbjct  527  FPEEEIRMRSHEILENEDMQHLLRIFNM  554



>ref|XP_009375849.1| PREDICTED: uncharacterized protein LOC103964603 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009375923.1| PREDICTED: uncharacterized protein LOC103964603 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009375988.1| PREDICTED: uncharacterized protein LOC103964603 isoform X1 [Pyrus 
x bretschneideri]
Length=638

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 115/208 (55%), Gaps = 29/208 (14%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  168
            KVYVD LV KAYENW+   EYDGK+LL  K +K+ +    E+P    DY NS + Q   P
Sbjct  370  KVYVDGLVTKAYENWMHVMEYDGKSLL--KQQKSPDVSLPEVPTASQDYPNSFDQQFTLP  427

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LPA V SEP  +D G+ +GG  Y ++M  R+S +S  ++ S+  Q +   F        
Sbjct  428  SLPASVSSEPPTMDSGLNVGG--YTDSMANRFSVESQNINLSAPSQLDGLSFP-----LQ  480

Query  349  mnnsqqmqnARYDNNVG-LALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  519
                     A++  N   LALGPPQSS   F  +G+S             N   +G E+ 
Sbjct  481  NQQPITSHQAQFQGNENMLALGPPQSSTSGFQNIGTS-------------NPSYRGAEDL  527

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSM  603
              EEEIR+RSHE+L NEDMQHLL++F+M
Sbjct  528  FPEEEIRMRSHEILENEDMQHLLRIFNM  555



>ref|XP_009398635.1| PREDICTED: uncharacterized protein LOC103983171 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009398636.1| PREDICTED: uncharacterized protein LOC103983171 [Musa acuminata 
subsp. malaccensis]
Length=655

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 126/214 (59%), Gaps = 14/214 (7%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSF-KNKKA---RNELPMGQVDYSNSLNNQLQQP  168
            KV+ D+LVKKAY+NW+   EYDG+ LL+F KNKKA   + E  +   +Y +S + Q+ Q 
Sbjct  375  KVFADALVKKAYDNWMQVIEYDGRALLNFTKNKKAPAAQKESLLASSNYPSSYDQQVSQM  434

Query  169  RLPAPVQSEPSALDPGMLIGGSS----YNENMGARYSNQSHIMSSSSRMQYENTQFAPnd  336
               A   S   + + G   GG +    Y+    ARY N +  + S + +  E+T   P +
Sbjct  435  HSQASASSTELSAEMGNTTGGGTISAGYSGTQSARYPNLTQHVDSDAHISTESTSSTPQN  494

Query  337  qqqlmnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRD-KG  507
            Q     +  Q       +   LA  PPQ +     ++G +VQQ +L++++DWS  RD +G
Sbjct  495  QLVGSTHQTQFTRT---DGTSLAPAPPQQASMELQSLGHTVQQPDLSTYDDWSRQRDSRG  551

Query  508  VEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            ++++ SE+EIRLRSHE+L ++DMQHLL++F+MGG
Sbjct  552  IDDFFSEDEIRLRSHELLEHDDMQHLLRVFTMGG  585



>ref|XP_002524676.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF37695.1| calmodulin binding protein, putative [Ricinus communis]
Length=458

 Score =   130 bits (326),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 89/208 (43%), Positives = 124/208 (60%), Gaps = 20/208 (10%)
 Frame = +1

Query  4    VYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQPR  171
            VYVD LVKKAYENW+   EYDGKTLL FK  +    ++ + P+ Q D+ NS ++Q+  P 
Sbjct  195  VYVDGLVKKAYENWMHVIEYDGKTLLDFKQNENIVASQTDNPICQEDFLNSYDHQVTLPT  254

Query  172  LPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlm  351
            L  PV  E  A+D G  +GG  YN NM AR+S Q+   + ++  Q++        Q  L 
Sbjct  255  LSVPVPPEQPAMDSGPTVGG--YNNNMAARFSMQAQNENINTPFQFDAASMP--LQNPLP  310

Query  352  nnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEE  531
            + SQQ Q +R D+   LAL PPQSS     G  V   N+ S+        +G E++  EE
Sbjct  311  STSQQNQFSRSDSL--LALAPPQSSTSSFQG--VCTPNVTSY--------RGSEDFFPEE  358

Query  532  EIRLRSHEML*NEDMQHLLQLFSMGGHA  615
            ++R+RS+EML N+DMQHLL++F+MGG  
Sbjct  359  DLRVRSNEMLENDDMQHLLRIFNMGGQG  386



>ref|XP_004504984.1| PREDICTED: uncharacterized protein LOC101509425 [Cicer arietinum]
Length=627

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/209 (40%), Positives = 123/209 (59%), Gaps = 22/209 (11%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNEL----PMGQVDYSNSLNNQLQQP  168
            K+YVD+LVKKAY+NW+   EYDGK+LLS+   K  + L    PMG  +YSNS+  Q+  P
Sbjct  365  KIYVDTLVKKAYDNWMHVIEYDGKSLLSYNQDKNLDTLHPQDPMGSHEYSNSIQ-QISIP  423

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LP PV +   +++ G ++G   Y++    R+   S   + +S +Q+++  F+   Q   
Sbjct  424  SLPQPVHTGQPSMETGAIVG--VYHDGTTTRFPLPSQNANLNSSIQFDDNAFSLQSQLMS  481

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  528
            + +  Q+Q     N  GL  G PQ++      +S+           SN+  +GVE+   E
Sbjct  482  VPHQAQLQR----NENGLTHGLPQTATHGFQTASI-----------SNSTYRGVEDLFPE  526

Query  529  EEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
            EEIR+RSHEML NEDMQHLL++F+MGGHA
Sbjct  527  EEIRIRSHEMLENEDMQHLLRIFNMGGHA  555



>ref|XP_004952753.1| PREDICTED: uncharacterized protein LOC101756263 isoform X1 [Setaria 
italica]
 ref|XP_004952754.1| PREDICTED: uncharacterized protein LOC101756263 isoform X2 [Setaria 
italica]
Length=649

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 88/219 (40%), Positives = 127/219 (58%), Gaps = 18/219 (8%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            KVY D+LVKKAYE+W+   EYDGK LLSFK KK     R++          S      Q 
Sbjct  370  KVYADALVKKAYEDWMHAVEYDGKALLSFKQKKKSITTRSDTAAASTSNPASYGLASSQK  429

Query  169  RLPAPVQS-EPSALDPGMLIGG--SSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndq  339
            +LP P +S +PS+        G  S+YN N  ARY++ +  + ++  MQ++ +  +P   
Sbjct  430  QLPLPTKSGQPSSAGTTNEADGTRSAYNGNQSARYTSNTQNIPANITMQFDRSALSP---  486

Query  340  qqlmnnsqqmqnARYDNNVGLALGPP----QSSCFPTVGSSVQQTNLNSFEDWSNTRDK-  504
            +   N S     A   +N+ LALGPP    QS  FP +G S+Q T +N F++WS  ++  
Sbjct  487  ESQFNGSSLQAQASRGSNM-LALGPPQQQQQSFEFPALGQSMQPTGMNPFDEWSQPQENR  545

Query  505  -GVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
             GV++YL  EEIR+RSHE+L NE+MQ +L++ SMGG  +
Sbjct  546  GGVDDYLM-EEIRMRSHEILENEEMQQMLRILSMGGAGT  583



>ref|XP_003529298.1| PREDICTED: uncharacterized protein LOC100812605 [Glycine max]
Length=623

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 125/207 (60%), Gaps = 23/207 (11%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  168
            KVYVD+LVKKAY+NW+   EYDGK+L++    KA +    + PM   +YSNSL  Q+  P
Sbjct  362  KVYVDTLVKKAYDNWMHVIEYDGKSLINDNEDKALDTTHPQAPMTSHEYSNSLQ-QISIP  420

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LP PV     ++D G+ +GG  Y++   +R+S Q H   +SS +Q+++  F    Q QL
Sbjct  421  ALPLPVHPGQPSMDSGVTVGG--YHDGTASRFSLQPHPNLNSS-IQFDDNAFP--LQNQL  475

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  528
            M+ S   Q  R +N  G  +GPPQSS       S+           SN   +GVEEY  E
Sbjct  476  MSASHHAQLPRNEN--GQTIGPPQSSTHGFEPVSI-----------SNPTYRGVEEYFPE  522

Query  529  EEIRLRSHEML*NEDMQHLLQLFSMGG  609
            EEIR+RS+EML NEDMQHLL++F+MGG
Sbjct  523  EEIRIRSNEMLENEDMQHLLRIFNMGG  549



>ref|XP_004952755.1| PREDICTED: uncharacterized protein LOC101756263 isoform X3 [Setaria 
italica]
Length=648

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 88/218 (40%), Positives = 127/218 (58%), Gaps = 17/218 (8%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            KVY D+LVKKAYE+W+   EYDGK LLSFK KK     R++          S      Q 
Sbjct  370  KVYADALVKKAYEDWMHAVEYDGKALLSFKQKKKSITTRSDTAAASTSNPASYGLASSQK  429

Query  169  RLPAPVQS-EPSALDPGMLIGG-SSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqq  342
            +LP P +S +PS+       G  S+YN N  ARY++ +  + ++  MQ++ +  +P   +
Sbjct  430  QLPLPTKSGQPSSAGTTNEDGTRSAYNGNQSARYTSNTQNIPANITMQFDRSALSP---E  486

Query  343  qlmnnsqqmqnARYDNNVGLALGPP----QSSCFPTVGSSVQQTNLNSFEDWSNTRDK--  504
               N S     A   +N+ LALGPP    QS  FP +G S+Q T +N F++WS  ++   
Sbjct  487  SQFNGSSLQAQASRGSNM-LALGPPQQQQQSFEFPALGQSMQPTGMNPFDEWSQPQENRG  545

Query  505  GVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            GV++YL  EEIR+RSHE+L NE+MQ +L++ SMGG  +
Sbjct  546  GVDDYLM-EEIRMRSHEILENEEMQQMLRILSMGGAGT  582



>gb|KHN07315.1| hypothetical protein glysoja_027405 [Glycine soja]
Length=623

 Score =   128 bits (322),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 125/209 (60%), Gaps = 27/209 (13%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  168
            KVYVD+LVKKAY+NW+   EYDGK+L++    K  +    + PM   +YSNSL  Q+  P
Sbjct  362  KVYVDTLVKKAYDNWMHVIEYDGKSLINDNEDKTLDTTHPQAPMTSHEYSNSLQ-QISIP  420

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LP PV     ++D G+ +GG  Y++   +R+S Q H   +SS +Q+++  F    Q QL
Sbjct  421  ALPLPVHPGQPSMDSGVTVGG--YHDGTASRFSLQPHPNLNSS-IQFDDNAFP--LQNQL  475

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFE--DWSNTRDKGVEEYL  522
            M+ S   Q  R +N  G  +GPPQSS              + FE    SN   +GVEEY 
Sbjct  476  MSASHHAQLPRNEN--GQTIGPPQSST-------------HGFEPVSISNPTYRGVEEYF  520

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
             EEEIR+RS+EML NEDMQHLL++F+MGG
Sbjct  521  PEEEIRIRSNEMLENEDMQHLLRIFNMGG  549



>ref|XP_008364144.1| PREDICTED: uncharacterized protein LOC103427840 isoform X2 [Malus 
domestica]
Length=637

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 115/208 (55%), Gaps = 28/208 (13%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  168
            KVYVD LV KAYENW+   EYDGK+LL  K +K+ +    E+P    DY NS + Q   P
Sbjct  369  KVYVDGLVTKAYENWMHVMEYDGKSLL--KQEKSPDVSLSEVPTASQDYPNSFDQQFTLP  426

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LPA V SEP  +D G+ +GG  Y + M  R+S +S  ++ S+  Q +   F        
Sbjct  427  SLPASVSSEPPTMDSGLNVGG--YTDGMANRFSVESQNLNLSAPSQLDGLPFP-----LQ  479

Query  349  mnnsqqmqnARYDNNVG-LALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  519
                     A++  N   LALGPPQSS   F  +G+S    N +S+        +G E+ 
Sbjct  480  NQQPITSHQAQFQRNENMLALGPPQSSTSGFQNIGTS----NPSSY--------RGAEDL  527

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSM  603
              EEEIR+RSHE+L NEDMQ LL +F+M
Sbjct  528  FPEEEIRMRSHEILENEDMQRLLHIFNM  555



>ref|XP_009606926.1| PREDICTED: uncharacterized protein LOC104101191 isoform X1 [Nicotiana 
tomentosiformis]
Length=581

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 117/212 (55%), Gaps = 22/212 (10%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA----RNELPMGQVDYSNSLNNQLQQP  168
            K YVD+LVKKAY+NW++  EYDG++LLS    K     +N+L  G   +S+S ++QL  P
Sbjct  318  KEYVDTLVKKAYDNWMNVVEYDGESLLSLNQNKTSDGPQNDLTTGSQSHSSSFDHQLNLP  377

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
              PA + SE   +DPG+ IGG  YN++    Y+ QS  M+ S   Q     F P +   +
Sbjct  378  SFPASISSEQPTMDPGLNIGG--YNDSRTGSYTIQSQKMNLSVNEQLNVASFPPQNHHFV  435

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  528
              + Q             AL PP+SS      +S             N   KG +++ +E
Sbjct  436  GTSQQTQPPGSESIQ---ALRPPESSFSSFYVAST-----------PNPSYKGTDDFFAE  481

Query  529  EEIRLRSHEML*NEDMQHLLQLFSMGG--HAS  618
            EEIR+RSHEML NEDMQHLL++F+MGG  HAS
Sbjct  482  EEIRMRSHEMLENEDMQHLLRIFNMGGQNHAS  513



>ref|XP_008364142.1| PREDICTED: uncharacterized protein LOC103427840 isoform X1 [Malus 
domestica]
 ref|XP_008364143.1| PREDICTED: uncharacterized protein LOC103427840 isoform X1 [Malus 
domestica]
Length=638

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 115/208 (55%), Gaps = 28/208 (13%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  168
            KVYVD LV KAYENW+   EYDGK+LL  K +K+ +    E+P    DY NS + Q   P
Sbjct  370  KVYVDGLVTKAYENWMHVMEYDGKSLL--KQEKSPDVSLSEVPTASQDYPNSFDQQFTLP  427

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LPA V SEP  +D G+ +GG  Y + M  R+S +S  ++ S+  Q +   F        
Sbjct  428  SLPASVSSEPPTMDSGLNVGG--YTDGMANRFSVESQNLNLSAPSQLDGLPFP-----LQ  480

Query  349  mnnsqqmqnARYDNNVG-LALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  519
                     A++  N   LALGPPQSS   F  +G+S    N +S+        +G E+ 
Sbjct  481  NQQPITSHQAQFQRNENMLALGPPQSSTSGFQNIGTS----NPSSY--------RGAEDL  528

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSM  603
              EEEIR+RSHE+L NEDMQ LL +F+M
Sbjct  529  FPEEEIRMRSHEILENEDMQRLLHIFNM  556



>ref|XP_010525739.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104803505 
[Tarenaya hassleriana]
Length=636

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 123/214 (57%), Gaps = 24/214 (11%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSF-KNKKA----RNELPMGQVDYSNSLNNQLQQ  165
            KVYVD LVKKAYENW    EYDG++L+ F + +KA      +L +G  +Y          
Sbjct  366  KVYVDGLVKKAYENWDQVIEYDGQSLMDFNQARKAGSSKSQQLLLGNENYP---------  416

Query  166  PRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqq  345
              +P  +  + S+    + +  S Y+ N  A Y +QS + +SSS   + N  FA      
Sbjct  417  --MPMAIPGQQSSSHSDITVEASVYDGNPAAGYQSQSQLDNSSSYSHFGNVSFA-TQDHL  473

Query  346  lmnnsqqmqnARYDNNVGLALGPPQSS--CFPT--VGSSV---QQTNLNSFEDWSNTRDK  504
            + N ++       +  V LALGPPQ S   F T  V SS    Q +N+NSF+DWSNT ++
Sbjct  474  ISNPNESQSMMNSNGAVRLALGPPQLSPTGFQTTPVSSSTMRAQPSNINSFDDWSNTHER  533

Query  505  GVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMG  606
            G EE+LSEEEIR RS+E+L N+DMQ LL+LFSMG
Sbjct  534  GAEEFLSEEEIRARSNEILENDDMQQLLRLFSMG  567



>ref|XP_010696620.1| PREDICTED: uncharacterized protein LOC104909117 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=639

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 121/211 (57%), Gaps = 26/211 (12%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            KVY D+L+KKAYENW    EYDGK+LLS K  K    +R E P+ Q +  N   ++L  P
Sbjct  374  KVYADTLIKKAYENWTHVVEYDGKSLLSLKQNKIEDSSRTESPVSQPN-PNFYTHELSLP  432

Query  169  RLP-APVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqq  345
             LP AP   +PS +DPG+ IGG   ++ MG RYS QS  M+ +   QY  T   P +Q  
Sbjct  433  SLPVAPPMEQPS-VDPGLKIGG--LHDAMGTRYSAQSQTMNFNGSAQYA-TSLLPQNQFI  488

Query  346  lmnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLS  525
              +   Q       NN  L+LGP Q S      S +Q    ++F D+     +G E  LS
Sbjct  489  GTSGLSQPSR----NNDALSLGPAQPSL-----SGLQPVGTSNFVDY-----RGNENLLS  534

Query  526  EEEIRLRSHEML*NEDMQHLLQLFSM--GGH  612
            EE+IR+RSH+ML +EDMQHLL++F M  GGH
Sbjct  535  EEDIRMRSHQMLEHEDMQHLLRIFGMGNGGH  565



>ref|XP_010696621.1| PREDICTED: uncharacterized protein LOC104909117 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=634

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 121/211 (57%), Gaps = 26/211 (12%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            KVY D+L+KKAYENW    EYDGK+LLS K  K    +R E P+ Q +  N   ++L  P
Sbjct  369  KVYADTLIKKAYENWTHVVEYDGKSLLSLKQNKIEDSSRTESPVSQPN-PNFYTHELSLP  427

Query  169  RLP-APVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqq  345
             LP AP   +PS +DPG+ IGG   ++ MG RYS QS  M+ +   QY  T   P +Q  
Sbjct  428  SLPVAPPMEQPS-VDPGLKIGG--LHDAMGTRYSAQSQTMNFNGSAQYA-TSLLPQNQFI  483

Query  346  lmnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLS  525
              +   Q       NN  L+LGP Q S      S +Q    ++F D+     +G E  LS
Sbjct  484  GTSGLSQPSR----NNDALSLGPAQPSL-----SGLQPVGTSNFVDY-----RGNENLLS  529

Query  526  EEEIRLRSHEML*NEDMQHLLQLFSM--GGH  612
            EE+IR+RSH+ML +EDMQHLL++F M  GGH
Sbjct  530  EEDIRMRSHQMLEHEDMQHLLRIFGMGNGGH  560



>ref|XP_009606927.1| PREDICTED: uncharacterized protein LOC104101191 isoform X2 [Nicotiana 
tomentosiformis]
Length=626

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 87/214 (41%), Positives = 119/214 (56%), Gaps = 26/214 (12%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA----RNELPMGQVDYSNSLNNQLQQP  168
            K YVD+LVKKAY+NW++  EYDG++LLS    K     +N+L  G   +S+S ++QL  P
Sbjct  363  KEYVDTLVKKAYDNWMNVVEYDGESLLSLNQNKTSDGPQNDLTTGSQSHSSSFDHQLNLP  422

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
              PA + SE   +DPG+ IGG  YN++    Y+ QS  M+ S   Q     F P +   +
Sbjct  423  SFPASISSEQPTMDPGLNIGG--YNDSRTGSYTIQSQKMNLSVNEQLNVASFPPQNHHFV  480

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWS--NTRDKGVEEYL  522
              + Q             AL PP+SS              +SF   S  N   KG +++ 
Sbjct  481  GTSQQTQPPGSESIQ---ALRPPESS-------------FSSFYVASTPNPSYKGTDDFF  524

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGG--HAS  618
            +EEEIR+RSHEML NEDMQHLL++F+MGG  HAS
Sbjct  525  AEEEIRMRSHEMLENEDMQHLLRIFNMGGQNHAS  558



>ref|XP_006347126.1| PREDICTED: uncharacterized protein LOC102591443 [Solanum tuberosum]
Length=621

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/211 (39%), Positives = 122/211 (58%), Gaps = 24/211 (11%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA----RNELPMGQVDYSNSLNNQLQQP  168
            K+YVD+LVKKAY+NW+   EYDGK+LLS    KA    +N+  +G  +++ S + Q    
Sbjct  361  KIYVDTLVKKAYDNWMQVVEYDGKSLLSLGQNKAAVSSQNDPTIGSQNHTISFDQQTNLA  420

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LPA + SE  +++ G+ +GG  YN+++  RY+ Q   M+ +  M      F  N     
Sbjct  421  SLPASISSEQPSMNSGLNMGG--YNDSLSGRYTMQPQNMNLNGNMHLNGASFPQNHLLGT  478

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  528
               +Q      + ++  LAL PPQ    P++ S    +  N +        KG E++L+E
Sbjct  479  SQQAQP-----HGSDSMLALRPPQ----PSMSSYFTASTPNPY--------KGAEDFLTE  521

Query  529  EEIRLRSHEML*NEDMQHLLQLFSMG-GHAS  618
            EEIR++SHEML NEDMQHLL++FSMG GHAS
Sbjct  522  EEIRMKSHEMLENEDMQHLLRMFSMGQGHAS  552



>ref|NP_200566.1| Calmodulin-binding protein [Arabidopsis thaliana]
 dbj|BAB08793.1| calmodulin-binding protein [Arabidopsis thaliana]
 gb|AAL07138.1| putative calmodulin-binding protein [Arabidopsis thaliana]
 gb|AAM14373.1| putative calmodulin-binding protein [Arabidopsis thaliana]
 gb|AED96923.1| Calmodulin-binding protein [Arabidopsis thaliana]
Length=647

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 88/216 (41%), Positives = 117/216 (54%), Gaps = 23/216 (11%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            KVYV+ LVKKAYENW    EYDGK+LL  K  +    L +   +  N     +  P    
Sbjct  366  KVYVEGLVKKAYENWNLVIEYDGKSLLDLKQPQ---RLSITHTNLENYSTAAIDHPM--Q  420

Query  181  PVQSEPSALDPG-------MLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndq  339
             V    S++ P          IGG  Y++ +  RY +   +++S+ R Q+E    + +  
Sbjct  421  MVAGHSSSMPPNQSPVLSDFAIGG--YDQTLATRYHSHPQLLNSNPRAQFEVASCSTSQD  478

Query  340  qqlmnnsqqmqnARYDNNVGLALGPPQSSCFPTVG------SSVQQTNLNSFEDWSNTRD  501
            Q + N  Q        +  GLALGP QSS   T G      SSV Q +LN  EDWSN R+
Sbjct  479  QFMGNLHQTQSTINNQHMNGLALGPSQSS---TSGYQNINPSSVHQADLNHLEDWSNPRE  535

Query  502  KGVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            +G +++ SEEEIRLRSHEML +EDMQ  L+LFSMGG
Sbjct  536  RGPDDFFSEEEIRLRSHEMLESEDMQQFLRLFSMGG  571



>ref|XP_009388351.1| PREDICTED: uncharacterized protein LOC103975166 [Musa acuminata 
subsp. malaccensis]
Length=327

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 114/206 (55%), Gaps = 14/206 (7%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            KV+ D LVKKAY+NW+   EYDGK LL+F  KK          D SN  +++  Q  L A
Sbjct  63   KVFADVLVKKAYDNWMHVIEYDGKALLNFTKKKK------ALSDSSN--DHEESQVNLQA  114

Query  181  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  360
                E   +D G     + Y+ N G  YS+    + S + MQYE+  F P ++       
Sbjct  115  SFPLEHPLVDMGGSTITAVYSGNEGVTYSSSLPNVVSDTNMQYESACFTPQNEAIGSAQQ  174

Query  361  qqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRD-KGVEEYLSEE  531
              +     +++  LAL  PQ +   F     S++ + LN ++DWS  +D + ++++ SEE
Sbjct  175  SLITR---NDSTSLALALPQQTSIGFQPSSHSMEHSGLNIYDDWSGQQDSRCMDDFFSEE  231

Query  532  EIRLRSHEML*NEDMQHLLQLFSMGG  609
            EIRLRSHEML NEDMQHLL+ F+MGG
Sbjct  232  EIRLRSHEMLENEDMQHLLRTFTMGG  257



>gb|KDO75731.1| hypothetical protein CISIN_1g006875mg [Citrus sinensis]
Length=623

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 85/210 (40%), Positives = 122/210 (58%), Gaps = 28/210 (13%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELP----MGQVDYSNSLNNQLQQP  168
            KV+VD+LVKKAY+NW+   EYDGK+LL F   K+ +  P     G  +Y+N  + QL  P
Sbjct  365  KVHVDTLVKKAYDNWMHVIEYDGKSLLGFTQNKSVDAPPTDFQTGPPNYTNPFSQQLALP  424

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             L  PV  E  ++D G       YN+ + +R+S QS  ++ +S  Q++ T F    Q  L
Sbjct  425  TLSVPVPPEQPSMDSG-------YNDGIPSRFSLQSQNVNINS--QFDGTSFP--QQNPL  473

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  528
            ++   +    R +N   LALGPPQSS    V  ++  +N   +        +G+E++ SE
Sbjct  474  VSVPHEAHIPRSENV--LALGPPQSSSL--VSQTIGTSNPAPY--------RGIEDFFSE  521

Query  529  EEIRLRSHEML*NEDM-QHLLQLFSMGGHA  615
            EEIR+RSHEML NEDM QHLL++F+MGG  
Sbjct  522  EEIRMRSHEMLENEDMQQHLLRIFNMGGQG  551



>ref|XP_011043290.1| PREDICTED: uncharacterized protein LOC105138780 isoform X3 [Populus 
euphratica]
Length=623

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 112/209 (54%), Gaps = 34/209 (16%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            K+YVDSLV KAY+NW+   EYDG +LL FK  +    ++N++P GQ D+ N  ++Q   P
Sbjct  372  KIYVDSLVNKAYDNWMHVMEYDGNSLLDFKQHQGVAASQNDVPSGQQDFLNPYDHQDSLP  431

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             +  PV SE   +  G  IGG  Y +   AR+S      S ++  Q++  Q         
Sbjct  432  TISVPVPSEQPVVHSGPAIGG--YTDGAIARFSIDPQNGSLNTPFQFDAIQ---------  480

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  528
                    N    NN+ LALGPPQSS   + G      NL+          +G E++ SE
Sbjct  481  --------NPLGTNNL-LALGPPQSSTPGSQGFCTSNLNLH----------RGKEDFFSE  521

Query  529  EEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
            EEIR RSH+ML NEDMQ LL++F+MGG  
Sbjct  522  EEIRTRSHDMLENEDMQQLLRIFNMGGQG  550



>ref|XP_011043289.1| PREDICTED: uncharacterized protein LOC105138780 isoform X2 [Populus 
euphratica]
Length=626

 Score =   123 bits (309),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 112/209 (54%), Gaps = 34/209 (16%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            K+YVDSLV KAY+NW+   EYDG +LL FK  +    ++N++P GQ D+ N  ++Q   P
Sbjct  375  KIYVDSLVNKAYDNWMHVMEYDGNSLLDFKQHQGVAASQNDVPSGQQDFLNPYDHQDSLP  434

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             +  PV SE   +  G  IGG  Y +   AR+S      S ++  Q++  Q         
Sbjct  435  TISVPVPSEQPVVHSGPAIGG--YTDGAIARFSIDPQNGSLNTPFQFDAIQ---------  483

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  528
                    N    NN+ LALGPPQSS   + G      NL+          +G E++ SE
Sbjct  484  --------NPLGTNNL-LALGPPQSSTPGSQGFCTSNLNLH----------RGKEDFFSE  524

Query  529  EEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
            EEIR RSH+ML NEDMQ LL++F+MGG  
Sbjct  525  EEIRTRSHDMLENEDMQQLLRIFNMGGQG  553



>ref|XP_003532556.1| PREDICTED: uncharacterized protein LOC100806393 [Glycine max]
Length=624

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 124/211 (59%), Gaps = 27/211 (13%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  168
            KVYVD+LVKKAY+NW+   EYDGK+L++    K  +    + PM   +YSNSL  Q+  P
Sbjct  363  KVYVDTLVKKAYDNWMHVIEYDGKSLINDNEDKTLDTTHPQAPMTSHEYSNSLQ-QISIP  421

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LP P+     ++D G+ +GG  Y++   +R+S Q H   +SS +Q+++  F    Q QL
Sbjct  422  ALPLPLHPGQPSVDSGVAVGG--YHDGTASRFSLQPHPNLNSS-IQFDDNAFP--LQNQL  476

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFE--DWSNTRDKGVEEYL  522
            M+ S   Q  R +N  G  +GPPQSS              + FE    SN   +G EEY 
Sbjct  477  MSVSHHTQLPRNEN--GRTVGPPQSST-------------HGFEPLTISNPTYRGAEEYF  521

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
             EEEIR+RS+EML N DMQHLL++F+MGG +
Sbjct  522  PEEEIRIRSNEMLENNDMQHLLRIFNMGGQS  552



>gb|KHN00110.1| hypothetical protein glysoja_028638 [Glycine soja]
Length=624

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 124/211 (59%), Gaps = 27/211 (13%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  168
            KVYVD+LVKKAY+NW+   EYDGK+L++    K  +    + PM   +YSNSL  Q+  P
Sbjct  363  KVYVDTLVKKAYDNWMHVIEYDGKSLINDNEDKTLDTTHPQAPMTSHEYSNSLQ-QISIP  421

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LP P+     ++D G+ +GG  Y++   +R+S Q H   +SS +Q+++  F    Q QL
Sbjct  422  ALPLPLHPGQPSVDSGVAVGG--YHDGTASRFSLQPHPNLNSS-IQFDDNAFP--LQNQL  476

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFE--DWSNTRDKGVEEYL  522
            M+ S   Q  R +N  G  +GPPQSS              + FE    SN   +G EEY 
Sbjct  477  MSVSHHTQLPRNEN--GRTVGPPQSST-------------HGFEPLTISNPTYRGAEEYF  521

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
             EEEIR+RS+EML N DMQHLL++F+MGG +
Sbjct  522  PEEEIRIRSNEMLENNDMQHLLRIFNMGGQS  552



>ref|XP_003545838.1| PREDICTED: uncharacterized protein LOC100802994 isoform X1 [Glycine 
max]
 ref|XP_006597397.1| PREDICTED: uncharacterized protein LOC100802994 isoform X2 [Glycine 
max]
Length=635

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 86/212 (41%), Positives = 117/212 (55%), Gaps = 23/212 (11%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNE----LPMGQVDYS--NSLNNQLQ  162
            KVYVD+LVKKAYENW+   EYDG++LL++   K         P+G  DYS  NSL+ Q  
Sbjct  369  KVYVDTLVKKAYENWMHVIEYDGESLLNYNQNKTLGTSQPLAPVGSHDYSISNSLDQQTS  428

Query  163  QPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqq  342
             P LP P+ +   +++P + +GG  Y+     R S Q    +  S +Q++NT F    Q 
Sbjct  429  IPSLPVPLTTGQPSMNPAVTVGG--YHNVTTTRCSMQPQNDNLHSSIQFDNTAFP--LQN  484

Query  343  qlmnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  522
            QLM+ S   Q  R +N + L    P +  F  V               SN   +G+E+Y 
Sbjct  485  QLMSASHHSQFPRNENGLTLGTRQPATPGFQNVS-------------ISNPNYRGLEDYF  531

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
             E+EIR RSHEML NEDMQHLL++F+MGG  S
Sbjct  532  PEDEIRTRSHEMLENEDMQHLLRIFNMGGGQS  563



>ref|XP_008678706.1| PREDICTED: uncharacterized protein LOC103653644 [Zea mays]
 gb|AFW62646.1| hypothetical protein ZEAMMB73_771415 [Zea mays]
Length=652

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 86/219 (39%), Positives = 128/219 (58%), Gaps = 18/219 (8%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            K Y D+LVKKAYE+W+   EYDGK LLSFK KK     R++  +   ++  S  + + Q 
Sbjct  373  KGYADALVKKAYEDWMQVVEYDGKALLSFKQKKKSVMTRSDAAVASTNHPASNGSAISQK  432

Query  169  RLPAPVQSEPSALDPGMLIGGS--SYNE--NMGARYSNQSHIMSSSSRMQYENTQFAPnd  336
            +L  P ++  ++    M   G+  +YN   N  ARY+  +  + ++  MQY+ +  +P  
Sbjct  433  QLSLPAKAGQTSSAGIMNEDGTRNAYNANGNQSARYAATTQNIPANVAMQYDRSAVSP--  490

Query  337  qqqlmnnsqqmqnARYDNNVGLALGPP---QSSCFPTVGSSVQQTNLNSFEDWSNTRDK-  504
            + Q   +S Q Q +R  N   LALGPP   QS  FP +G S++ T LN FE+W   ++  
Sbjct  491  ESQFSGSSLQSQASRGSNT--LALGPPQQHQSFAFPALGQSMRPTGLNPFEEWPQQQENC  548

Query  505  -GVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
             GV++YL  EEIR+RSHE+L NE+MQ +L+L S GG  +
Sbjct  549  GGVDDYLM-EEIRMRSHEILENEEMQQMLRLLSTGGAGT  586



>ref|XP_008645829.1| PREDICTED: uncharacterized protein LOC103627307 isoform X2 [Zea 
mays]
Length=650

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 87/220 (40%), Positives = 122/220 (55%), Gaps = 19/220 (9%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            KVY D+LVKKAYE+W+   EYDGK LLSFK KK     R+++         S  +   Q 
Sbjct  370  KVYADALVKKAYEDWMQVVEYDGKALLSFKQKKKTVTTRSDVASASTSNPASYGSANSQK  429

Query  169  RLPAPVQSEPSALDPGMLIGGS--SYNE--NMGARYSNQSHIMSSSSRMQYENTQFAPnd  336
            +L  P ++  ++    M   G+  +YN   N  ARY+  +  + ++  MQY+ +  +P  
Sbjct  430  QLSLPAKAGQTSSAGTMNEDGTRNAYNANGNQSARYAANTQSIPANVGMQYDGSAVSPEI  489

Query  337  qqqlmnnsqqmqnARYDNNVGLALGPP---QSSCFPTVGSSVQQTNLNSFEDW---SNTR  498
            Q    +   Q       +N+ LALGPP   QS  FP +G  VQ T LN FE+W      R
Sbjct  490  QFSGSSLQSQSSRG---SNM-LALGPPQQHQSFEFPALGQPVQPTGLNPFEEWPQQQENR  545

Query  499  DKGVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
              GV++YL  EEIR+RSHE+L NE+MQ +L+L SMGG  +
Sbjct  546  GGGVDDYLM-EEIRMRSHEILENEEMQQMLRLLSMGGAGT  584



>ref|XP_007148242.1| hypothetical protein PHAVU_006G191900g [Phaseolus vulgaris]
 gb|ESW20236.1| hypothetical protein PHAVU_006G191900g [Phaseolus vulgaris]
Length=638

 Score =   121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 89/218 (41%), Positives = 119/218 (55%), Gaps = 30/218 (14%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNE-----LPMGQVDYS--NSLNNQL  159
            KVYVD+LVKKAYENW+   EYDGK+LL+    K          P+G  DYS  NSL+ Q 
Sbjct  370  KVYVDTLVKKAYENWMHVIEYDGKSLLNANQNKTLGASQPLLAPVGSHDYSISNSLDQQT  429

Query  160  QQPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndq  339
              P LP PV +   ++DP + +GG  Y+     R S Q       S +Q++NT F   +Q
Sbjct  430  SMPNLPDPVTTGQPSMDPAITVGG--YHNATTIRSSMQPQNDDLHSSIQFDNTAFPLQNQ  487

Query  340  qqlmnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRD--KGVE  513
                ++  Q+      N   L LG            S QQ   + F++ SN+    +G+E
Sbjct  488  LLNASHQSQLPI----NENELTLG------------SRQQPATHGFQNVSNSNPCYRGLE  531

Query  514  EYLSEEEIRLRSHEML*NEDMQHLLQLFSMGG---HAS  618
            +Y  EEEIR RSHEML NEDMQ+LL++F+MGG   HAS
Sbjct  532  DYFPEEEIRTRSHEMLENEDMQNLLRIFNMGGGQSHAS  569



>gb|AGT16661.1| hypothetical protein SHCRBa_107_F16_R_30 [Saccharum hybrid cultivar 
R570]
Length=649

 Score =   120 bits (302),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 90/226 (40%), Positives = 123/226 (54%), Gaps = 32/226 (14%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK-------------ARNELPMGQVDYSN  141
            KVY D+LVKKAYE+W+   EYDGK LLSFK KK               N  P G      
Sbjct  370  KVYADALVKKAYEDWMQVVEYDGKALLSFKQKKKSVMTRSDAAAASTSNPAPYG------  423

Query  142  SLNNQLQQPRLPAPVQSEPSA--LDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYEN  315
            S N+Q +Q  LPA      SA  ++        + N N  ARY+  +  + ++  MQY+ 
Sbjct  424  SANSQ-KQLSLPAKAGQTSSAGTMNEDGTRNAYNGNGNQSARYAANTQNIPANVTMQYDR  482

Query  316  TQFAPndqqqlmnnsqqmqnARYDNNVGLALGPP---QSSCFPTVGSSVQQTNLNSFEDW  486
            +  +P   +   + S     A   +N+ LALGPP   QS  FP +G S+Q T LN FE+W
Sbjct  483  SAVSP---ESQFSGSSLQSQASRGSNM-LALGPPQQHQSFEFPALGQSMQPTGLNPFEEW  538

Query  487  SNTRDK--GVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
               ++   GV++YL  EEIR+RSHE+L NE+MQ +L+L SMGG  +
Sbjct  539  PQQQENRGGVDDYLM-EEIRMRSHEILENEEMQQMLRLLSMGGAGT  583



>ref|XP_002316656.1| calmodulin-binding protein 60-C [Populus trichocarpa]
 gb|EEE97268.1| calmodulin-binding protein 60-C [Populus trichocarpa]
Length=625

 Score =   120 bits (300),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 80/209 (38%), Positives = 111/209 (53%), Gaps = 34/209 (16%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            K+YVDSLVKKAY+NW+   EYDG +LL FK  +    ++N++P G  D+ N  ++Q   P
Sbjct  372  KIYVDSLVKKAYDNWMHVIEYDGNSLLDFKQHQGVAASQNDVPSGHQDFLNPYDHQDSLP  431

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             +  PV SE   +     IGG  Y +   AR+S      S ++  Q++  Q  P      
Sbjct  432  TISVPVPSEQPVVHSSPAIGG--YTDGTVARFSIDPQNGSLNTPFQFDAIQ-NPLGT---  485

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  528
                         NN+ LALGPPQSS   + G      NL+          +G +++ SE
Sbjct  486  -------------NNL-LALGPPQSSTPGSQGFCASNLNLH----------RGKDDFFSE  521

Query  529  EEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
            EEIR RSH+ML NEDMQ LL++F+MGG  
Sbjct  522  EEIRTRSHDMLENEDMQQLLRIFNMGGQG  550



>gb|KJB57646.1| hypothetical protein B456_009G173400 [Gossypium raimondii]
Length=631

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 88/211 (42%), Positives = 121/211 (57%), Gaps = 24/211 (11%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA----RNELPMGQVDYSNSLNNQLQQP  168
            KVYVD+LVKKAYENW+   EYD K+LL  K   +    +  +PM    Y  S+N Q   P
Sbjct  362  KVYVDALVKKAYENWMHVIEYDSKSLLGSKEDDSAGPSQANVPMDPQGYPISINQQHTLP  421

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             L  PV SE   +D  + +GG  Y+++M AR S QS  +   ++ Q+  + F    Q  L
Sbjct  422  TLSVPVPSEQPPIDSSLNVGG--YDDSMAARMSMQSQNVHLHAQNQFSGSSFT--LQNPL  477

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  522
            ++ S Q+Q   +DN  G ALGP QSS   F   G+S   T             KG++++ 
Sbjct  478  VSGSHQVQVPGHDN--GPALGPCQSSMPGFHEGGTSHIPTY------------KGIDDFF  523

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
            SEEEI++RS+EML NEDMQHLL++F+MG H 
Sbjct  524  SEEEIKMRSNEMLDNEDMQHLLRIFNMGSHC  554



>emb|CDO99627.1| unnamed protein product [Coffea canephora]
Length=633

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 83/211 (39%), Positives = 120/211 (57%), Gaps = 25/211 (12%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA----RNELPMGQVDYSNSLNNQLQQP  168
            K+YVD+LVKKAYENW+   EYDGK LLSF   K+    ++++  G  + SNS + Q+  P
Sbjct  370  KLYVDTLVKKAYENWMHVIEYDGKALLSFAENKSSSAPQSDIATGSQNDSNSFDYQVNLP  429

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LP  + SE  ++ P   IG   Y+EN G+R+  QS  M+ +  +    +    ++Q   
Sbjct  430  SLPPLIPSEQPSISPVQTIG---YDENGGSRFQMQSQSMNLNPTIHIHGSSLPLHNQMIT  486

Query  349  mnnsqqmqnARYDNNVGLALGPPQSS--CFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  522
             ++          N   LALGP QSS   F   G S    NL+++        +G ++  
Sbjct  487  TSSQVHSPT----NTNLLALGPLQSSMSSFHAPGPS----NLSNY--------RGFDDVF  530

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
            SEE+IRLRSHEML NEDMQ+LL++F+MGG+ 
Sbjct  531  SEEDIRLRSHEMLENEDMQNLLRIFNMGGYG  561



>ref|XP_007159256.1| hypothetical protein PHAVU_002G222600g [Phaseolus vulgaris]
 gb|ESW31250.1| hypothetical protein PHAVU_002G222600g [Phaseolus vulgaris]
Length=628

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 87/207 (42%), Positives = 120/207 (58%), Gaps = 25/207 (12%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            +VYVD+LVKKAY+NW+   EYDGK+L++    K    A  + PM   +YSNSL    QQ 
Sbjct  369  RVYVDTLVKKAYDNWMHVIEYDGKSLINDIEDKTLDTAHPQAPMTPHEYSNSL----QQI  424

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             +P PV +   ++D G+ +GG  Y++   +R+S Q    S +S +Q++   F+   Q QL
Sbjct  425  PIPLPVHAGQPSMDSGVTVGG--YHDGTTSRFSLQPQNPSFNSSIQFDENAFS--LQNQL  480

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  528
            M+     Q  R +N  GL  GP QSS       S+           SN   +GVEEY  E
Sbjct  481  MSVPHHTQLPRSEN--GLTHGPAQSSTHGFEPVSI-----------SNPTYRGVEEYFPE  527

Query  529  EEIRLRSHEML*NEDMQHLLQLFSMGG  609
            EEIR+RSHEML NEDMQ LL++F++GG
Sbjct  528  EEIRIRSHEMLENEDMQQLLRMFNVGG  554



>ref|XP_008645828.1| PREDICTED: uncharacterized protein LOC103627307 isoform X1 [Zea 
mays]
 gb|AFW71857.1| hypothetical protein ZEAMMB73_193945 [Zea mays]
Length=651

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 90/221 (41%), Positives = 120/221 (54%), Gaps = 20/221 (9%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLN--NQLQ  162
            KVY D+LVKKAYE+W+   EYDGK LLSFK KK     R+++         S    N  +
Sbjct  370  KVYADALVKKAYEDWMQVVEYDGKALLSFKQKKKTVTTRSDVASASTSNPASYGSANSQK  429

Query  163  QPRLPAPVQSEPSALDPGMLIGG-SSYNE--NMGARYSNQSHIMSSSSRMQYENTQFAPn  333
            Q  LPA      SA       G  ++YN   N  ARY+  +  + ++  MQY+ +  +P 
Sbjct  430  QLSLPAKAGQTSSAGTMNEADGTRNAYNANGNQSARYAANTQSIPANVGMQYDGSAVSPE  489

Query  334  dqqqlmnnsqqmqnARYDNNVGLALGPP---QSSCFPTVGSSVQQTNLNSFEDW---SNT  495
             Q    +   Q       +N+ LALGPP   QS  FP +G  VQ T LN FE+W      
Sbjct  490  IQFSGSSLQSQSSRG---SNM-LALGPPQQHQSFEFPALGQPVQPTGLNPFEEWPQQQEN  545

Query  496  RDKGVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            R  GV++YL  EEIR+RSHE+L NE+MQ +L+L SMGG  +
Sbjct  546  RGGGVDDYLM-EEIRMRSHEILENEEMQQMLRLLSMGGAGT  585



>ref|NP_001047151.1| Os02g0562300 [Oryza sativa Japonica Group]
 dbj|BAD16554.1| putative calmodulin-binding protein [Oryza sativa Japonica Group]
 dbj|BAF09065.1| Os02g0562300 [Oryza sativa Japonica Group]
 dbj|BAG93360.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57202.1| hypothetical protein OsJ_07158 [Oryza sativa Japonica Group]
Length=652

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 86/223 (39%), Positives = 120/223 (54%), Gaps = 26/223 (12%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQ----VDYSNS-LNN  153
            K+Y D LVKKAYE+W+   EYDGK LLSFK KK     R++         V Y +S  + 
Sbjct  373  KIYADGLVKKAYEDWMHVVEYDGKALLSFKQKKKSVTTRSDTAAAATNSPVSYGSSNTHK  432

Query  154  QLQQPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPn  333
            QL QP       +  ++ D       S+YN N   RY+  S  + ++   QYE +   P 
Sbjct  433  QLSQPAKAGQTSTGTTSEDGST----SAYNGNQAGRYAVNSQSIPANVTTQYERSSLTPE  488

Query  334  dqqqlmnnsqqmqnARYDNNVGLALGPPQSSC-----FPTVGS-SVQQTNLNSFEDWSNT  495
             Q        Q+      +N+ LALGPPQ        F  +G  S+Q T LN F+DWS  
Sbjct  489  SQFNGSALQNQVSRG---SNI-LALGPPQQQHQQNFEFSALGGQSMQPTGLNPFDDWSQP  544

Query  496  RD--KGVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            ++   GV++YL  EEIR+RSHE+L NE+MQ +L++ SMGG ++
Sbjct  545  QENRSGVDDYLM-EEIRMRSHEILENEEMQQMLRILSMGGAST  586



>ref|XP_011096210.1| PREDICTED: uncharacterized protein LOC105175464 [Sesamum indicum]
Length=636

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 121/209 (58%), Gaps = 29/209 (14%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNE----LPMGQVDYSNSLNNQLQQP  168
            KV+VD+LVKKAYENW+   EYDGK+LL +   K+ N     L +   D  NS + QL  P
Sbjct  370  KVFVDTLVKKAYENWMHVIEYDGKSLLGYDQSKSSNSSQNDLRIHIQDQPNSFD-QLSLP  428

Query  169  RLPAP--VQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqq  342
             LP P  + +EP   +PG+ IGG  YN+N+ +RY  Q   M+ +  +Q +   F P +Q 
Sbjct  429  NLPIPSSIPAEPPT-NPGLTIGG--YNDNIVSRYPTQPQNMNLNVSIQLDGASFPPQNQL  485

Query  343  qlmnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEE  516
                   Q   +    NV LALG P S+   FPT G+S    NL S+        +G E+
Sbjct  486  INSVQQAQPSGS---ENV-LALGLPHSTTLSFPTGGTS----NLTSY--------RGFED  529

Query  517  YLSEEEIRLRSHEML*NEDMQHLLQLFSM  603
             + E+EIR+RSHEML NEDMQHLL++FSM
Sbjct  530  -IPEDEIRIRSHEMLENEDMQHLLRVFSM  557



>gb|KHG24590.1| eukaryotic translation initiation factor 3 subunit m [Gossypium 
arboreum]
Length=631

 Score =   117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 86/211 (41%), Positives = 120/211 (57%), Gaps = 24/211 (11%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA----RNELPMGQVDYSNSLNNQLQQP  168
            KVYVD+LVKKAYENW+   EYD K+LL  K   +    +  +PM    Y  S+N Q   P
Sbjct  362  KVYVDALVKKAYENWMHVIEYDSKSLLGSKEDDSAGPSQANVPMDPQGYPISINQQHTLP  421

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             L  PV SE   +D  + +GG  Y+++M AR S QS  +   ++ Q+  + F    Q  L
Sbjct  422  TLSVPVPSEQPPIDSSLNVGG--YDDSMAARMSMQSQNVHLHAQNQFSGSSFT--LQNPL  477

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  522
            ++ + Q+Q   +DN    ALGP QSS   F   G+S   T             KG++++ 
Sbjct  478  VSGTHQVQVPGHDNEP--ALGPCQSSMPGFHEGGTSHIPTY------------KGIDDFF  523

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
            SEEEI++RS+EML NEDMQHLL++F+MG H 
Sbjct  524  SEEEIKMRSNEMLDNEDMQHLLRIFNMGSHC  554



>gb|EYU27904.1| hypothetical protein MIMGU_mgv1a0037712mg, partial [Erythranthe 
guttata]
Length=526

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 81/210 (39%), Positives = 113/210 (54%), Gaps = 42/210 (20%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA---RNELPMGQVDYSNSLNNQLQQPR  171
            K +VD+LVKKAY+NW++  EYD K+LL F   K+    N+L +   D  NS + QL  P 
Sbjct  286  KGFVDTLVKKAYDNWMNVLEYDSKSLLGFDQNKSSPFENDLRIHTQDQLNSFD-QLSVPI  344

Query  172  LPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlm  351
            L A +  +  +++PG+ IGG  Y++N+G RY  Q    +    +Q + T F         
Sbjct  345  LSASIPPQNPSVNPGLTIGG--YHDNLGGRYPIQPQNPNLHVALQLDGTSFP--------  394

Query  352  nnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLS  525
                      +D    LALG P S+   FPT  +S   T+   FED            + 
Sbjct  395  ----------HDQ---LALGQPISTTASFPTASTS-NVTSYRGFED------------IP  428

Query  526  EEEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
            E+EIR+RSHEML +EDMQHLL++FSMGGH 
Sbjct  429  EDEIRVRSHEMLEHEDMQHLLRMFSMGGHT  458



>ref|XP_010414641.1| PREDICTED: uncharacterized protein LOC104700762 [Camelina sativa]
 ref|XP_010414649.1| PREDICTED: uncharacterized protein LOC104700762 [Camelina sativa]
Length=624

 Score =   117 bits (293),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 115/209 (55%), Gaps = 30/209 (14%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            K YVD LV+KAYENW    EYD K+L++F N+  + +     +DYS           +P 
Sbjct  366  KGYVDGLVRKAYENWDQVIEYDSKSLMNF-NQVGKTD----AIDYS-----------MPV  409

Query  181  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  360
             V S+PS     + +  S YN++  + +  QS +  +++ M + N+ +AP DQ     + 
Sbjct  410  SVPSQPSTSYSDVTVEASVYNQSPASSFPGQSQLADTTTYMHFGNSSYAPQDQLINNTHE  469

Query  361  qqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQT------NLNSFEDWSNTRDKGVEEYL  522
             Q      +  V LALGP         GS  QQ        +NS+ DWSNT ++GV+ +L
Sbjct  470  SQSM-INSNGGVRLALGP-------ATGSQNQQLVQPPPPEINSYNDWSNTCNRGVDGFL  521

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            SEEEIR RS+EML N+DMQ LL+LFSM G
Sbjct  522  SEEEIRARSNEMLENDDMQQLLRLFSMNG  550



>dbj|BAJ94992.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=653

 Score =   117 bits (293),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 82/216 (38%), Positives = 119/216 (55%), Gaps = 17/216 (8%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKAR-----NELPMGQVDYSNSLNNQLQQ  165
            KVY D+LVKKAYE+W+   EYDGK LL FK KK       + +     + SN   N   Q
Sbjct  379  KVYADTLVKKAYEDWMHAVEYDGKALLGFKQKKRSVMTRSDTVSASTSNASNGFANT--Q  436

Query  166  PRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqq  345
             +L +    + S   P      S+YN N  ARY+      +++  MQY+ +  +P  Q  
Sbjct  437  KQLLSGKAGQTSTGTPSEAGARSAYNGNQTARYTVSPQNNAANITMQYDRSALSPESQFS  496

Query  346  lmnnsqqmqnARYDNNVGLALGPPQSSC----FPTVGSSVQQTNLNSFEDWSNTRD-KGV  510
              +   Q       +N+ LAL PPQ       F  VG S+Q  NLN F+ WS+ ++ +GV
Sbjct  497  GSSLQTQTSGG---SNI-LALEPPQQQQQGFEFSAVGQSMQPANLNHFDQWSHPQENRGV  552

Query  511  EEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            ++YL EE IRLRSHE+L N++MQ +L++ +MGG ++
Sbjct  553  DDYLMEE-IRLRSHEILENDEMQQMLRILNMGGAST  587



>ref|XP_010467708.1| PREDICTED: uncharacterized protein LOC104747723 [Camelina sativa]
 ref|XP_010467709.1| PREDICTED: uncharacterized protein LOC104747723 [Camelina sativa]
Length=629

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 114/209 (55%), Gaps = 30/209 (14%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            K YVD LV+KAYENW    EYD K+L++F N+  + +     +DYS           +P 
Sbjct  371  KDYVDGLVRKAYENWDQVIEYDSKSLMNF-NQVGKTD----AIDYS-----------MPV  414

Query  181  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  360
               S+PS     + +  S YN++  + +  QS I  +++ M + N+ FAP DQ     + 
Sbjct  415  SGPSQPSTSYSDVTVEASVYNQSPASSFPGQSQIADTTTYMHFGNSSFAPQDQLINNTHE  474

Query  361  qqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQT------NLNSFEDWSNTRDKGVEEYL  522
             Q      +  V LALGP         GS  QQ        +NS+ DWSNT ++GV+ +L
Sbjct  475  SQTM-INSNGGVRLALGP-------ATGSQNQQLVQPPPPEINSYNDWSNTCNRGVDGFL  526

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            SEEEIR RS+EML N+DMQ LL+LFSM G
Sbjct  527  SEEEIRARSNEMLENDDMQQLLRLFSMNG  555



>ref|XP_006297211.1| hypothetical protein CARUB_v10013220mg [Capsella rubella]
 gb|EOA30109.1| hypothetical protein CARUB_v10013220mg [Capsella rubella]
Length=624

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 80/209 (38%), Positives = 114/209 (55%), Gaps = 30/209 (14%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            K YVD LV+KAYENW    EYD K+L++F          +G+ D ++          +P 
Sbjct  366  KGYVDGLVRKAYENWDQVIEYDSKSLMNFDQ--------VGKTDATDY--------SMPV  409

Query  181  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  360
             V S+PS     + +  S YN++  + +  QS +  +++ MQ+ N+ +AP DQ     + 
Sbjct  410  SVPSQPSTSYSDVTVEASVYNQSPASSFPGQSQLADTTTYMQFGNSSYAPQDQLINNTHE  469

Query  361  qqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQT------NLNSFEDWSNTRDKGVEEYL  522
             Q      +  V LALGP         GS  QQ        +NS+ DWSNT ++GV+ +L
Sbjct  470  SQSM-INSNGGVRLALGP-------ATGSQNQQQLVQPPPEINSYNDWSNTCNRGVDGFL  521

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            SEEEIR RS+EML N+DMQ LL+LFSM G
Sbjct  522  SEEEIRARSNEMLENDDMQQLLRLFSMNG  550



>gb|EEC73417.1| hypothetical protein OsI_07682 [Oryza sativa Indica Group]
Length=652

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 120/223 (54%), Gaps = 26/223 (12%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQ----VDYSNS-LNN  153
            K+Y D LVKKAYE+W+   EYDGK LLSFK KK     R++         V Y +S  + 
Sbjct  373  KIYADGLVKKAYEDWMHVVEYDGKALLSFKQKKKSVTTRSDTAAAATNSPVSYGSSNTHK  432

Query  154  QLQQPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPn  333
            QL QP       +  ++ D       S+YN N   RY+  S  + ++   QYE +   P 
Sbjct  433  QLSQPAKAGQTSTGTTSEDGST----SAYNGNQAGRYAVNSQSIPANVTTQYERSSLTPE  488

Query  334  dqqqlmnnsqqmqnARYDNNVGLALGPPQSSC-----FPTVGS-SVQQTNLNSFEDWSNT  495
             Q        Q+      +N+ LALGPPQ        F  +G  S+Q T LN F+DWS  
Sbjct  489  SQFNGSALQNQVSRG---SNI-LALGPPQQQHQQNFEFSALGGQSMQPTGLNPFDDWSQP  544

Query  496  RD--KGVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            ++   GV++YL  EEIR++SHE+L NE+MQ +L++ SMGG ++
Sbjct  545  QENRSGVDDYLM-EEIRMQSHEILENEEMQQMLRILSMGGAST  586



>ref|XP_010057559.1| PREDICTED: uncharacterized protein LOC104445366 [Eucalyptus grandis]
 gb|KCW74752.1| hypothetical protein EUGRSUZ_E03474 [Eucalyptus grandis]
Length=621

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/210 (38%), Positives = 113/210 (54%), Gaps = 34/210 (16%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKAR---NELPMGQVDYSNSLNNQLQQPR  171
            KV+VD+LVKKAY+NW+   EYDGK+L+ F N+ A    +E PMGQ +YSN  + Q+  P 
Sbjct  369  KVHVDTLVKKAYDNWMHVIEYDGKSLVDFNNEDAGASCSEFPMGQQEYSNIYDQQITPPS  428

Query  172  LPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlm  351
            L  P+  +    D G       YN+++  RY  Q   ++ S  +Q + + F   D     
Sbjct  429  LSVPISMDQPPADSG-------YNDSISTRYQMQPPSVNVSIPLQVDGSSFPLQDPLISS  481

Query  352  nnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLS  525
            ++  Q+          L++GP Q+S   F + G S     L  +        +G EE   
Sbjct  482  SHQTQL----------LSIGPSQASASGFHSAGPS----GLPPY--------RGAEELFP  519

Query  526  EEEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
            EEEIR+RS  ML NEDMQHLL++F+MGGH 
Sbjct  520  EEEIRMRSLAMLENEDMQHLLRIFNMGGHT  549



>ref|XP_006361013.1| PREDICTED: uncharacterized protein LOC102605248 [Solanum tuberosum]
Length=625

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 113/212 (53%), Gaps = 22/212 (10%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  168
            K YVDSLVKKAY+NW+   EYDGK+LLS    K  +    +   G  ++ NS ++QL  P
Sbjct  361  KEYVDSLVKKAYDNWMHVVEYDGKSLLSLNQNKTSDAPQYDPSTGSQNHPNSFDHQLNLP  420

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LPA   SE   ++ G+ +G   YN+++   Y+ +S   + S   Q     F+ N    +
Sbjct  421  SLPASTSSEQPPMNSGLNMGLEGYNDSLMGTYTTESQNTNVSVNEQLSGASFSQNHFVGM  480

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  528
               +QQ  +        LAL PPQ S      +S             N+  KG +++ +E
Sbjct  481  SQQAQQPGSESR-----LALHPPQPSFSSFFAAST-----------PNSSYKGTDDFFTE  524

Query  529  EEIRLRSHEML*NEDMQHLLQLFSMGG--HAS  618
            EEIR RSHEML N+DMQHLL +F+MGG  HAS
Sbjct  525  EEIRTRSHEMLENDDMQHLLHIFNMGGQHHAS  556



>ref|XP_009761692.1| PREDICTED: uncharacterized protein LOC104213840 isoform X2 [Nicotiana 
sylvestris]
Length=583

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 78/217 (36%), Positives = 112/217 (52%), Gaps = 27/217 (12%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNE---------LPMGQVDYSNSLNN  153
            K YVD+LVKKAY+NW++  EYDG++LLS    +  ++         L  G  ++S+S ++
Sbjct  315  KEYVDTLVKKAYDNWMNVVEYDGESLLSLNQNQTSDDPQNHSNSFDLTTGSQNHSSSFDH  374

Query  154  QLQQPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPn  333
            QL  P  PA + SE  A+DPG  IGG  YN++    Y+ QS   + S   Q     F P 
Sbjct  375  QLNLPNFPASISSEQPAMDPGRNIGG--YNDSRTGSYTIQSQNANLSVNEQLNGAPFPPQ  432

Query  334  dqqqlmnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVE  513
            +   +  + Q                P  S    T+       +        N   KG +
Sbjct  433  NHHFVGTSQQTQ--------------PSGSGSMQTLRPPESSFSSFFAASIPNPSYKGAD  478

Query  514  EYLSEEEIRLRSHEML*NEDMQHLLQLFSMGG--HAS  618
            ++ +E+EIR+RSHEML NEDMQHLL++F+MGG  HAS
Sbjct  479  DFFTEQEIRMRSHEMLENEDMQHLLRIFNMGGQNHAS  515



>ref|XP_002452291.1| hypothetical protein SORBIDRAFT_04g023100 [Sorghum bicolor]
 gb|EES05267.1| hypothetical protein SORBIDRAFT_04g023100 [Sorghum bicolor]
Length=650

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 124/220 (56%), Gaps = 19/220 (9%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            KVY D+LVKKAYE+W+   EYDGK LLSFK KK     R++          S  +   Q 
Sbjct  370  KVYADALVKKAYEDWMQVVEYDGKALLSFKQKKKSVTTRSDAAAASTSNPASYGSTNSQK  429

Query  169  RLPAPVQS-EPSALDPGMLIGGS--SYNE--NMGARYSNQSHIMSSSSRMQYENTQFAPn  333
            ++  P ++ + S++       G+  +YN   N  ARY+  +  + ++  MQY+ +  +P 
Sbjct  430  QMSLPAKAGQTSSVGTMNEADGTRNAYNANGNQSARYAANTQNIPANITMQYDRSAVSP-  488

Query  334  dqqqlmnnsqqmqnARYDNNVGLALGPP---QSSCFPTVGSSVQQTNLNSFEDWSNTRDK  504
              +   + S     A   +N+ LALGP    QS  FP +G S+Q T LN FE+W   ++ 
Sbjct  489  --ESQFSGSSLQSQASRGSNM-LALGPSQQHQSFEFPALGQSLQPTGLNPFEEWPQQQEN  545

Query  505  --GVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
              GV++YL  EEIR+RSHE+L NE+MQ +L+L SMGG  +
Sbjct  546  RGGVDDYLM-EEIRMRSHEILENEEMQQMLRLLSMGGAGT  584



>ref|XP_010235560.1| PREDICTED: uncharacterized protein LOC100846328 isoform X1 [Brachypodium 
distachyon]
Length=650

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 116/215 (54%), Gaps = 19/215 (9%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYS---NSLNNQL  159
            KVY D+LVKKAYE+W+   EYDGK LLSFK KK     R++             S+N Q 
Sbjct  374  KVYADTLVKKAYEDWMHAVEYDGKALLSFKQKKKTVTTRSDTAAASSSNLASYGSVNAQK  433

Query  160  QQPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndq  339
            Q   LP       +          S+YN N  ARY+     + ++  MQYE +   P  Q
Sbjct  434  QI--LPGKAGQSSAGTTSEADGARSTYNGNQTARYTASPQSIPANITMQYERSALLPESQ  491

Query  340  qqlmnnsqqmqnARYDNNVGLALGPPQSSC----FPTVGSSVQQTNLNSFEDWSNTRD-K  504
                +   Q   A   +N+ LALGPPQ       F  +G S+Q   LN+F+ WS  ++ +
Sbjct  492  LNGSSLQTQ---ASGGSNM-LALGPPQQQPQGFEFQALGQSMQPAGLNTFDQWSQPQENR  547

Query  505  GVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            GV++YL EE IRLRSHE+L N++MQ +L++ +MGG
Sbjct  548  GVDDYLMEE-IRLRSHEILENDEMQQMLRILNMGG  581



>ref|XP_009761691.1| PREDICTED: uncharacterized protein LOC104213840 isoform X1 [Nicotiana 
sylvestris]
Length=628

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 78/217 (36%), Positives = 112/217 (52%), Gaps = 27/217 (12%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNE---------LPMGQVDYSNSLNN  153
            K YVD+LVKKAY+NW++  EYDG++LLS    +  ++         L  G  ++S+S ++
Sbjct  360  KEYVDTLVKKAYDNWMNVVEYDGESLLSLNQNQTSDDPQNHSNSFDLTTGSQNHSSSFDH  419

Query  154  QLQQPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPn  333
            QL  P  PA + SE  A+DPG  IGG  YN++    Y+ QS   + S   Q     F P 
Sbjct  420  QLNLPNFPASISSEQPAMDPGRNIGG--YNDSRTGSYTIQSQNANLSVNEQLNGAPFPPQ  477

Query  334  dqqqlmnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVE  513
            +   +  + Q                P  S    T+       +        N   KG +
Sbjct  478  NHHFVGTSQQTQ--------------PSGSGSMQTLRPPESSFSSFFAASIPNPSYKGAD  523

Query  514  EYLSEEEIRLRSHEML*NEDMQHLLQLFSMGG--HAS  618
            ++ +E+EIR+RSHEML NEDMQHLL++F+MGG  HAS
Sbjct  524  DFFTEQEIRMRSHEMLENEDMQHLLRIFNMGGQNHAS  560



>ref|XP_010489590.1| PREDICTED: uncharacterized protein LOC104767243 [Camelina sativa]
 ref|XP_010489591.1| PREDICTED: uncharacterized protein LOC104767243 [Camelina sativa]
 ref|XP_010489592.1| PREDICTED: uncharacterized protein LOC104767243 [Camelina sativa]
Length=624

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 117/209 (56%), Gaps = 30/209 (14%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            K YVD LV+KAYENW    EYD K+L++F N+  + +     +DYS           +P 
Sbjct  366  KGYVDGLVRKAYENWDQVIEYDSKSLMNF-NQVGKTD----AIDYS-----------MPV  409

Query  181  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  360
             V S+PS     + +  S YN++  + +  QS +  +++ M + N+ FAP DQ     N 
Sbjct  410  SVPSQPSTSYSDVTVEASVYNQSPASSFPGQSQLADTTTYMHFGNSSFAPQDQLINNTNE  469

Query  361  qqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQT------NLNSFEDWSNTRDKGVEEYL  522
             Q   +  +NN G+ L    ++     GS  QQ        +NS+ DWSNT ++GV+ +L
Sbjct  470  SQ---SMINNNGGVRLAFGAAT-----GSQNQQLVQPPPPEINSYNDWSNTCNRGVDGFL  521

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            SEEEIR RS+EML N+DMQ LL+LFSM G
Sbjct  522  SEEEIRARSNEMLENDDMQQLLRLFSMNG  550



>ref|XP_003608224.1| Calmodulin-binding protein [Medicago truncatula]
 gb|AES90421.1| calmodulin-binding protein [Medicago truncatula]
Length=629

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 87/209 (42%), Positives = 122/209 (58%), Gaps = 23/209 (11%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            KVYVD+LVKKAY+NW+   EYDGK+LL++   K    A  +  MG  +YSN L  Q    
Sbjct  368  KVYVDTLVKKAYDNWMHVIEYDGKSLLNYNQDKNLEPAHPQALMGSHEYSN-LIQQTSIH  426

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LP PV +   ++D G  +GG  Y++     +S QS   + +S +Q+++  F+   Q QL
Sbjct  427  SLPHPVNTGQPSMDTGATVGG--YHDGTTTSFSMQSQNTNLNSSIQFDDNAFS--LQSQL  482

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  528
            M+   Q Q  R +N  G+ LG PQ     TV    Q  ++++    S  R   VE++  E
Sbjct  483  MSVPHQAQLQRSEN--GMMLGMPQ-----TVTHGFQTASISN----STYR---VEDFFPE  528

Query  529  EEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
            EEIR+RSHEML NEDMQ LL++F+MG HA
Sbjct  529  EEIRIRSHEMLENEDMQQLLRMFNMGSHA  557



>ref|XP_006647388.1| PREDICTED: uncharacterized protein LOC102720488 isoform X1 [Oryza 
brachyantha]
Length=655

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 83/220 (38%), Positives = 120/220 (55%), Gaps = 19/220 (9%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            K+Y D LVKKAYE+W+   EYDGK LLSFK KK     R++      +   S  +   Q 
Sbjct  375  KIYADGLVKKAYEDWMHVVEYDGKALLSFKQKKKSVTTRSDTAAAATNNPASYGSPSTQK  434

Query  169  RLPAPVQSEPSALDPGMLIGGS--SYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqq  342
            +L  P ++  ++        GS  SYN N    Y+  S  + ++   QYE +   P   +
Sbjct  435  QLSQPAKAGQTSTGTTSEADGSTISYNGNQAGHYTANSQSIPANVTTQYERSSLTP---E  491

Query  343  qlmnnsqqmqnARYDNNVGLALGPPQSSC-----FPTVGS-SVQQTNLNSFEDWSNTRD-  501
              +N S     A   +N+ LALGPPQ        F  +G  S+Q T +N F+DWS  ++ 
Sbjct  492  SQLNGSALQNQASRGSNM-LALGPPQQHQQQNFEFSALGGQSMQPTGMNPFDDWSQPQEN  550

Query  502  -KGVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
              GV++YL  EEIR+RSHE+L NE+MQ +L++ SMGG ++
Sbjct  551  RSGVDDYLM-EEIRMRSHEILENEEMQQMLRILSMGGAST  589



>ref|XP_003575160.1| PREDICTED: uncharacterized protein LOC100846328 isoform X2 [Brachypodium 
distachyon]
Length=649

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 85/215 (40%), Positives = 118/215 (55%), Gaps = 20/215 (9%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYS---NSLNNQL  159
            KVY D+LVKKAYE+W+   EYDGK LLSFK KK     R++             S+N Q 
Sbjct  374  KVYADTLVKKAYEDWMHAVEYDGKALLSFKQKKKTVTTRSDTAAASSSNLASYGSVNAQK  433

Query  160  QQPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndq  339
            Q     A   S  +  + G     S+YN N  ARY+     + ++  MQYE +   P  Q
Sbjct  434  QILPGKAGQSSAGTTSEDG---ARSTYNGNQTARYTASPQSIPANITMQYERSALLPESQ  490

Query  340  qqlmnnsqqmqnARYDNNVGLALGPPQSSC----FPTVGSSVQQTNLNSFEDWSNTRD-K  504
                +   Q   A   +N+ LALGPPQ       F  +G S+Q   LN+F+ WS  ++ +
Sbjct  491  LNGSSLQTQ---ASGGSNM-LALGPPQQQPQGFEFQALGQSMQPAGLNTFDQWSQPQENR  546

Query  505  GVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            GV++YL EE IRLRSHE+L N++MQ +L++ +MGG
Sbjct  547  GVDDYLMEE-IRLRSHEILENDEMQQMLRILNMGG  580



>ref|XP_006647389.1| PREDICTED: uncharacterized protein LOC102720488 isoform X2 [Oryza 
brachyantha]
Length=654

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 82/219 (37%), Positives = 120/219 (55%), Gaps = 18/219 (8%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            K+Y D LVKKAYE+W+   EYDGK LLSFK KK     R++      +   S  +   Q 
Sbjct  375  KIYADGLVKKAYEDWMHVVEYDGKALLSFKQKKKSVTTRSDTAAAATNNPASYGSPSTQK  434

Query  169  RLPAPVQSEPSALDPGMLIGGS-SYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqq  345
            +L  P ++  ++       G + SYN N    Y+  S  + ++   QYE +   P   + 
Sbjct  435  QLSQPAKAGQTSTGTTSEDGSTISYNGNQAGHYTANSQSIPANVTTQYERSSLTP---ES  491

Query  346  lmnnsqqmqnARYDNNVGLALGPPQSSC-----FPTVGS-SVQQTNLNSFEDWSNTRD--  501
             +N S     A   +N+ LALGPPQ        F  +G  S+Q T +N F+DWS  ++  
Sbjct  492  QLNGSALQNQASRGSNM-LALGPPQQHQQQNFEFSALGGQSMQPTGMNPFDDWSQPQENR  550

Query  502  KGVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
             GV++YL  EEIR+RSHE+L NE+MQ +L++ SMGG ++
Sbjct  551  SGVDDYLM-EEIRMRSHEILENEEMQQMLRILSMGGAST  588



>emb|CDY02746.1| BnaC02g11430D [Brassica napus]
Length=624

 Score =   112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 83/206 (40%), Positives = 114/206 (55%), Gaps = 28/206 (14%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            KVYVD LVKKAY+NW    EYDGK+L+  K  +   E      +YS +  +       P 
Sbjct  362  KVYVDGLVKKAYDNWNLVIEYDGKSLIDMKQPQNPPE------NYSTAAFDH------PM  409

Query  181  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  360
             +     +LD    IGG  Y++ M   Y     ++ S++R  +E         Q + +  
Sbjct  410  QMAGANQSLD--FTIGG--YDQTMVTSYPPHPQLLDSNTRAHFEVAS-----DQLMGSVH  460

Query  361  qqmqnARYDNNVG--LALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKG---VEEYLS  525
             Q Q++ Y+ N+   LA+GPPQSS   +   ++ Q NLN FEDWSN  ++G    E++ S
Sbjct  461  PQAQSSTYNQNMNGLLAIGPPQSST--SHYQNINQANLNPFEDWSNHGERGGGGAEDFFS  518

Query  526  EEEIRLRSHEML*NEDMQHLLQLFSM  603
            EEEIRLRSHEML NEDMQ  L+LFSM
Sbjct  519  EEEIRLRSHEMLENEDMQKFLRLFSM  544



>gb|AAL11615.1|AF424622_1 At2g18750/MSF3.13 [Arabidopsis thaliana]
 gb|AAN28789.1| At2g18750/MSF3.13 [Arabidopsis thaliana]
Length=315

 Score =   109 bits (273),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 79/209 (38%), Positives = 113/209 (54%), Gaps = 33/209 (16%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            K YVD LV+KAYENW    EYD K+L++F      ++     +DYS           +P 
Sbjct  61   KGYVDGLVRKAYENWEQVIEYDSKSLMNFNQVSKTDD-----IDYS-----------MPV  104

Query  181  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  360
             V S+PS     + +   +YN++  + +  QS  ++ ++ M + N+ FAP DQ     + 
Sbjct  105  SVPSQPSTSYSDVTV--EAYNQSPASSFPGQSQ-LADTTYMHFGNSSFAPQDQLVNNTHE  161

Query  361  qqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQT------NLNSFEDWSNTRDKGVEEYL  522
             Q      +  V LALGP         GS  Q+        +NS+ DWSNT ++GV+ +L
Sbjct  162  SQSM-INSNGGVRLALGP-------ATGSQNQEQLVHPPPEINSYNDWSNTCNRGVDGFL  213

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            SEEEIR RS+EML N+DMQ LL+LFSM G
Sbjct  214  SEEEIRARSNEMLENDDMQQLLRLFSMNG  242



>ref|XP_002886266.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62525.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata]
Length=621

 Score =   112 bits (279),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 116/208 (56%), Gaps = 32/208 (15%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            K YVD LV+KAYENW    EYD K+L++F N+ ++ +     +DYS           +P 
Sbjct  368  KGYVDGLVRKAYENWDQVIEYDSKSLMNF-NQVSKTD----AIDYS-----------MPV  411

Query  181  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  360
             V S+PS     + +   +YNE+  + +  QS  ++ ++ M + N+ FAP D      + 
Sbjct  412  SVPSQPSTSYSDVTV--EAYNESPASSFPGQSQ-LADTTYMHFGNSSFAPQDHLVNNTHE  468

Query  361  qqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQT-----NLNSFEDWSNTRDKGVEEYLS  525
             Q      ++ V LALGP         GS  QQ       +NS+ DWSNT ++GV+ +LS
Sbjct  469  SQSM-INSNSGVRLALGP-------ATGSQNQQLVQPPPEINSYNDWSNTCNRGVDGFLS  520

Query  526  EEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            EEEIR RS+EML N+DMQ LL+LFSM G
Sbjct  521  EEEIRARSNEMLENDDMQQLLRLFSMNG  548



>ref|XP_009126828.1| PREDICTED: uncharacterized protein LOC103851701 [Brassica rapa]
 ref|XP_009126829.1| PREDICTED: uncharacterized protein LOC103851701 [Brassica rapa]
Length=625

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 85/211 (40%), Positives = 111/211 (53%), Gaps = 27/211 (13%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            KVYVD LVKKAY+NW    EYDGK+L+  K  +   E      +YS +  +       P 
Sbjct  362  KVYVDGLVKKAYDNWNLVIEYDGKSLIDMKQPQNPPE------NYSTTAFDH------PM  409

Query  181  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  360
             +     +LD    IGG  Y++ M   Y     ++ S+   QYE      +DQ     + 
Sbjct  410  QMAGANQSLD--FTIGG--YDQTMVTSYPQHPQLLDSNPGAQYE----VASDQLMGSVHQ  461

Query  361  qqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKG-----VEEYLS  525
             Q      + N  LALGPPQSS   +    + Q NLN FEDWSN  ++G      E++ S
Sbjct  462  AQSSTNNQNMNGLLALGPPQSST--SHYQHINQANLNPFEDWSNHGERGGGGGGAEDFFS  519

Query  526  EEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            EEEIRLRSHEML NEDMQ  ++LFSMGG  +
Sbjct  520  EEEIRLRSHEMLENEDMQKFVRLFSMGGGGT  550



>ref|XP_010327019.1| PREDICTED: uncharacterized protein LOC101268806 isoform X3 [Solanum 
lycopersicum]
Length=588

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 79/215 (37%), Positives = 112/215 (52%), Gaps = 28/215 (13%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  168
            K YVD+LVKKAY+NW+   EYDGK+LLS    K  +    +L  G  ++ NS ++QL  P
Sbjct  324  KEYVDTLVKKAYDNWMHVVEYDGKSLLSLDQNKTSDAPQYDLSTGSQNHPNSFDHQLNLP  383

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LPA   SE   ++ G+ +G   YN+++   Y+ +S   + S   Q     F+ N    +
Sbjct  384  SLPASTSSEQPPMNSGLNMGLEGYNDSLMGTYTTESQNTNLSVNEQLSGASFSQNHFVGM  443

Query  349  mnnsqqmqnARYDNNVGLALGPPQ---SSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  519
               +Q   +         AL PPQ   SS F                +  N+  KG +++
Sbjct  444  SQQAQPTGSESRP-----ALHPPQPPFSSFFAA--------------NTPNSSYKGTDDF  484

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSMGG--HAS  618
             +EEEIR RS EML N+DMQHLL +F+MGG  HAS
Sbjct  485  YTEEEIRTRSQEMLENDDMQHLLHIFNMGGQHHAS  519



>ref|XP_010327020.1| PREDICTED: uncharacterized protein LOC101268806 isoform X4 [Solanum 
lycopersicum]
Length=570

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 79/215 (37%), Positives = 112/215 (52%), Gaps = 28/215 (13%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  168
            K YVD+LVKKAY+NW+   EYDGK+LLS    K  +    +L  G  ++ NS ++QL  P
Sbjct  306  KEYVDTLVKKAYDNWMHVVEYDGKSLLSLDQNKTSDAPQYDLSTGSQNHPNSFDHQLNLP  365

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LPA   SE   ++ G+ +G   YN+++   Y+ +S   + S   Q     F+ N    +
Sbjct  366  SLPASTSSEQPPMNSGLNMGLEGYNDSLMGTYTTESQNTNLSVNEQLSGASFSQNHFVGM  425

Query  349  mnnsqqmqnARYDNNVGLALGPPQ---SSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  519
               +Q   +         AL PPQ   SS F                +  N+  KG +++
Sbjct  426  SQQAQPTGSESRP-----ALHPPQPPFSSFFAA--------------NTPNSSYKGTDDF  466

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSMGG--HAS  618
             +EEEIR RS EML N+DMQHLL +F+MGG  HAS
Sbjct  467  YTEEEIRTRSQEMLENDDMQHLLHIFNMGGQHHAS  501



>ref|XP_004248099.1| PREDICTED: uncharacterized protein LOC101268806 isoform X2 [Solanum 
lycopersicum]
Length=594

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 79/215 (37%), Positives = 112/215 (52%), Gaps = 28/215 (13%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  168
            K YVD+LVKKAY+NW+   EYDGK+LLS    K  +    +L  G  ++ NS ++QL  P
Sbjct  330  KEYVDTLVKKAYDNWMHVVEYDGKSLLSLDQNKTSDAPQYDLSTGSQNHPNSFDHQLNLP  389

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LPA   SE   ++ G+ +G   YN+++   Y+ +S   + S   Q     F+ N    +
Sbjct  390  SLPASTSSEQPPMNSGLNMGLEGYNDSLMGTYTTESQNTNLSVNEQLSGASFSQNHFVGM  449

Query  349  mnnsqqmqnARYDNNVGLALGPPQ---SSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  519
               +Q   +         AL PPQ   SS F                +  N+  KG +++
Sbjct  450  SQQAQPTGSESRP-----ALHPPQPPFSSFFAA--------------NTPNSSYKGTDDF  490

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSMGG--HAS  618
             +EEEIR RS EML N+DMQHLL +F+MGG  HAS
Sbjct  491  YTEEEIRTRSQEMLENDDMQHLLHIFNMGGQHHAS  525



>ref|XP_004248098.1| PREDICTED: uncharacterized protein LOC101268806 isoform X1 [Solanum 
lycopersicum]
Length=625

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 79/215 (37%), Positives = 112/215 (52%), Gaps = 28/215 (13%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  168
            K YVD+LVKKAY+NW+   EYDGK+LLS    K  +    +L  G  ++ NS ++QL  P
Sbjct  361  KEYVDTLVKKAYDNWMHVVEYDGKSLLSLDQNKTSDAPQYDLSTGSQNHPNSFDHQLNLP  420

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LPA   SE   ++ G+ +G   YN+++   Y+ +S   + S   Q     F+ N    +
Sbjct  421  SLPASTSSEQPPMNSGLNMGLEGYNDSLMGTYTTESQNTNLSVNEQLSGASFSQNHFVGM  480

Query  349  mnnsqqmqnARYDNNVGLALGPPQ---SSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  519
               +Q   +         AL PPQ   SS F                +  N+  KG +++
Sbjct  481  SQQAQPTGSESRP-----ALHPPQPPFSSFFAA--------------NTPNSSYKGTDDF  521

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSMGG--HAS  618
             +EEEIR RS EML N+DMQHLL +F+MGG  HAS
Sbjct  522  YTEEEIRTRSQEMLENDDMQHLLHIFNMGGQHHAS  556



>ref|NP_565441.2| Calmodulin-binding protein [Arabidopsis thaliana]
 ref|NP_001031372.1| Calmodulin-binding protein [Arabidopsis thaliana]
 ref|NP_001189550.1| Calmodulin-binding protein [Arabidopsis thaliana]
 dbj|BAH30392.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC06802.1| Calmodulin-binding protein [Arabidopsis thaliana]
 gb|AEC06803.1| Calmodulin-binding protein [Arabidopsis thaliana]
 gb|AEC06804.1| Calmodulin-binding protein [Arabidopsis thaliana]
Length=622

 Score =   108 bits (271),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 80/209 (38%), Positives = 116/209 (56%), Gaps = 33/209 (16%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            K YVD LV+KAYENW    EYD K+L++F N+ ++ +     +DYS           +P 
Sbjct  368  KGYVDGLVRKAYENWEQVIEYDSKSLMNF-NQVSKTD----DIDYS-----------MPV  411

Query  181  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  360
             V S+PS     + +   +YN++  + +  QS  ++ ++ M + N+ FAP DQ     + 
Sbjct  412  SVPSQPSTSYSDVTV--EAYNQSPASSFPGQSQ-LADTTYMHFGNSSFAPQDQLVNNTHE  468

Query  361  qqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQT------NLNSFEDWSNTRDKGVEEYL  522
             Q      +  V LALGP         GS  Q+        +NS+ DWSNT ++GV+ +L
Sbjct  469  SQSM-INSNGGVRLALGP-------ATGSQNQEQLVHPPPEINSYNDWSNTCNRGVDGFL  520

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            SEEEIR RS+EML N+DMQ LL+LFSM G
Sbjct  521  SEEEIRARSNEMLENDDMQQLLRLFSMNG  549



>ref|XP_002869655.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45914.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata]
Length=600

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 84/205 (41%), Positives = 106/205 (52%), Gaps = 29/205 (14%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            KVYVD LVKKAYENW    EY+GK+LL+F N+  R  L + Q D   +L          A
Sbjct  355  KVYVDGLVKKAYENWNQVVEYEGKSLLNF-NQPER--LDISQTDPVTAL----------A  401

Query  181  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  360
               + P +  P   I G  YN+ +    ++Q H   +      +  QF        +   
Sbjct  402  SYSTVPLSQFPEFAIEG--YNQTLA---TSQPHNPQAQFDFVSQQDQF------MGIQQP  450

Query  361  qqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEEE  534
            Q       +N  GL LGPP SS   +  + SSV Q NLN FEDW N  +    +  +EEE
Sbjct  451  QSQPTIENENVTGLVLGPPYSSTGGYQDIKSSVDQENLNPFEDWINPNEN---DLFAEEE  507

Query  535  IRLRSHEML*NEDMQHLLQLFSMGG  609
            IR RSH+ML NEDMQ LLQLFSMGG
Sbjct  508  IRQRSHDMLANEDMQQLLQLFSMGG  532



>ref|XP_010433589.1| PREDICTED: uncharacterized protein LOC104717678 [Camelina sativa]
 ref|XP_010433590.1| PREDICTED: uncharacterized protein LOC104717678 [Camelina sativa]
Length=620

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 83/213 (39%), Positives = 110/213 (52%), Gaps = 28/213 (13%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSL---------NN  153
            KVYVD LV+KAYENW    EY+GK+LL+F N+  R  L   Q D + +L         +N
Sbjct  355  KVYVDELVRKAYENWNQVVEYEGKSLLNF-NQPER--LDTFQTDPAATLANYSTTAAADN  411

Query  154  QLQQPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPn  333
             +    +P+ V    S+L     IGG  YN+ +    + Q H          +  QF   
Sbjct  412  PIHVTVIPSAVPPNHSSLLSEFSIGG--YNQTLA---TAQPHNPQEQFDNGLQQDQFMGI  466

Query  334  dqqqlmnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKG  507
             Q Q     +       +N  G   GPPQS+   +  + SS+ Q NLN FEDWS   +  
Sbjct  467  RQHQTQTTIEN------ENVTGFVFGPPQSATGGYQDIESSIDQENLNPFEDWSKHHEG-  519

Query  508  VEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMG  606
              ++ SEEEIR RSHE+L NEDMQ LLQLF+MG
Sbjct  520  --DFFSEEEIRQRSHELLANEDMQELLQLFNMG  550



>ref|XP_002446536.1| hypothetical protein SORBIDRAFT_06g017740 [Sorghum bicolor]
 gb|EES10864.1| hypothetical protein SORBIDRAFT_06g017740 [Sorghum bicolor]
Length=652

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 84/218 (39%), Positives = 117/218 (54%), Gaps = 21/218 (10%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDY--SNSLNNQLQ  162
            +V+ D+LVK+AY++W++  EYDGK LLSFK  K     R+E       Y  SN L N  Q
Sbjct  374  RVFADTLVKQAYDDWINAVEYDGKALLSFKQTKKTVTTRSETAKASASYPASNDLMNS-Q  432

Query  163  QPRLPAPVQSEPSALDPGMLIGGS---SYNENMGARYSNQSHIMSSSSRMQYENTQFAPn  333
            +     PV +E S+L      GG+   S    +   Y+     ++ S  MQY+ +   P 
Sbjct  433  KQLAGGPVNTEQSSLKNTREAGGTGIPSMGNQVAREYAGNPQHVAPSITMQYDMSSLVP-  491

Query  334  dqqqlmnnsqqmqnARYDNNVGLALGP---PQSSCFPTVGSSVQQTNLNSFEDWSN---T  495
               Q   +S Q Q +R  N   LAL P   PQ+  F  +G S Q + LN F+DWS     
Sbjct  492  -GGQFSGSSVQTQTSRSSNM--LALRPMQQPQNFEFSGLGQSTQPSGLNPFDDWSRLQEN  548

Query  496  RDKGVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            R  G ++YL  +EIR RSHE+L N++MQ +L+L SMGG
Sbjct  549  RGGGADDYLM-DEIRARSHEILENDEMQQMLRLLSMGG  585



>emb|CDY59992.1| BnaA02g35270D [Brassica napus]
Length=629

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 110/204 (54%), Gaps = 20/204 (10%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNS-LNNQLQQPRLP  177
            KVYVD LVKKAYENW    EYDGK+L+  K  +   E      +YS + ++N +Q   + 
Sbjct  362  KVYVDGLVKKAYENWNLVIEYDGKSLIDMKQPQNPPE------NYSTAAVDNPMQ---MA  412

Query  178  APVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnn  357
                S P+        GG  Y++ M A Y     ++ S+ R  +E      +DQ     +
Sbjct  413  GHSSSLPANQFSDFTTGG--YDQTMVASYPLHPQLLDSNPRAHFE----VASDQLMGSVH  466

Query  358  sqqmqnARYDNNVGLALGPPQSSCFPTV-GSSVQQTNLNSFED-WSNTRDKGVEEYLSEE  531
              Q      + N  LALGPPQ+  +  +  SS  Q NLN FED WSN R    E++ SEE
Sbjct  467  QAQSSTNNQNMNGLLALGPPQA--YQNINSSSAHQENLNPFEDCWSNHRGGAEEDFFSEE  524

Query  532  EIRLRSHEML*NEDMQHLLQLFSM  603
            EIRLRSHEML NEDM+  L+LFSM
Sbjct  525  EIRLRSHEMLENEDMKQFLRLFSM  548



>ref|XP_010438831.1| PREDICTED: uncharacterized protein LOC104722380 [Camelina sativa]
Length=630

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 109/214 (51%), Gaps = 26/214 (12%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            KVYVD LVKKA ENW    EY+GK+LL+F N+  R  L M Q D + +L N         
Sbjct  356  KVYVDELVKKANENWNQVVEYEGKSLLNF-NQPER--LDMSQTDPAATLANYSTTAAADN  412

Query  181  PVQSE--PSALDPG-------MLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPn  333
            P+     PSA+ P          IGG  YN+ +    + Q H    + + Q++N      
Sbjct  413  PIHVTVIPSAVPPNQSSVLTEFSIGG--YNQTLA---TAQPH----NPQEQFDNGLQRDQ  463

Query  334  dqqqlmnnsqqmqnARYDNNVGLALGPPQ--SSCFPTVGSSVQQTNLNSFEDWSNTRDKG  507
                  +  Q       +N  GL  GPPQ  SS +    SSV Q NLN FEDWSN  +  
Sbjct  464  FMGIHQHQHQTRTTIENENVTGLVFGPPQSASSGYQDTESSVDQENLNPFEDWSNHHEG-  522

Query  508  VEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
              ++ SEEEIR RS+E+L NEDMQ LLQLF   G
Sbjct  523  --DFFSEEEIRQRSNELLANEDMQELLQLFMGDG  554



>gb|ACN34699.1| unknown [Zea mays]
Length=304

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 84/223 (38%), Positives = 114/223 (51%), Gaps = 31/223 (14%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDY--SNSLNNQLQ  162
            +V+ D+LVK+AY +W++  EYDGK LL F  KK     R+E       Y  SN L N   
Sbjct  25   EVFADTLVKQAYADWINVLEYDGKALLKFNQKKKYVTTRSETAKASASYPASNGLVN--S  82

Query  163  QPRLP-APVQSEPSALD----------PGMLIGGSSYNENMGARYSNQSHIMSSSSRMQY  309
            Q  LP  PV +E S+L+          P M +G     E     Y+     M+ S  MQ 
Sbjct  83   QKELPGGPVNAEQSSLNNASQADRTRIPSMSMGNQVARE-----YAGNPQHMTPSITMQC  137

Query  310  ENTQFAPndqqqlmnnsqqmqnARYDNNVGLALGP---PQSSCFPTVGSSVQQTNLNSFE  480
            +     P   Q    +S Q Q +R  N   LAL P   PQ+  F  +G S Q +  N F 
Sbjct  138  DTRSLIP-GGQFSGGSSVQTQTSRSSNM--LALRPTQQPQNLDFSGLGQSTQPSGTNPFA  194

Query  481  DWSNTRDKGVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            DWS  ++  V+EYL  +EIR RSHE+L N++MQH+L+  S+GG
Sbjct  195  DWSRLQESSVDEYLM-DEIRARSHELLENDEMQHMLRFLSVGG  236



>emb|CDY29246.1| BnaA06g25110D [Brassica napus]
Length=625

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 107/207 (52%), Gaps = 32/207 (15%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            KVYVD LV+KAYENW    EYD K+L++F      + L     DYS           +P 
Sbjct  367  KVYVDGLVRKAYENWDQVIEYDSKSLMNFNQVNKVDAL-----DYS-----------MPV  410

Query  181  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  360
             V S+PS    G     S Y+++ G  +  QS +  ++S M + N+ +AP   Q + N  
Sbjct  411  SVPSQPSTSYSGE---ASVYSQSQGTSFPAQSQLADTTSYMHFGNSSYAPPQDQLINNTH  467

Query  361  qqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQT-----NLNSFEDWSNTRDKGVEE-YL  522
            +       +    LALG        T GS  Q        +N F DWSNT ++G  + +L
Sbjct  468  ESQIMINSNGGERLALGQ-------TTGSQNQHLVQPPPEVNPFNDWSNTGNRGGGDGFL  520

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSM  603
            SEEEIR RS+EML N+DMQ LL+LFSM
Sbjct  521  SEEEIRARSNEMLENDDMQQLLRLFSM  547



>emb|CDY30302.1| BnaA09g09750D [Brassica napus]
Length=624

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 111/206 (54%), Gaps = 35/206 (17%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFK--NKKARNELPMGQVDYSNSLNNQLQQPRL  174
            K YVD+LVKKAYENW    EYD K+L++F   NK A       ++DYS           +
Sbjct  371  KGYVDALVKKAYENWDQVVEYDSKSLMNFNQVNKTA-------EIDYS-----------M  412

Query  175  PAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmn  354
            P  V S+PS     +    S YN+   + +  QS    ++S M Y N  FAP DQ     
Sbjct  413  PVSVPSQPSTSYSDITGEASVYNQIPASSFQAQS---DTTSYMHYGNASFAPQDQLVSNT  469

Query  355  nsqqmqnARYDNNVG--LALGPPQSSCFPTVGSSVQ-QTNLNSFEDWSNTRDKGVEEYLS  525
            +  Q      ++N G  LALGPP  S    +   VQ  T +N F DWSN   +G + +LS
Sbjct  470  HESQ---GMMNSNGGGRLALGPPSGSQNNHL---VQPHTEMNPFNDWSN---RGGDGFLS  520

Query  526  EEEIRLRSHEML*NEDMQHLLQLFSM  603
            EEEIR RS+EML N+DMQ LL+LFSM
Sbjct  521  EEEIRARSNEMLENDDMQQLLRLFSM  546



>ref|NP_001130446.1| uncharacterized protein LOC100191543 [Zea mays]
 gb|ACF78658.1| unknown [Zea mays]
Length=471

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 84/222 (38%), Positives = 114/222 (51%), Gaps = 30/222 (14%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDY--SNSLNNQLQ  162
            +V+ D+LVK+AY +W++  EYDGK LL F  KK     R+E       Y  SN L N   
Sbjct  193  QVFADTLVKQAYADWINVLEYDGKALLKFNQKKKYVTTRSETAKASASYPASNGLVN--S  250

Query  163  QPRLP-APVQSEPSALD---------PGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYE  312
            Q  LP  PV +E S+L+         P M +G     E     Y+     M+ S  MQ +
Sbjct  251  QKELPGGPVNAEQSSLNNASQDRTRIPSMSMGNQVARE-----YAGNPQHMTPSITMQCD  305

Query  313  NTQFAPndqqqlmnnsqqmqnARYDNNVGLALGP---PQSSCFPTVGSSVQQTNLNSFED  483
                 P   Q    +S Q Q +R  N   LAL P   PQ+  F  +G S Q +  N F D
Sbjct  306  TRSLIP-GGQFSGGSSVQTQTSRSSNM--LALRPTQQPQNLDFSGLGQSTQPSGTNPFAD  362

Query  484  WSNTRDKGVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            WS  ++  V+EYL  +EIR RSHE+L N++MQH+L+  S+GG
Sbjct  363  WSRLQESSVDEYLM-DEIRARSHELLENDEMQHMLRFLSVGG  403



>ref|XP_009112562.1| PREDICTED: uncharacterized protein LOC103837921 [Brassica rapa]
Length=624

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 111/206 (54%), Gaps = 35/206 (17%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFK--NKKARNELPMGQVDYSNSLNNQLQQPRL  174
            K YVD+LVKKAYENW    EYD K+L++F   NK A       ++DYS           +
Sbjct  371  KGYVDALVKKAYENWDQVVEYDSKSLMNFNQVNKTA-------EIDYS-----------M  412

Query  175  PAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmn  354
            P  V S+PS     +    S YN+   + +  QS    ++S M Y N  FAP DQ     
Sbjct  413  PVSVPSQPSTSYSDITGEASVYNQIPASSFQAQS---DTTSYMHYGNASFAPQDQLVSNT  469

Query  355  nsqqmqnARYDNNVG--LALGPPQSSCFPTVGSSVQ-QTNLNSFEDWSNTRDKGVEEYLS  525
            +  Q      ++N G  LALGPP  S    +   VQ  T +N F DWSN   +G + +LS
Sbjct  470  HESQ---GMMNSNGGGRLALGPPSGSQNNHL---VQPHTEMNPFNDWSN---RGGDGFLS  520

Query  526  EEEIRLRSHEML*NEDMQHLLQLFSM  603
            EEEIR RS+EML N+DMQ LL+LFSM
Sbjct  521  EEEIRARSNEMLENDDMQQLLRLFSM  546



>ref|XP_009150716.1| PREDICTED: uncharacterized protein LOC103874061 [Brassica rapa]
 ref|XP_009150718.1| PREDICTED: uncharacterized protein LOC103874061 [Brassica rapa]
 ref|XP_009150719.1| PREDICTED: uncharacterized protein LOC103874061 [Brassica rapa]
 ref|XP_009150720.1| PREDICTED: uncharacterized protein LOC103874061 [Brassica rapa]
Length=626

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 78/207 (38%), Positives = 106/207 (51%), Gaps = 32/207 (15%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            KVYVD LV+KAYENW    EYD K+L++F      + L     DYS           +P 
Sbjct  367  KVYVDGLVRKAYENWDQVIEYDSKSLMNFNQVNKVDAL-----DYS-----------MPV  410

Query  181  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  360
             V S+PS    G     S Y+++ G  +  QS +  ++S M + N+ +AP   Q + N  
Sbjct  411  SVPSQPSTSYSGE---ASVYSQSQGTSFPAQSQLADTTSYMHFGNSSYAPPQDQLINNTH  467

Query  361  qqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQT-----NLNSFEDWSNTRDKGVEE-YL  522
            +       +    LALG        T GS  Q        +N F DWSNT ++G  + +L
Sbjct  468  ESQIMINSNGGERLALGQ-------TTGSQNQHLVQPPPEINHFNDWSNTGNRGGGDGFL  520

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSM  603
            SEEEIR RS+EML N+DMQ LL+LF M
Sbjct  521  SEEEIRARSNEMLENDDMQQLLRLFCM  547



>ref|XP_008667039.1| PREDICTED: uncharacterized protein LOC100191543 isoform X1 [Zea 
mays]
Length=652

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 86/222 (39%), Positives = 115/222 (52%), Gaps = 30/222 (14%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDY--SNSLNNQLQ  162
            +V+ D+LVK+AY +W++  EYDGK LL F  KK     R+E       Y  SN L N   
Sbjct  374  RVFADTLVKQAYADWINVLEYDGKALLKFNQKKKYVTTRSETAKASASYPASNGLVN--S  431

Query  163  QPRLP-APVQSEPSALD---------PGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYE  312
            Q  LP  PV +E S+L+         P M +G     E  G    N  H M+ S  MQ +
Sbjct  432  QKELPGGPVNAEQSSLNNASQDRTRIPSMSMGNQVAREYAG----NPQH-MTPSITMQCD  486

Query  313  NTQFAPndqqqlmnnsqqmqnARYDNNVGLALGP---PQSSCFPTVGSSVQQTNLNSFED  483
                 P   Q    +S Q Q +R  N   LAL P   PQ+  F  +G S Q +  N F D
Sbjct  487  TRSLIP-GGQFSGGSSVQTQTSRSSNM--LALRPTQQPQNLDFSGLGQSTQPSGTNPFAD  543

Query  484  WSNTRDKGVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            WS  ++  V+EYL  +EIR RSHE+L N++MQH+L+  S+GG
Sbjct  544  WSRLQESSVDEYLM-DEIRARSHELLENDEMQHMLRFLSVGG  584



>emb|CDY59605.1| BnaC03g74590D [Brassica napus]
Length=627

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 76/202 (38%), Positives = 106/202 (52%), Gaps = 22/202 (11%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            KVYVD LV+KAYENW    EYD K+L++F      + L     DYS           +P 
Sbjct  369  KVYVDGLVRKAYENWDQVIEYDSKSLMNFNQVNKVDAL-----DYS-----------IPV  412

Query  181  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  360
               S+PS    G     S Y+++ G  +  +S +  ++S M + N+ +AP   Q + N  
Sbjct  413  SGPSQPSTSYSGE---ASVYSQSQGTSFPARSQLADTTSYMHFGNSSYAPPQDQLINNTH  469

Query  361  qqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEE-YLSEEEI  537
            +       +    LALG P  S    +     + NL  F DWSNT ++G  + +LSEEEI
Sbjct  470  ESQSMINSNGGGSLALGAPTGSQSQHLVQPPPEVNL--FNDWSNTGNRGGGDGFLSEEEI  527

Query  538  RLRSHEML*NEDMQHLLQLFSM  603
            R RS+EML N+DMQ LL+LFSM
Sbjct  528  RARSNEMLENDDMQQLLRLFSM  549



>ref|XP_008667040.1| PREDICTED: uncharacterized protein LOC100191543 isoform X2 [Zea 
mays]
Length=653

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 86/223 (39%), Positives = 115/223 (52%), Gaps = 31/223 (14%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDY--SNSLNNQLQ  162
            +V+ D+LVK+AY +W++  EYDGK LL F  KK     R+E       Y  SN L N   
Sbjct  374  RVFADTLVKQAYADWINVLEYDGKALLKFNQKKKYVTTRSETAKASASYPASNGLVN--S  431

Query  163  QPRLP-APVQSEPSALD----------PGMLIGGSSYNENMGARYSNQSHIMSSSSRMQY  309
            Q  LP  PV +E S+L+          P M +G     E  G    N  H M+ S  MQ 
Sbjct  432  QKELPGGPVNAEQSSLNNASQADRTRIPSMSMGNQVAREYAG----NPQH-MTPSITMQC  486

Query  310  ENTQFAPndqqqlmnnsqqmqnARYDNNVGLALGP---PQSSCFPTVGSSVQQTNLNSFE  480
            +     P   Q    +S Q Q +R  N   LAL P   PQ+  F  +G S Q +  N F 
Sbjct  487  DTRSLIP-GGQFSGGSSVQTQTSRSSNM--LALRPTQQPQNLDFSGLGQSTQPSGTNPFA  543

Query  481  DWSNTRDKGVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            DWS  ++  V+EYL  +EIR RSHE+L N++MQH+L+  S+GG
Sbjct  544  DWSRLQESSVDEYLM-DEIRARSHELLENDEMQHMLRFLSVGG  585



>gb|EMS66476.1| hypothetical protein TRIUR3_28909 [Triticum urartu]
Length=774

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 82/219 (37%), Positives = 117/219 (53%), Gaps = 22/219 (10%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNS-------LNNQL  159
            KVY D+LVKKAYE+W+   EYDGK LL FK KK            S S       +N Q 
Sbjct  408  KVYADTLVKKAYEDWMHAVEYDGKALLGFKQKKKSVTTRSDTASASTSNPALYGFVNAQK  467

Query  160  QQPRLPAPVQSEPSALDPGMLIG-GSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPnd  336
            Q   LP     + S   P    G  S+YN N+ AR ++  +  +++  MQYE +  +P  
Sbjct  468  QL--LPGKA-GQTSTGTPSEAAGVRSTYNGNLAARNTSPQN-NAANITMQYERSALSPES  523

Query  337  qqqlmnnsqqmqnARYDNNVGLALGPPQSSC----FPTVGSSVQQTNLNSFEDWSNTRD-  501
            Q    +   Q       +N+ LAL P Q       F  VG S+Q  +LN F+ WS  ++ 
Sbjct  524  QFSGPSLQTQTSGG---SNI-LALEPAQQQQQGFEFSAVGQSMQPADLNPFDQWSQPQEN  579

Query  502  KGVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            + V++YL EE IRLRSHE+L N++MQ +L++ +MGG ++
Sbjct  580  RAVDDYLMEE-IRLRSHEILENDEMQQMLRILNMGGAST  617



>tpg|DAA37640.1| TPA: hypothetical protein ZEAMMB73_428755 [Zea mays]
Length=450

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 84/221 (38%), Positives = 113/221 (51%), Gaps = 30/221 (14%)
 Frame = +1

Query  4    VYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDY--SNSLNNQLQQ  165
            V+ D+LVK+AY +W++  EYDGK LL F  KK     R+E       Y  SN L N   Q
Sbjct  173  VFADTLVKQAYADWINVLEYDGKALLKFNQKKKYVTTRSETAKASASYPASNGLVN--SQ  230

Query  166  PRLP-APVQSEPSALD---------PGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYEN  315
              LP  PV +E S+L+         P M +G     E     Y+     M+ S  MQ + 
Sbjct  231  KELPGGPVNAEQSSLNNASQDRTRIPSMSMGNQVARE-----YAGNPQHMTPSITMQCDT  285

Query  316  TQFAPndqqqlmnnsqqmqnARYDNNVGLALGP---PQSSCFPTVGSSVQQTNLNSFEDW  486
                P   Q    +S Q Q +R  N   LAL P   PQ+  F  +G S Q +  N F DW
Sbjct  286  RSLIP-GGQFSGGSSVQTQTSRSSNM--LALRPTQQPQNLDFSGLGQSTQPSGTNPFADW  342

Query  487  SNTRDKGVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            S  ++  V+EYL  +EIR RSHE+L N++MQH+L+  S+GG
Sbjct  343  SRLQESSVDEYLM-DEIRARSHELLENDEMQHMLRFLSVGG  382



>gb|EAY94271.1| hypothetical protein OsI_16040 [Oryza sativa Indica Group]
Length=652

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 78/217 (36%), Positives = 120/217 (55%), Gaps = 16/217 (7%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            +++ D+LVK+AY++W++  EYDGK LL FK KK     R++       Y +S  +     
Sbjct  376  RLFADTLVKQAYDDWINVVEYDGKELLRFKQKKKSVTTRSDTAKASTSYPSSYGSTHSHK  435

Query  169  RLP-APVQSEPSALDPGMLIGGSSY-NENMGARYSNQSHIMSSSSRMQYENTQFAPndqq  342
            +L   PV  E S++      G  +  N ++ ARY+     +S S  M Y+ +   P   +
Sbjct  436  QLTGGPVNIEQSSMSSMSEDGTRNMSNGSLAARYAANPQDISQSITMPYDMSSLRP---E  492

Query  343  qlmnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDK--GV  510
            +    S     A   +N+ LALGP Q     F  +G S+Q + LN F+DWS  ++   GV
Sbjct  493  EQFAGSSIQTQASRSSNM-LALGPTQQQNFEFSALGQSMQPSPLNPFDDWSRLQENRGGV  551

Query  511  EEYLSEEEIRLRSHEML*N-EDMQHLLQLFSMGGHAS  618
            ++YL  EEIR+RSHE+L N EDMQ +L++ SMGG ++
Sbjct  552  DDYLM-EEIRVRSHEILENEEDMQQMLRILSMGGSSA  587



>ref|XP_009414724.1| PREDICTED: uncharacterized protein LOC103995757 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009414730.1| PREDICTED: uncharacterized protein LOC103995757 [Musa acuminata 
subsp. malaccensis]
Length=634

 Score =   100 bits (250),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 81/211 (38%), Positives = 113/211 (54%), Gaps = 28/211 (13%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLL-SFKNKKARNEL----PMGQVDYSNSLNNQ-LQ  162
            KV+ D+LVKKAY+NW+    YD  TLL + K+KKA   L    P+       SL++Q + 
Sbjct  373  KVFADTLVKKAYDNWMHAIAYDSHTLLDNTKSKKATASLLQESPLVSSLNHPSLHDQHIS  432

Query  163  Q--PRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPnd  336
            Q  P+   P+Q +P A+          YN +   RYSN       +++M  ++T FA   
Sbjct  433  QFHPQSSVPLQHQPVAIADT----AEGYNGSRATRYSNLPQDADLNAQMPIQSTSFA---  485

Query  337  qqqlmnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEE  516
             Q   ++S    + R D+  GLAL PP     P++           +EDWS  +D    +
Sbjct  486  FQNQSSSSSHQSHFRRDDRAGLALAPPLHQ--PSM-------EFQPYEDWSCQQD----D  532

Query  517  YLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            +LSEEEIRLRSHEML NEDMQHLL+  S+ G
Sbjct  533  FLSEEEIRLRSHEMLENEDMQHLLRNLSVVG  563



>gb|EMT06125.1| hypothetical protein F775_27254 [Aegilops tauschii]
Length=699

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 81/219 (37%), Positives = 118/219 (54%), Gaps = 23/219 (11%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNS-------LNNQL  159
            KVY D+LVKKAYE+W+   EYDGK LL FK KK            S S       +N Q 
Sbjct  374  KVYADTLVKKAYEDWMHAVEYDGKALLGFKQKKKSVTTRSDTASASTSNPALYGFVNAQK  433

Query  160  QQPRLPAPV-QSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPnd  336
            Q   LP    QS  +  +   + G  +YN N+ AR ++  +  ++ + MQYE +  +P  
Sbjct  434  QL--LPGKAGQSTGTPSEAAGVRG--TYNGNLAARNTSPQNNAANIT-MQYERSALSPES  488

Query  337  qqqlmnnsqqmqnARYDNNVGLALGPPQSSC----FPTVGSSVQQTNLNSFEDWSNTRD-  501
            Q    +   Q       +N+ LAL P Q       F  VG S+Q  +LN F+ WS  ++ 
Sbjct  489  QFSGPSLQTQTSGG---SNI-LALEPAQQQQQSFEFSAVGQSMQPADLNPFDQWSQPQEN  544

Query  502  KGVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            + V++YL EE IRLRSHE+L N++MQ +L++ +MGG ++
Sbjct  545  RAVDDYLMEE-IRLRSHEILENDEMQQMLRILNMGGAST  582



>gb|EAZ30858.1| hypothetical protein OsJ_14930 [Oryza sativa Japonica Group]
Length=610

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 78/217 (36%), Positives = 119/217 (55%), Gaps = 16/217 (7%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            +++ D+LVK+AY++W++  EYDGK LL FK KK     R++       Y +S  +     
Sbjct  376  RLFADTLVKQAYDDWINVVEYDGKELLRFKQKKKSVTTRSDTAKASTSYPSSYGSTHSHK  435

Query  169  RLP-APVQSEPSALDPGMLIGGSSY-NENMGARYSNQSHIMSSSSRMQYENTQFAPndqq  342
            +L   PV  E S++      G  +  N +  ARY+     +S S  M Y+ +   P   +
Sbjct  436  QLTGGPVNIEQSSMSSMSEDGTRNMSNGSQAARYAANPQDISQSITMPYDMSSLRP---E  492

Query  343  qlmnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDK--GV  510
            +    S     A   +N+ LALGP Q     F  +G S+Q + LN F+DWS  ++   GV
Sbjct  493  EQFAGSSIQTQASRSSNM-LALGPTQQQNFEFSALGQSMQPSPLNPFDDWSRLQENRGGV  551

Query  511  EEYLSEEEIRLRSHEML*N-EDMQHLLQLFSMGGHAS  618
            ++YL  EEIR+RSHE+L N EDMQ +L++ SMGG ++
Sbjct  552  DDYLM-EEIRVRSHEILENEEDMQQMLRILSMGGSSA  587



>ref|NP_001052891.1| Os04g0444200 [Oryza sativa Japonica Group]
 emb|CAE02429.1| OSJNBa0058G03.4 [Oryza sativa Japonica Group]
 dbj|BAF14805.1| Os04g0444200 [Oryza sativa Japonica Group]
Length=652

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 78/217 (36%), Positives = 119/217 (55%), Gaps = 16/217 (7%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            +++ D+LVK+AY++W++  EYDGK LL FK KK     R++       Y +S  +     
Sbjct  376  RLFADTLVKQAYDDWINVVEYDGKELLRFKQKKKSVTTRSDTAKASTSYPSSYGSTHSHK  435

Query  169  RLP-APVQSEPSALDPGMLIGGSSY-NENMGARYSNQSHIMSSSSRMQYENTQFAPndqq  342
            +L   PV  E S++      G  +  N +  ARY+     +S S  M Y+ +   P   +
Sbjct  436  QLTGGPVNIEQSSMSSMSEDGTRNMSNGSQAARYAANPQDISQSITMPYDMSSLRP---E  492

Query  343  qlmnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDK--GV  510
            +    S     A   +N+ LALGP Q     F  +G S+Q + LN F+DWS  ++   GV
Sbjct  493  EQFAGSSIQTQASRSSNM-LALGPTQQQNFEFSALGQSMQPSPLNPFDDWSRLQENRGGV  551

Query  511  EEYLSEEEIRLRSHEML*N-EDMQHLLQLFSMGGHAS  618
            ++YL  EEIR+RSHE+L N EDMQ +L++ SMGG ++
Sbjct  552  DDYLM-EEIRVRSHEILENEEDMQQMLRILSMGGSSA  587



>ref|XP_010448369.1| PREDICTED: uncharacterized protein LOC104730838 isoform X2 [Camelina 
sativa]
 ref|XP_010448370.1| PREDICTED: uncharacterized protein LOC104730838 isoform X2 [Camelina 
sativa]
Length=614

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 76/213 (36%), Positives = 111/213 (52%), Gaps = 26/213 (12%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQ--------  156
            KVYVD LV+KAYENW    EY+GK+LL+F N+  R++  M Q D + +  N         
Sbjct  346  KVYVDELVRKAYENWNQVVEYEGKSLLNF-NQPGRSD--MSQTDPAATFANYSSTAAAGH  402

Query  157  -LQQPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPn  333
             +    +P+ V    S+L     +GG  YN+ +    + Q H    + + Q++N      
Sbjct  403  PINVTVIPSTVPPNQSSLLSEFSVGG--YNQTLA---TAQPH----NPQEQFDNGLQQDQ  453

Query  334  dqqqlmnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKG  507
                  +  Q       +N  G   GP +S+   +  + SS+ Q NLN FEDWS   +  
Sbjct  454  FMGIHQHQHQTRTTIENENVTGFVFGPLRSATGGYQDIESSLDQENLNPFEDWSKHNEG-  512

Query  508  VEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMG  606
              ++ SEEEIR RS+E+L NED+Q LLQLF+MG
Sbjct  513  --DFFSEEEIRQRSNELLANEDLQELLQLFNMG  543



>ref|XP_010448367.1| PREDICTED: uncharacterized protein LOC104730838 isoform X1 [Camelina 
sativa]
 ref|XP_010448368.1| PREDICTED: uncharacterized protein LOC104730838 isoform X1 [Camelina 
sativa]
Length=624

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 76/213 (36%), Positives = 111/213 (52%), Gaps = 26/213 (12%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQ--------  156
            KVYVD LV+KAYENW    EY+GK+LL+F N+  R++  M Q D + +  N         
Sbjct  356  KVYVDELVRKAYENWNQVVEYEGKSLLNF-NQPGRSD--MSQTDPAATFANYSSTAAAGH  412

Query  157  -LQQPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPn  333
             +    +P+ V    S+L     +GG  YN+ +    + Q H    + + Q++N      
Sbjct  413  PINVTVIPSTVPPNQSSLLSEFSVGG--YNQTLA---TAQPH----NPQEQFDNGLQQDQ  463

Query  334  dqqqlmnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKG  507
                  +  Q       +N  G   GP +S+   +  + SS+ Q NLN FEDWS   +  
Sbjct  464  FMGIHQHQHQTRTTIENENVTGFVFGPLRSATGGYQDIESSLDQENLNPFEDWSKHNEG-  522

Query  508  VEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMG  606
              ++ SEEEIR RS+E+L NED+Q LLQLF+MG
Sbjct  523  --DFFSEEEIRQRSNELLANEDLQELLQLFNMG  553



>ref|XP_006282572.1| hypothetical protein CARUB_v10004387mg [Capsella rubella]
 gb|EOA15470.1| hypothetical protein CARUB_v10004387mg [Capsella rubella]
Length=619

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 105/211 (50%), Gaps = 22/211 (10%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN------ELPMGQVDYSNSLNNQLQ  162
            KVYVD LV+KAYENW    EY+GK+L +F   +  N         +     +++ +N + 
Sbjct  355  KVYVDELVRKAYENWNQVVEYEGKSLSNFNQPERLNISQNNPAATLANYSTTSAADNPIH  414

Query  163  QPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqq  342
               +P+ V    S +     +G   YN+ +    + Q H       +  +  QF    Q 
Sbjct  415  VTVVPSAVPPNQSPVHSEFSMG--EYNQTL---TTAQPHNPQELFDIGLQQDQFMGIRQH  469

Query  343  qlmnnsqqmqnARYDNNVGLALGPPQS-SC-FPTVGSSVQQTNLNSFEDWSNTRDKGVEE  516
            Q +   +        N  G  LGPPQS +C +  + SSV Q NLN F+DWS        +
Sbjct  470  QTLATIENA------NVTGFVLGPPQSATCGYQDIESSVDQGNLNLFDDWSKHHGN---D  520

Query  517  YLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
              SEEEIR  SHE+L NEDMQ LLQLFSMGG
Sbjct  521  LFSEEEIRKISHELLANEDMQELLQLFSMGG  551



>ref|XP_004975724.1| PREDICTED: uncharacterized protein LOC101760764 isoform X1 [Setaria 
italica]
Length=660

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 120/223 (54%), Gaps = 25/223 (11%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            +V+ D+LVK+AY++W++  EYDGK LL FK KK     R+E       Y  S      Q 
Sbjct  376  RVFADTLVKQAYDDWINVVEYDGKALLRFKQKKKSVTTRSETAKASASYPASNGLVHSQK  435

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNE--NMGAR-YSNQSHIM--SSSSRMQYENTQFAPn  333
            +L +PV +E S+L       G+      N GAR Y+     M  +SS  MQY+ +  AP 
Sbjct  436  QLASPVNAEQSSLSNISEADGTRVVSIGNQGARGYAANPQDMAPTSSITMQYDMSSLAP-  494

Query  334  dqqqlmnnsqqmqnARYDNNVGLALGPPQSSCFPTV---------GSSVQQTNLNSFEDW  486
             + Q   +S Q Q +R  N   LAL P Q    P +         G S Q ++LN F+DW
Sbjct  495  -EGQFSGSSIQPQASRSSNT--LALRPMQQQQQPLLQNFEFSGLGGQSTQPSSLNPFDDW  551

Query  487  SNTRDK--GVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            S  ++    V++YL  EEIR RSHE+L N++MQ +L++ SMGG
Sbjct  552  SRLQENRGSVDDYLM-EEIRARSHEILENDEMQQMLRILSMGG  593



>ref|XP_004975725.1| PREDICTED: uncharacterized protein LOC101760764 isoform X2 [Setaria 
italica]
Length=659

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 85/222 (38%), Positives = 120/222 (54%), Gaps = 24/222 (11%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            +V+ D+LVK+AY++W++  EYDGK LL FK KK     R+E       Y  S      Q 
Sbjct  376  RVFADTLVKQAYDDWINVVEYDGKALLRFKQKKKSVTTRSETAKASASYPASNGLVHSQK  435

Query  169  RLPAPVQSEPSALDPGMLIGGSSYN-ENMGAR-YSNQSHIM--SSSSRMQYENTQFAPnd  336
            +L +PV +E S+L      G    +  N GAR Y+     M  +SS  MQY+ +  AP  
Sbjct  436  QLASPVNAEQSSLSNISEDGTRVVSIGNQGARGYAANPQDMAPTSSITMQYDMSSLAP--  493

Query  337  qqqlmnnsqqmqnARYDNNVGLALGPPQSSCFPTV---------GSSVQQTNLNSFEDWS  489
            + Q   +S Q Q +R  N   LAL P Q    P +         G S Q ++LN F+DWS
Sbjct  494  EGQFSGSSIQPQASRSSNT--LALRPMQQQQQPLLQNFEFSGLGGQSTQPSSLNPFDDWS  551

Query  490  NTRDK--GVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
              ++    V++YL  EEIR RSHE+L N++MQ +L++ SMGG
Sbjct  552  RLQENRGSVDDYLM-EEIRARSHEILENDEMQQMLRILSMGG  592



>ref|NP_194310.3| Calmodulin-binding protein [Arabidopsis thaliana]
 ref|NP_001078448.1| Calmodulin-binding protein [Arabidopsis thaliana]
 dbj|BAE98742.1| putative calmodulin-binding protein [Arabidopsis thaliana]
 gb|AEE85115.1| Calmodulin-binding protein [Arabidopsis thaliana]
 gb|AEE85116.1| Calmodulin-binding protein [Arabidopsis thaliana]
Length=601

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 107/206 (52%), Gaps = 33/206 (16%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            KVYVD LVKKAYENW    EY+G++LL+  N+  R  L + Q D   +L          A
Sbjct  355  KVYVDGLVKKAYENWNQVVEYEGESLLNL-NQPER--LDISQTDPVTAL----------A  401

Query  181  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  360
               + P +  P   I G  YN+ +       +  +  + + Q++   F P   Q +    
Sbjct  402  SYSTVPLSQFPEFAIEG--YNQTL-------TTALPHNPQAQFD---FVPQQDQFIGIQQ  449

Query  361  qqmqnARYDNNVG-LALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEE  531
             Q Q    + NV  L LGPPQSS   +  + SS  Q NLN FEDW+N  +    ++ SEE
Sbjct  450  PQTQTNIENENVTRLVLGPPQSSTGGYQDIKSSADQENLNPFEDWTNLSEN---DFFSEE  506

Query  532  EIRLRSHEML*NEDMQHLLQLFSMGG  609
            EIR  SH++L NEDMQ L  LFSMGG
Sbjct  507  EIRQTSHDLLANEDMQQL--LFSMGG  530



>emb|CAB39601.1| putative calmodulin-binding protein [Arabidopsis thaliana]
 emb|CAB79435.1| putative calmodulin-binding protein [Arabidopsis thaliana]
Length=536

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 108/208 (52%), Gaps = 21/208 (10%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            KVYVD LVKKAYENW    EY+G++LL+  N+  R  L + Q D   +L +         
Sbjct  274  KVYVDGLVKKAYENWNQVVEYEGESLLNL-NQPER--LDISQTDPVTALASY-----STV  325

Query  181  PVQSEPSALDPGMLIGGSSYNENMGARYSNQ--SHIMSSSSRMQYENTQFAPndqqqlmn  354
            P+   P     G  I    Y+ ++     NQ  +  +  + + Q++   F P   Q +  
Sbjct  326  PLSQFPEFAIEGWQISPFLYSTSIFTAGYNQTLTTALPHNPQAQFD---FVPQQDQFIGI  382

Query  355  nsqqmqnARYDNNVG-LALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLS  525
               Q Q    + NV  L LGPPQSS   +  + SS  Q NLN FEDW+N  +    ++ S
Sbjct  383  QQPQTQTNIENENVTRLVLGPPQSSTGGYQDIKSSADQENLNPFEDWTNLSEN---DFFS  439

Query  526  EEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            EEEIR  SH++L NEDMQ L  LFSMGG
Sbjct  440  EEEIRQTSHDLLANEDMQQL--LFSMGG  465



>ref|XP_008349259.1| PREDICTED: uncharacterized protein LOC103412486 [Malus domestica]
Length=228

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 95/168 (57%), Gaps = 20/168 (12%)
 Frame = +1

Query  118  MGQVDYSNSLNNQLQQPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSS  297
            M   DY NS + Q   P LPA V S+P  +D G+ +GG  Y + M AR+S QS   + + 
Sbjct  1    MASQDYPNSCDQQFTLPSLPASVSSQPPPMDSGLNVGG--YXDGMAARFSIQSQNGNLNX  58

Query  298  RMQYENTQFAPndqqqlmnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLN  471
             +Q +   F    Q QL + S Q    R +N   L+LGP QSS   F  +G+S    NL+
Sbjct  59   PIQLDGLSFP--QQNQLPSISXQXHFQRNENM--LSLGPLQSSTSGFQNIGTS----NLS  110

Query  472  SFEDWSNTRDKGVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
            S+        +GVE+   EEEIR+RS+E+L NEDMQHLL++ +MGG  
Sbjct  111  SY--------RGVEDLFPEEEIRMRSNEILENEDMQHLLRVINMGGQG  150



>gb|EMT33137.1| hypothetical protein F775_28653 [Aegilops tauschii]
Length=959

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 78/222 (35%), Positives = 117/222 (53%), Gaps = 26/222 (12%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYS-NSLNNQLQ-  162
            +V+ D+LVK+AY++W++  EYDGK LL FK KK     R++       Y+ +S ++Q Q 
Sbjct  688  RVFADTLVKQAYDDWINVVEYDGKGLLKFKQKKKSVTTRSDAANVSTSYTYDSAHSQKQL  747

Query  163  ---QPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPn  333
                P +   + S  S  +   +    + N N  A Y+     +S S  MQY  +   P 
Sbjct  748  ARGHPNIERSLMSSTSKAEETRI----ASNGNQVAIYAANPQDISPSITMQYGMSSLIP-  802

Query  334  dqqqlmnnsqqmqnARYDNNVGLALGPP----QSSCFPTVGSSVQQTNLNSFEDW---SN  492
              +   N S     A   +N+ LA GPP    Q+  F T+G S+Q   LN F+DW   S 
Sbjct  803  --EGQFNGSSIQTQASRSSNM-LAFGPPPQQQQNFEFSTLGLSMQSPALNPFDDWPGRSQ  859

Query  493  TRDKGVEEYLSEEEIRLRSHEML*N-EDMQHLLQLFSMGGHA  615
                GV+++L  EEIR+RSH++L N E+MQH+L++ S G  A
Sbjct  860  ENRGGVDDFLM-EEIRVRSHDILENEEEMQHMLRILSGGAAA  900



>gb|EMS55488.1| hypothetical protein TRIUR3_12862 [Triticum urartu]
Length=657

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 78/223 (35%), Positives = 117/223 (52%), Gaps = 27/223 (12%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYS--NSLNNQLQ  162
            +V+ D+LVK+AY++W++  EYDGK LL FK KK     R++       Y+  +S ++Q Q
Sbjct  380  RVFADTLVKQAYDDWINVVEYDGKGLLKFKQKKKSVTTRSDAANVSTSYTSYDSAHSQKQ  439

Query  163  ----QPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAP  330
                 P +   + S  S  +   +    + N N  A Y+     +S S  MQY  +   P
Sbjct  440  LARGHPNIERSLMSSTSKAEETRV----ASNGNQVAIYATNPQDISPSITMQYGMSSLIP  495

Query  331  ndqqqlmnnsqqmqnARYDNNVGLALGPP----QSSCFPTVGSSVQQTNLNSFEDW---S  489
               +   N S     A   +N+ LA GPP    Q+  F T+G S+Q   LN F+DW   S
Sbjct  496  ---EGQFNGSSIQTQAPRSSNM-LAFGPPPQQQQNFEFSTLGLSMQSPALNPFDDWPGRS  551

Query  490  NTRDKGVEEYLSEEEIRLRSHEML*N-EDMQHLLQLFSMGGHA  615
                 GV+++L  EEIR+RSH++L N E+MQH+L++ S G  A
Sbjct  552  QENRGGVDDFLM-EEIRVRSHDILENEEEMQHMLRILSGGAAA  593



>emb|CDY52577.1| BnaCnng22620D [Brassica napus]
Length=623

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 99/203 (49%), Gaps = 29/203 (14%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFK--NKKARNELPMGQVDYSNSLNNQLQQPRL  174
            K YVD+LVKKAYENW    EYD K+L++F   NK A       ++DYS           +
Sbjct  371  KGYVDALVKKAYENWDQVVEYDSKSLMNFNQVNKTA-------EIDYS-----------M  412

Query  175  PAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmn  354
            P  V S+PS     +    S YN+   + +  QS    ++S M Y N  FAP DQ     
Sbjct  413  PVSVPSQPSTSYSDITGEASVYNQIPASSFPAQS---DTTSYMHYGNASFAPQDQLVSNT  469

Query  355  nsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEEE  534
            +  Q               P  S     V      + +N F DWS    +G + +LSEEE
Sbjct  470  HESQGMMNGNGGGRLGLGPPSGSQNNHLVQP---HSEMNPFNDWST---RGGDGFLSEEE  523

Query  535  IRLRSHEML*NEDMQHLLQLFSM  603
            IR RS+EML N+DMQ LL+LFSM
Sbjct  524  IRARSNEMLENDDMQQLLRLFSM  546



>ref|XP_006409114.1| hypothetical protein EUTSA_v10022604mg [Eutrema salsugineum]
 ref|XP_006409115.1| hypothetical protein EUTSA_v10022604mg [Eutrema salsugineum]
 gb|ESQ50567.1| hypothetical protein EUTSA_v10022604mg [Eutrema salsugineum]
 gb|ESQ50568.1| hypothetical protein EUTSA_v10022604mg [Eutrema salsugineum]
Length=608

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 105/213 (49%), Gaps = 53/213 (25%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            K YVD LV+KAYENW    EYD K+L++F      + L     DYS           +P 
Sbjct  365  KGYVDGLVRKAYENWDQVIEYDSKSLMNFNQVNKTDAL-----DYS-----------IPV  408

Query  181  PVQSEPSALDPGMLIGGSSYNENMG-ARYSNQSHI-MSSSSRMQYENTQFAPndqqqlmn  354
             V S+ S          +SY++  G A   NQS +   +SS M + N  FA  +Q     
Sbjct  409  SVPSQAS----------TSYSDLTGEASVYNQSQLGADTSSYMHFGNNSFATQEQLINNA  458

Query  355  nsqqmqnARYDNNVG--LALGPPQSSCFPTVGSSVQQT-----NLNSF-EDWSNTRDKGV  510
            +  Q       N VG  LAL PP        GS  QQ       +NSF  DWSNT +   
Sbjct  459  HGSQS------NGVGARLALCPP-------TGSQSQQMVQPPPEMNSFNSDWSNTGNG--  503

Query  511  EEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
              +LSEEEIR RS+EML N+DMQ LL+LFSM G
Sbjct  504  --FLSEEEIRARSNEMLENDDMQQLLRLFSMSG  534



>gb|KJB68601.1| hypothetical protein B456_010G254300 [Gossypium raimondii]
Length=621

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 71/210 (34%), Positives = 107/210 (51%), Gaps = 40/210 (19%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKN----KKARNELPMGQVDYSNSLNNQLQQP  168
            KVYVD LVKKAYENW+   EYDGK+LL           R +LPM    +++S + Q   P
Sbjct  368  KVYVDILVKKAYENWIHVIEYDGKSLLGCNEDDSLDTCRAKLPMDL--HTSSTSQQQILP  425

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             L  PV +   ++D  +++ G  Y+++M  R +N+S  +  ++ +      F   +    
Sbjct  426  TLSVPVPTGQPSMDSYLVVRG--YDDSMAGRLANESQNVHLNATILLNGASFPLQNPLV-  482

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  522
                         N+  L  GP QS+   F  VG+S                 +GVE++ 
Sbjct  483  -------------NDNELVHGPSQSTVRGFNNVGTS--------------NIPEGVEDFF  515

Query  523  SE-EEIRLRS-HEML*NEDMQHLLQLFSMG  606
            SE EE+R+RS +EML NEDMQHL+++F+ G
Sbjct  516  SEDEEMRMRSNNEMLANEDMQHLIRIFNKG  545



>gb|ACJ85726.1| unknown [Medicago truncatula]
Length=119

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  VQQTNLNSFEDWSNTRDKGVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            +Q    N F+DWSN RDKGV+++ SE+EIR+RS+E+L NEDMQHLL+LFSMGGH S
Sbjct  1    MQPPAPNPFDDWSNNRDKGVDDFFSEDEIRVRSNEILENEDMQHLLRLFSMGGHPS  56



>ref|XP_002532196.1| hypothetical protein RCOM_0445820 [Ricinus communis]
 gb|EEF30188.1| hypothetical protein RCOM_0445820 [Ricinus communis]
Length=171

 Score = 58.5 bits (140),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  455  SKPISILLRTGLTPVTRGLRNICLRRRFVSEAMKCYRMKICSTCFSSSAW  604
            S  +SILL TG T  T+ L N  LR+RF  E M+C RMKIC++CF S AW
Sbjct  117  SHLVSILLMTGPTTETKELMNTLLRKRFAYEVMRCLRMKICNSCFDSLAW  166


 Score = 53.1 bits (126),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 67/133 (50%), Gaps = 38/133 (29%)
 Frame = +1

Query  25   KKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQPRLPAPVQS  192
            KKAY+NW    EYDGK+LL+FK  K  N    EL +GQ+ Y          PR       
Sbjct  10   KKAYDNWNEVIEYDGKSLLNFKQSKRSNTYQDELQIGQIGY----------PR-------  52

Query  193  EPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnnsqqmq  372
                           YN++MGA +S QS +++ +S  ++++T F     + L++NS   Q
Sbjct  53   ---------------YNDSMGAGFSAQSQLVNPNSSTRFDSTSF--RVHEPLISNSHHAQ  95

Query  373  nARYDNNVGLALG  411
              R DN+VGLA G
Sbjct  96   GMRNDNSVGLAQG  108



>gb|EEC72606.1| hypothetical protein OsI_06079 [Oryza sativa Indica Group]
Length=669

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 68/209 (33%), Positives = 113/209 (54%), Gaps = 14/209 (7%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQ-QPRLP  177
            K++ D+LVKKAY+NW+   EYDGK LL+ K KK     P GQV+    L+     + R+ 
Sbjct  406  KLFADALVKKAYDNWMYAIEYDGKALLNSKPKK--KAAPTGQVETHPPLSQPASYEQRIS  463

Query  178  APVQSEPS-ALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENT-QFAPndqqqlm  351
            +   + PS A   G       Y+ N  A   +Q    S++  + Y++T  F P       
Sbjct  464  SASMTGPSPAGGSGTGTDSIGYDGNQAATQPSQLQSTSANVPVPYDDTFSFLPPSMLMGS  523

Query  352  nnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEE  531
            +N +       ++ +GL LG  Q +   +   S+Q  N+  ++DW+ +++    +  + E
Sbjct  524  DNQETG-----NDGMGLELGQLQQAI--SQSQSIQPANVG-YDDWTRSQNGQFADDFT-E  574

Query  532  EIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            +IR++SH+ML +EDMQ LL++FSMGG ++
Sbjct  575  DIRMKSHQMLESEDMQQLLRVFSMGGAST  603



>gb|KDO62472.1| hypothetical protein CISIN_1g006542mg [Citrus sinensis]
Length=465

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 58/84 (69%), Gaps = 4/84 (5%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            KVYVDS VKKAY+NW    EYDGK+LLS K  K    ++NE  +GQ+D+SN+L+NQLQ  
Sbjct  370  KVYVDSQVKKAYDNWNQVVEYDGKSLLSLKQNKRSNASKNEPQIGQIDFSNALDNQLQLS  429

Query  169  RLPAPVQSEPSALDPGMLIGGSSY  240
            RLPA V +E S+   G  IGG  +
Sbjct  430  RLPAAVPTEQSSAHSGHPIGGKYF  453



>ref|XP_003570530.1| PREDICTED: uncharacterized protein LOC100822237 [Brachypodium 
distachyon]
 ref|XP_010233903.1| PREDICTED: uncharacterized protein LOC100822237 [Brachypodium 
distachyon]
Length=614

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 106/209 (51%), Gaps = 20/209 (10%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            K++ D+LVKKAY+NW+   EYDGK LL+ + KK            S +    L +    A
Sbjct  357  KLFADALVKKAYDNWMYVIEYDGKALLNPEPKKK-------AASTSQAEARPLPERYPTA  409

Query  181  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRM--QYENT-QFAPndqqqlm  351
              Q   S   PG    G + +   G R + QS + S+S  +   Y++T  F P      +
Sbjct  410  YAQRGSSTTLPGPSPAGITDSIGHGNRSATQSALQSTSVNLPVPYDDTFSFLPPTMFMGV  469

Query  352  nnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEE  531
            +           + +GL LG  Q     + G S+Q  N+  ++DW+ TRD    +  + E
Sbjct  470  DQGTAS------DAMGLELGQLQQVV--SHGQSIQPANIG-YDDWTRTRDGQYADDFT-E  519

Query  532  EIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            +IR++SH+ML  EDMQ LL++FSMGG ++
Sbjct  520  DIRMKSHQMLEGEDMQQLLRVFSMGGAST  548



>ref|NP_001046071.1| Os02g0177800 [Oryza sativa Japonica Group]
 dbj|BAD27989.1| putative calmodulin-binding protein [Oryza sativa Japonica Group]
 dbj|BAF07985.1| Os02g0177800 [Oryza sativa Japonica Group]
Length=624

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 67/209 (32%), Positives = 112/209 (54%), Gaps = 14/209 (7%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQ-QPRLP  177
            K++ D+LVKKAY+NW+   EYDGK LL+ K KK     P G V+    L+     + R+ 
Sbjct  361  KLFADALVKKAYDNWMYAIEYDGKALLNSKPKK--KAAPTGHVETHPPLSQPASYEQRIS  418

Query  178  APVQSEPS-ALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENT-QFAPndqqqlm  351
            +   + PS A   G       Y+ N  A   +Q    S++  + Y++T  F P       
Sbjct  419  SASMTGPSPAGGSGTGTDSIGYDGNQAATQPSQLQSTSANVPVPYDDTFSFLPPSMLMGS  478

Query  352  nnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEE  531
            +N +       ++ +GL LG  Q +   +   S+Q  N+  ++DW+ +++    +  + E
Sbjct  479  DNQETG-----NDGMGLELGQLQQAI--SQSQSIQPANVG-YDDWTRSQNGQFADDFT-E  529

Query  532  EIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            +IR++SH+ML +EDMQ LL++FSMGG ++
Sbjct  530  DIRMKSHQMLESEDMQQLLRVFSMGGAST  558



>gb|AFW62647.1| hypothetical protein ZEAMMB73_771415 [Zea mays]
Length=222

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 77/131 (59%), Gaps = 10/131 (8%)
 Frame = +1

Query  241  NENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnnsqqmqnARYDNNVGLALGPPQ  420
            N N  ARY+  +  + ++  MQY+ +  +P  Q    +   Q   +R  N   LALGPPQ
Sbjct  31   NGNQSARYAATTQNIPANVAMQYDRSAVSPESQFSGSSLQSQA--SRGSNT--LALGPPQ  86

Query  421  ---SSCFPTVGSSVQQTNLNSFEDWSNTRDK--GVEEYLSEEEIRLRSHEML*NEDMQHL  585
               S  FP +G S++ T LN FE+W   ++   GV++YL EE IR+RSHE+L NE+MQ +
Sbjct  87   QHQSFAFPALGQSMRPTGLNPFEEWPQQQENCGGVDDYLMEE-IRMRSHEILENEEMQQM  145

Query  586  LQLFSMGGHAS  618
            L+L S GG  +
Sbjct  146  LRLLSTGGAGT  156



>ref|XP_002535531.1| hypothetical protein RCOM_2098470 [Ricinus communis]
 gb|EEF26852.1| hypothetical protein RCOM_2098470 [Ricinus communis]
Length=196

 Score = 60.8 bits (146),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  464  ISILLRTGLTPVTRGLRNICLRRRFVSEAMKCYRMKICSTCFSSSAW  604
            +SILL TG T  TR L N  LR+RF SE M+C RMKIC+TCF S  W
Sbjct  79   VSILLMTGPTTGTRELMNTLLRKRFASEVMRCLRMKICNTCFDSLPW  125


 Score = 47.8 bits (112),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 48/89 (54%), Gaps = 27/89 (30%)
 Frame = +1

Query  157  LQQPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPnd  336
            +Q  RLPA + +E +++  G+ +GG+  N++MGA +S QS +++ +SRM           
Sbjct  1    MQLSRLPASITTEQASVHSGLQVGGN--NDSMGAGFSAQSQLVNPNSRM-----------  47

Query  337  qqqlmnnsqqmqnARYDNNVGLALGPPQS  423
                          R DN+VGLALG PQS
Sbjct  48   --------------RNDNSVGLALGTPQS  62



>gb|EEE56432.1| hypothetical protein OsJ_05602 [Oryza sativa Japonica Group]
Length=789

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 67/209 (32%), Positives = 112/209 (54%), Gaps = 14/209 (7%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQ-QPRLP  177
            K++ D+LVKKAY+NW+   EYDGK LL+ K KK     P G V+    L+     + R+ 
Sbjct  526  KLFADALVKKAYDNWMYAIEYDGKALLNSKPKK--KAAPTGHVETHPPLSQPASYEQRIS  583

Query  178  APVQSEPS-ALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENT-QFAPndqqqlm  351
            +   + PS A   G       Y+ N  A   +Q    S++  + Y++T  F P       
Sbjct  584  SASMTGPSPAGGSGTGTDSIGYDGNQAATQPSQLQSTSANVPVPYDDTFSFLPPSMLMGS  643

Query  352  nnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEE  531
            +N +       ++ +GL LG  Q +   +   S+Q  N+  ++DW+ +++    +  + E
Sbjct  644  DNQETG-----NDGMGLELGQLQQAI--SQSQSIQPANVG-YDDWTRSQNGQFADDFT-E  694

Query  532  EIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            +IR++SH+ML +EDMQ LL++FSMGG ++
Sbjct  695  DIRMKSHQMLESEDMQQLLRVFSMGGAST  723



>dbj|BAJ96828.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=654

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 77/226 (34%), Positives = 113/226 (50%), Gaps = 34/226 (15%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYS--NSLNNQLQ  162
            +V+ D+LVK+AY++W++  EYDGK LL FK KK     R+++      Y+  +S ++Q Q
Sbjct  378  RVFADTLVKQAYDDWINVVEYDGKGLLKFKQKKKSVTTRSDVANVSTSYTSYDSAHSQKQ  437

Query  163  QPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHI-------MSSSSRMQYENTQ  321
              R  A ++          L+  +S +E   A   NQ  I       +S S  MQY  + 
Sbjct  438  LARGHANIERS--------LMSSTSKDETRIASNGNQVAIYEANPQDISPSITMQYGMSS  489

Query  322  FAPndqqqlmnnsqqmqnARYDNNVGLALGP----PQSSCFPTVGSSVQQTNLNSFEDWS  489
              P   +   N S     A   +N+ LA GP    P +  F   G S+Q    N F+DW 
Sbjct  490  LIP---ESQFNGSSIQTQASRSSNM-LAFGPPPQQPHNFEFSAFGLSMQSPAPNPFDDWP  545

Query  490  NTRDK---GVEEYLSEEEIRLRSHEML*N-EDMQHLLQLFSMGGHA  615
                +   GV++ L  EEIR RSH+ML N E+MQH+L++ S G  A
Sbjct  546  GRLQENRGGVDDCLM-EEIRGRSHDMLENEEEMQHMLRILSGGAAA  590



>gb|AFW71858.1| hypothetical protein ZEAMMB73_193945 [Zea mays]
Length=173

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 53/79 (67%), Gaps = 7/79 (9%)
 Frame = +1

Query  400  LALGPPQ---SSCFPTVGSSVQQTNLNSFEDWSN---TRDKGVEEYLSEEEIRLRSHEML  561
            LALGPPQ   S  FP +G  VQ T LN FE+W      R  GV++YL EE IR+RSHE+L
Sbjct  30   LALGPPQQHQSFEFPALGQPVQPTGLNPFEEWPQQQENRGGGVDDYLMEE-IRMRSHEIL  88

Query  562  *NEDMQHLLQLFSMGGHAS  618
             NE+MQ +L+L SMGG  +
Sbjct  89   ENEEMQQMLRLLSMGGAGT  107



>gb|EPS57962.1| calmodulin-binding protein, partial [Genlisea aurea]
Length=150

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 57/83 (69%), Gaps = 7/83 (8%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFK-NKKA-----RNELPMGQVDY-SNSLNNQL  159
            KVYVD+L+KKAY+NW    EYDGK+LL FK NKK+     + ELP G   Y   SL+NQ+
Sbjct  68   KVYVDTLMKKAYDNWDQVLEYDGKSLLGFKQNKKSTSSMLKIELPSGSNSYPPRSLDNQM  127

Query  160  QQPRLPAPVQSEPSALDPGMLIG  228
            Q  RLPA V SE ++++  MLIG
Sbjct  128  QLQRLPASVHSETASVEHNMLIG  150



>dbj|BAK04468.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=655

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 77/223 (35%), Positives = 112/223 (50%), Gaps = 27/223 (12%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYS--NSLNNQLQ  162
            +V+ D+LVK+AY++W++  EYDGK LL FK KK     R+++      Y+  +S ++Q Q
Sbjct  378  RVFADTLVKQAYDDWINVVEYDGKGLLKFKQKKKSVTTRSDVANVSTSYTSYDSAHSQKQ  437

Query  163  QPRLPAPVQ----SEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAP  330
              R  A ++    S  S  D   +    + N N  A Y      +S S  MQY  +   P
Sbjct  438  LARGHANIERSLMSSTSKADETRI----ASNGNQVAIYEANPQDISPSITMQYGMSSLIP  493

Query  331  ndqqqlmnnsqqmqnARYDNNVGLALGP----PQSSCFPTVGSSVQQTNLNSFEDWSNTR  498
               +   N S     A   +N+ LA GP    P +  F   G S+Q    N F+DW    
Sbjct  494  ---EGQFNGSSIQTQASRSSNM-LAFGPPPQQPHNFEFSAFGLSMQSPAPNPFDDWPGRL  549

Query  499  DK---GVEEYLSEEEIRLRSHEML*N-EDMQHLLQLFSMGGHA  615
             +   GV++ L  EEIR RSH+ML N E+MQH+L++ S G  A
Sbjct  550  QENRGGVDDCLM-EEIRGRSHDMLENEEEMQHMLRILSGGAAA  591



>ref|XP_002532915.1| hypothetical protein RCOM_1318360 [Ricinus communis]
 gb|EEF29472.1| hypothetical protein RCOM_1318360 [Ricinus communis]
Length=195

 Score = 60.5 bits (145),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  464  ISILLRTGLTPVTRGLRNICLRRRFVSEAMKCYRMKICSTCFSSSAW  604
            +SILL TG T  TR L N  LR+RF SE M+C RMKIC++CF S AW
Sbjct  86   VSILLMTGPTTRTRELMNTLLRKRFASEVMRCLRMKICNSCFESLAW  132


 Score = 45.1 bits (105),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 48/73 (66%), Gaps = 4/73 (5%)
 Frame = +1

Query  205  LDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnnsqqmqnARY  384
            +  G+ +GG  YN +MGA +S QS +++ +S  ++++T F     + L++NS   Q  R 
Sbjct  1    MHSGLQVGG--YNNSMGAGFSAQSQLVNPNSSTRFDSTSFT--VHEPLISNSHHAQGMRN  56

Query  385  DNNVGLALGPPQS  423
            DN+VGLALGPPQS
Sbjct  57   DNSVGLALGPPQS  69



>ref|XP_006646962.1| PREDICTED: uncharacterized protein LOC102709708 [Oryza brachyantha]
Length=606

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 106/209 (51%), Gaps = 28/209 (13%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQ-QPRLP  177
            K++ D+LVKKAY+NW+   EYDGK LL+ K KK     P GQ +   +L+     + R+ 
Sbjct  360  KLFADALVKKAYDNWMYAIEYDGKALLNSKPKK--KAAPTGQAETQPTLSQPASYEQRIS  417

Query  178  APVQSEPSALDPGMLIG--GSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlm  351
            +   + PS       IG  G+    N+   Y +    +  S  M  +N +          
Sbjct  418  SAGMTGPSPAGGTDSIGYDGNQAAANVPVPYDDTFSFLPPSMLMGSDNQETG--------  469

Query  352  nnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEE  531
                       ++ +GL LG  Q +   +   S+Q  N+  ++DW+ +++    +  + E
Sbjct  470  -----------NDAMGLELGELQQAI--SQSHSIQPANVG-YDDWTRSQNGQFADDFT-E  514

Query  532  EIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            +IR++SH+ML +EDMQ LL++FSMGG ++
Sbjct  515  DIRMKSHQMLESEDMQQLLRVFSMGGAST  543



>gb|AFW70388.1| calmodulin binding protein [Zea mays]
Length=616

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 70/212 (33%), Positives = 103/212 (49%), Gaps = 35/212 (17%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDY------SNSLNNQLQ  162
            K++ D+LVKKAY+NW+   EYDGK LL+ K KK       GQ +       S S    L 
Sbjct  362  KLFADALVKKAYDNWMYVIEYDGKGLLNLKPKK--KAASTGQAETHASAGGSTSYQQHLS  419

Query  163  QPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQ--YENT-QFAPn  333
               +P    S PS        G  S    +    ++ S + SSS+ +Q  Y++T  F P 
Sbjct  420  STSMPG---SSPSG-------GTDSVGYGVDQSATHLSQLQSSSTNLQTPYDDTFSFLPP  469

Query  334  dqqqlmnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVE  513
            +                ++ +GL LG  Q     + G  +Q  N+  + DW   RD    
Sbjct  470  NLLTGSA----------NDAMGLELG--QLHQVISQGQPIQPANVG-YVDWPRNRDSQYA  516

Query  514  EYLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            +  + E+IR++SH+ML +EDMQ LL++FSMGG
Sbjct  517  DDFT-EDIRVKSHQMLESEDMQQLLRVFSMGG  547



>gb|AFW66308.1| hypothetical protein ZEAMMB73_910550 [Zea mays]
Length=317

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 69/212 (33%), Positives = 103/212 (49%), Gaps = 35/212 (17%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDY------SNSLNNQLQ  162
            K++ D+LVKKAY+NW+   EYDGK LL+ K KK       GQV+         S    L 
Sbjct  63   KLFADALVKKAYDNWMYVIEYDGKGLLNPKPKK--KSASTGQVETHAPAGGPTSYQQYLS  120

Query  163  QPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQ--YENT-QFAPn  333
               +P P    PS        G  S    +    ++ S + SSS+ +Q  Y++T  F P 
Sbjct  121  SMSMPGP---SPSG-------GTDSAGYGVDQSATHPSQLQSSSANVQAPYDDTFSFLPP  170

Query  334  dqqqlmnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVE  513
            +                ++ +GL LG  Q     + G ++Q  N+  + DW   RD    
Sbjct  171  NMLTGSA----------NDAMGLELGQLQQVT--SQGQTIQPANVG-YGDWPRNRDSQYP  217

Query  514  EYLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            +  + E+IR++SH++L  EDMQ LL++FSMGG
Sbjct  218  DDFT-EDIRVKSHQLLEGEDMQQLLRVFSMGG  248



>ref|NP_001150045.1| calmodulin binding protein [Zea mays]
 gb|ACG37616.1| calmodulin binding protein [Zea mays]
Length=616

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 70/212 (33%), Positives = 102/212 (48%), Gaps = 35/212 (17%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDY------SNSLNNQLQ  162
            K++ D+LVKKAY+NW+   EYDGK LL+ K KK       GQ +       S S    L 
Sbjct  362  KLFADALVKKAYDNWMYVIEYDGKGLLNLKPKK--KAASTGQAETHASAGGSTSYQQHLS  419

Query  163  QPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQ--YENT-QFAPn  333
               +P    S PS        G  S    +    ++ S + SSS+ +Q  Y+ T  F P 
Sbjct  420  STSMPG---SSPSG-------GTDSVGYGVDQSATHLSQLQSSSTNLQTPYDYTFSFLPP  469

Query  334  dqqqlmnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVE  513
            +                ++ +GL LG  Q     + G  +Q  N+  + DW   RD    
Sbjct  470  NLLTGSA----------NDAMGLELG--QLHQVISQGQPIQPANVG-YVDWPRNRDSQYA  516

Query  514  EYLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            +  + E+IR++SH+ML +EDMQ LL++FSMGG
Sbjct  517  DDFT-EDIRVKSHQMLESEDMQQLLRVFSMGG  547



>gb|ACG47634.1| calmodulin binding protein [Zea mays]
Length=612

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 69/212 (33%), Positives = 103/212 (49%), Gaps = 35/212 (17%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDY------SNSLNNQLQ  162
            K++ D+LVKKAY+NW+   EYDGK LL+ K KK       GQV+         S    L 
Sbjct  358  KLFADALVKKAYDNWMYVIEYDGKGLLNPKPKK--KSASTGQVETHAPAGGPTSYQQYLS  415

Query  163  QPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQ--YENT-QFAPn  333
               +P P    PS        G  S    +    ++ S + SSS+ +Q  Y++T  F P 
Sbjct  416  SMSMPGP---SPSG-------GTDSAGYGVDQSATHPSQLQSSSANVQAPYDDTFSFLPP  465

Query  334  dqqqlmnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVE  513
            +                ++ +GL LG  Q     + G ++Q  N+  + DW   RD    
Sbjct  466  NMLTGSA----------NDAMGLELGQLQQVT--SQGQTIQPANVG-YGDWPRNRDSQYP  512

Query  514  EYLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            +  + E+IR++SH++L  EDMQ LL++FSMGG
Sbjct  513  DDFT-EDIRVKSHQLLEGEDMQQLLRVFSMGG  543



>ref|NP_001152440.1| LOC100286080 [Zea mays]
 gb|ACN34355.1| unknown [Zea mays]
 gb|AFW66305.1| calmodulin binding protein [Zea mays]
Length=612

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 69/212 (33%), Positives = 103/212 (49%), Gaps = 35/212 (17%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDY------SNSLNNQLQ  162
            K++ D+LVKKAY+NW+   EYDGK LL+ K KK       GQV+         S    L 
Sbjct  358  KLFADALVKKAYDNWMYVIEYDGKGLLNPKPKK--KSASTGQVETHAPAGGPTSYQQYLS  415

Query  163  QPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQ--YENT-QFAPn  333
               +P P    PS        G  S    +    ++ S + SSS+ +Q  Y++T  F P 
Sbjct  416  SMSMPGP---SPSG-------GTDSAGYGVDQSATHPSQLQSSSANVQAPYDDTFSFLPP  465

Query  334  dqqqlmnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVE  513
            +                ++ +GL LG  Q     + G ++Q  N+  + DW   RD    
Sbjct  466  NMLTGSA----------NDAMGLELG--QLQQVTSQGQTIQPANVG-YGDWPRNRDSQYP  512

Query  514  EYLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            +  + E+IR++SH++L  EDMQ LL++FSMGG
Sbjct  513  DDFT-EDIRVKSHQLLEGEDMQQLLRVFSMGG  543



>gb|KHG17962.1| Insulin-like receptor [Gossypium arboreum]
Length=538

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 67/209 (32%), Positives = 99/209 (47%), Gaps = 38/209 (18%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            KVYVD LVKKAYENW+   EYD K+            ++  +PM    Y +         
Sbjct  295  KVYVDGLVKKAYENWMHVIEYDAKSSPGSNEDDNTGCSKANVPMDLQAYPS------HHQ  348

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LP+ +  E   +D G+ +G     + M A   +Q  + S ++R+  + TQ         
Sbjct  349  VLPSLLVPEQPPMDSGLNVG-----DPMAA---SQLPMQSQNARLNAQTTQL--------  392

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  528
                     A  ++N      P  SS  P     V  +N+ SF+          +++LSE
Sbjct  393  ----NGALFAELNDNELTHHCPSHSSSKPGF-HGVAASNIPSFK-------AEADDFLSE  440

Query  529  EEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
            EEIR+RS+E+L NEDMQHLL++F+MG H 
Sbjct  441  EEIRMRSNEVLENEDMQHLLRVFNMGSHG  469



>ref|XP_002453396.1| hypothetical protein SORBIDRAFT_04g005240 [Sorghum bicolor]
 gb|EES06372.1| hypothetical protein SORBIDRAFT_04g005240 [Sorghum bicolor]
Length=622

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 99/204 (49%), Gaps = 13/204 (6%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQ-QPRLP  177
            K++ D LVKK+Y+NW+   EYDGK LL+ K KK       GQ +    +   +  Q  L 
Sbjct  365  KLFADGLVKKSYDNWMYVIEYDGKGLLNPKPKK--KAASTGQAETHAPVGGPISYQQHLS  422

Query  178  APVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnn  357
            +   S PS   P      + Y  +  A + +Q  + SSS+ +Q    Q  P         
Sbjct  423  STSMSGPS---PSGGTNSAGYGVDQSATHPSQ--LQSSSTNVQSAIVQ--PPYDDTFSFL  475

Query  358  sqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEEEI  537
               M     ++ +GL LG  Q     + G ++Q  N+    DW   RD    +  + E+I
Sbjct  476  PPNMLTGSANDAMGLELGQLQQVI--SQGQAIQPANVGYGSDWPRNRDNQYADDFT-EDI  532

Query  538  RLRSHEML*NEDMQHLLQLFSMGG  609
             ++SH+ML +EDMQ LL++FSMGG
Sbjct  533  HVKSHQMLESEDMQQLLRVFSMGG  556



>ref|XP_002531478.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30902.1| conserved hypothetical protein [Ricinus communis]
Length=145

 Score = 62.4 bits (150),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  464  ISILLRTGLTPVTRGLRNICLRRRFVSEAMKCYRMKICSTCFSSSAW  604
            +SILL TG T  TR L N  LR+RF SE M+C RMKIC+TCF S AW
Sbjct  73   VSILLMTGPTTGTRELMNTLLRKRFASEVMRCLRMKICNTCFDSLAW  119


 Score = 37.7 bits (86),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 39/58 (67%), Gaps = 2/58 (3%)
 Frame = +1

Query  250  MGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnnsqqmqnARYDNNVGLALGPPQS  423
            MGA +S QS +++ +S  Q+++T F    ++ L++NS   Q  R DN+VGLALGPP S
Sbjct  1    MGAGFSAQSQLVNPNSSTQFDSTSFT--VREPLISNSPHAQGMRNDNSVGLALGPPHS  56



>gb|EMT26442.1| hypothetical protein F775_27587 [Aegilops tauschii]
Length=613

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 102/211 (48%), Gaps = 27/211 (13%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            K + D LVKKAY+NW+   EYDGK LL+ K KK              +L NQ +     A
Sbjct  360  KHFADGLVKKAYDNWMYVIEYDGKALLNPKPKK------------KAALTNQAEARAPAA  407

Query  181  PVQSEPSALDPGMLIGGS----SYNENMGARYSNQSHIMSSSSRMQYENT-QFAPndqqq  345
             VQ   S   PG    G+     Y+ N  A  S Q    S++  + Y++   F P+    
Sbjct  408  YVQRISSTSMPGPSTTGTNGSIGYDGNQTATQSVQLQSSSANMPVPYDDAFPFLPHTMLM  467

Query  346  lmnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLS  525
              N           + +GL LG    +   + G  +Q  N+  +++W + RD    +  +
Sbjct  468  GSNQGTAS------DGMGLELGQLHHTI--SQGHPIQPANVG-YDNWHHNRDGQYADDFT  518

Query  526  EEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
             E+IRL+SH++L  +DMQ LL++F+MGG ++
Sbjct  519  -EDIRLKSHQLLEGDDMQQLLRVFNMGGAST  548



>ref|XP_004951715.1| PREDICTED: uncharacterized protein LOC101768423 [Setaria italica]
Length=617

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 99/210 (47%), Gaps = 31/210 (15%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYS------NSLNNQLQ  162
            K++ D+LVKKAY+NW+   EYDGK L + K KK       GQV+ +       S    L 
Sbjct  363  KLFADALVKKAYDNWMYVIEYDGKGLFNPKPKK--KAASTGQVETNLPAVGPASYQQHLS  420

Query  163  QPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENT-QFAPndq  339
               +P P         P        Y+ +  A +  Q    SS+ +  +++T  F P + 
Sbjct  421  STSMPGP--------SPAGRSDSVGYDGDQSATHPAQLQSSSSNVQSPFDDTFSFLPPNM  472

Query  340  qqlmnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  519
                           ++ +GL LG  Q     +   S+Q  N+  + DW   R+    + 
Sbjct  473  LTGSA----------NDAMGLELGQLQQVI--SQSQSIQPANVG-YTDWPRNRESQYGDD  519

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
             + E+IR++SH+ML +EDMQ LL++FSMGG
Sbjct  520  FT-EDIRIKSHQMLESEDMQQLLRVFSMGG  548



>gb|KDO75736.1| hypothetical protein CISIN_1g006875mg [Citrus sinensis]
Length=448

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 52/84 (62%), Gaps = 4/84 (5%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELP----MGQVDYSNSLNNQLQQP  168
            KV+VD+LVKKAY+NW+   EYDGK+LL F   K+ +  P     G  +Y+N  + QL  P
Sbjct  365  KVHVDTLVKKAYDNWMHVIEYDGKSLLGFTQNKSVDAPPTDFQTGPPNYTNPFSQQLALP  424

Query  169  RLPAPVQSEPSALDPGMLIGGSSY  240
             L  PV  E  ++D G+ +GG+ +
Sbjct  425  TLSVPVPPEQPSMDSGLTVGGTIF  448



>gb|EMS66803.1| hypothetical protein TRIUR3_04882 [Triticum urartu]
Length=591

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 64/211 (30%), Positives = 100/211 (47%), Gaps = 27/211 (13%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            K + D LVKKAY+NW+   EYDGK LL+ K KK              +L NQ +     A
Sbjct  338  KHFADGLVKKAYDNWMYVIEYDGKALLNPKPKK------------KAALTNQAEARAPAA  385

Query  181  PVQSEPSALDPGMLIGGS----SYNENMGARYSNQSHIMSSSSRMQYENT-QFAPndqqq  345
             VQ   S   PG    G+     Y+ N  A  S Q    S++  + Y++   F P     
Sbjct  386  YVQCISSTSMPGPSTTGTNGSIGYDGNQTATQSVQLQSSSANVPVPYDDAFSFLPPTMLM  445

Query  346  lmnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLS  525
              N           + +GL LG    +   +    +Q  N+  +++W + RD    +  +
Sbjct  446  GSNQGTAS------DGMGLELGQLHHTI--SQRQPIQPANVG-YDNWHHNRDGQYADDFT  496

Query  526  EEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
             E+IR++SH++L  +DMQ LL++F+MGG ++
Sbjct  497  -EDIRMKSHQLLEGDDMQQLLRIFNMGGAST  526



>ref|XP_011043291.1| PREDICTED: uncharacterized protein LOC105138780 isoform X4 [Populus 
euphratica]
Length=578

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 51/82 (62%), Gaps = 4/82 (5%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            K+YVDSLV KAY+NW+   EYDG +LL FK  +    ++N++P GQ D+ N  ++Q   P
Sbjct  375  KIYVDSLVNKAYDNWMHVMEYDGNSLLDFKQHQGVAASQNDVPSGQQDFLNPYDHQDSLP  434

Query  169  RLPAPVQSEPSALDPGMLIGGS  234
             +  PV SE   +  G  IGGS
Sbjct  435  TISVPVPSEQPVVHSGPAIGGS  456


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  502  KGVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
            +G E++ SEEEIR RSH+ML NEDMQ LL++F+MGG  
Sbjct  468  RGKEDFFSEEEIRTRSHDMLENEDMQQLLRIFNMGGQG  505



>emb|CDX94414.1| BnaC01g17700D [Brassica napus]
Length=576

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 72/208 (35%), Positives = 96/208 (46%), Gaps = 56/208 (27%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            KVYVD LVKKAY+NW    EY+GKT L+F N+  R E+    V  + S+         P+
Sbjct  354  KVYVDGLVKKAYDNWNQVIEYEGKTPLNF-NQPKRVEIEPVTVPANYSVLP-------PS  405

Query  181  PVQSEPSALDPGMLIGGSSY---NENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlm  351
            P+   P +  PG    G S    ++ MG       H   + ++   EN            
Sbjct  406  PI---PPSQFPGFSFEGYSVLQQDQFMGI------HQHQTQTQTNLEN------------  444

Query  352  nnsqqmqnARYDNNVGLALG--PPQSSC-FPTVGSS-VQQTNLNSFEDWSNTRDKGVEEY  519
                        N  G+ LG  P QS+  +P +GSS V Q NL+  E+WS          
Sbjct  445  -----------QNVTGMTLGTTPLQSTGGYPDMGSSSVHQANLDPLEEWSRQH-------  486

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSM  603
              E ++  RSHEML +EDMQ LLQL SM
Sbjct  487  --ENDLLSRSHEMLESEDMQQLLQLCSM  512



>emb|CDX89394.1| BnaA01g14990D [Brassica napus]
Length=575

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 97/207 (47%), Gaps = 55/207 (27%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            KVYVD LVKKAY+NW    EY+GKT L+  N+  R E+    V  + S+         P+
Sbjct  354  KVYVDGLVKKAYDNWNQVIEYEGKTPLNL-NQPERVEIESVTVPANYSVLP-------PS  405

Query  181  PVQSEPSALDPGMLIGGSSY---NENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlm  351
            P+   P +  PG    G +    ++ MG       H   + ++   EN            
Sbjct  406  PI---PPSQFPGFSFEGYNVLQQDQFMGI------HQHQTQTQTNLEN------------  444

Query  352  nnsqqmqnARYDNNVGLALGPP-QSSC-FPTVGSS-VQQTNLNSFEDWSNTRDKGVEEYL  522
                        N  G+ALG   QS+C +  +GSS V Q NL+ FE+WS+          
Sbjct  445  -----------QNVTGMALGTTLQSTCGYQDMGSSSVHQANLDPFEEWSHQH--------  485

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSM  603
             E ++  RSHEML +EDMQ LLQL SM
Sbjct  486  -ENDLLSRSHEMLESEDMQQLLQLCSM  511



>ref|XP_009139545.1| PREDICTED: uncharacterized protein LOC103863555 [Brassica rapa]
Length=575

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 97/207 (47%), Gaps = 55/207 (27%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            KVYVD LVKKAY+NW    EY+GKT L+  N+  R E+    V  + S+         P+
Sbjct  354  KVYVDGLVKKAYDNWNQVIEYEGKTPLNL-NQPERVEIEPVTVPANYSVLP-------PS  405

Query  181  PVQSEPSALDPGMLIGGSSY---NENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlm  351
            P+   P +  PG    G +    ++ MG       H   + ++   EN            
Sbjct  406  PI---PPSQFPGFSFEGYNVLQQDQFMGI------HQHQTQTQTNLEN------------  444

Query  352  nnsqqmqnARYDNNVGLALGPP-QSSC-FPTVGSS-VQQTNLNSFEDWSNTRDKGVEEYL  522
                        N  G+ALG   QS+C +  +GSS V Q NL+ FE+WS+          
Sbjct  445  -----------QNVTGMALGTTLQSTCGYQDMGSSSVHQANLDPFEEWSHQH--------  485

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSM  603
             E ++  RSHEML +EDMQ LLQL SM
Sbjct  486  -ENDLLSRSHEMLESEDMQQLLQLCSM  511



>gb|AAA33446.1| calmodulin-binding protein, partial [Zea mays]
Length=129

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 4/62 (6%)
 Frame = +1

Query  433  PTVGSSVQQTNLNSFEDW---SNTRDKGVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSM  603
            P +G  VQ T LN FE+W      R  GV++YL EE IR+RSHE+L NE+MQ +L+L SM
Sbjct  1    PALGQPVQPTGLNPFEEWPQQQENRGGGVDDYLMEE-IRMRSHEILENEEMQQMLRLLSM  59

Query  604  GG  609
            GG
Sbjct  60   GG  61



>emb|CAD40976.1| OSJNBa0027P08.1 [Oryza sativa Japonica Group]
Length=143

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 54/78 (69%), Gaps = 6/78 (8%)
 Frame = +1

Query  400  LALGPPQSSCF--PTVGSSVQQTNLNSFEDWSNTRDK--GVEEYLSEEEIRLRSHEML*N  567
            LALGP Q   F    +G S+Q + LN F+DWS  ++   GV++YL  EEIR+RSHE+L N
Sbjct  2    LALGPTQQQNFEFSALGQSMQPSPLNPFDDWSRLQENRGGVDDYLM-EEIRVRSHEILEN  60

Query  568  -EDMQHLLQLFSMGGHAS  618
             EDMQ +L++ SMGG ++
Sbjct  61   EEDMQQMLRILSMGGSSA  78



>ref|XP_002530779.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31606.1| conserved hypothetical protein [Ricinus communis]
Length=127

 Score = 58.5 bits (140),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  464  ISILLRTGLTPVTRGLRNICLRRRFVSEAMKCYRMKICSTCFSSSAW  604
            +SILL TG T  TR L N  LR+RF SE M+C R+KIC++CF S AW
Sbjct  73   VSILLMTGPTTGTRELMNTLLRKRFASEVMRCLRIKICNSCFDSLAW  119


 Score = 34.3 bits (77),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 37/58 (64%), Gaps = 2/58 (3%)
 Frame = +1

Query  250  MGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnnsqqmqnARYDNNVGLALGPPQS  423
            MGA +S QS +++ +S  ++++T F     + L++N    Q  R DN+VGLALGPP S
Sbjct  1    MGAGFSAQSQLVNPNSSTRFDSTSFT--VHEPLISNYHHAQGMRNDNSVGLALGPPPS  56



>gb|KJB69416.1| hypothetical protein B456_011G022600 [Gossypium raimondii]
Length=605

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 95/209 (45%), Gaps = 38/209 (18%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  168
            KVYVD LVKKAYENW+   EYD K+            ++  +PM    Y +         
Sbjct  362  KVYVDGLVKKAYENWMHVIEYDAKSSPGSNEDDNTGCSKANVPMDLQAYPS------HHQ  415

Query  169  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  348
             LP+ +  E   +D G+ +G     + M A   +Q  + S ++R+  + TQ         
Sbjct  416  VLPSLLVPEQPPMDSGLNVG-----DPMAA---SQLPMQSQNARLNAQTTQL--------  459

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  528
                        ++N      P  SS  P     V  +N+  F+          +++LSE
Sbjct  460  ----NGALFTELNDNELTHHCPSHSSSKPGF-HGVAASNIPPFK-------AEADDFLSE  507

Query  529  EEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
            EEI +RS+E+L NEDMQHLL++ +MG H 
Sbjct  508  EEIIMRSNEVLENEDMQHLLRVINMGSHG  536



>ref|XP_002535201.1| hypothetical protein RCOM_0245460 [Ricinus communis]
 gb|EEF27182.1| hypothetical protein RCOM_0245460 [Ricinus communis]
Length=192

 Score = 62.4 bits (150),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  464  ISILLRTGLTPVTRGLRNICLRRRFVSEAMKCYRMKICSTCFSSSAW  604
            +SILL TG T  TR L N  LR+RF SE M+C RMKIC+TCF S AW
Sbjct  75   VSILLMTGPTTGTRELMNTLLRKRFASEVMRCLRMKICNTCFDSLAW  121


 Score = 28.9 bits (63),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 13/15 (87%), Gaps = 0/15 (0%)
 Frame = +1

Query  379  RYDNNVGLALGPPQS  423
            R DN+VGLALGPP S
Sbjct  44   RNDNSVGLALGPPHS  58



>ref|XP_002532912.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29469.1| conserved hypothetical protein [Ricinus communis]
Length=114

 Score = 60.5 bits (145),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  464  ISILLRTGLTPVTRGLRNICLRRRFVSEAMKCYRMKICSTCFSSSAWEVM  613
            +SIL  TG T  TR L N  LR+RF SE M+C RMKIC++CF S AW  M
Sbjct  63   VSILFMTGPTTGTRELMNTLLRKRFASEVMRCLRMKICNSCFDSLAWGGM  112


 Score = 30.8 bits (68),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +1

Query  379  RYDNNVGLALGPPQS  423
            R DN+VGLALGPPQS
Sbjct  32   RNDNSVGLALGPPQS  46



>gb|KFK39129.1| hypothetical protein AALP_AA3G204700 [Arabis alpina]
Length=291

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 86/170 (51%), Gaps = 33/170 (19%)
 Frame = +1

Query  7    YVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPAPV  186
            YVD LV+KAYENW    EYD K+L++F N+  + +     VDYS           +P  V
Sbjct  148  YVDGLVRKAYENWDQVIEYDNKSLMNF-NQVNKTDF----VDYS-----------MPVSV  191

Query  187  QSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnnsqq  366
             S+PS     + +  S YN++ G+ +S QS +  +SS + + NT F P DQ     +  Q
Sbjct  192  PSQPSTSYSDVTVDASVYNQSSGSSFSAQSQLADTSSYIHFGNTSFTPQDQLISNTHESQ  251

Query  367  mqnARYDNNVG--LALGPPQSSCFPTVGSSVQQT-----NLNSFEDWSNT  495
                  +NN G  LALGPP       +G   QQ       +NSF DWSNT
Sbjct  252  HMI---NNNGGVRLALGPP-------IGLQNQQFVQPPPEINSFNDWSNT  291



>ref|XP_006453636.1| hypothetical protein CICLE_v10008603mg [Citrus clementina]
 ref|XP_006453642.1| hypothetical protein CICLE_v10008603mg [Citrus clementina]
 gb|ESR66876.1| hypothetical protein CICLE_v10008603mg [Citrus clementina]
 gb|ESR66882.1| hypothetical protein CICLE_v10008603mg [Citrus clementina]
Length=607

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 72/213 (34%), Positives = 92/213 (43%), Gaps = 44/213 (21%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            K+ VDSLVK+AY+NW    EYDGK L S  N                  N +       A
Sbjct  366  KISVDSLVKRAYDNWHQVLEYDGKFLSSLTN------------------NTKKAIKSSAA  407

Query  181  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYE--NTQFAPndqqqlmn  354
            P  S  S  D G     +           ++   MSS  R QY+  N Q AP  Q     
Sbjct  408  PTVS--SNYDTGRCTSTTQ----------SRQQYMSSEPRSQYQSGNHQHAPVTQLIEFP  455

Query  355  nsqqmqnARYDNNVGLALGPPQ---SSCFPTVGSSVQQTNLNSFE-DWSNTRD-KGVEEY  519
                    R D    + L  PQ   S  F  +         + F+ DWS  R+  G+E++
Sbjct  456  F------VRPDQTSLMILNNPQAALSGSFDHLSVGNAAAGGSYFQGDWSRPRNGHGLEDF  509

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            L+EE IR+RS EML N+DMQ LL+  SMG  AS
Sbjct  510  LAEE-IRVRSSEMLENDDMQRLLKTLSMGMTAS  541



>gb|KDO59436.1| hypothetical protein CISIN_1g007350mg [Citrus sinensis]
 gb|KDO59437.1| hypothetical protein CISIN_1g007350mg [Citrus sinensis]
Length=607

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 72/213 (34%), Positives = 90/213 (42%), Gaps = 44/213 (21%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            K+ VDSLVK+AY+NW    EYDGK L S  N                  N +       A
Sbjct  366  KISVDSLVKRAYDNWHQVLEYDGKFLSSLTN------------------NTKKAIKSSAA  407

Query  181  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYE--NTQFAPndqqqlmn  354
            P  S  S  D G     +            +   MSS  R QY+  N Q AP  Q     
Sbjct  408  PTVS--SNYDTGRCTSTTQ----------TRQQYMSSEPRSQYQSGNHQHAPVTQLIEFP  455

Query  355  nsqqmqnARYDNNVGLALGPPQ---SSCFPTVGSSVQQTNLNSFE-DWSNTRD-KGVEEY  519
                    R D    + L  PQ   S  F  +         + F  DWS  R+  G+E++
Sbjct  456  F------VRPDQTSLMILNNPQAVLSGSFDHLSVGNAAAGGSYFPGDWSRPRNGHGLEDF  509

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            L+EE IR+RS EML N+DMQ LL+  SMG  AS
Sbjct  510  LAEE-IRVRSSEMLENDDMQRLLKTLSMGMTAS  541



>gb|KDO59439.1| hypothetical protein CISIN_1g007350mg [Citrus sinensis]
Length=531

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 72/213 (34%), Positives = 90/213 (42%), Gaps = 44/213 (21%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            K+ VDSLVK+AY+NW    EYDGK L S  N                  N +       A
Sbjct  290  KISVDSLVKRAYDNWHQVLEYDGKFLSSLTN------------------NTKKAIKSSAA  331

Query  181  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYE--NTQFAPndqqqlmn  354
            P  S  S  D G     +            +   MSS  R QY+  N Q AP  Q     
Sbjct  332  PTVS--SNYDTGRCTSTTQ----------TRQQYMSSEPRSQYQSGNHQHAPVTQLIEFP  379

Query  355  nsqqmqnARYDNNVGLALGPPQ---SSCFPTVGSSVQQTNLNSFE-DWSNTRD-KGVEEY  519
                    R D    + L  PQ   S  F  +         + F  DWS  R+  G+E++
Sbjct  380  F------VRPDQTSLMILNNPQAVLSGSFDHLSVGNAAAGGSYFPGDWSRPRNGHGLEDF  433

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSMGGHAS  618
            L+EE IR+RS EML N+DMQ LL+  SMG  AS
Sbjct  434  LAEE-IRVRSSEMLENDDMQRLLKTLSMGMTAS  465



>gb|AAN65369.1| calmodulin-binding protein 60-C [Phaseolus vulgaris]
Length=129

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 40/53 (75%), Gaps = 2/53 (4%)
 Frame = +1

Query  457  QTNLNSFE--DWSNTRDKGVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
            Q++ + FE    SN   +GVEEY  EEEIR+RSHEML NEDMQ LL++F++GG
Sbjct  3    QSSTHGFEPVSISNPTYRGVEEYFPEEEIRIRSHEMLENEDMQQLLRMFNVGG  55



>gb|AAN65367.1| calmodulin-binding protein 60-A [Phaseolus vulgaris]
Length=101

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 33/37 (89%), Gaps = 1/37 (3%)
 Frame = +1

Query  511  EEYLSEEEIRLRSHEML*NEDMQHLLQLFSM-GGHAS  618
            +E+ SEEEIRLRSHEML NEDMQHLL+LFSM GGH S
Sbjct  1    DEFFSEEEIRLRSHEMLENEDMQHLLRLFSMGGGHGS  37



>ref|XP_006473988.1| PREDICTED: uncharacterized protein LOC102629839 [Citrus sinensis]
Length=607

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 88/209 (42%), Gaps = 44/209 (21%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            K+ VDSLVK+AY+NW    EYDGK L S  N                  N +       A
Sbjct  366  KISVDSLVKRAYDNWHQVLEYDGKFLSSLTN------------------NTKKAIKSSAA  407

Query  181  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYE--NTQFAPndqqqlmn  354
            P  S  S  D G     +            +   MSS  R QY+  N Q AP  Q     
Sbjct  408  PTVS--SNYDTGRCTSTTQ----------TRQQYMSSEPRSQYQSGNHQHAPVTQLIEFP  455

Query  355  nsqqmqnARYDNNVGLALGPPQ---SSCFPTVGSSVQQTNLNSFE-DWSNTRD-KGVEEY  519
                    R D    + L  PQ   S  F  +         + F  DWS  R+  G+E++
Sbjct  456  F------VRPDQTSLMILNNPQAVLSGSFDHLSVGNAAAGGSYFPGDWSRPRNGHGLEDF  509

Query  520  LSEEEIRLRSHEML*NEDMQHLLQLFSMG  606
            L+EE IR+RS EML N+DMQ LL+  SMG
Sbjct  510  LAEE-IRVRSSEMLENDDMQRLLKTLSMG  537



>gb|ABA27028.1| TO69-3 [Taraxacum officinale]
Length=74

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  502  KGVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMG  606
            +G+++Y  EEEIR+RSHEML NEDMQHLL+LF+MG
Sbjct  5    RGLDDYFPEEEIRMRSHEMLENEDMQHLLRLFNMG  39



>gb|KDP38647.1| hypothetical protein JCGZ_04000 [Jatropha curcas]
Length=610

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 65/208 (31%), Positives = 94/208 (45%), Gaps = 46/208 (22%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            KV VDSLVK+AYENW    EYDGK L                    N+L N     R   
Sbjct  368  KVSVDSLVKQAYENWHQVMEYDGKVL--------------------NTLMNTKNGRR---  404

Query  181  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  360
                  +++ P  ++     N  + +  + Q   +SS      E  Q    +    +   
Sbjct  405  ------TSVAP--IVDNYDTNHYITSNQNRQQQYISSE-----EGLQSQAVNNHTSVPQL  451

Query  361  qqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNS----FE-DWSNTRD-KGVEEYL  522
             +    R D++  + L   Q +   T GSS+   ++ +    F  DWS TR+ +G+E+Y 
Sbjct  452  IEFPFVRSDHDAVMTLNNQQVA---TAGSSMDHMSVATPGTYFSGDWSQTRNGQGLEDYF  508

Query  523  SEEEIRLRSHEML*NEDMQHLLQLFSMG  606
            +EE IRLRS EML + DMQ LL+ F MG
Sbjct  509  AEE-IRLRSTEMLESGDMQRLLKTFGMG  535



>ref|NP_001291237.1| uncharacterized LOC105121148 [Populus euphratica]
 gb|AEL95441.1| calmodulin-binding protein [Populus euphratica]
Length=610

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 59/207 (29%), Positives = 87/207 (42%), Gaps = 53/207 (26%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            KV VDSLVK+AYENW    EYDGK L S  + K                           
Sbjct  369  KVSVDSLVKRAYENWHHVVEYDGKVLNSLASNKGGK------------------------  404

Query  181  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqq----l  348
                            G+S    + + Y    +I S  ++ Q+  ++ +P  Q       
Sbjct  405  ----------------GASAAPIVDSSYERNQYITSDQNKQQFIPSEPSPQYQAIINHPS  448

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSC-----FPTVGSSVQQTNLNSFEDWSNTRD-KGV  510
            +    +    R D N  + L  PQ++      + +VG+ V  T      DWS  R   G+
Sbjct  449  VPQLIKFPFVRSDQNAAMTLNNPQAALSGGTDYMSVGTPVGDTCFPG--DWSRPRTGNGL  506

Query  511  EEYLSEEEIRLRSHEML*NEDMQHLLQ  591
            E++ +EE IR+RS EML ++DMQ LL+
Sbjct  507  EDFFTEE-IRVRSSEMLESDDMQRLLK  532



>ref|XP_011017983.1| PREDICTED: uncharacterized protein LOC105121148 [Populus euphratica]
Length=610

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 59/207 (29%), Positives = 87/207 (42%), Gaps = 53/207 (26%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            KV VDSLVK+AYENW    EYDGK L S  + K                           
Sbjct  369  KVSVDSLVKRAYENWHHVVEYDGKVLNSLASNKGGK------------------------  404

Query  181  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqq----l  348
                            G+S    + + Y    +I S  ++ Q+  ++ +P  Q       
Sbjct  405  ----------------GASAAPIVDSSYERNQYITSDQNKQQFIPSEPSPQYQAIINHPS  448

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSC-----FPTVGSSVQQTNLNSFEDWSNTRD-KGV  510
            +    +    R D N  + L  PQ++      + +VG+ V  T      DWS  R   G+
Sbjct  449  VPQLIKFPFVRSDQNAAMTLNNPQAALSGGTDYMSVGTPVGDTCFPG--DWSRPRTGNGL  506

Query  511  EEYLSEEEIRLRSHEML*NEDMQHLLQ  591
            E++ +EE IR+RS EML ++DMQ LL+
Sbjct  507  EDFFTEE-IRVRSSEMLESDDMQRLLK  532



>gb|AFK38635.1| unknown [Medicago truncatula]
Length=128

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  508  VEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGGHA  615
            VE++  EEEIR+RSHEML NEDMQ LL++F+MG HA
Sbjct  21   VEDFSPEEEIRIRSHEMLENEDMQQLLRMFNMGSHA  56



>ref|XP_009366145.1| PREDICTED: uncharacterized protein LOC103955955 [Pyrus x bretschneideri]
Length=611

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 66/212 (31%), Positives = 96/212 (45%), Gaps = 55/212 (26%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFK-NKKARNELPMGQVDYSN-------SLNNQ  156
            KV VDSLVK+AY+NW    EYDGK L +   NKK     P    DY+N       S + Q
Sbjct  368  KVSVDSLVKRAYDNWQQVIEYDGKVLHALAGNKKVTRASPAPVADYNNYAIMDHHSASTQ  427

Query  157  LQQPRLPAPV--QSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAP  330
              Q + PA    Q +P    P +    S + E    R SNQ+ ++               
Sbjct  428  NSQQQYPAQFSQQFQPENNHPSV----SQFIEFPFVR-SNQTELI---------------  467

Query  331  ndqqqlmnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSN-TRDKG  507
                            +++N    AL P  +   P+VG S      +   DW+      G
Sbjct  468  ----------------KFNNPEPAAL-PSSTGYMPSVGGS------DFSGDWTRPNYGNG  504

Query  508  VEEYLSEEEIRLRSHEML*NEDMQHLLQLFSM  603
            ++++++ +EIR+RS EML ++DMQ LL+ FSM
Sbjct  505  LDDFVA-DEIRIRSSEMLESDDMQRLLKTFSM  535



>ref|XP_008336916.1| PREDICTED: uncharacterized protein LOC103400014 [Malus domestica]
Length=608

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 65/205 (32%), Positives = 96/205 (47%), Gaps = 41/205 (20%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            KV VDSLVK+AY+NW    EYDGK L +    K        QV  ++           PA
Sbjct  368  KVSVDSLVKRAYDNWHQVVEYDGKVLHALAGNK--------QVXRAS-----------PA  408

Query  181  PVQSEP--SALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQ-FAPndqqqlm  351
            PV +    +A+D       S+  +N   +Y+ Q      S   Q EN+    P   +   
Sbjct  409  PVAAHNNYAAMD-----HHSASTQNRQQQYTPQ-----FSQHFQPENSHPSVPQFIEFPF  458

Query  352  nnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTR-DKGVEEYLSE  528
             +S Q    +++N    AL P      P VG S      +   DW+      G++++++ 
Sbjct  459  VSSDQTALIKFNNPEPAAL-PSSMGYMPVVGGS------HFSGDWTRPNYGNGLDDFVA-  510

Query  529  EEIRLRSHEML*NEDMQHLLQLFSM  603
            +EIR+RS EML ++DMQ LL+ FSM
Sbjct  511  DEIRIRSSEMLESDDMQRLLKTFSM  535



>ref|XP_006384007.1| hypothetical protein POPTR_0004s03500g, partial [Populus trichocarpa]
 gb|ERP61804.1| hypothetical protein POPTR_0004s03500g, partial [Populus trichocarpa]
Length=399

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 56/104 (54%), Gaps = 13/104 (13%)
 Frame = +1

Query  25   KKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQPRLPAPVQS  192
            K AY+ W+   E+DGKTLL  K  +    ++N++P G  ++ NS ++Q+  P LPAP+  
Sbjct  267  KMAYDTWMHVIEHDGKTLLDLKQNQGVIASQNDVPSGHKEFLNSYDHQVTLPNLPAPLSH  326

Query  193  EPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQF  324
              S L PG       YN+ M A +S  +   + ++  Q++ T  
Sbjct  327  --SCLSPG-------YNDGMAAIFSIHTQNENLNTPFQFDATSL  361



>emb|CDY20299.1| BnaC04g36570D [Brassica napus]
Length=591

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 87/207 (42%), Gaps = 61/207 (29%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  180
            K+  D LVK AYENW    EYDGK L         N LP+ + +             LP 
Sbjct  365  KISADILVKIAYENWHKAVEYDGKLL---------NCLPVAEKEIKG----------LPE  405

Query  181  P-VQSEPSALDPGMLIGGSSYNENMGARYSNQSH---IMSSSSRMQYENTQFAPndqqql  348
            P + + P+A +   L     +N+N   R + Q H   I  S      E  QF        
Sbjct  406  PKMVTAPTAQNHQQL-----HNQN--NRQTVQCHQNAITYSPLPQPVEYPQFVQQHC---  455

Query  349  mnnsqqmqnARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTR-DKGVEEYLS  525
                                    S   P++ S+VQ  + N+ EDW   R  +G+E+  S
Sbjct  456  ------------------------SQLLPSLPSNVQ--DYNNGEDWCRPRAGQGLEDIFS  489

Query  526  EEEIRLRSHEML*NEDMQHLLQLFSMG  606
            EE IRLRS EML  +DMQ LL+ F +G
Sbjct  490  EE-IRLRSSEMLETDDMQRLLKTFGIG  515



>gb|AAA33447.1| calmodulin-binding protein, partial [Zea mays]
Length=282

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 60/222 (27%), Positives = 94/222 (42%), Gaps = 54/222 (24%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA--------RNELPMGQVDYSN----S  144
            K++ D+LVKKAY+NW+   EYDGK LL+ K KK          + L +G +DYSN    S
Sbjct  27   KLFADALVKKAYDNWMYVIEYDGKGLLNPKPKKKSASTGQVETHALRVGPLDYSNNTMSS  86

Query  145  LNNQLQQPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYS---NQSHIMSSSSRMQY--  309
            +  Q    +L   +Q   S           S + ++  R     ++ H+M+         
Sbjct  87   MACQGHHHQLELILQGMAST---------KSQHIHLSCRVHPPMSRHHMMTHFRSYHVPC  137

Query  310  -ENTQFAPndqqqlmnnsqqmqnARYDNNV-GLALGPPQSSCFPTVGSSVQQTNLNSFED  483
             +  Q  P      +  S  ++  ++      + +GP       TV  S+  T+L +F  
Sbjct  138  RQGLQMMPWVWNWAVAASNFLKARQFSQQTWDMVIGP------GTVTVSILMTSLKTFG-  190

Query  484  WSNTRDKGVEEYLSEEEIRLRSHEML*NEDMQHLLQLFSMGG  609
                               LR+  +L  EDMQ LL++FSMGG
Sbjct  191  -------------------LRATSLLEGEDMQQLLRVFSMGG  213



>ref|XP_001767931.1| predicted protein [Physcomitrella patens]
 gb|EDQ67206.1| predicted protein, partial [Physcomitrella patens]
Length=614

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 68/217 (31%), Positives = 94/217 (43%), Gaps = 33/217 (15%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA-----RNELPMGQVDYSN-------S  144
            KVYVD LVK AYENW +  EYDG+ L+  K  +A     R E P+G  + SN       S
Sbjct  334  KVYVDKLVKVAYENWENVVEYDGEALIGVKTYQAKGFDTRIEDPLGGRNISNMHPQGPGS  393

Query  145  LNNQLQQPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQF  324
            L+   +Q R+ +   +  S +     I G      M +   N    ++ SS         
Sbjct  394  LSYGQEQRRMTSRSFAGLSQMPDNHSISGPVL--QMNSSIDNHHQTVAGSSPNNLLMGGG  451

Query  325  APndqqqlmnnsqqmqnARYDNNVGLALGPPQSSC-FPTVGSSVQQT-NLNSFEDWSNTR  498
                    +   Q    A   +  GLA  PP S    P+  +  QQ  N NSF       
Sbjct  452  HTGLTGLALGPPQSSVTASRSDMTGLA--PPASMMNVPSGANDWQQLGNGNSF-------  502

Query  499  DKGVEEYLSEEEIRLRSHEML*NEDM----QHLLQLF  597
                 E ++E+E+R RS E+L NEDM    Q LL++F
Sbjct  503  ----GEDITEDELRARSMELLENEDMHTQIQQLLRMF  535



>dbj|BAJ96886.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=470

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK  99
            KVY D+LVKKAYE+W+   EYDGK LL FK KK
Sbjct  379  KVYADTLVKKAYEDWMHAVEYDGKALLGFKQKK  411



>ref|XP_002531050.1| hypothetical protein RCOM_0518120 [Ricinus communis]
 gb|EEF31343.1| hypothetical protein RCOM_0518120 [Ricinus communis]
Length=145

 Score = 36.6 bits (83),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 37/70 (53%), Gaps = 20/70 (29%)
 Frame = +1

Query  214  GMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnnsqqmqnARYDNN  393
            G+ +GG  YN++MGA +S QS +++ +S                       ++  R DN+
Sbjct  4    GLQVGG--YNDSMGAGFSAQSQLVNPNS------------------TTLTMLKGMRNDNS  43

Query  394  VGLALGPPQS  423
            VGLALGPPQS
Sbjct  44   VGLALGPPQS  53


 Score = 36.2 bits (82),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 27/52 (52%), Gaps = 4/52 (8%)
 Frame = +2

Query  449  LFSKP----ISILLRTGLTPVTRGLRNICLRRRFVSEAMKCYRMKICSTCFS  592
            LF+ P    +SILL TG T  TR L N  LR+RF SE      + I    FS
Sbjct  61   LFALPCSHLVSILLMTGPTTGTRKLMNTLLRKRFASEHGGNGAVNIPEDGFS  112



>ref|XP_001758879.1| predicted protein [Physcomitrella patens]
 gb|EDQ76385.1| predicted protein, partial [Physcomitrella patens]
Length=618

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN  108
            KVYVD LVK AYENW +  EYDG+ L+  KN +A+N
Sbjct  334  KVYVDKLVKVAYENWENVVEYDGEALIGLKNYQAKN  369



Lambda      K        H        a         alpha
   0.313    0.128    0.370    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520