BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS033B02

Length=565
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU22712.1|  hypothetical protein MIMGU_mgv1a000991mg                188   8e-52   Erythranthe guttata [common monkey flower]
ref|XP_009601552.1|  PREDICTED: SCY1-like protein 2                     187   2e-51   Nicotiana tomentosiformis
ref|XP_007019922.1|  Kinase family protein with ARM repeat domain...    186   5e-51   
ref|XP_007019921.1|  Kinase family protein with ARM repeat domain...    186   5e-51   
ref|XP_008361497.1|  PREDICTED: SCY1-like protein 2                     181   2e-50   
ref|XP_006362717.1|  PREDICTED: SCY1-like protein 2-like                184   3e-50   Solanum tuberosum [potatoes]
ref|XP_011095377.1|  PREDICTED: SCY1-like protein 2                     184   4e-50   Sesamum indicum [beniseed]
ref|XP_006441714.1|  hypothetical protein CICLE_v10018760mg             183   5e-50   Citrus clementina [clementine]
emb|CDP20126.1|  unnamed protein product                                182   2e-49   Coffea canephora [robusta coffee]
ref|XP_004250719.1|  PREDICTED: SCY1-like protein 2                     181   2e-49   Solanum lycopersicum
gb|KDP45586.1|  hypothetical protein JCGZ_17193                         181   3e-49   Jatropha curcas
ref|XP_006478453.1|  PREDICTED: SCY1-like protein 2-like                180   7e-49   Citrus sinensis [apfelsine]
gb|KHG06707.1|  SCY1-like protein 2                                     180   1e-48   Gossypium arboreum [tree cotton]
ref|XP_010112043.1|  SCY1-like protein 2                                179   1e-48   Morus notabilis
gb|EPS68984.1|  hypothetical protein M569_05783                         177   1e-48   Genlisea aurea
ref|XP_009366854.1|  PREDICTED: SCY1-like protein 2 isoform X2          178   1e-48   Pyrus x bretschneideri [bai li]
ref|XP_009366853.1|  PREDICTED: SCY1-like protein 2 isoform X1          179   2e-48   Pyrus x bretschneideri [bai li]
ref|XP_008348711.1|  PREDICTED: SCY1-like protein 2                     177   6e-48   
ref|XP_008459573.1|  PREDICTED: SCY1-like protein 2                     177   8e-48   Cucumis melo [Oriental melon]
ref|XP_010279110.1|  PREDICTED: SCY1-like protein 2 isoform X2          176   9e-48   Nelumbo nucifera [Indian lotus]
ref|XP_004290244.1|  PREDICTED: SCY1-like protein 2                     177   1e-47   Fragaria vesca subsp. vesca
gb|KJB60121.1|  hypothetical protein B456_009G290500                    177   1e-47   Gossypium raimondii
ref|XP_010279109.1|  PREDICTED: SCY1-like protein 2 isoform X1          177   1e-47   Nelumbo nucifera [Indian lotus]
ref|XP_006586743.1|  PREDICTED: SCY1-like protein 2-like isoform X2     175   2e-47   Glycine max [soybeans]
ref|XP_003534437.1|  PREDICTED: SCY1-like protein 2-like isoform X1     176   3e-47   Glycine max [soybeans]
ref|XP_010248020.1|  PREDICTED: SCY1-like protein 2                     173   4e-47   Nelumbo nucifera [Indian lotus]
ref|XP_010063716.1|  PREDICTED: SCY1-like protein 2                     175   4e-47   Eucalyptus grandis [rose gum]
ref|XP_010521095.1|  PREDICTED: SCY1-like protein 2                     175   6e-47   Tarenaya hassleriana [spider flower]
ref|XP_003540550.1|  PREDICTED: SCY1-like protein 2-like                175   6e-47   Glycine max [soybeans]
gb|KHN19409.1|  SCY1-like protein 2                                     174   7e-47   Glycine soja [wild soybean]
ref|XP_007201757.1|  hypothetical protein PRUPE_ppa001052mg             174   7e-47   Prunus persica
gb|KJB26955.1|  hypothetical protein B456_004G267700                    174   2e-46   Gossypium raimondii
ref|XP_011004854.1|  PREDICTED: SCY1-like protein 2                     174   2e-46   Populus euphratica
ref|XP_008237746.1|  PREDICTED: SCY1-like protein 2                     173   2e-46   Prunus mume [ume]
ref|XP_010534134.1|  PREDICTED: SCY1-like protein 2 isoform X3          172   5e-46   Tarenaya hassleriana [spider flower]
ref|XP_002273755.1|  PREDICTED: SCY1-like protein 2                     172   5e-46   Vitis vinifera
ref|XP_007133873.1|  hypothetical protein PHAVU_011G216200g             172   6e-46   Phaseolus vulgaris [French bean]
ref|XP_010534131.1|  PREDICTED: SCY1-like protein 2 isoform X1          172   6e-46   Tarenaya hassleriana [spider flower]
ref|XP_010534132.1|  PREDICTED: SCY1-like protein 2 isoform X2          171   7e-46   Tarenaya hassleriana [spider flower]
ref|XP_008775612.1|  PREDICTED: SCY1-like protein 2                     164   1e-45   Phoenix dactylifera
gb|KHG01693.1|  SCY1-like protein 2                                     172   1e-45   Gossypium arboreum [tree cotton]
ref|XP_003605415.1|  SCY1-like protein                                  164   2e-45   
ref|XP_002319896.2|  hypothetical protein POPTR_0013s10610g             170   2e-45   Populus trichocarpa [western balsam poplar]
ref|XP_006416147.1|  hypothetical protein EUTSA_v10006737mg             169   8e-45   Eutrema salsugineum [saltwater cress]
emb|CDY04777.1|  BnaC05g18120D                                          168   1e-44   
ref|XP_009788433.1|  PREDICTED: SCY1-like protein 2                     159   1e-44   Nicotiana sylvestris
ref|XP_009115591.1|  PREDICTED: SCY1-like protein 2                     168   1e-44   Brassica rapa
emb|CDY21396.1|  BnaA09g30310D                                          166   3e-44   Brassica napus [oilseed rape]
ref|XP_010477557.1|  PREDICTED: SCY1-like protein 2                     167   3e-44   Camelina sativa [gold-of-pleasure]
ref|XP_006306722.1|  hypothetical protein CARUB_v10008248mg             167   4e-44   Capsella rubella
ref|XP_010460052.1|  PREDICTED: SCY1-like protein 2                     167   4e-44   Camelina sativa [gold-of-pleasure]
ref|NP_173700.2|  protein kinase family protein                         167   5e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006390775.1|  hypothetical protein EUTSA_v10018097mg             166   5e-44   Eutrema salsugineum [saltwater cress]
ref|XP_009127867.1|  PREDICTED: SCY1-like protein 2                     166   7e-44   Brassica rapa
emb|CDY03692.1|  BnaA02g15450D                                          166   7e-44   
gb|KFK41573.1|  hypothetical protein AALP_AA2G146900                    166   8e-44   Arabis alpina [alpine rockcress]
gb|KFK44375.1|  hypothetical protein AALP_AA1G249300                    166   9e-44   Arabis alpina [alpine rockcress]
ref|XP_002890539.1|  kinase family protein                              166   9e-44   Arabidopsis lyrata subsp. lyrata
ref|XP_010415850.1|  PREDICTED: SCY1-like protein 2                     166   1e-43   Camelina sativa [gold-of-pleasure]
emb|CDY37942.1|  BnaC02g20690D                                          166   1e-43   Brassica napus [oilseed rape]
emb|CDX72804.1|  BnaC06g32520D                                          164   3e-43   
gb|AES87595.2|  ARM repeat kinase family protein                        164   4e-43   Medicago truncatula
ref|XP_010498773.1|  PREDICTED: SCY1-like protein 2 isoform X2          163   6e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010471155.1|  PREDICTED: SCY1-like protein 2                     163   7e-43   Camelina sativa [gold-of-pleasure]
ref|NP_177297.1|  putative protein kinase                               163   7e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010498772.1|  PREDICTED: SCY1-like protein 2 isoform X1          163   9e-43   
emb|CDX96321.1|  BnaA07g29320D                                          162   1e-42   
ref|XP_006300351.1|  hypothetical protein CARUB_v10021914mg             162   2e-42   Capsella rubella
ref|XP_004141537.1|  PREDICTED: SCY1-like protein 2-like                162   3e-42   Cucumis sativus [cucumbers]
ref|XP_002888835.1|  kinase family protein                              162   3e-42   Arabidopsis lyrata subsp. lyrata
gb|EAY74967.1|  hypothetical protein OsI_02864                          162   3e-42   Oryza sativa Indica Group [Indian rice]
ref|XP_010913247.1|  PREDICTED: SCY1-like protein 2                     161   4e-42   Elaeis guineensis
dbj|BAF01849.1|  hypothetical protein                                   161   4e-42   Arabidopsis thaliana [mouse-ear cress]
gb|EMT11865.1|  SCY1-like protein 2                                     160   6e-42   
ref|XP_009105810.1|  PREDICTED: SCY1-like protein 2                     160   7e-42   Brassica rapa
emb|CDM83285.1|  unnamed protein product                                160   8e-42   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002455952.1|  hypothetical protein SORBIDRAFT_03g027880          160   9e-42   Sorghum bicolor [broomcorn]
ref|XP_008675496.1|  PREDICTED: SCY1-like protein 2                     160   1e-41   Zea mays [maize]
ref|XP_010427973.1|  PREDICTED: SCY1-like protein 2                     160   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010677079.1|  PREDICTED: SCY1-like protein 2                     160   1e-41   Beta vulgaris subsp. vulgaris [field beet]
gb|EAZ12691.1|  hypothetical protein OsJ_02609                          159   2e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004969167.1|  PREDICTED: SCY1-like protein 2-like                159   2e-41   Setaria italica
ref|XP_003569359.1|  PREDICTED: SCY1-like protein 2                     159   3e-41   Brachypodium distachyon [annual false brome]
gb|AAB72172.1|  hypothetical protein                                    157   4e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006646100.1|  PREDICTED: SCY1-like protein 2-like                158   7e-41   Oryza brachyantha
gb|KHG23607.1|  SCY1-like protein 2                                     156   8e-41   Gossypium arboreum [tree cotton]
gb|KJB59598.1|  hypothetical protein B456_009G262900                    156   4e-40   Gossypium raimondii
ref|XP_006852429.1|  hypothetical protein AMTR_s00021p00078920          155   6e-40   Amborella trichopoda
ref|XP_009393077.1|  PREDICTED: SCY1-like protein 2                     154   2e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008654448.1|  PREDICTED: uncharacterized protein LOC100194...    154   3e-39   
emb|CDP07807.1|  unnamed protein product                                150   2e-38   Coffea canephora [robusta coffee]
ref|XP_003605398.1|  SCY1-like protein                                  151   2e-38   
gb|KDO45470.1|  hypothetical protein CISIN_1g0453201mg                  137   9e-37   Citrus sinensis [apfelsine]
gb|KDO45469.1|  hypothetical protein CISIN_1g0453204mg                  134   3e-36   Citrus sinensis [apfelsine]
ref|XP_002525488.1|  ATP binding protein, putative                      144   3e-36   
ref|XP_004164535.1|  PREDICTED: LOW QUALITY PROTEIN: SCY1-like pr...    140   9e-35   
ref|XP_002980242.1|  hypothetical protein SELMODRAFT_178166             139   2e-34   Selaginella moellendorffii
ref|XP_002963091.1|  hypothetical protein SELMODRAFT_165698             139   3e-34   Selaginella moellendorffii
ref|XP_001777004.1|  predicted protein                                  138   6e-34   
ref|XP_008358266.1|  PREDICTED: SCY1-like protein 2                     125   2e-32   
gb|EMS46807.1|  SCY1-like protein 2                                     124   4e-29   Triticum urartu
ref|XP_797681.2|  PREDICTED: LOW QUALITY PROTEIN: SCY1-like prote...  88.6    3e-26   
ref|XP_009105807.1|  PREDICTED: protein kinase domain-containing ...    103   4e-24   Brassica rapa
gb|EFX89231.1|  hypothetical protein DAPPUDRAFT_1152                  68.9    5e-24   Daphnia pulex
ref|XP_005185357.1|  PREDICTED: SCY1-like protein 2                   83.2    7e-24   Musca domestica
ref|XP_001999469.1|  GI23050                                          82.8    4e-23   Drosophila mojavensis
ref|XP_002054795.1|  GJ24635                                          82.8    6e-23   Drosophila virilis
ref|XP_002037140.1|  GM12753                                          81.3    6e-23   Drosophila sechellia
ref|NP_651655.1|  CG1951                                              81.3    6e-23   Drosophila melanogaster
ref|XP_001634807.1|  predicted protein                                77.8    6e-23   Nematostella vectensis
ref|XP_002098647.1|  GE23820                                          81.3    7e-23   Drosophila yakuba
ref|XP_002105285.1|  GD21400                                          81.3    7e-23   Drosophila simulans
ref|XP_001981409.1|  GG11631                                          81.3    9e-23   Drosophila erecta
ref|XP_001994272.1|  GH10138                                          81.6    1e-22   Drosophila grimshawi
ref|XP_001955375.1|  GF16268                                          81.3    2e-22   Drosophila ananassae
ref|XP_001358671.1|  GA15148                                          81.3    3e-22   Drosophila pseudoobscura pseudoobscura
ref|XP_002013645.1|  GL24246                                          81.3    3e-22   
ref|XP_002071981.1|  GK22563                                          80.1    8e-22   Drosophila willistoni
ref|XP_011184986.1|  PREDICTED: SCY1-like protein 2                   77.0    2e-21   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011206711.1|  PREDICTED: SCY1-like protein 2                   76.6    4e-21   Bactrocera dorsalis [papaya fruit fly]
ref|XP_004529318.1|  PREDICTED: SCY1-like protein 2-like              75.9    6e-21   
ref|XP_001662347.1|  AAEL012247-PA                                    71.2    3e-20   
ref|XP_010736936.1|  PREDICTED: SCY1-like protein 2                   68.2    5e-20   
gb|KFM58356.1|  SCY1-like protein 2                                   75.1    4e-19   Stegodyphus mimosarum
gb|KFB50851.1|  AGAP005207-PA-like protein                            75.1    1e-18   Anopheles sinensis
gb|ERG82889.1|  scy1-like protein 2                                   94.4    1e-18   
emb|CDS31865.1|  scy1 protein 2                                       63.5    1e-18   Hymenolepis microstoma
ref|XP_009061701.1|  hypothetical protein LOTGIDRAFT_127669           64.3    4e-18   Lottia gigantea
gb|KHN80443.1|  SCY1-like protein 2                                   92.8    5e-18   Toxocara canis
ref|XP_002172144.1|  SCY1 protein kinase Ppk32                        67.8    7e-18   Schizosaccharomyces japonicus yFS275
ref|XP_007384804.1|  kinase-like protein                              70.5    8e-18   Punctularia strigosozonata HHB-11173 SS5
ref|XP_003704464.1|  PREDICTED: SCY1-like protein 2-like              91.3    1e-17   
ref|XP_008192504.1|  PREDICTED: SCY1-like protein 2                   68.9    2e-17   
gb|EFZ10635.1|  hypothetical protein SINV_03385                       90.5    2e-17   
gb|EEZ99986.1|  hypothetical protein TcasGA2_TC002787                 68.6    2e-17   
ref|XP_011171073.1|  PREDICTED: SCY1-like protein 2                   90.5    2e-17   Solenopsis invicta [imported red fire ant]
emb|CDJ94235.1|  Serine threonine protein kinase-related domain c...  71.2    3e-17   Haemonchus contortus [red stomach worm]
ref|XP_011262686.1|  PREDICTED: SCY1-like protein 2                   89.7    4e-17   Camponotus floridanus
ref|XP_395903.3|  PREDICTED: SCY1-like protein 2-like                 89.7    4e-17   Apis mellifera [bee]
ref|XP_011387980.1|  hypothetical protein UMAG_10800                  63.9    4e-17   Ustilago maydis 521
dbj|GAM17573.1|  hypothetical protein SAMD00019534_007480             62.4    6e-17   Acytostelium subglobosum LB1
ref|XP_006620198.1|  PREDICTED: SCY1-like protein 2-like              88.6    9e-17   
gb|KIM87600.1|  hypothetical protein PILCRDRAFT_284654                67.0    1e-16   Piloderma croceum F 1598
gb|ETN58416.1|  hypothetical protein AND_010006                       64.3    1e-16   Anopheles darlingi [American malaria mosquito]
ref|XP_003697658.1|  PREDICTED: SCY1-like protein 2                   88.2    1e-16   Apis florea [dwarf honeybee]
gb|EYC42611.1|  hypothetical protein Y032_0525g2930                   72.8    2e-16   Ancylostoma ceylanicum
gb|EYC42610.1|  hypothetical protein Y032_0525g2930                   73.2    2e-16   Ancylostoma ceylanicum
gb|EYC42609.1|  hypothetical protein Y032_0525g2930                   73.2    2e-16   Ancylostoma ceylanicum
gb|EYC42608.1|  hypothetical protein Y032_0525g2930                   73.2    2e-16   Ancylostoma ceylanicum
gb|EJD75769.1|  SCY1 protein kinase                                   78.2    2e-16   Loa loa
gb|KDQ33764.1|  hypothetical protein PLEOSDRAFT_1073929               63.5    2e-16   Pleurotus ostreatus PC15
ref|XP_009763333.1|  PREDICTED: SCY1-like protein 2                   87.0    3e-16   Nicotiana sylvestris
gb|KFB53079.1|  AGAP002142-PA-like protein                            62.0    3e-16   Anopheles sinensis
ref|XP_007920708.1|  hypothetical protein MYCFIDRAFT_114886           77.0    3e-16   Pseudocercospora fijiensis CIRAD86
gb|KFM57018.1|  SCY1-like protein 2                                   87.0    3e-16   Stegodyphus mimosarum
gb|KHJ93653.1|  hypothetical protein OESDEN_06432                     74.7    5e-16   Oesophagostomum dentatum [nodule worm]
ref|NP_491915.2|  Protein ZC581.9                                     67.8    6e-16   Caenorhabditis elegans [roundworm]
ref|XP_960288.1|  protein kinase domain-containing protein ppk32      73.6    6e-16   Neurospora crassa OR74A
gb|EGZ68505.1|  hypothetical protein NEUTE2DRAFT_160848               73.6    6e-16   Neurospora tetrasperma FGSC 2509
ref|XP_009854070.1|  hypothetical protein NEUTE1DRAFT_124407          73.6    6e-16   Neurospora tetrasperma FGSC 2508
emb|CCG81569.1|  putative Protein kinase Scy1                         64.7    6e-16   Taphrina deformans PYCC 5710
ref|XP_003493344.1|  PREDICTED: SCY1-like protein 2-like              85.9    7e-16   Bombus impatiens
ref|XP_003385265.2|  PREDICTED: SCY1-like protein 2                   85.9    9e-16   Amphimedon queenslandica
gb|KHN71737.1|  SCY1-like protein 2                                   68.6    1e-15   Toxocara canis
ref|XP_011172314.1|  PREDICTED: SCY1-like protein 2                   68.9    1e-15   
ref|XP_002603632.1|  hypothetical protein BRAFLDRAFT_101363           85.5    1e-15   Branchiostoma floridae
ref|XP_011065985.1|  PREDICTED: SCY1-like protein 2                   85.1    1e-15   Acromyrmex echinatior
ref|XP_003353074.1|  hypothetical protein SMAC_03392                  72.0    1e-15   Sordaria macrospora k-hell
gb|KIJ44257.1|  hypothetical protein M422DRAFT_228299                 62.8    1e-15   Sphaerobolus stellatus SS14
gb|EMG47746.1|  hypothetical protein G210_1797                        71.2    1e-15   Candida maltosa Xu316
gb|EJT98337.1|  hypothetical protein DACRYDRAFT_57369                 70.5    2e-15   Dacryopinax primogenitus
gb|EGT38777.1|  hypothetical protein CAEBREN_20632                    70.1    2e-15   Caenorhabditis brenneri
gb|EGT41199.1|  hypothetical protein CAEBREN_06528                    70.1    2e-15   Caenorhabditis brenneri
ref|XP_011298914.1|  PREDICTED: SCY1-like protein 2                   84.7    2e-15   Fopius arisanus
ref|XP_007863336.1|  kinase-like protein                              64.3    2e-15   Gloeophyllum trabeum ATCC 11539
ref|XP_011152169.1|  PREDICTED: SCY1-like protein 2                   84.7    2e-15   Harpegnathos saltator
emb|CDR45825.1|  CYFA0S20e00584g1_1                                   72.0    2e-15   Cyberlindnera fabianii
gb|EPY54134.1|  SCY1 protein kinase Ppk32                             67.4    2e-15   Schizosaccharomyces cryophilus OY26
ref|XP_003293479.1|  hypothetical protein DICPUDRAFT_158338           64.3    3e-15   Dictyostelium purpureum
gb|KFH73263.1|  SCY1 protein kinase                                   84.3    3e-15   Mortierella verticillata NRRL 6337
gb|EUN25037.1|  hypothetical protein COCVIDRAFT_28319                 69.3    4e-15   Bipolaris victoriae FI3
ref|XP_011332287.1|  PREDICTED: SCY1-like protein 2                   84.0    4e-15   
gb|EPX74501.1|  SCY1 protein kinase Ppk32                             63.9    4e-15   Schizosaccharomyces octosporus yFS286
ref|XP_002640193.1|  Hypothetical protein CBG12696                    67.0    4e-15   Caenorhabditis briggsae
gb|KHC83256.1|  hypothetical protein W5Q_00468                        65.5    4e-15   Candida albicans SC5314
ref|XP_007372470.1|  hypothetical protein SPAPADRAFT_48109            73.6    4e-15   Spathaspora passalidarum NRRL Y-27907
gb|KGU19499.1|  hypothetical protein MEY_00470                        65.5    4e-15   Candida albicans 19F
gb|KGR23532.1|  hypothetical protein MG9_00467                        65.5    4e-15   Candida albicans P37037
gb|KGR21506.1|  hypothetical protein MG3_00509                        65.5    4e-15   Candida albicans P78048
gb|KGU14816.1|  hypothetical protein MEQ_00460                        65.5    4e-15   Candida albicans P87
gb|KGT72667.1|  hypothetical protein MEK_00472                        65.5    4e-15   Candida albicans 12C
gb|EEQ42696.1|  conserved hypothetical protein                        65.5    4e-15   Candida albicans WO-1
gb|KGU33852.1|  hypothetical protein MG7_00458                        65.5    4e-15   Candida albicans P34048
gb|KHC48991.1|  hypothetical protein W5O_00472                        65.5    4e-15   Candida albicans Ca6
gb|KGU18727.1|  hypothetical protein MEM_00474                        65.5    4e-15   Candida albicans L26
ref|XP_003114607.1|  hypothetical protein CRE_28224                   68.6    5e-15   Caenorhabditis remanei
gb|KHC85073.1|  hypothetical protein MGS_00466                        65.1    5e-15   Candida albicans P78042
gb|KHC57438.1|  hypothetical protein MEW_00470                        65.1    5e-15   Candida albicans P60002
gb|KGQ91742.1|  hypothetical protein MEO_00466                        65.1    5e-15   Candida albicans P94015
gb|KGQ98869.1|  hypothetical protein MEU_00465                        65.5    5e-15   Candida albicans P37005
gb|KGR03685.1|  hypothetical protein MG1_00467                        65.5    5e-15   Candida albicans GC75
gb|KGR15606.1|  hypothetical protein MG5_00459                        65.1    5e-15   Candida albicans P57072
gb|KHC75891.1|  hypothetical protein MGI_00461                        65.5    5e-15   Candida albicans P75016
gb|KGU36063.1|  hypothetical protein MGM_00462                        65.5    5e-15   Candida albicans P75063
ref|XP_002417122.1|  protein kinase, putative                         65.1    5e-15   Candida dubliniensis CD36
ref|XP_007338830.1|  kinase-like protein                              69.7    5e-15   
ref|XP_003336080.2|  SCY1 protein kinase                              65.1    7e-15   Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_008548320.1|  PREDICTED: SCY1-like protein 2                   82.8    9e-15   Microplitis demolitor
ref|XP_002591089.1|  hypothetical protein BRAFLDRAFT_119065           82.8    9e-15   Branchiostoma floridae
ref|XP_003402082.1|  PREDICTED: SCY1-like protein 2-like              82.4    1e-14   Bombus terrestris [large earth bumblebee]
ref|XP_006686133.1|  kinase-like protein                              69.7    1e-14   Yamadazyma tenuis ATCC 10573
ref|XP_646778.1|  SCY1 family protein kinase                          60.5    2e-14   Dictyostelium discoideum AX4
gb|ERL86428.1|  hypothetical protein D910_03835                       80.5    2e-14   Dendroctonus ponderosae
ref|XP_011497019.1|  PREDICTED: SCY1-like protein 2                   81.3    2e-14   Ceratosolen solmsi marchali
ref|XP_009013981.1|  hypothetical protein HELRODRAFT_190932           54.7    3e-14   Helobdella robusta
gb|EQL01093.1|  protein kinase domain-containing protein ppk32        80.9    3e-14   Ophiocordyceps sinensis CO18
gb|KJB60123.1|  hypothetical protein B456_009G290500                  80.9    3e-14   Gossypium raimondii
ref|XP_503708.2|  YALI0E08866p                                        65.5    3e-14   Yarrowia lipolytica CLIB122
ref|XP_004361630.1|  SCY1 family protein kinase                       58.2    3e-14   Cavenderia fasciculata
ref|XP_002550183.1|  conserved hypothetical protein                   68.2    3e-14   Candida tropicalis MYA-3404
gb|AJR81481.1|  Scy1p                                                 72.8    4e-14   Saccharomyces cerevisiae YJM451
ref|XP_011103446.1|  scy1p                                            72.4    4e-14   
ref|XP_007764881.1|  kinase-like protein                              66.2    4e-14   Coniophora puteana RWD-64-598 SS2
ref|XP_003664227.1|  hypothetical protein MYCTH_116348                69.3    5e-14   Thermothelomyces thermophila ATCC 42464
emb|CCD49499.1|  hypothetical protein BofuT4_P100090.1                71.2    5e-14   Botrytis cinerea T4
ref|XP_001546912.1|  hypothetical protein BC1G_14726                  70.9    6e-14   Botrytis cinerea B05.10
gb|EDK41031.2|  hypothetical protein PGUG_05129                       80.1    6e-14   Meyerozyma guilliermondii ATCC 6260
ref|XP_005991381.1|  PREDICTED: LOW QUALITY PROTEIN: SCY1-like pr...  72.8    7e-14   
gb|EJW76801.1|  other/SCY1 protein kinase                             79.0    8e-14   Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_308053.4|  AGAP002142-PA                                       53.5    9e-14   Anopheles gambiae str. PEST
ref|XP_011399866.1|  SCY1-like protein 2                              70.1    9e-14   Auxenochlorella protothecoides
ref|XP_007837082.1|  hypothetical protein PFICI_10310                 71.6    1e-13   Pestalotiopsis fici W106-1
gb|AJS02698.1|  Scy1p                                                 71.2    1e-13   Saccharomyces cerevisiae YJM1447
emb|CCU82686.1|  protein kinase Scy1                                  65.5    1e-13   Blumeria graminis f. sp. hordei DH14
emb|CDQ03616.1|  Protein Bm9111, isoform b                            79.3    1e-13   
ref|XP_458583.2|  DEHA2D02640p                                        79.3    1e-13   Debaryomyces hansenii CBS767
gb|KEF56467.1|  SCY1 protein kinase                                   64.7    1e-13   Exophiala aquamarina CBS 119918
gb|ELU10963.1|  hypothetical protein CAPTEDRAFT_109432                79.3    1e-13   Capitella teleta
ref|XP_003143373.1|  SCY1 protein kinase                              79.3    1e-13   Loa loa
gb|KIX94417.1|  hypothetical protein Z520_09803                       65.9    1e-13   Fonsecaea multimorphosa CBS 102226
gb|AJR99248.1|  Scy1p                                                 70.5    2e-13   Saccharomyces cerevisiae YJM1418
ref|XP_002498357.1|  ZYRO0G08316p                                     62.0    2e-13   Zygosaccharomyces rouxii
gb|EDV10307.1|  protein SCY1                                          70.5    2e-13   Saccharomyces cerevisiae RM11-1a
emb|CDQ05208.1|  Protein Bm7414, isoform a                            68.9    2e-13   Brugia malayi [agent of lymphatic filariasis]
gb|AJS29195.1|  Scy1p                                                 70.5    2e-13   Saccharomyces cerevisiae YJM1401
gb|AJR83965.1|  Scy1p                                                 70.5    2e-13   Saccharomyces cerevisiae YJM554
gb|ACX93858.1|  Scy1-like 2                                           75.1    2e-13   Heliconius melpomene aglaope
gb|EDN62034.1|  conserved protein                                     70.5    2e-13   Saccharomyces cerevisiae YJM789
gb|AJR97253.1|  Scy1p                                                 70.5    2e-13   Saccharomyces cerevisiae YJM1250
gb|AJR84465.1|  Scy1p                                                 70.5    2e-13   Saccharomyces cerevisiae YJM555
gb|AJR78520.1|  Scy1p                                                 70.5    2e-13   Saccharomyces cerevisiae YJM270
gb|EDZ72203.1|  YGL083Wp-like protein                                 70.5    2e-13   Saccharomyces cerevisiae AWRI1631
gb|AJR76535.1|  Scy1p                                                 70.5    2e-13   Saccharomyces cerevisiae YJM193
gb|AJR76034.1|  Scy1p                                                 70.5    2e-13   Saccharomyces cerevisiae YJM189
ref|NP_011432.1|  Scy1p                                               70.5    2e-13   Saccharomyces cerevisiae S288C
dbj|GAA23309.1|  K7_Scy1p                                             70.5    2e-13   Saccharomyces cerevisiae Kyokai no. 7
gb|AJS28211.1|  Scy1p                                                 70.5    2e-13   Saccharomyces cerevisiae YJM1399
gb|AJS23253.1|  Scy1p                                                 70.5    2e-13   Saccharomyces cerevisiae YJM1342
gb|AJS27226.1|  Scy1p                                                 70.5    2e-13   Saccharomyces cerevisiae YJM1388
gb|AJR77032.1|  Scy1p                                                 70.5    2e-13   Saccharomyces cerevisiae YJM195
gb|AJS23750.1|  Scy1p                                                 70.5    2e-13   Saccharomyces cerevisiae YJM1355
gb|AJR84969.1|  Scy1p                                                 70.5    2e-13   Saccharomyces cerevisiae YJM627
emb|CDQ05207.1|  Protein Bm7414, isoform e                            68.6    2e-13   Brugia malayi [agent of lymphatic filariasis]
gb|AJS25247.1|  Scy1p                                                 70.5    2e-13   Saccharomyces cerevisiae YJM1383
gb|ACX93879.1|  Scy1-like 2                                           75.1    2e-13   Heliconius melpomene amaryllis
gb|EGA86947.1|  Scy1p                                                 70.5    2e-13   Saccharomyces cerevisiae VL3
ref|XP_001867759.1|  kinase domain-containing protein ppk32           76.6    2e-13   Culex quinquefasciatus
ref|XP_003177818.1|  SCY1 protein kinase                              78.6    2e-13   Nannizzia gypsea CBS 118893
gb|EFA80937.1|  SCY1 family protein kinase                            52.4    2e-13   Heterostelium album PN500
gb|ACX93852.1|  Scy1-like 2                                           74.7    3e-13   Heliconius melpomene aglaope
gb|ACX93851.1|  Scy1-like 2                                           74.7    3e-13   Heliconius melpomene aglaope
gb|EWC44334.1|  hypothetical protein DRE_01160                        57.8    3e-13   Drechslerella stenobrocha 248
gb|ACX93840.1|  Scy1-like 2                                           74.3    3e-13   Heliconius melpomene aglaope
gb|ADI82353.1|  Scy1 protein                                          75.1    3e-13   Heliconius cydno cordula
gb|ADI82335.1|  Scy1 protein                                          75.1    3e-13   Heliconius cydno cordula
gb|ADI82303.1|  Scy1 protein                                          74.7    3e-13   Heliconius melpomene melpomene
ref|XP_002424055.1|  conserved hypothetical protein                   77.8    3e-13   Pediculus humanus corporis [human body lice]
gb|ADI82313.1|  Scy1 protein                                          74.7    3e-13   Heliconius melpomene melpomene
gb|ACX93896.1|  Scy1-like 2                                           74.3    4e-13   Heliconius melpomene amaryllis
gb|ACX93841.1|  Scy1-like 2                                           73.9    4e-13   
gb|ADI82294.1|  Scy1 protein                                          74.7    4e-13   
gb|ACX93861.1|  Scy1-like 2                                           73.9    4e-13   
gb|ADI82295.1|  Scy1 protein                                          74.7    4e-13   
ref|XP_010885695.1|  PREDICTED: SCY1-like protein 2 isoform X1        77.8    5e-13   
ref|XP_010885696.1|  PREDICTED: SCY1-like protein 2 isoform X2        77.4    5e-13   
gb|ADI82315.1|  Scy1 protein                                          73.9    8e-13   
emb|CDF87877.1|  BN860_16512g1_1                                      62.8    8e-13   
gb|ADI82349.1|  Scy1 protein                                          73.6    9e-13   
ref|XP_001483174.1|  hypothetical protein PGUG_05129                  76.6    9e-13   
ref|XP_003956345.1|  hypothetical protein KAFR_0C02170                68.2    1e-12   
gb|EJW76735.1|  hypothetical protein WUBG_12355                       72.0    1e-12   
ref|XP_008599580.1|  clathrin-coated vesicle protein                  76.3    1e-12   
ref|XP_001655979.1|  AAEL012374-PA                                    75.9    2e-12   
ref|XP_003682732.1|  hypothetical protein TDEL_0G01540                67.8    2e-12   
gb|KGQ04473.1|  Protein kinase domain-containing protein ppk32        75.9    2e-12   
gb|ETN65010.1|  hypothetical protein AND_003228                       74.7    2e-12   
ref|XP_009648819.1|  protein kinase domain-containing protein ppk32   75.9    2e-12   
ref|XP_003676311.1|  hypothetical protein NCAS_0D03690                67.4    2e-12   
ref|XP_002772353.1|  hypothetical protein Pmar_PMAR019586             60.5    2e-12   
gb|ETN77431.1|  hypothetical protein NECAME_11059                     72.8    2e-12   
ref|XP_006050173.1|  PREDICTED: SCY1-like protein 2 isoform X4        75.5    3e-12   
emb|CEJ91703.1|  Putative Clathrin-coated vesicle protein             75.5    3e-12   
ref|XP_006050172.1|  PREDICTED: SCY1-like protein 2 isoform X3        75.5    3e-12   
ref|XP_006050170.1|  PREDICTED: SCY1-like protein 2 isoform X1        75.5    3e-12   
ref|XP_003141892.1|  SCY1 protein kinase                              75.1    3e-12   
gb|EGD98700.1|  SCY1 protein kinase                                   75.1    3e-12   
ref|XP_004589681.1|  PREDICTED: SCY1-like protein 2                   75.1    3e-12   
gb|EZF32859.1|  SCY1 protein kinase                                   75.1    3e-12   
ref|XP_314106.3|  AGAP005207-PA                                       75.1    3e-12   
ref|XP_010309597.1|  PREDICTED: SCY1-like protein 2                   72.8    3e-12   
gb|KJE97470.1|  SCY1 protein kinase                                   74.7    3e-12   
ref|XP_001647272.1|  hypothetical protein Kpol_1002p61                65.9    3e-12   
gb|EHN02438.1|  Scy1p                                                 65.9    3e-12   
emb|CEF68130.1|  SCY1-like protein 2                                  75.1    3e-12   
gb|EJT43120.1|  SCY1-like protein                                     66.2    3e-12   
ref|XP_005097980.1|  PREDICTED: SCY1-like protein 2-like              74.7    4e-12   
ref|XP_007293987.1|  protein kinase domain-containing protein ppk32   65.5    4e-12   
ref|XP_003020484.1|  hypothetical protein TRV_05415                   74.7    4e-12   
ref|XP_003011149.1|  hypothetical protein ARB_02671                   74.7    4e-12   
ref|XP_001892158.1|  Protein kinase domain containing protein         74.3    4e-12   
gb|KIN02093.1|  hypothetical protein OIDMADRAFT_103325                63.9    5e-12   
ref|XP_006816046.1|  PREDICTED: LOW QUALITY PROTEIN: SCY1-like pr...  74.7    5e-12   
ref|XP_007809049.1|  protein kinase domain-containing protein ppk32   74.7    5e-12   
emb|CAY54151.1|  unnamed protein product                              74.3    5e-12   
gb|AGC92739.1|  SCY1-like protein 2                                   74.3    5e-12   
ref|XP_008255168.1|  PREDICTED: SCY1-like protein 2                   74.3    6e-12   
emb|CAH92591.1|  hypothetical protein                                 72.4    6e-12   
ref|XP_003709285.1|  SCY1 protein kinase                              74.3    6e-12   
ref|XP_010174079.1|  PREDICTED: SCY1-like protein 2                   73.6    6e-12   
ref|XP_002435761.1|  conserved hypothetical protein                   63.9    6e-12   
gb|EZF22188.1|  SCY1 protein kinase                                   73.6    6e-12   
gb|EZG00689.1|  SCY1 protein kinase                                   73.6    7e-12   
gb|KFO30307.1|  SCY1-like protein 2                                   74.3    7e-12   
ref|XP_011441145.1|  PREDICTED: SCY1-like protein 2                   73.9    7e-12   
ref|XP_004178865.1|  hypothetical protein TBLA_0B05130                67.0    7e-12   
ref|XP_969159.1|  PREDICTED: SCY1-like protein 2                      73.9    7e-12   
ref|XP_004343184.2|  hypothetical protein CAOG_07325                  73.9    7e-12   
ref|XP_002127212.1|  PREDICTED: SCY1-like protein 2                   73.9    7e-12   
ref|XP_009043653.1|  hypothetical protein LOTGIDRAFT_151904           73.6    7e-12   
ref|XP_009964074.1|  PREDICTED: SCY1-like protein 2                   72.8    7e-12   
gb|KFA77164.1|  hypothetical protein S40288_08370                     73.9    8e-12   
gb|AGO13090.1|  AaceriAFL068Cp                                        64.7    8e-12   
ref|XP_009707520.1|  PREDICTED: SCY1-like protein 2                   73.2    8e-12   
gb|KFP55960.1|  SCY1-like 2                                           73.2    8e-12   
gb|EMF16604.1|  ARM repeat-containing protein                         73.9    8e-12   
ref|NP_595822.1|  serine/threonine protein kinase Ppk32 (predicted)   73.6    8e-12   
gb|ESA04363.1|  hypothetical protein GLOINDRAFT_336297                73.9    8e-12   
ref|XP_002851233.1|  clathrin-coated vesicle protein                  73.9    8e-12   
dbj|GAM82353.1|  hypothetical protein ANO11243_003320                 73.9    8e-12   
ref|XP_009462223.1|  PREDICTED: SCY1-like protein 2                   73.6    9e-12   
gb|KDO33300.1|  SCY1 protein kinase                                   73.6    9e-12   
gb|KEZ46478.1|  Protein kinase domain-containing protein ppk32        73.9    9e-12   
gb|KFV94012.1|  SCY1-like 2                                           73.6    9e-12   
gb|EAW97634.1|  SCY1-like 2 (S. cerevisiae), isoform CRA_e            73.6    9e-12   
emb|CEF63111.1|  Novel protein                                        73.6    9e-12   
ref|XP_010707737.1|  PREDICTED: SCY1-like protein 2                   73.6    9e-12   
ref|XP_008634762.1|  PREDICTED: SCY1-like protein 2                   73.6    9e-12   
ref|XP_009977654.1|  PREDICTED: SCY1-like protein 2                   73.6    9e-12   
gb|KFP57305.1|  SCY1-like 2                                           73.6    9e-12   
ref|XP_009067504.1|  PREDICTED: SCY1-like protein 2                   73.6    9e-12   
gb|KFQ89482.1|  SCY1-like 2                                           73.6    9e-12   
gb|EAW97636.1|  SCY1-like 2 (S. cerevisiae), isoform CRA_g            73.2    9e-12   
gb|KFQ58380.1|  SCY1-like 2                                           73.6    9e-12   
ref|XP_008504133.1|  PREDICTED: SCY1-like protein 2 isoform X2        73.6    9e-12   
ref|XP_005144396.1|  PREDICTED: SCY1-like protein 2                   73.6    9e-12   
gb|KGL80009.1|  SCY1-like 2                                           73.6    9e-12   
ref|XP_010409067.1|  PREDICTED: SCY1-like protein 2 isoform X3        73.6    9e-12   
ref|XP_008944505.1|  PREDICTED: SCY1-like protein 2                   73.6    1e-11   
ref|XP_005480773.1|  PREDICTED: SCY1-like protein 2                   73.6    1e-11   
ref|XP_009938424.1|  PREDICTED: SCY1-like protein 2                   73.6    1e-11   
ref|XP_010147034.1|  PREDICTED: SCY1-like protein 2                   73.6    1e-11   
ref|XP_008918486.1|  PREDICTED: SCY1-like protein 2                   73.6    1e-11   
ref|XP_010409065.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.6    1e-11   
gb|KFW89611.1|  SCY1-like 2                                           73.6    1e-11   
ref|XP_009282444.1|  PREDICTED: SCY1-like protein 2                   73.6    1e-11   
ref|XP_009491643.1|  PREDICTED: LOW QUALITY PROTEIN: SCY1-like pr...  73.6    1e-11   
gb|KFV15505.1|  SCY1-like 2                                           73.6    1e-11   
ref|XP_009927953.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.6    1e-11   
ref|XP_005519513.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.6    1e-11   
gb|EXX68419.1|  Scy1p                                                 73.2    1e-11   
ref|XP_009643885.1|  PREDICTED: SCY1-like protein 2                   73.6    1e-11   
ref|XP_010082046.1|  PREDICTED: SCY1-like protein 2                   73.6    1e-11   
ref|XP_002191378.1|  PREDICTED: SCY1-like protein 2 isoform 1         73.6    1e-11   
ref|XP_009880880.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.6    1e-11   
gb|KFQ00575.1|  SCY1-like 2                                           73.2    1e-11   
ref|XP_009319572.1|  PREDICTED: SCY1-like protein 2                   73.6    1e-11   
ref|XP_009569850.1|  PREDICTED: SCY1-like protein 2                   73.6    1e-11   
ref|XP_008504132.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.6    1e-11   
ref|XP_009896784.1|  PREDICTED: SCY1-like protein 2                   73.6    1e-11   
ref|XP_009500370.1|  PREDICTED: LOW QUALITY PROTEIN: SCY1-like pr...  73.6    1e-11   
ref|XP_005421671.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.6    1e-11   
ref|XP_009874950.1|  PREDICTED: SCY1-like protein 2                   73.6    1e-11   
ref|XP_006669900.1|  protein kinase domain-containing protein ppk32   73.6    1e-11   
ref|XP_009955076.1|  PREDICTED: SCY1-like protein 2                   72.8    1e-11   
ref|XP_010284684.1|  PREDICTED: SCY1-like protein 2                   73.6    1e-11   
ref|XP_001387470.2|  Suppressor of GTPase mutant                      73.6    1e-11   
ref|XP_009084885.1|  PREDICTED: SCY1-like protein 2                   73.6    1e-11   
ref|XP_003235558.1|  SCY1 protein kinase                              73.6    1e-11   
ref|XP_008590886.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.6    1e-11   
gb|KFQ43472.1|  SCY1-like 2                                           73.2    1e-11   
gb|KFA53157.1|  hypothetical protein S40293_03135                     73.6    1e-11   
gb|KEY69150.1|  hypothetical protein S7711_04933                      73.6    1e-11   
gb|EAW97630.1|  SCY1-like 2 (S. cerevisiae), isoform CRA_a            72.8    1e-11   
gb|KFV45627.1|  SCY1-like 2                                           73.2    1e-11   
ref|XP_008590888.1|  PREDICTED: SCY1-like protein 2 isoform X3        73.2    1e-11   
dbj|BAG72436.1|  SCY1-like 2                                          73.2    1e-11   
ref|XP_008590887.1|  PREDICTED: SCY1-like protein 2 isoform X2        73.2    1e-11   
ref|XP_006719560.1|  PREDICTED: SCY1-like protein 2 isoform X3        73.2    1e-11   
dbj|BAA92598.1|  KIAA1360 protein                                     73.2    1e-11   
ref|XP_005242731.1|  PREDICTED: SCY1-like protein 2                   73.2    1e-11   
ref|XP_011489472.1|  PREDICTED: SCY1-like protein 2 isoform X2        73.2    1e-11   
ref|XP_008313756.1|  PREDICTED: SCY1-like protein 2 isoform X3        73.2    1e-11   
ref|XP_008313755.1|  PREDICTED: SCY1-like protein 2 isoform X2        73.2    1e-11   
ref|XP_008313753.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.2    1e-11   
ref|XP_005956561.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.2    1e-11   
gb|KFA63699.1|  hypothetical protein S40285_08497                     73.2    1e-11   
ref|XP_005956563.1|  PREDICTED: SCY1-like protein 2 isoform X3        73.2    1e-11   
gb|KDN48714.1|  hypothetical protein RSAG8_02701                      73.2    1e-11   
ref|XP_005024592.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.2    1e-11   
gb|KFP40373.1|  SCY1-like 2                                           73.2    1e-11   
ref|XP_005024593.1|  PREDICTED: SCY1-like protein 2 isoform X2        73.2    1e-11   
ref|XP_011489471.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.2    1e-11   
ref|XP_004469270.1|  PREDICTED: SCY1-like protein 2 isoform 1         73.2    1e-11   
ref|XP_004469271.1|  PREDICTED: SCY1-like protein 2 isoform 2         73.2    1e-11   
ref|XP_010208812.1|  PREDICTED: SCY1-like protein 2                   73.2    1e-11   
ref|XP_003783366.1|  PREDICTED: SCY1-like protein 2                   73.2    1e-11   
ref|XP_011384924.1|  PREDICTED: SCY1-like protein 2 isoform X2        73.2    1e-11   
ref|XP_005444100.1|  PREDICTED: SCY1-like protein 2                   73.2    1e-11   
gb|EAW97631.1|  SCY1-like 2 (S. cerevisiae), isoform CRA_b            72.4    1e-11   
ref|XP_001603554.1|  PREDICTED: SCY1-like protein 2                   73.2    1e-11   
ref|XP_004623885.1|  PREDICTED: SCY1-like protein 2                   73.2    2e-11   
ref|XP_004650608.1|  PREDICTED: SCY1-like protein 2                   72.8    2e-11   
ref|XP_004890463.1|  PREDICTED: SCY1-like protein 2 isoform X3        72.8    2e-11   
ref|XP_005651406.1|  hypothetical protein COCSUDRAFT_39838            72.8    2e-11   
ref|XP_010629690.1|  PREDICTED: SCY1-like protein 2 isoform X2        72.8    2e-11   
ref|XP_009997331.1|  PREDICTED: SCY1-like protein 2 isoform X1        72.8    2e-11   
ref|XP_001526967.1|  conserved hypothetical protein                   72.8    2e-11   
ref|XP_010629688.1|  PREDICTED: SCY1-like protein 2 isoform X1        72.8    2e-11   
emb|CCO29648.1|  SCY1-like protein 2 AltName: Full=Coated vesicle...  72.8    2e-11   
ref|XP_004890461.1|  PREDICTED: SCY1-like protein 2 isoform X1        72.8    2e-11   
ref|XP_005374586.1|  PREDICTED: SCY1-like protein 2 isoform X1        72.8    2e-11   
ref|XP_003126739.3|  PREDICTED: SCY1-like protein 2                   72.8    2e-11   
ref|XP_008556194.1|  PREDICTED: SCY1-like protein 2                   72.8    2e-11   
ref|XP_004845135.1|  PREDICTED: SCY1-like protein 2                   72.8    2e-11   
gb|KFH73262.1|  SCY1 protein kinase, variant                          72.8    2e-11   
ref|XP_009675888.1|  PREDICTED: SCY1-like protein 2 isoform X3        72.8    2e-11   
gb|KFV82709.1|  SCY1-like 2                                           72.8    2e-11   
ref|XP_008615114.1|  SCY1 protein kinase                              72.8    2e-11   
ref|XP_009675886.1|  PREDICTED: SCY1-like protein 2 isoform X1        72.8    2e-11   
ref|XP_002780074.1|  conserved hypothetical protein                   59.7    2e-11   
ref|XP_009675887.1|  PREDICTED: SCY1-like protein 2 isoform X2        72.8    2e-11   
gb|EHJ67834.1|  hypothetical protein KGM_02565                        62.4    2e-11   
ref|XP_011264551.1|  PREDICTED: SCY1-like protein 2 isoform X2        72.4    2e-11   
emb|CEL55653.1|  SCY1-like protein 2 OS=Homo sapiens GN=SCYL2 PE=...  72.4    2e-11   
ref|XP_010795535.1|  PREDICTED: SCY1-like protein 2 isoform X1        72.4    2e-11   
ref|XP_011264550.1|  PREDICTED: SCY1-like protein 2 isoform X1        72.4    2e-11   
ref|XP_005499807.1|  PREDICTED: SCY1-like protein 2                   72.4    2e-11   
gb|EFN62650.1|  SCY1-like protein 2                                   72.4    2e-11   
gb|KJA27330.1|  hypothetical protein HYPSUDRAFT_35179                 72.4    2e-11   
emb|CCK70877.1|  hypothetical protein KNAG_0F02100                    63.5    2e-11   
ref|XP_004743009.1|  PREDICTED: SCY1-like protein 2 isoform X2        72.4    2e-11   
ref|XP_010795536.1|  PREDICTED: SCY1-like protein 2 isoform X2        72.4    2e-11   
ref|XP_004787252.1|  PREDICTED: SCY1-like protein 2 isoform X1        72.4    3e-11   
ref|XP_004743008.1|  PREDICTED: SCY1-like protein 2 isoform X1        72.4    3e-11   
ref|XP_001365162.1|  PREDICTED: SCY1-like protein 2 isoform X1        72.4    3e-11   
ref|XP_007503328.1|  PREDICTED: SCY1-like protein 2 isoform X2        72.4    3e-11   
ref|XP_003771110.1|  PREDICTED: SCY1-like protein 2                   72.4    3e-11   
gb|EWY95759.1|  SCY1 protein kinase                                   72.4    3e-11   
gb|EXM02943.1|  SCY1 protein kinase                                   72.4    3e-11   
gb|KHN99123.1|  protein kinase domain-containing protein ppk32        72.4    3e-11   
gb|EXA00462.1|  SCY1 protein kinase                                   72.4    3e-11   
tpg|DAA29574.1|  TPA: SCY1-like 2                                     72.4    3e-11   
ref|NP_001095999.1|  SCY1-like protein 2                              72.4    3e-11   
gb|EWG42138.1|  SCY1 protein kinase                                   72.4    3e-11   
ref|XP_005039618.1|  PREDICTED: SCY1-like protein 2                   72.0    3e-11   
ref|XP_004006699.1|  PREDICTED: SCY1-like protein 2                   72.0    3e-11   
gb|EXK94392.1|  SCY1 protein kinase                                   72.0    3e-11   
gb|EKC28718.1|  SCY1-like protein 2                                   71.6    3e-11   
gb|EXM31937.1|  SCY1 protein kinase                                   72.0    3e-11   
gb|EXK35576.1|  SCY1 protein kinase                                   72.0    3e-11   
gb|EWZ42440.1|  SCY1 protein kinase                                   72.0    3e-11   
gb|EXA47291.1|  SCY1 protein kinase                                   72.0    3e-11   
ref|XP_007503329.1|  PREDICTED: SCY1-like protein 2 isoform X3        72.0    3e-11   
emb|CBK25058.2|  unnamed protein product                              70.9    3e-11   
ref|XP_007818288.1|  protein kinase domain-containing protein ppk32   72.0    3e-11   
gb|EXV05717.1|  protein kinase                                        72.0    3e-11   
ref|NP_985480.1|  AFL068Cp                                            64.7    3e-11   
gb|KFG85027.1|  protein kinase domain-containing protein ppk32        72.0    3e-11   
gb|KIW53486.1|  hypothetical protein PV05_09057                       72.0    3e-11   
ref|XP_011416932.1|  PREDICTED: SCY1-like protein 2                   71.6    3e-11   
ref|XP_006888580.1|  PREDICTED: SCY1-like protein 2                   72.0    3e-11   
ref|XP_004930703.1|  PREDICTED: SCY1-like protein 2-like              72.0    3e-11   
emb|CDQ83779.1|  unnamed protein product                              70.1    4e-11   
ref|XP_007672188.1|  hypothetical protein BAUCODRAFT_41841            71.6    4e-11   
ref|XP_007536708.1|  PREDICTED: SCY1-like protein 2                   72.0    4e-11   
gb|KID77949.1|  protein kinase domain-containing protein ppk32        72.0    4e-11   
ref|XP_010829895.1|  PREDICTED: SCY1-like protein 2                   71.6    4e-11   
ref|XP_007564128.1|  PREDICTED: SCY1-like protein 2                   71.6    4e-11   
ref|XP_007893557.1|  PREDICTED: SCY1-like protein 2                   71.6    4e-11   
gb|EDM16977.1|  SCY1-like 2 (S. cerevisiae) (predicted), isoform ...  71.2    4e-11   



>gb|EYU22712.1| hypothetical protein MIMGU_mgv1a000991mg [Erythranthe guttata]
Length=919

 Score =   188 bits (478),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETLDFLHNNARL+HRAISPE+VL+TSNGAWKL GF FA+ST+ SS+D ++MQ
Sbjct  173  KHGLLQIAETLDFLHNNARLIHRAISPESVLLTSNGAWKLGGFGFAISTDQSSNDSASMQ  232

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHYAEYDVEDSI+PLQPS+NYTAPELVR+  SS+GC++DIFSFGCL
Sbjct  233  AFHYAEYDVEDSILPLQPSINYTAPELVRNKASSVGCAADIFSFGCL  279


 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IRADAARLVRLRHPGVVHVVQALDESKNAM+MVTEPLF+SAAN LG L
Sbjct  93   LSKAAEDAFLDVIRADAARLVRLRHPGVVHVVQALDESKNAMSMVTEPLFSSAANTLGNL  152

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            ENI KVPKELKG+EMGLLEVK  +  +   L F
Sbjct  153  ENIPKVPKELKGMEMGLLEVKHGLLQIAETLDF  185



>ref|XP_009601552.1| PREDICTED: SCY1-like protein 2 [Nicotiana tomentosiformis]
Length=933

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 98/107 (92%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETLDFLH NARL+HR+ISPET+LITSNGAWKL GF FA+S +  ++D SNMQ
Sbjct  175  KHGLLQIAETLDFLHGNARLIHRSISPETILITSNGAWKLGGFGFAISVD-QAADLSNMQ  233

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHYAEYDVEDSI+PLQPSLNYTAPELVRS TSS+GCSSDIFSFGCL
Sbjct  234  AFHYAEYDVEDSIIPLQPSLNYTAPELVRSKTSSVGCSSDIFSFGCL  280


 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSKTAED+FFD+IRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALG L
Sbjct  95   LSKTAEDSFFDVIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGDL  154

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            ENIEKVPKELKG+EMGLLEVK  +  +   L F
Sbjct  155  ENIEKVPKELKGMEMGLLEVKHGLLQIAETLDF  187



>ref|XP_007019922.1| Kinase family protein with ARM repeat domain isoform 2 [Theobroma 
cacao]
 gb|EOY17147.1| Kinase family protein with ARM repeat domain isoform 2 [Theobroma 
cacao]
Length=934

 Score =   186 bits (472),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AE+LDFLHNNARL+HRAISPE +LITS+GAWKL GF FA+ST+ +S+D +N+Q
Sbjct  172  KHGLLQIAESLDFLHNNARLIHRAISPENILITSSGAWKLGGFGFAISTDQASNDLANVQ  231

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHYAEYD+EDS+MPLQPSLNYTAPELVRS  SS GCSSDIFSFGCL
Sbjct  232  AFHYAEYDIEDSVMPLQPSLNYTAPELVRSKASSTGCSSDIFSFGCL  278


 Score =   144 bits (364),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 70/93 (75%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AED+FFD+IRADA RLVRLRHPGVVHVVQALDE+KNAMAMVTEPLFAS ANALG +
Sbjct  92   LSKVAEDSFFDLIRADAGRLVRLRHPGVVHVVQALDENKNAMAMVTEPLFASVANALGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+  VPK+LKG+EMGLLEVK  +  +  +L F
Sbjct  152  ENVANVPKDLKGMEMGLLEVKHGLLQIAESLDF  184



>ref|XP_007019921.1| Kinase family protein with ARM repeat domain isoform 1 [Theobroma 
cacao]
 gb|EOY17146.1| Kinase family protein with ARM repeat domain isoform 1 [Theobroma 
cacao]
Length=933

 Score =   186 bits (472),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AE+LDFLHNNARL+HRAISPE +LITS+GAWKL GF FA+ST+ +S+D +N+Q
Sbjct  172  KHGLLQIAESLDFLHNNARLIHRAISPENILITSSGAWKLGGFGFAISTDQASNDLANVQ  231

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHYAEYD+EDS+MPLQPSLNYTAPELVRS  SS GCSSDIFSFGCL
Sbjct  232  AFHYAEYDIEDSVMPLQPSLNYTAPELVRSKASSTGCSSDIFSFGCL  278


 Score =   144 bits (364),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 70/93 (75%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AED+FFD+IRADA RLVRLRHPGVVHVVQALDE+KNAMAMVTEPLFAS ANALG +
Sbjct  92   LSKVAEDSFFDLIRADAGRLVRLRHPGVVHVVQALDENKNAMAMVTEPLFASVANALGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+  VPK+LKG+EMGLLEVK  +  +  +L F
Sbjct  152  ENVANVPKDLKGMEMGLLEVKHGLLQIAESLDF  184



>ref|XP_008361497.1| PREDICTED: SCY1-like protein 2 [Malus domestica]
Length=531

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AE+LDFLHNNARL+HRAISPE V ITS+GAWKL GF FA+ST+ +S + +N+Q
Sbjct  173  KHGLLQIAESLDFLHNNARLIHRAISPENVFITSSGAWKLGGFGFAISTDQASGNMANVQ  232

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHYAEYDVEDS++PLQPSLNYTAPEL RS  SS GCSSDIFSFGCL
Sbjct  233  AFHYAEYDVEDSVLPLQPSLNYTAPELARSKASSAGCSSDIFSFGCL  279


 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            L K AED F ++IRADAARLVRLRHPGVVHVVQALDE+KNAMAMVTEPLFAS ANALG +
Sbjct  93   LPKAAEDGFLEIIRADAARLVRLRHPGVVHVVQALDENKNAMAMVTEPLFASVANALGNV  152

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+ KVPKELKG+EMG+LEVK  +  +  +L F
Sbjct  153  ENVAKVPKELKGMEMGILEVKHGLLQIAESLDF  185



>ref|XP_006362717.1| PREDICTED: SCY1-like protein 2-like [Solanum tuberosum]
Length=935

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 98/107 (92%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETLDFLH+NARL+HR+ISPET+LITSNGAWKL GF F +S +  ++D SNMQ
Sbjct  175  KHGLLQIAETLDFLHSNARLIHRSISPETILITSNGAWKLGGFGFTISVD-QAADLSNMQ  233

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHYAEYDVEDSI+PLQPSL+YTAPELVRS TSS+GCSSDIFSFGCL
Sbjct  234  AFHYAEYDVEDSIIPLQPSLDYTAPELVRSKTSSVGCSSDIFSFGCL  280


 Score =   156 bits (395),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 78/93 (84%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSKTAED+FFD+IRADAARLVRLRHPGVVHVVQALDESKN MAMVTEPLFASAANALG L
Sbjct  95   LSKTAEDSFFDIIRADAARLVRLRHPGVVHVVQALDESKNGMAMVTEPLFASAANALGDL  154

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            ENIEKVPKELKG+EMGLLEVK  +  +   L F
Sbjct  155  ENIEKVPKELKGMEMGLLEVKHGLLQIAETLDF  187



>ref|XP_011095377.1| PREDICTED: SCY1-like protein 2 [Sesamum indicum]
Length=934

 Score =   184 bits (466),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETLDFLHNNARL+HRAI+PE+VLITSNGAWKL+GF FA+ST+ SS+D ++MQ
Sbjct  177  KHGLLQIAETLDFLHNNARLIHRAIAPESVLITSNGAWKLSGFGFAISTDQSSNDSASMQ  236

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHYAEYDVEDSI+PLQPS+NYTAPELVRS TSS+G +SD+FS  CL
Sbjct  237  AFHYAEYDVEDSILPLQPSINYTAPELVRSKTSSVGPASDVFSLACL  283


 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFAS AN LG +
Sbjct  97   LSKAAEDAFLDVIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASVANTLGNV  156

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            ENI KVPKELKG++MGLLEVK  +  +   L F
Sbjct  157  ENISKVPKELKGMDMGLLEVKHGLLQIAETLDF  189



>ref|XP_006441714.1| hypothetical protein CICLE_v10018760mg [Citrus clementina]
 ref|XP_006441715.1| hypothetical protein CICLE_v10018760mg [Citrus clementina]
 gb|ESR54954.1| hypothetical protein CICLE_v10018760mg [Citrus clementina]
 gb|ESR54955.1| hypothetical protein CICLE_v10018760mg [Citrus clementina]
Length=913

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AE+L+FLH+NARL+HRAISPE +LITSNGAWKL GF FA+ST+ + SD SN+Q
Sbjct  173  KHGLLQIAESLEFLHSNARLIHRAISPENILITSNGAWKLGGFGFAISTDQAISDSSNVQ  232

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHYAEYDVEDS++PLQPSLNYTAPELVRS T+S GCSSDIFSFGC+
Sbjct  233  AFHYAEYDVEDSMLPLQPSLNYTAPELVRSKTNSFGCSSDIFSFGCV  279


 Score =   136 bits (343),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 63/93 (68%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            L+K+AEDAF D++RADA +LVRLRHPG+VHVVQA+DE+KNAMAMVTEPLFAS AN LG  
Sbjct  93   LTKSAEDAFLDLVRADAGKLVRLRHPGIVHVVQAMDENKNAMAMVTEPLFASVANVLGNF  152

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+ KVP+ELKG+EM LLE+K  +  +  +L F
Sbjct  153  ENVSKVPRELKGLEMSLLEMKHGLLQIAESLEF  185



>emb|CDP20126.1| unnamed protein product [Coffea canephora]
Length=931

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETLDFLHNNARL+HR+I+PET+LITSNGAWKL GF F +ST+ SSSD +N+Q
Sbjct  171  KHGLLQIAETLDFLHNNARLIHRSIAPETILITSNGAWKLGGFGFTISTDQSSSDSANLQ  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHYAEYDVEDSI+PLQP+L+YTAPELVRS  S++G +SDIFSF CL
Sbjct  231  AFHYAEYDVEDSILPLQPALDYTAPELVRSKASTVGSASDIFSFACL  277


 Score =   146 bits (369),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF +++RADA+RLVRLRHPGVVHVV ALDESKNAMAMVTEPLFASAANALG L
Sbjct  91   LSKAAEDAFLEVLRADASRLVRLRHPGVVHVVHALDESKNAMAMVTEPLFASAANALGNL  150

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+EKVPKELKG+EM LLEVK  +  +   L F
Sbjct  151  ENVEKVPKELKGMEMRLLEVKHGLLQIAETLDF  183



>ref|XP_004250719.1| PREDICTED: SCY1-like protein 2 [Solanum lycopersicum]
Length=934

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 98/107 (92%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETLDFLH+NARLVHR+ISPET+LITSNGAWKL GF F +S +  ++D SN+Q
Sbjct  175  KHGLLQIAETLDFLHSNARLVHRSISPETILITSNGAWKLGGFGFTISVD-QAADLSNIQ  233

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHY+EYDVEDSI+PLQPSL+YTAPELVRS TSS+GCSSDIFSFGCL
Sbjct  234  AFHYSEYDVEDSIIPLQPSLDYTAPELVRSKTSSVGCSSDIFSFGCL  280


 Score =   155 bits (393),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 77/93 (83%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSKTAED+FFD+IRADA+RLVRLRHPGVVHVVQALDESKN MAMVTEPLFASAANALG L
Sbjct  95   LSKTAEDSFFDIIRADASRLVRLRHPGVVHVVQALDESKNGMAMVTEPLFASAANALGDL  154

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            ENIEKVPKELKG+EMGLLEVK  +  +   L F
Sbjct  155  ENIEKVPKELKGMEMGLLEVKHGLLQIAETLDF  187



>gb|KDP45586.1| hypothetical protein JCGZ_17193 [Jatropha curcas]
Length=929

 Score =   181 bits (459),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETLDFLHNNARL+HR+ISPE VLITS+GAWKL GF FA+ST+ +S D  + Q
Sbjct  173  KHGLLQIAETLDFLHNNARLIHRSISPENVLITSSGAWKLGGFGFAISTDQASGDLPSSQ  232

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHYAEYDVEDS++PLQPSLNYTAPELVRS + S+GCSSDIFSFGCL
Sbjct  233  AFHYAEYDVEDSMLPLQPSLNYTAPELVRSKSPSVGCSSDIFSFGCL  279


 Score =   144 bits (364),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 71/93 (76%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IRADAA+LVRLRHPGVVHVVQA+DE+KNA+AMVTEPLFAS ANALG +
Sbjct  93   LSKVAEDAFLDVIRADAAKLVRLRHPGVVHVVQAMDENKNAIAMVTEPLFASVANALGNV  152

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            ENI KVPKELKG+EMGLLEVK  +  +   L F
Sbjct  153  ENIAKVPKELKGMEMGLLEVKHGLLQIAETLDF  185



>ref|XP_006478453.1| PREDICTED: SCY1-like protein 2-like [Citrus sinensis]
Length=915

 Score =   180 bits (457),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AE+L+FLH+NARL+HRAISPE +LITSNGAWKL GF FA+ST+ + SD SN+ 
Sbjct  173  KHGLLQIAESLEFLHSNARLIHRAISPENILITSNGAWKLGGFGFAISTDQAISDSSNVL  232

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHYAEYDVEDS++PLQPSLNYTAPELVRS T+S GCSSDIFSFGC+
Sbjct  233  AFHYAEYDVEDSMLPLQPSLNYTAPELVRSKTNSFGCSSDIFSFGCV  279


 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            L+K AEDAF D++RADA +LVRLRHPG+VHVVQA+DE+KNAMAMVTEPLFAS AN LG  
Sbjct  93   LTKVAEDAFLDLVRADAGKLVRLRHPGIVHVVQAMDENKNAMAMVTEPLFASVANVLGNF  152

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+ KVPKELKG+EM LLE+K  +  +  +L F
Sbjct  153  ENVSKVPKELKGLEMSLLEMKHGLLQIAESLEF  185



>gb|KHG06707.1| SCY1-like protein 2 [Gossypium arboreum]
Length=932

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETLDFLHNNARL+H AISPE VLITS+GAWKL GF FA+S + +SSD +N+Q
Sbjct  172  KHGLLQIAETLDFLHNNARLIHCAISPENVLITSHGAWKLGGFGFAISKDQASSDLTNVQ  231

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SFHY+EYD EDS++PLQPSLNYTAPELVRS  SS GCSSDIFSFGCL
Sbjct  232  SFHYSEYDTEDSVIPLQPSLNYTAPELVRSKASSAGCSSDIFSFGCL  278


 Score =   142 bits (357),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 68/93 (73%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AED+F D+IRADAA+LVRLRHPGVVHVVQALDE+KNAMAMVTEPLFAS AN LG +
Sbjct  92   LSKVAEDSFLDLIRADAAKLVRLRHPGVVHVVQALDENKNAMAMVTEPLFASVANTLGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+ +VPK+LKG+EMGLLEVK  +  +   L F
Sbjct  152  ENVAQVPKDLKGMEMGLLEVKHGLLQIAETLDF  184



>ref|XP_010112043.1| SCY1-like protein 2 [Morus notabilis]
 gb|EXC32462.1| SCY1-like protein 2 [Morus notabilis]
Length=919

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AE+L+FLH+NARL+HRAI+PE VLITS+GAWKLAGF FA+ST+ ++SD +N+Q
Sbjct  174  KHGLLQIAESLEFLHSNARLIHRAIAPENVLITSSGAWKLAGFGFAVSTDQATSDTANLQ  233

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             FHYAEYDVEDSI+PLQPSLNYTAPELVR  ++S GC SDIFSFGCL
Sbjct  234  PFHYAEYDVEDSILPLQPSLNYTAPELVRRKSASAGCPSDIFSFGCL  280


 Score =   147 bits (371),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D++RADA RLVRLRHPGVVHVVQALDE+KNAMAMVTEPLFAS ANALG +
Sbjct  94   LSKAAEDAFLDVVRADAGRLVRLRHPGVVHVVQALDENKNAMAMVTEPLFASVANALGNV  153

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            ENI KVPKELKG+EMGLLEVK  +  +  +L F
Sbjct  154  ENIAKVPKELKGMEMGLLEVKHGLLQIAESLEF  186



>gb|EPS68984.1| hypothetical protein M569_05783, partial [Genlisea aurea]
Length=575

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETLDF+HNNARLVHRAISPETVLITSNGAWKL GFSFA+ST+ S  D  N  
Sbjct  173  KHGLLQVAETLDFIHNNARLVHRAISPETVLITSNGAWKLGGFSFAISTDQSPDDSFNEH  232

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHYAEYDVEDSI+PLQPS+NY APELVR   SS+G + DIFS GCL
Sbjct  233  AFHYAEYDVEDSILPLQPSINYAAPELVRRKASSVGSACDIFSLGCL  279


 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IRADAARLVRLRHPGVVHVVQALDESK+AMAMVTEP+FAS ANALG L
Sbjct  93   LSKAAEDAFLDLIRADAARLVRLRHPGVVHVVQALDESKSAMAMVTEPVFASIANALGNL  152

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+ KVPKELKG+ MGLLEVK  +  V   L F
Sbjct  153  ENLSKVPKELKGMVMGLLEVKHGLLQVAETLDF  185



>ref|XP_009366854.1| PREDICTED: SCY1-like protein 2 isoform X2 [Pyrus x bretschneideri]
Length=758

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AE+LDFLHNNARL+HRAISPE V IT++GAWKL GF FA+ST+ +S + +N+Q
Sbjct  7    KHGLLQIAESLDFLHNNARLIHRAISPENVFITASGAWKLGGFGFAISTDQASGNMANVQ  66

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHYAEYDVEDS++PLQPSLNYTAPEL RS  SS GCSSDIFSFGCL
Sbjct  67   AFHYAEYDVEDSVLPLQPSLNYTAPELARSKASSAGCSSDIFSFGCL  113



>ref|XP_009366853.1| PREDICTED: SCY1-like protein 2 isoform X1 [Pyrus x bretschneideri]
Length=924

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AE+LDFLHNNARL+HRAISPE V IT++GAWKL GF FA+ST+ +S + +N+Q
Sbjct  173  KHGLLQIAESLDFLHNNARLIHRAISPENVFITASGAWKLGGFGFAISTDQASGNMANVQ  232

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHYAEYDVEDS++PLQPSLNYTAPEL RS  SS GCSSDIFSFGCL
Sbjct  233  AFHYAEYDVEDSVLPLQPSLNYTAPELARSKASSAGCSSDIFSFGCL  279


 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            L+K AED F ++IRADAARLVRLRHPGVVHVVQALDE+KNAMAMVTEPLFAS ANALG +
Sbjct  93   LAKAAEDGFLEIIRADAARLVRLRHPGVVHVVQALDENKNAMAMVTEPLFASVANALGNV  152

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+ KVPKELKG+EMG+LEVK  +  +  +L F
Sbjct  153  ENVAKVPKELKGMEMGILEVKHGLLQIAESLDF  185



>ref|XP_008348711.1| PREDICTED: SCY1-like protein 2 [Malus domestica]
Length=928

 Score =   177 bits (450),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ AE+LDFLHNNARL+HRAISPE V ITS+GAWKL GF FA+ST+ +S + +N+Q
Sbjct  173  KHGLLQJAESLDFLHNNARLIHRAISPENVFITSSGAWKLGGFGFAISTDQASGNMTNVQ  232

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHYAEYDVEDS++P+QP LNYTAPE+ +S  SS+GCSSDIFSFGCL
Sbjct  233  AFHYAEYDVEDSVLPIQPXLNYTAPEIAKSKASSVGCSSDIFSFGCL  279


 Score =   142 bits (358),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 68/93 (73%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            L+K AED F ++IRADAARLVRLRHPGVVHVVQALDE+KNAMAMVTEPLFAS ANALG +
Sbjct  93   LTKAAEDGFLEIIRADAARLVRLRHPGVVHVVQALDENKNAMAMVTEPLFASVANALGNV  152

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            +N+ KVPKELKG+EMG+LEVK  +     +L F
Sbjct  153  ZNVAKVPKELKGMEMGILEVKHGLLQJAESLDF  185



>ref|XP_008459573.1| PREDICTED: SCY1-like protein 2 [Cucumis melo]
Length=931

 Score =   177 bits (449),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQLAE+L+FLH+NA L+HRAISPE VLITSNGAWKLAGF FA+  + +S D + MQ
Sbjct  172  KHGLLQLAESLNFLHSNAHLIHRAISPENVLITSNGAWKLAGFCFAIPADQTSGDMATMQ  231

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHYAEYDVEDS++PLQPSLNYTAPELVRS +S  GCSSDIFSFGCL
Sbjct  232  AFHYAEYDVEDSVLPLQPSLNYTAPELVRSKSSVAGCSSDIFSFGCL  278


 Score =   140 bits (352),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 66/93 (71%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK+ ED+F D+IRADA RLVRLRHPGVVHVVQALDE+KNAMAMVTEPLFAS AN +G +
Sbjct  92   LSKSVEDSFLDLIRADAGRLVRLRHPGVVHVVQALDENKNAMAMVTEPLFASVANVIGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+ KVPKEL G+EMGLLE+K  +  +  +L F
Sbjct  152  ENVAKVPKELNGLEMGLLEIKHGLLQLAESLNF  184



>ref|XP_010279110.1| PREDICTED: SCY1-like protein 2 isoform X2 [Nelumbo nucifera]
Length=780

 Score =   176 bits (445),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AE+LDFLHNNARL+HRAISPETV ITS+GAWKL GF FA+S + +S D  N+Q
Sbjct  7    KHGLLQVAESLDFLHNNARLIHRAISPETVFITSSGAWKLGGFGFAVSADQTSGDVINVQ  66

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHYAEYDVEDSI+PLQPSL+YTAPELVRS T S G SSDIFSFGCL
Sbjct  67   TFHYAEYDVEDSILPLQPSLDYTAPELVRSKTFSAGYSSDIFSFGCL  113



>ref|XP_004290244.1| PREDICTED: SCY1-like protein 2 [Fragaria vesca subsp. vesca]
Length=928

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AE+LDFLHNNARL+HRAISPE V ITS+GAWKL GF FA+ST+ +S + +N+Q
Sbjct  171  KHGLLQIAESLDFLHNNARLIHRAISPENVFITSSGAWKLGGFGFAISTDQASGNMANVQ  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             FHYAEYDVEDS++PLQPSLNYTAPEL RS   S GCSSDIFSFGCL
Sbjct  231  EFHYAEYDVEDSVLPLQPSLNYTAPELARSKALSAGCSSDIFSFGCL  277


 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IRADAARLVRLRHPGVVHVVQALDE+KNAMAMVTEPLFAS ANA+G L
Sbjct  91   LSKAAEDAFLDIIRADAARLVRLRHPGVVHVVQALDENKNAMAMVTEPLFASVANAVGNL  150

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            +N+ KVPKELKG+EMGLLEVK  +  +  +L F
Sbjct  151  DNMAKVPKELKGMEMGLLEVKHGLLQIAESLDF  183



>gb|KJB60121.1| hypothetical protein B456_009G290500 [Gossypium raimondii]
Length=932

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETLDFLHNNARLVH AISPE VLITS+GAWKL GF FA+  + +SSD +N+Q
Sbjct  172  KHGLLQIAETLDFLHNNARLVHCAISPENVLITSHGAWKLGGFGFAILKDQASSDLTNVQ  231

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHY+EYD EDS++PLQPSLNYTAPELVRS  SS GCSSDIFSFGCL
Sbjct  232  AFHYSEYDTEDSVIPLQPSLNYTAPELVRSKASSAGCSSDIFSFGCL  278


 Score =   142 bits (357),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 68/93 (73%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AED+F D+IRADAA+LVRLRHPGVVHVVQALDE+KNAMAMVTEPLFAS AN LG +
Sbjct  92   LSKVAEDSFLDLIRADAAKLVRLRHPGVVHVVQALDENKNAMAMVTEPLFASVANTLGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+ +VPK+LKG+EMGLLEVK  +  +   L F
Sbjct  152  ENVAQVPKDLKGMEMGLLEVKHGLLQIAETLDF  184



>ref|XP_010279109.1| PREDICTED: SCY1-like protein 2 isoform X1 [Nelumbo nucifera]
Length=944

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 101/130 (78%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  GFWRTLRKCRRSSKE*KWDY*R*NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGA  353
            G    + K  +  KE +       +GLLQ+AE+LDFLHNNARL+HRAISPETV ITS+GA
Sbjct  148  GVVDNIAKVPKELKEMEMGLLEVKHGLLQVAESLDFLHNNARLIHRAISPETVFITSSGA  207

Query  354  WKLAGFSFALSTNPSSSDPSNMQSFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGC  533
            WKL GF FA+S + +S D  N+Q+FHYAEYDVEDSI+PLQPSL+YTAPELVRS T S G 
Sbjct  208  WKLGGFGFAVSADQTSGDVINVQTFHYAEYDVEDSILPLQPSLDYTAPELVRSKTFSAGY  267

Query  534  SSDIFSFGCL  563
            SSDIFSFGCL
Sbjct  268  SSDIFSFGCL  277


 Score =   146 bits (369),  Expect = 8e-37, Method: Composition-based stats.
 Identities = 72/93 (77%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAFFD+IRADAARLVRLRHPG+VHVVQALDE+KNAMAMVTEPLFAS AN LG++
Sbjct  91   LSKAAEDAFFDVIRADAARLVRLRHPGIVHVVQALDENKNAMAMVTEPLFASVANTLGVV  150

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            +NI KVPKELK +EMGLLEVK  +  V  +L F
Sbjct  151  DNIAKVPKELKEMEMGLLEVKHGLLQVAESLDF  183



>ref|XP_006586743.1| PREDICTED: SCY1-like protein 2-like isoform X2 [Glycine max]
Length=783

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AE+LDFLHN+A L+HRAISPE +LIT +GAWKLAGF FA+S   +S D SN+Q
Sbjct  25   KHGLLQIAESLDFLHNHAHLLHRAISPENILITLSGAWKLAGFGFAVSATQTSGDSSNLQ  84

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             FHYAEYDVEDSI+PLQPSLNYTAPEL RS  SS GCSSDIFSFGCL
Sbjct  85   PFHYAEYDVEDSILPLQPSLNYTAPELARSTASSAGCSSDIFSFGCL  131



>ref|XP_003534437.1| PREDICTED: SCY1-like protein 2-like isoform X1 [Glycine max]
 gb|KHN40902.1| SCY1-like protein 2 [Glycine soja]
Length=930

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AE+LDFLHN+A L+HRAISPE +LIT +GAWKLAGF FA+S   +S D SN+Q
Sbjct  172  KHGLLQIAESLDFLHNHAHLLHRAISPENILITLSGAWKLAGFGFAVSATQTSGDSSNLQ  231

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             FHYAEYDVEDSI+PLQPSLNYTAPEL RS  SS GCSSDIFSFGCL
Sbjct  232  PFHYAEYDVEDSILPLQPSLNYTAPELARSTASSAGCSSDIFSFGCL  278


 Score =   140 bits (353),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 66/93 (71%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            L+K AED+F D+IR DAA+LVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAAN LGI+
Sbjct  92   LTKAAEDSFLDLIRTDAAKLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANTLGIV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            +NI  +PK+L+G+EMG+LEVK  +  +  +L F
Sbjct  152  DNIPNLPKDLRGMEMGILEVKHGLLQIAESLDF  184



>ref|XP_010248020.1| PREDICTED: SCY1-like protein 2 [Nelumbo nucifera]
Length=647

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AE+LDFLHNNA L+HRAISPET+ ITS+GAWKL GF FA+S + +S D +NMQ
Sbjct  171  KHGLLQVAESLDFLHNNAHLIHRAISPETIFITSSGAWKLGGFGFAISADQTSGDQTNMQ  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             FHYAEYDV+DS++PLQPSLNYTAPELVRS   S  CSSD+FSFGCL
Sbjct  231  PFHYAEYDVDDSLLPLQPSLNYTAPELVRSKEFSARCSSDMFSFGCL  277


 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAFFD+IR+DAARLVRLRHPG+VHVVQALDE+KNAMAMVTEPLFAS AN LG +
Sbjct  91   LSKAAEDAFFDIIRSDAARLVRLRHPGIVHVVQALDENKNAMAMVTEPLFASVANTLGAV  150

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            +NI K PKEL+ +EMGLLE+K  +  V  +L F
Sbjct  151  DNIAKTPKELEEMEMGLLEMKHGLLQVAESLDF  183



>ref|XP_010063716.1| PREDICTED: SCY1-like protein 2 [Eucalyptus grandis]
 gb|KCW70965.1| hypothetical protein EUGRSUZ_F04075 [Eucalyptus grandis]
Length=916

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AE+LDFLHNNARL+HR+ISPE VLITS+GAWKL GF  A+S++ +S D S++Q
Sbjct  173  KHGLLQIAESLDFLHNNARLIHRSISPENVLITSSGAWKLGGFGLAISSDQASGDLSSLQ  232

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SFHY+EYDVEDS++PLQPSLNYTAPELVRS T+S G +SD+FSFGCL
Sbjct  233  SFHYSEYDVEDSVLPLQPSLNYTAPELVRSKTASAGSASDVFSFGCL  279


 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D++RADAARLVRLRHPGVVHVVQALDE+KNAMAMVTEPLFAS ANALG L
Sbjct  93   LSKAAEDAFLDIVRADAARLVRLRHPGVVHVVQALDENKNAMAMVTEPLFASVANALGNL  152

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            ENI KVPKELKG+EMGLLEVK  +  +  +L F
Sbjct  153  ENIPKVPKELKGMEMGLLEVKHGLLQIAESLDF  185



>ref|XP_010521095.1| PREDICTED: SCY1-like protein 2 [Tarenaya hassleriana]
Length=920

 Score =   175 bits (443),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETL+FLHNNARL+HRAISPE VL+TS G+WKLAGF FA+S +  S +  NMQ
Sbjct  172  KHGLLQVAETLNFLHNNARLIHRAISPENVLVTSTGSWKLAGFCFAISAD-QSGNLDNMQ  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHYAEYDVEDS++PLQPSLNYTAPELVR+ TSS+G SSDIFSFGC+
Sbjct  231  AFHYAEYDVEDSVLPLQPSLNYTAPELVRNKTSSVGASSDIFSFGCI  277


 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IRADAA++VRLRHPGVVHVVQALDE+KNAMAMVTEPLFAS ANALG L
Sbjct  92   LSKAAEDAFLDLIRADAAKMVRLRHPGVVHVVQALDENKNAMAMVTEPLFASVANALGKL  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+ K+PK+L+ +EM LLEVK  +  V   L F
Sbjct  152  ENVAKIPKDLQSMEMSLLEVKHGLLQVAETLNF  184



>ref|XP_003540550.1| PREDICTED: SCY1-like protein 2-like [Glycine max]
Length=928

 Score =   175 bits (443),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AE+LDFLHN+A L+HR+ISPE +LIT +GAWKLAGF FA+S   +S D SN+Q
Sbjct  172  KHGLLQIAESLDFLHNHAHLIHRSISPENILITLSGAWKLAGFGFAVSATQTSGDSSNLQ  231

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             FHYAEYDVEDSI+PLQPSLNYTAPELVRS  SS GCSSDIFS GCL
Sbjct  232  PFHYAEYDVEDSILPLQPSLNYTAPELVRSTVSSAGCSSDIFSIGCL  278


 Score =   137 bits (346),  Expect = 9e-34, Method: Composition-based stats.
 Identities = 65/93 (70%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            L+K AED+F D+IR DA++LVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAAN LGI+
Sbjct  92   LTKAAEDSFLDLIRMDASKLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANTLGIV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            +NI  +PK+L+G+EMG+LEVK  +  +  +L F
Sbjct  152  DNILNLPKDLRGMEMGILEVKHGLLQIAESLDF  184



>gb|KHN19409.1| SCY1-like protein 2 [Glycine soja]
Length=915

 Score =   174 bits (442),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AE+LDFLHN+A L+HR+ISPE +LIT +GAWKLAGF FA+S   +S D SN+Q
Sbjct  159  KHGLLQIAESLDFLHNHAHLIHRSISPENILITLSGAWKLAGFGFAVSATQTSGDSSNLQ  218

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             FHYAEYDVEDSI+PLQPSLNYTAPELVRS  SS GCSSDIFS GCL
Sbjct  219  PFHYAEYDVEDSILPLQPSLNYTAPELVRSTVSSAGCSSDIFSIGCL  265


 Score =   134 bits (338),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 63/91 (69%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +2

Query  8    KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  187
            + AED+F D+IR DA++LVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAAN LGI++N
Sbjct  81   QAAEDSFLDLIRMDASKLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANTLGIVDN  140

Query  188  IEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            I  +PK+L+G+EMG+LEVK  +  +  +L F
Sbjct  141  ILNLPKDLRGMEMGILEVKHGLLQIAESLDF  171



>ref|XP_007201757.1| hypothetical protein PRUPE_ppa001052mg [Prunus persica]
 gb|EMJ02956.1| hypothetical protein PRUPE_ppa001052mg [Prunus persica]
Length=923

 Score =   174 bits (442),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AE+LDFLHNNA L+HRAISPE V ITS+GAWKL GF FA+ST+ +S + +N+Q
Sbjct  173  KHGLLQIAESLDFLHNNAHLIHRAISPENVFITSSGAWKLGGFGFAISTDQASGNMANVQ  232

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHYAEYD EDS++PLQPSLNYTAPEL RS  SS GCSSDIFSFGCL
Sbjct  233  AFHYAEYDGEDSVLPLQPSLNYTAPELARSKESSTGCSSDIFSFGCL  279


 Score =   141 bits (355),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 69/93 (74%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF ++IRADA+RLVRLRHPGVVHVVQALDE+KNAMAMVTEPLFAS AN LG +
Sbjct  93   LSKAAEDAFLEIIRADASRLVRLRHPGVVHVVQALDENKNAMAMVTEPLFASVANTLGNV  152

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+ KVPKELKG+EM LLEVK  +  +  +L F
Sbjct  153  ENVAKVPKELKGMEMSLLEVKHGLLQIAESLDF  185



>gb|KJB26955.1| hypothetical protein B456_004G267700 [Gossypium raimondii]
Length=1121

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AE L+FLHNNAR+VHRAISPE VLITS+GAWK  GF FA ST+ +S D +N+Q
Sbjct  176  KHGLLQIAECLNFLHNNARIVHRAISPENVLITSSGAWKFGGFGFATSTDKASGDCANVQ  235

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHY EYD EDS+MPLQPSLNYTAPELV S  SS GCSSDIFSFGCL
Sbjct  236  AFHYGEYDTEDSVMPLQPSLNYTAPELVCSKASSAGCSSDIFSFGCL  282


 Score =   139 bits (350),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 68/93 (73%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK  ED+FF++IRADA RLVRLRHPGVVHVVQALDE+KNAMAMVTEPLFAS ANALG +
Sbjct  96   LSKAVEDSFFNLIRADAVRLVRLRHPGVVHVVQALDENKNAMAMVTEPLFASVANALGNV  155

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            +N+ KVPKELK IEMGL+EVK  +  +   L F
Sbjct  156  DNVAKVPKELKEIEMGLVEVKHGLLQIAECLNF  188



>ref|XP_011004854.1| PREDICTED: SCY1-like protein 2 [Populus euphratica]
Length=928

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AE+LDFLHNNA L+HRAISPE +LITS+GAWKL GF FA++T+ +S D ++ Q
Sbjct  173  KHGLLQIAESLDFLHNNAHLIHRAISPENILITSSGAWKLGGFGFAITTDQASGDLASSQ  232

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHYAEYD EDSI+PLQPSLNYTAPELVRS   S GCSSDIFSFGCL
Sbjct  233  AFHYAEYDDEDSILPLQPSLNYTAPELVRSKAPSAGCSSDIFSFGCL  279


 Score =   143 bits (361),  Expect = 9e-36, Method: Composition-based stats.
 Identities = 69/93 (74%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            L+K AED F D+IRADAARLVR+RHPGVVHVVQALDE+KNAMAMVTEPLF+S ANA+G L
Sbjct  93   LTKVAEDTFLDVIRADAARLVRIRHPGVVHVVQALDENKNAMAMVTEPLFSSVANAIGNL  152

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+ KVPKELKG+EMGLLEVK  +  +  +L F
Sbjct  153  ENVGKVPKELKGMEMGLLEVKHGLLQIAESLDF  185



>ref|XP_008237746.1| PREDICTED: SCY1-like protein 2 [Prunus mume]
Length=929

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AE+LDFLHNNA L+HRAISPE V ITS+GAWKL GF FA+ST+ +S + +N+Q
Sbjct  173  KHGLLQIAESLDFLHNNACLIHRAISPENVFITSSGAWKLGGFGFAISTDQASGNMANVQ  232

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHYAEYD EDS++PLQPSLNYTAPEL RS  SS GCSSDIFSFGCL
Sbjct  233  AFHYAEYDGEDSVLPLQPSLNYTAPELARSKESSTGCSSDIFSFGCL  279


 Score =   144 bits (362),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 70/93 (75%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF ++IRADA+RLVRLRHPGVVHVVQALDE+KNAMAMVTEPLFAS AN LG +
Sbjct  93   LSKAAEDAFLEIIRADASRLVRLRHPGVVHVVQALDENKNAMAMVTEPLFASVANTLGNV  152

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+ KVPKELKG+EMGLLEVK  +  +  +L F
Sbjct  153  ENVAKVPKELKGMEMGLLEVKHGLLQIAESLDF  185



>ref|XP_010534134.1| PREDICTED: SCY1-like protein 2 isoform X3 [Tarenaya hassleriana]
Length=912

 Score =   172 bits (436),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETLDFLHNNARL+HRAISPE VL+T+ G+WKLAGF FALS +    +  NMQ
Sbjct  172  KHGLLQIAETLDFLHNNARLIHRAISPENVLVTATGSWKLAGFGFALSAD-QCGNLDNMQ  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHYAEYDVEDS++PLQPSLNY APELVR  T S+G SSDIFSFGCL
Sbjct  231  TFHYAEYDVEDSVLPLQPSLNYIAPELVRGKTPSVGVSSDIFSFGCL  277


 Score =   138 bits (348),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 68/93 (73%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IRADAA+LVRLRHPGVVHVVQALDE+KNA+AMVTEPLFAS ANALG +
Sbjct  92   LSKAAEDAFLDLIRADAAKLVRLRHPGVVHVVQALDENKNAIAMVTEPLFASIANALGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+ KVPK+LK +EM LLEVK  +  +   L F
Sbjct  152  ENVAKVPKDLKSMEMSLLEVKHGLLQIAETLDF  184



>ref|XP_002273755.1| PREDICTED: SCY1-like protein 2 [Vitis vinifera]
 emb|CBI17053.3| unnamed protein product [Vitis vinifera]
Length=931

 Score =   172 bits (436),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ++ETL+FLHNNARL+HRAISPETV+ITS+GAWKL+GF FA+S++ +S D +N+ 
Sbjct  173  KHGLLQVSETLEFLHNNARLIHRAISPETVVITSSGAWKLSGFGFAISSDQASGDLANVP  232

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHYAEYDVEDSI+PLQP+LNYTAPELVRS  S  G +SDIFSFGCL
Sbjct  233  AFHYAEYDVEDSILPLQPALNYTAPELVRSRGSPAGSASDIFSFGCL  279


 Score =   141 bits (356),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 71/93 (76%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LS+ AE++F D+IRADA RLVRLRHPGVVHVVQALDE+KNAMAMVTEPLFAS ANALG L
Sbjct  93   LSRAAEESFLDVIRADAGRLVRLRHPGVVHVVQALDENKNAMAMVTEPLFASVANALGSL  152

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            E I KVPKELKG+EMGLLEVK  +  V   L F
Sbjct  153  EGIGKVPKELKGMEMGLLEVKHGLLQVSETLEF  185



>ref|XP_007133873.1| hypothetical protein PHAVU_011G216200g [Phaseolus vulgaris]
 gb|ESW05867.1| hypothetical protein PHAVU_011G216200g [Phaseolus vulgaris]
Length=928

 Score =   172 bits (436),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AE+LDFLHN+A L+HRAISPE +LIT +GAWKLAGF FA+     S D SN+Q
Sbjct  172  KHGLLQIAESLDFLHNHAHLIHRAISPENILITLSGAWKLAGFGFAVPATQISGDSSNLQ  231

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             FHYAEYDVEDSI+PLQPSLNYTAPELVRS  SS GCSSDIFSF CL
Sbjct  232  PFHYAEYDVEDSILPLQPSLNYTAPELVRSTGSSAGCSSDIFSFACL  278


 Score =   135 bits (341),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 65/93 (70%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            L+K AED+F D+IR DAA+LVRLRHPGVVHVVQALDESK+AMAMVTEPLFASAAN L I+
Sbjct  92   LTKAAEDSFLDLIRTDAAKLVRLRHPGVVHVVQALDESKHAMAMVTEPLFASAANTLAIV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            +NI  +PK+L+G+EMGLLEVK  +  +  +L F
Sbjct  152  DNIPVLPKDLRGMEMGLLEVKHGLLQIAESLDF  184



>ref|XP_010534131.1| PREDICTED: SCY1-like protein 2 isoform X1 [Tarenaya hassleriana]
Length=879

 Score =   172 bits (435),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETLDFLHNNARL+HRAISPE VL+T+ G+WKLAGF FALS +    +  NMQ
Sbjct  139  KHGLLQIAETLDFLHNNARLIHRAISPENVLVTATGSWKLAGFGFALSAD-QCGNLDNMQ  197

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHYAEYDVEDS++PLQPSLNY APELVR  T S+G SSDIFSFGCL
Sbjct  198  TFHYAEYDVEDSVLPLQPSLNYIAPELVRGKTPSVGVSSDIFSFGCL  244


 Score =   139 bits (349),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 68/93 (73%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IRADAA+LVRLRHPGVVHVVQALDE+KNA+AMVTEPLFAS ANALG +
Sbjct  59   LSKAAEDAFLDLIRADAAKLVRLRHPGVVHVVQALDENKNAIAMVTEPLFASIANALGNV  118

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+ KVPK+LK +EM LLEVK  +  +   L F
Sbjct  119  ENVAKVPKDLKSMEMSLLEVKHGLLQIAETLDF  151



>ref|XP_010534132.1| PREDICTED: SCY1-like protein 2 isoform X2 [Tarenaya hassleriana]
Length=871

 Score =   171 bits (434),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETLDFLHNNARL+HRAISPE VL+T+ G+WKLAGF FALS +    +  NMQ
Sbjct  131  KHGLLQIAETLDFLHNNARLIHRAISPENVLVTATGSWKLAGFGFALSAD-QCGNLDNMQ  189

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHYAEYDVEDS++PLQPSLNY APELVR  T S+G SSDIFSFGCL
Sbjct  190  TFHYAEYDVEDSVLPLQPSLNYIAPELVRGKTPSVGVSSDIFSFGCL  236


 Score =   120 bits (302),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 63/93 (68%), Positives = 71/93 (76%), Gaps = 8/93 (9%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IRADAA+LVRLRHPGVVHVVQALDE+KNA+AMVTEPLFAS ANALG +
Sbjct  59   LSKAAEDAFLDLIRADAAKLVRLRHPGVVHVVQALDENKNAIAMVTEPLFASIANALGNV  118

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+ K        EM LLEVK  +  +   L F
Sbjct  119  ENVAK--------EMSLLEVKHGLLQIAETLDF  143



>ref|XP_008775612.1| PREDICTED: SCY1-like protein 2 [Phoenix dactylifera]
Length=320

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETLDFLHNNA LVHRAISPETV IT++GAWKL GF FA+S +  S   ++MQ
Sbjct  7    KHGLLQIAETLDFLHNNAHLVHRAISPETVFITASGAWKLGGFGFAVSIDQVSGGLTSMQ  66

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             FHY EYDVEDS++PLQPSLNYTAPELVR    + G SSDIFS GCL
Sbjct  67   QFHYPEYDVEDSMLPLQPSLNYTAPELVRGKAPTAGYSSDIFSLGCL  113



>gb|KHG01693.1| SCY1-like protein 2 [Gossypium arboreum]
Length=1165

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AE L+FLHNNAR+VHRAI PE VL+TS+GAWK  GF FA ST+ +S D +++Q
Sbjct  233  KHGLLQVAECLNFLHNNARIVHRAILPENVLMTSSGAWKFGGFGFATSTDKASGDCAHVQ  292

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHY EYD EDS+MPLQPSLNYTAPELVRS  SS GCSSDIFSFGCL
Sbjct  293  AFHYGEYDTEDSVMPLQPSLNYTAPELVRSKASSAGCSSDIFSFGCL  339


 Score =   123 bits (308),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 66/89 (74%), Positives = 75/89 (84%), Gaps = 3/89 (3%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK  ED+FF++IRADA RLVRLRHPGVVHVVQALDE+KNAMAMVTEPLFAS ANALG +
Sbjct  96   LSKAVEDSFFNLIRADAVRLVRLRHPGVVHVVQALDENKNAMAMVTEPLFASVANALGNV  155

Query  182  ENIEKVPKELKGIEMGLLEVKQW-VTSVG  265
            +N+ KVPKELK  E+G L  K   V+SVG
Sbjct  156  DNVAKVPKELK--EIGQLIGKSLSVSSVG  182



>ref|XP_003605415.1| SCY1-like protein [Medicago truncatula]
Length=371

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AE+LDFLHN+A L+HRAI+PE V IT +GAWKL GF FA+S+  ++ D SN+ 
Sbjct  172  KHGLLQIAESLDFLHNHAHLIHRAIAPENVFITLSGAWKLGGFGFAISSQ-NTGDSSNLH  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHYAEYDVEDS++PLQPS+NYTAPE+VRS  SS GC SDIFSFGCL
Sbjct  231  AFHYAEYDVEDSVLPLQPSINYTAPEMVRSTASSAGCYSDIFSFGCL  277


 Score =   139 bits (350),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            L+K AEDAF D+IR DA ++VRLRHPG+VHVVQ LDESKNAMAMVTEPLFAS AN LG L
Sbjct  92   LTKAAEDAFLDLIRMDAGKMVRLRHPGIVHVVQGLDESKNAMAMVTEPLFASVANTLGKL  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            +N++ VPK+LKG+EMGLLEVK  +  +  +L F
Sbjct  152  DNVQSVPKDLKGMEMGLLEVKHGLLQIAESLDF  184



>ref|XP_002319896.2| hypothetical protein POPTR_0013s10610g [Populus trichocarpa]
 gb|EEE95819.2| hypothetical protein POPTR_0013s10610g [Populus trichocarpa]
Length=930

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AE+LDFLHNNA L+HRAISPE +LITS+GAWKL GF FA++T+ +S D ++ Q
Sbjct  173  KHGLLQIAESLDFLHNNAHLIHRAISPENILITSSGAWKLGGFGFAITTDQASGDLASSQ  232

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHYAEYD EDS++PLQPSLNY APELVRS   S GCSSDIFSFGCL
Sbjct  233  AFHYAEYDDEDSMLPLQPSLNYIAPELVRSKAPSAGCSSDIFSFGCL  279


 Score =   144 bits (364),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 70/93 (75%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            L+K AED F D+IRADAARLVR+RHPGVVHVVQALDE+KNAMAMVTEPLFAS ANA+G L
Sbjct  93   LTKVAEDTFLDVIRADAARLVRIRHPGVVHVVQALDENKNAMAMVTEPLFASVANAIGNL  152

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+ KVPKELKG+EMGLLEVK  +  +  +L F
Sbjct  153  ENVGKVPKELKGMEMGLLEVKHGLLQIAESLDF  185



>ref|XP_006416147.1| hypothetical protein EUTSA_v10006737mg [Eutrema salsugineum]
 gb|ESQ34500.1| hypothetical protein EUTSA_v10006737mg [Eutrema salsugineum]
Length=913

 Score =   169 bits (427),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETL+FLHNNA L+HRA+SPE VLITS G+WKLAGF FA+S    + +  NMQ
Sbjct  172  KHGLLQIAETLNFLHNNAHLIHRAVSPENVLITSTGSWKLAGFGFAVS-EAQAGNLDNMQ  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SFHY+EYDVEDSI+PLQPSLNYTAPELVRS T S G SSDIFSFGCL
Sbjct  231  SFHYSEYDVEDSILPLQPSLNYTAPELVRSKTPSAGVSSDIFSFGCL  277


 Score =   138 bits (348),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LS+ AED+F D+IRADA +LVRLRHPGVVHVVQALDE+KNAMAMVTEPLFAS ANALG +
Sbjct  92   LSRAAEDSFLDLIRADAGKLVRLRHPGVVHVVQALDENKNAMAMVTEPLFASVANALGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN++ VPK+LK +EM LLEVK  +  +   L F
Sbjct  152  ENVDNVPKDLKAMEMSLLEVKHGLLQIAETLNF  184



>emb|CDY04777.1| BnaC05g18120D [Brassica napus]
Length=893

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 90/107 (84%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETL+FLHNNA L+HRA+SPE VLITS G+WK AGF FA+S    + +  NMQ
Sbjct  172  KHGLLQMAETLNFLHNNAHLIHRAVSPENVLITSAGSWKFAGFGFAIS-EAQAGNLDNMQ  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SFHYAEYDVEDSI+PLQPSLNYTAPELVRS T S G SSDIFSFGCL
Sbjct  231  SFHYAEYDVEDSILPLQPSLNYTAPELVRSKTPSAGASSDIFSFGCL  277


 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AED+F D+IRADA +LVRLRHPGVVHVVQALDE+KNAMAMVTEPLFAS ANALG +
Sbjct  92   LSKAAEDSFLDLIRADAGKLVRLRHPGVVHVVQALDENKNAMAMVTEPLFASVANALGDV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN++ VPK+LK +EM LLEVK  +  +   L F
Sbjct  152  ENVDNVPKDLKSMEMSLLEVKHGLLQMAETLNF  184



>ref|XP_009788433.1| PREDICTED: SCY1-like protein 2 [Nicotiana sylvestris]
Length=237

 Score =   159 bits (402),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSKTAED+FFD+IRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALG L
Sbjct  91   LSKTAEDSFFDVIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGDL  150

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            ENIEKVPKELKG+EMGLLEVK  +  +   L F
Sbjct  151  ENIEKVPKELKGMEMGLLEVKHGLLQIAETLDF  183


 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETLDFLH NARL+HR+ISPET+LITSNGAWKL GF FA+S +  ++D SNMQ
Sbjct  171  KHGLLQIAETLDFLHGNARLIHRSISPETILITSNGAWKLGGFGFAISVD-QAADLSNMQ  229

Query  423  SFHYA  437
            +FHYA
Sbjct  230  AFHYA  234



>ref|XP_009115591.1| PREDICTED: SCY1-like protein 2 [Brassica rapa]
Length=910

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 90/107 (84%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETL+FLHNNA L+HRA+SPE VLITS G+WK AGF FA+S    + +  NMQ
Sbjct  172  KHGLLQMAETLNFLHNNAHLIHRAVSPENVLITSAGSWKFAGFGFAIS-EAQAGNLDNMQ  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SFHYAEYDVEDSI+PLQPSLNYTAPELVRS T S G SSDIFSFGCL
Sbjct  231  SFHYAEYDVEDSILPLQPSLNYTAPELVRSKTPSAGASSDIFSFGCL  277


 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AED+F D+IRADA +LVRLRHPGVVHVVQALDE+KNAMAMVTEPLFAS ANALG +
Sbjct  92   LSKAAEDSFLDLIRADAGKLVRLRHPGVVHVVQALDENKNAMAMVTEPLFASVANALGDV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN++ VPK+LK +EM LLEVK  +  +   L F
Sbjct  152  ENVDNVPKDLKSMEMSLLEVKHGLLQMAETLNF  184



>emb|CDY21396.1| BnaA09g30310D [Brassica napus]
Length=760

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETL+FLHNNA L+HRA+SPE VLITS G+WK AGF FA+S    + +  NMQ
Sbjct  40   KHGLLQMAETLNFLHNNAHLIHRAVSPENVLITSAGSWKFAGFGFAIS-EAQAGNLDNMQ  98

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SFHYAEYDVEDSI+PLQPSLNYTAPELVRS   S G SSDIFSFGCL
Sbjct  99   SFHYAEYDVEDSILPLQPSLNYTAPELVRSKAPSAGASSDIFSFGCL  145


 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +2

Query  125  MAMVTEPLFASAANALGILENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            MAMVTEPLFAS ANALG +EN++ VPK+LK +EM LLEVK  +  +   L F
Sbjct  1    MAMVTEPLFASVANALGDVENVDNVPKDLKSMEMSLLEVKHGLLQMAETLNF  52



>ref|XP_010477557.1| PREDICTED: SCY1-like protein 2 [Camelina sativa]
Length=913

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 90/107 (84%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETL+FLHNNA L+HRA+SPE V ITS G+WKLAGF FA+S +    +  NMQ
Sbjct  172  KHGLLQMAETLNFLHNNAHLIHRAVSPENVFITSGGSWKLAGFGFAISES-QDGNLDNMQ  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SFHY+EYDVEDSI+PLQPSLNYTAPELVRS T S G SSDIFSFGCL
Sbjct  231  SFHYSEYDVEDSILPLQPSLNYTAPELVRSKTPSAGVSSDIFSFGCL  277


 Score =   137 bits (346),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 67/93 (72%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IRADA +LVRLRHPGVVHVVQALDE+KNAMAMVTEPLFAS ANALG +
Sbjct  92   LSKAAEDAFLDLIRADAGKLVRLRHPGVVHVVQALDENKNAMAMVTEPLFASVANALGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN++ VPK+LK +EM LLEVK  +  +   L F
Sbjct  152  ENVDNVPKDLKSMEMSLLEVKHGLLQMAETLNF  184



>ref|XP_006306722.1| hypothetical protein CARUB_v10008248mg [Capsella rubella]
 gb|EOA39620.1| hypothetical protein CARUB_v10008248mg [Capsella rubella]
Length=915

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETL+FLHNNA LVHRA+SPE V ITS G+WKLAGF FA+S      +  NMQ
Sbjct  172  KHGLLQIAETLNFLHNNAHLVHRAVSPENVFITSAGSWKLAGFGFAIS-EAQGGNLDNMQ  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SFHY+EYDVEDSI+PLQPSLNYTAPELVRS T S G SSDIFSFGCL
Sbjct  231  SFHYSEYDVEDSILPLQPSLNYTAPELVRSKTPSAGVSSDIFSFGCL  277


 Score =   135 bits (340),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 65/93 (70%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IRADA +LVRLRHPGVVHVVQALDE+KNAMAMVTEPLF+S ANALG +
Sbjct  92   LSKVAEDAFLDLIRADAGKLVRLRHPGVVHVVQALDENKNAMAMVTEPLFSSVANALGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN++ VPK+LK ++M LLEVK  +  +   L F
Sbjct  152  ENVDNVPKDLKTMDMSLLEVKHGLLQIAETLNF  184



>ref|XP_010460052.1| PREDICTED: SCY1-like protein 2 [Camelina sativa]
Length=913

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETL+FLHNNA L+HRAISPE V ITS G+WKLAGF FA+S      +  NMQ
Sbjct  172  KHGLLQIAETLNFLHNNAHLIHRAISPENVFITSAGSWKLAGFGFAIS-EAQDGNLDNMQ  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SFHY+EYDVEDSI+PLQPSLNYTAPELVRS T S G SSDIFSFGCL
Sbjct  231  SFHYSEYDVEDSILPLQPSLNYTAPELVRSKTPSAGVSSDIFSFGCL  277


 Score =   135 bits (341),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 65/93 (70%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IRADA +LVRLRHPGVVHVVQALDE+KNAMAMVTEPLFAS AN+LG +
Sbjct  92   LSKAAEDAFLDLIRADAGKLVRLRHPGVVHVVQALDENKNAMAMVTEPLFASVANSLGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN++ VPK++K +EM LLEVK  +  +   L F
Sbjct  152  ENVDNVPKDVKSMEMSLLEVKHGLLQIAETLNF  184



>ref|NP_173700.2| protein kinase family protein [Arabidopsis thaliana]
 gb|AEE30298.1| protein kinase family protein [Arabidopsis thaliana]
Length=913

 Score =   167 bits (422),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 90/107 (84%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETL+FLHNNA L+HRA+SPE V ITS G+WKLAGF FA+S      +  N+Q
Sbjct  172  KHGLLQIAETLNFLHNNAHLIHRAVSPENVFITSAGSWKLAGFGFAIS-QAQDGNLDNLQ  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SFHY+EYDVEDSI+PLQPSLNYTAPELVRS TSS G SSDIFSFGCL
Sbjct  231  SFHYSEYDVEDSILPLQPSLNYTAPELVRSKTSSAGVSSDIFSFGCL  277


 Score =   137 bits (346),  Expect = 9e-34, Method: Composition-based stats.
 Identities = 66/93 (71%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IRAD+ +LVRLRHPGVVHVVQALDE+KNAMAMVTEPLFAS ANALG +
Sbjct  92   LSKAAEDAFLDLIRADSGKLVRLRHPGVVHVVQALDENKNAMAMVTEPLFASVANALGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN++ VPK+LK +EM LLEVK  +  +   L F
Sbjct  152  ENVDNVPKDLKSMEMSLLEVKHGLLQIAETLNF  184



>ref|XP_006390775.1| hypothetical protein EUTSA_v10018097mg [Eutrema salsugineum]
 gb|ESQ28061.1| hypothetical protein EUTSA_v10018097mg [Eutrema salsugineum]
Length=903

 Score =   166 bits (421),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ++ETL+FLHNNA+L+HRAISPE VLITS G+WKLAGF FA+ST   + +  NMQ
Sbjct  172  KHGLLQISETLNFLHNNAQLIHRAISPENVLITSAGSWKLAGFGFAIST-AQAGNLDNMQ  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SFHY+EYDVEDSI+P+QPSLNYTAPELVRS   S G SSDIFSFGCL
Sbjct  231  SFHYSEYDVEDSILPVQPSLNYTAPELVRSKGPSAGASSDIFSFGCL  277


 Score =   135 bits (340),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 66/93 (71%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IRADA +LVRLRHPGVVHVVQALDE+KNAMA+VTEPLFAS ANALG +
Sbjct  92   LSKAAEDAFLDLIRADAGKLVRLRHPGVVHVVQALDENKNAMALVTEPLFASVANALGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+  VPK+LK +EM LLEVK  +  +   L F
Sbjct  152  ENVANVPKDLKSMEMSLLEVKHGLLQISETLNF  184



>ref|XP_009127867.1| PREDICTED: SCY1-like protein 2 [Brassica rapa]
Length=896

 Score =   166 bits (420),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ++ETL+FLH+NA+L+HRAISPE VLITS+G+WKLAGF FA+ST   + +  NMQ
Sbjct  172  KHGLLQISETLNFLHSNAQLIHRAISPENVLITSSGSWKLAGFGFAIST-AQAGNLDNMQ  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SFHY+EYDVEDSI+P+QPSLNYTAPELVRS + S G SSDIFSFGCL
Sbjct  231  SFHYSEYDVEDSILPVQPSLNYTAPELVRSKSPSAGASSDIFSFGCL  277


 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IR DA +LVRLRHPGVVHVVQALDE+KNAMA+VTEPLFAS ANALG +
Sbjct  92   LSKAAEDAFLDLIRGDAGKLVRLRHPGVVHVVQALDENKNAMALVTEPLFASVANALGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+  VPK+LK +EM LLEVK  +  +   L F
Sbjct  152  ENVADVPKDLKSMEMSLLEVKHGLLQISETLNF  184



>emb|CDY03692.1| BnaA02g15450D [Brassica napus]
Length=896

 Score =   166 bits (420),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ++ETL+FLH+NA+L+HRAISPE VLITS+G+WKLAGF FA+ST   + +  NMQ
Sbjct  172  KHGLLQISETLNFLHSNAQLIHRAISPENVLITSSGSWKLAGFGFAIST-AQAGNLDNMQ  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SFHY+EYDVEDSI+P+QPSLNYTAPELVRS + S G SSDIFSFGCL
Sbjct  231  SFHYSEYDVEDSILPVQPSLNYTAPELVRSKSPSAGASSDIFSFGCL  277


 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IR DA +LVRLRHPGVVHVVQALDE+KNAMA+VTEPLFAS ANALG +
Sbjct  92   LSKAAEDAFLDLIRGDAGKLVRLRHPGVVHVVQALDENKNAMALVTEPLFASVANALGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+  VPK+LK +EM LLEVK  +  +   L F
Sbjct  152  ENVADVPKDLKSMEMSLLEVKHGLLQISETLNF  184



>gb|KFK41573.1| hypothetical protein AALP_AA2G146900 [Arabis alpina]
Length=905

 Score =   166 bits (420),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ++ETL+FLHNNA L+HRAISPE VLITS+G+WKLAGF FA+ST   + +  NMQ
Sbjct  172  KHGLLQISETLNFLHNNAHLIHRAISPENVLITSSGSWKLAGFGFAIST-AQAGNLDNMQ  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SFHY+EYDVEDS++P+QPSLNYTAPELVRS + S G SSDIFSFGCL
Sbjct  231  SFHYSEYDVEDSMLPVQPSLNYTAPELVRSKSPSAGASSDIFSFGCL  277


 Score =   134 bits (337),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 66/93 (71%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IRADA +LVRLRHPGVVHVVQALDE+KNAMA+VTEPLFAS ANALG +
Sbjct  92   LSKGAEDAFLDLIRADAGKLVRLRHPGVVHVVQALDENKNAMALVTEPLFASVANALGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+  VPK+LK +EM LLEVK  +  +   L F
Sbjct  152  ENVVNVPKDLKSMEMSLLEVKHGLLQISETLNF  184



>gb|KFK44375.1| hypothetical protein AALP_AA1G249300 [Arabis alpina]
Length=908

 Score =   166 bits (420),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 90/107 (84%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETL+FLHNNA L+HRA+SPE VLITS G+WKLAGF FA+S    + D  N+Q
Sbjct  169  KHGLLQIAETLNFLHNNAHLIHRAVSPENVLITSAGSWKLAGFGFAIS-EAQAGDLDNIQ  227

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             FHY+EYDVEDSI+PLQPSLNYTAPELVRS TS  G SSDIFSFGCL
Sbjct  228  LFHYSEYDVEDSILPLQPSLNYTAPELVRSKTSLAGTSSDIFSFGCL  274


 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 73/93 (78%), Gaps = 3/93 (3%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AED+F D+IRADA +LVRLRHPGVVHVVQALDE+KNAMAMVTEPLF S ANALG  
Sbjct  92   LSKAAEDSFLDLIRADAGKLVRLRHPGVVHVVQALDENKNAMAMVTEPLFTSVANALG--  149

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
             N+E V KE+K +EM LLEVK  +  +   L F
Sbjct  150  -NVENVSKEVKAVEMSLLEVKHGLLQIAETLNF  181



>ref|XP_002890539.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66798.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=912

 Score =   166 bits (420),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETL+FLHNNA L+HRA+SPE V ITS G+WKLAGF FA+S    + +  N+Q
Sbjct  172  KHGLLQIAETLNFLHNNAHLIHRAVSPENVFITSAGSWKLAGFGFAIS-EAQNRNFDNLQ  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SFHY+EYDVEDSI+PLQPSLNYTAPELVRS TSS G SSDIFSFGCL
Sbjct  231  SFHYSEYDVEDSILPLQPSLNYTAPELVRSKTSSAGVSSDIFSFGCL  277


 Score =   136 bits (342),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 65/93 (70%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IRADA +LVRLRHPGVVHVVQALDE+KNAMAMVTEPLFAS ANA+G +
Sbjct  92   LSKAAEDAFLDLIRADAGKLVRLRHPGVVHVVQALDENKNAMAMVTEPLFASVANAVGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            +N++ VPK+LK +EM LLEVK  +  +   L F
Sbjct  152  DNVDNVPKDLKAMEMSLLEVKHGLLQIAETLNF  184



>ref|XP_010415850.1| PREDICTED: SCY1-like protein 2 [Camelina sativa]
Length=910

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ++ETL+FLHNNA L+HRAISPE VLITS G+WKLAGF FA+ST   + +  NMQ
Sbjct  172  KHGLLQISETLNFLHNNANLIHRAISPENVLITSAGSWKLAGFGFAIST-AQAGNLDNMQ  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SFHY+EYDVEDSI+P+QPSLNYTAPEL+RS + S G SSDIFSFGCL
Sbjct  231  SFHYSEYDVEDSILPVQPSLNYTAPELMRSKSPSAGASSDIFSFGCL  277


 Score =   135 bits (341),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 66/93 (71%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IRADA +LVRLRHPGVVHVVQALDE+KNAMA+VTEPLFAS ANALG +
Sbjct  92   LSKAAEDAFLDLIRADAGKLVRLRHPGVVHVVQALDENKNAMALVTEPLFASVANALGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+  VPK+LK +EM LLEVK  +  +   L F
Sbjct  152  ENVANVPKDLKSMEMSLLEVKHGLLQISETLNF  184



>emb|CDY37942.1| BnaC02g20690D [Brassica napus]
Length=900

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ++ETL+FLH+NA+L+HRAISPE VLITS G+WKLAGF FA+ST   + +  NMQ
Sbjct  172  KHGLLQISETLNFLHSNAQLIHRAISPENVLITSAGSWKLAGFGFAIST-AQAGNLDNMQ  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SFHY+EYDVEDSI+P+QPSLNYTAPELVRS + S G SSDIFSFGCL
Sbjct  231  SFHYSEYDVEDSILPVQPSLNYTAPELVRSKSPSAGASSDIFSFGCL  277


 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IR DA +LVRLRHPGVVHVVQALDE+KNAMA+VTEPLFAS ANALG +
Sbjct  92   LSKAAEDAFLDLIRGDAGKLVRLRHPGVVHVVQALDENKNAMALVTEPLFASVANALGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+  VPK+LK +EM LLEVK  +  +   L F
Sbjct  152  ENVADVPKDLKSMEMSLLEVKHGLLQISETLNF  184



>emb|CDX72804.1| BnaC06g32520D [Brassica napus]
Length=881

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ++ETL+FLHNNA+L+HRAISPE VLITS G+WKLAGF FA+S    + +  NMQ
Sbjct  172  KHGLLQISETLNFLHNNAQLIHRAISPENVLITSAGSWKLAGFGFAISA-AHAGNLDNMQ  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SFHY+EYDVEDS++P+QPSLNYTAPELVRS + S G SSDIFSFGCL
Sbjct  231  SFHYSEYDVEDSMLPVQPSLNYTAPELVRSKSPSAGVSSDIFSFGCL  277


 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IRADA +LVRLRHPGVVHVVQALDE+KNAMA+VTEPLFAS ANAL  +
Sbjct  92   LSKAAEDAFLDLIRADAGKLVRLRHPGVVHVVQALDENKNAMALVTEPLFASVANALRNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+  VPK+LK +EM LLEVK  +  +   L F
Sbjct  152  ENVANVPKDLKSMEMSLLEVKHGLLQISETLNF  184



>gb|AES87595.2| ARM repeat kinase family protein [Medicago truncatula]
Length=928

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AE+LDFLHN+A L+HRAI+PE V IT +GAWKL GF FA+S+  ++ D SN+ 
Sbjct  172  KHGLLQIAESLDFLHNHAHLIHRAIAPENVFITLSGAWKLGGFGFAISSQ-NTGDSSNLH  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHYAEYDVEDS++PLQPS+NYTAPE+VRS  SS GC SDIFSFGCL
Sbjct  231  AFHYAEYDVEDSVLPLQPSINYTAPEMVRSTASSAGCYSDIFSFGCL  277


 Score =   137 bits (346),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 64/93 (69%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            L+K AEDAF D+IR DA ++VRLRHPG+VHVVQ LDESKNAMAMVTEPLFAS AN LG L
Sbjct  92   LTKAAEDAFLDLIRMDAGKMVRLRHPGIVHVVQGLDESKNAMAMVTEPLFASVANTLGKL  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            +N++ VPK+LKG+EMGLLEVK  +  +  +L F
Sbjct  152  DNVQSVPKDLKGMEMGLLEVKHGLLQIAESLDF  184



>ref|XP_010498773.1| PREDICTED: SCY1-like protein 2 isoform X2 [Camelina sativa]
Length=913

 Score =   163 bits (413),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETL+FLHNNA L+HRA+SPE V ITS G+WKLAGF FA+S      +  NMQ
Sbjct  172  KHGLLQIAETLNFLHNNAHLIHRAVSPENVFITSAGSWKLAGFGFAIS-EAQDGNLDNMQ  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SFHY+EYDVEDSI+PLQPSLNYTAPELVRS T S G  SDIFSFGCL
Sbjct  231  SFHYSEYDVEDSILPLQPSLNYTAPELVRSETPSAGVFSDIFSFGCL  277


 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IRADA +LVRLRHPGVVHVVQA+DE+KNAMAMVTEPLFAS ANALG +
Sbjct  92   LSKAAEDAFLDLIRADAGKLVRLRHPGVVHVVQAIDENKNAMAMVTEPLFASVANALGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN++ VPK+LK +EM LLEVK  +  +   L F
Sbjct  152  ENVDNVPKDLKSMEMSLLEVKHGLLQIAETLNF  184



>ref|XP_010471155.1| PREDICTED: SCY1-like protein 2 [Camelina sativa]
Length=909

 Score =   163 bits (413),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ++ETL+FLHNNA L+HRAISPE VLITS G+WKLAGF FA+S    + +  NMQ
Sbjct  172  KHGLLQISETLNFLHNNANLIHRAISPENVLITSAGSWKLAGFGFAISA-AQAGNLDNMQ  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SFHY+EYDVEDSI+P+QPSLNYTAPEL+RS + S G SSDIFSFGCL
Sbjct  231  SFHYSEYDVEDSILPVQPSLNYTAPELMRSKSPSAGASSDIFSFGCL  277


 Score =   135 bits (341),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 66/93 (71%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IRADA +LVRLRHPGVVHVVQALDE+KNAMA+VTEPLFAS ANALG +
Sbjct  92   LSKAAEDAFLDLIRADAGKLVRLRHPGVVHVVQALDENKNAMALVTEPLFASVANALGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+  VPK+LK +EM LLEVK  +  +   L F
Sbjct  152  ENVANVPKDLKSMEMSLLEVKHGLLQISETLNF  184



>ref|NP_177297.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAG51833.1|AC016163_22 hypothetical protein; 58558-63003 [Arabidopsis thaliana]
 dbj|BAD93866.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE35198.1| putative protein kinase [Arabidopsis thaliana]
Length=909

 Score =   163 bits (413),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ++ETL+FLHNNA L+HRAISPE VLITS G+WKLAGF FA+S    + +  NMQ
Sbjct  172  KHGLLQISETLNFLHNNANLIHRAISPENVLITSAGSWKLAGFGFAISA-AQAGNLDNMQ  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SFHY+EYDVEDSI+P+QPSLNYTAPEL+RS + S G SSDIFSFGCL
Sbjct  231  SFHYSEYDVEDSILPVQPSLNYTAPELMRSKSPSAGASSDIFSFGCL  277


 Score =   135 bits (339),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 66/93 (71%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IRADA +LVRLRHPGVVHVVQALDE+KNAMA+VTEPLFAS ANALG +
Sbjct  92   LSKAAEDAFLDLIRADAGKLVRLRHPGVVHVVQALDENKNAMALVTEPLFASVANALGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+  VPK+LK +EM LLEVK  +  +   L F
Sbjct  152  ENVGNVPKDLKSMEMSLLEVKHGLLQISETLNF  184



>ref|XP_010498772.1| PREDICTED: SCY1-like protein 2 isoform X1 [Camelina sativa]
Length=917

 Score =   163 bits (412),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETL+FLHNNA L+HRA+SPE V ITS G+WKLAGF FA+S      +  NMQ
Sbjct  172  KHGLLQIAETLNFLHNNAHLIHRAVSPENVFITSAGSWKLAGFGFAIS-EAQDGNLDNMQ  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SFHY+EYDVEDSI+PLQPSLNYTAPELVRS T S G  SDIFSFGCL
Sbjct  231  SFHYSEYDVEDSILPLQPSLNYTAPELVRSETPSAGVFSDIFSFGCL  277


 Score =   138 bits (347),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 66/93 (71%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IRADA +LVRLRHPGVVHVVQA+DE+KNAMAMVTEPLFAS ANALG +
Sbjct  92   LSKAAEDAFLDLIRADAGKLVRLRHPGVVHVVQAIDENKNAMAMVTEPLFASVANALGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN++ VPK+LK +EM LLEVK  +  +   L F
Sbjct  152  ENVDNVPKDLKSMEMSLLEVKHGLLQIAETLNF  184



>emb|CDX96321.1| BnaA07g29320D [Brassica napus]
Length=877

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ++ETL+FLHNNA+L+HRAISPE VLITS G+WKLAGF FA+S    + +  N Q
Sbjct  172  KHGLLQISETLNFLHNNAQLIHRAISPENVLITSAGSWKLAGFGFAISA-AQAGNLDNKQ  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SFHY+EYDVEDS++P+QPSLNYTAPELVRS + S G SSDIFSFGCL
Sbjct  231  SFHYSEYDVEDSMLPVQPSLNYTAPELVRSKSPSAGASSDIFSFGCL  277


 Score =   135 bits (339),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IRADA +LVRLRHPGVVHVVQALDE+KNAMA+VTEPL AS ANALG +
Sbjct  92   LSKAAEDAFLDLIRADAGKLVRLRHPGVVHVVQALDENKNAMALVTEPLVASVANALGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+  VPK+LK +EM LLEVK  +  +   L F
Sbjct  152  ENVANVPKDLKSMEMSLLEVKHGLLQISETLNF  184



>ref|XP_006300351.1| hypothetical protein CARUB_v10021914mg [Capsella rubella]
 gb|EOA33249.1| hypothetical protein CARUB_v10021914mg [Capsella rubella]
Length=914

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ++ETL+FLHNNA L+HRAISPE VLITS G+WKLAGF FA+S +  + +  +MQ
Sbjct  172  KHGLLQISETLNFLHNNANLIHRAISPENVLITSAGSWKLAGFGFAISAS-QAGNLDHMQ  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SFHY+EYDVEDSI+P+QPSLNYTAPEL+RS + S G SSDIFSFGCL
Sbjct  231  SFHYSEYDVEDSILPVQPSLNYTAPELMRSKSPSAGASSDIFSFGCL  277


 Score =   135 bits (340),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 66/93 (71%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IRADA +LVRLRHPGVVHVVQALDE+KNAMA+VTEPLFAS ANALG +
Sbjct  92   LSKAAEDAFLDLIRADAGKLVRLRHPGVVHVVQALDENKNAMALVTEPLFASVANALGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+  VPK+LK +EM LLEVK  +  +   L F
Sbjct  152  ENVANVPKDLKSMEMSLLEVKHGLLQISETLNF  184



>ref|XP_004141537.1| PREDICTED: SCY1-like protein 2-like [Cucumis sativus]
 gb|KGN52653.1| hypothetical protein Csa_5G648740 [Cucumis sativus]
Length=931

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQLAE+L+FLH+NA L+HRAISPE VLITSNGAWKLAGF FA+  + +S D + MQ
Sbjct  172  KHGLLQLAESLNFLHSNAHLIHRAISPENVLITSNGAWKLAGFCFAIPADQTSGDMATMQ  231

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FH+AEYDVEDS++PLQPSLNYTAPELVRS +S   CSSDIFSFGCL
Sbjct  232  AFHFAEYDVEDSVLPLQPSLNYTAPELVRSKSSLASCSSDIFSFGCL  278


 Score =   140 bits (353),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 67/93 (72%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK+ ED+F D+IRADA RLVRLRHPGVVHVVQALDE+KNAMAMVTEPLFAS AN +G +
Sbjct  92   LSKSVEDSFLDLIRADAGRLVRLRHPGVVHVVQALDENKNAMAMVTEPLFASVANVIGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            ENI KVPKEL G+EMGLLE+K  +  +  +L F
Sbjct  152  ENIAKVPKELNGLEMGLLEIKHGLLQLAESLNF  184



>ref|XP_002888835.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65094.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=899

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ++ETL+FLHNNA L+HRAISPE VLITS G+WKLAGF FA+ST   + +  N+Q
Sbjct  172  KHGLLQISETLNFLHNNASLIHRAISPENVLITSAGSWKLAGFGFAIST-AQAGNLDNVQ  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHY+EYDVEDSI+P+QPSLNYTAPEL+RS + S G SSDIFSFGCL
Sbjct  231  AFHYSEYDVEDSILPVQPSLNYTAPELMRSKSPSAGASSDIFSFGCL  277


 Score =   135 bits (340),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 66/93 (71%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IRADA +LVRLRHPGVVHVVQALDE+KNAMA+VTEPLFAS ANALG +
Sbjct  92   LSKGAEDAFLDLIRADAGKLVRLRHPGVVHVVQALDENKNAMALVTEPLFASVANALGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+  VPK+LK +EM LLEVK  +  +   L F
Sbjct  152  ENVANVPKDLKSMEMSLLEVKHGLLQISETLNF  184



>gb|EAY74967.1| hypothetical protein OsI_02864 [Oryza sativa Indica Group]
Length=949

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ++ETLDFLHNNA L HRAISPETV ITSNG+WKL GF FALS + ++   ++ Q
Sbjct  172  KHGLLQVSETLDFLHNNAHLAHRAISPETVFITSNGSWKLGGFGFALSVDQATGSLTSTQ  231

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             FHY++YDVED+ +PLQPSLNYTAPELVRS  S +G + DIFSFGCL
Sbjct  232  QFHYSDYDVEDTALPLQPSLNYTAPELVRSGDSKVGSACDIFSFGCL  278


 Score =   139 bits (350),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 68/93 (73%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            L+K AEDAF D+ RADAARLVRLRHPGV+HVVQALDE+K AMAM TEP+FAS ANALG L
Sbjct  92   LTKAAEDAFLDLARADAARLVRLRHPGVLHVVQALDETKAAMAMATEPVFASVANALGCL  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            +N+ KVPKELKG+EMGLLEVK  +  V   L F
Sbjct  152  DNVGKVPKELKGMEMGLLEVKHGLLQVSETLDF  184



>ref|XP_010913247.1| PREDICTED: SCY1-like protein 2 [Elaeis guineensis]
Length=924

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETLDFLHNNA LVHRAISPETV IT++GAWKL GF FA+S +  S   ++ Q
Sbjct  172  KHGLLQIAETLDFLHNNAHLVHRAISPETVFITASGAWKLGGFGFAVSIDQVSGGLTSTQ  231

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             FHY EYDVEDS++PLQPSLNYTAPELVR+   + G SSDIFS GCL
Sbjct  232  QFHYPEYDVEDSMLPLQPSLNYTAPELVRNKAPTAGYSSDIFSLGCL  278


 Score =   142 bits (358),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 70/93 (75%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D++RADAARLVR+RHPGVVHVVQALDESK AMAMVTEPLFAS ANALG  
Sbjct  92   LSKAAEDAFLDLLRADAARLVRIRHPGVVHVVQALDESKTAMAMVTEPLFASVANALGNH  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            +N+ KVPKELKG+EMGLLEVK  +  +   L F
Sbjct  152  DNVPKVPKELKGMEMGLLEVKHGLLQIAETLDF  184



>dbj|BAF01849.1| hypothetical protein [Arabidopsis thaliana]
Length=909

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 90/107 (84%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ++ETL+FLHNNA L+HRAISPE VLI S G+WKLAGF FA+S    + +  NMQ
Sbjct  172  KHGLLQISETLNFLHNNANLIHRAISPENVLIISAGSWKLAGFGFAISA-AQAGNLDNMQ  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SFHY+EYDVEDSI+P+QPSLNYTAPEL+RS + S G SSDIFSFGCL
Sbjct  231  SFHYSEYDVEDSILPVQPSLNYTAPELMRSKSPSAGASSDIFSFGCL  277


 Score =   135 bits (339),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 66/93 (71%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IRADA +LVRLRHPGVVHVVQALDE+KNAMA+VTEPLFAS ANALG +
Sbjct  92   LSKAAEDAFLDLIRADAGKLVRLRHPGVVHVVQALDENKNAMALVTEPLFASVANALGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+  VPK+LK +EM LLEVK  +  +   L F
Sbjct  152  ENVGNVPKDLKSMEMSLLEVKHGLLQISETLNF  184



>gb|EMT11865.1| SCY1-like protein 2 [Aegilops tauschii]
Length=888

 Score =   160 bits (406),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETLDFLHNNA L HRAISPETV ITS+G+WKL GF FALS + ++   ++ Q
Sbjct  77   KHGLLQVAETLDFLHNNAHLAHRAISPETVFITSSGSWKLGGFGFALSVDQATGGLASSQ  136

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             FHY++YDVED+ +PLQPSLNYTAPELVRS  S +G + DIFSFGCL
Sbjct  137  QFHYSDYDVEDTALPLQPSLNYTAPELVRSGDSKVGSTCDIFSFGCL  183


 Score = 85.5 bits (210),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +2

Query  92   VVQALDESKNAMAMVTEPLFASAANALGILENIEKVPKELKGIEMGLLEVKQWVTSVGRN  271
            V +ALDE+K AMAMVTEPLFAS +NALG L+N+ KVPKELKG+EMG+LE+K  +  V   
Sbjct  27   VQEALDETKAAMAMVTEPLFASVSNALGCLDNVGKVPKELKGMEMGILEIKHGLLQVAET  86

Query  272  LGF  280
            L F
Sbjct  87   LDF  89



>ref|XP_009105810.1| PREDICTED: SCY1-like protein 2 [Brassica rapa]
Length=877

 Score =   160 bits (406),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 90/107 (84%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ++ETL+FLHNNA+L+HRAISPE VLITS G+WKLAGF FA+S    + +  N Q
Sbjct  172  KHGLLQISETLNFLHNNAQLIHRAISPENVLITSAGSWKLAGFGFAISA-AQAGNLDNRQ  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SFHY+EYDVEDS++P+QPSLNYT PELVRS + S G SSDIFSFGCL
Sbjct  231  SFHYSEYDVEDSMLPVQPSLNYTGPELVRSKSPSAGASSDIFSFGCL  277


 Score =   135 bits (340),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 66/93 (71%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IRADA +LVRLRHPGVVHVVQALDE+KNAMA+VTEPLFAS ANALG +
Sbjct  92   LSKAAEDAFLDLIRADAGKLVRLRHPGVVHVVQALDENKNAMALVTEPLFASVANALGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+  VPK+LK +EM LLEVK  +  +   L F
Sbjct  152  ENVANVPKDLKSMEMSLLEVKHGLLQISETLNF  184



>emb|CDM83285.1| unnamed protein product [Triticum aestivum]
Length=949

 Score =   160 bits (406),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETLDFLHNNA L HRAISPETV ITS+G+WKL GF FALS + ++   ++ Q
Sbjct  172  KHGLLQVAETLDFLHNNAHLAHRAISPETVFITSSGSWKLGGFGFALSVDQATGGLASSQ  231

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             FHY++YDVED+ +PLQPSLNYTAPELVRS  S +G + DIFSFGCL
Sbjct  232  QFHYSDYDVEDTALPLQPSLNYTAPELVRSGDSKVGSTCDIFSFGCL  278


 Score =   140 bits (353),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 67/93 (72%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LS+ AEDAF D+ RADAARLVRLRHPGV+HVVQALDE+K AMAMVTEPLFAS +NALG L
Sbjct  92   LSRAAEDAFLDLARADAARLVRLRHPGVLHVVQALDETKAAMAMVTEPLFASVSNALGCL  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            +N+ KVPKELKG+EMG+LE+K  +  V   L F
Sbjct  152  DNVGKVPKELKGMEMGILEIKHGLLQVAETLDF  184



>ref|XP_002455952.1| hypothetical protein SORBIDRAFT_03g027880 [Sorghum bicolor]
 gb|EES01072.1| hypothetical protein SORBIDRAFT_03g027880 [Sorghum bicolor]
Length=959

 Score =   160 bits (405),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETLDFLHNNA L HRAISPETV ITSNG+WKL GF FALS + ++   ++ Q
Sbjct  172  KHGLLQVAETLDFLHNNAHLAHRAISPETVFITSNGSWKLGGFGFALSVDQATGGLTSSQ  231

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             FHY++YDVED+ +PLQPSLNYTAPELVRS  S +G + D+FSFGCL
Sbjct  232  LFHYSDYDVEDTALPLQPSLNYTAPELVRSGDSKVGSACDMFSFGCL  278


 Score =   142 bits (357),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 68/93 (73%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D++RADAARLVRLRHPGV+HVVQALDE+K AMAM TEP+FAS ANALG L
Sbjct  92   LSKAAEDAFLDLVRADAARLVRLRHPGVLHVVQALDETKAAMAMATEPVFASVANALGCL  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            +N+ KVPKELKG+EMGLLE+K  +  V   L F
Sbjct  152  DNVGKVPKELKGMEMGLLEIKHGLLQVAETLDF  184



>ref|XP_008675496.1| PREDICTED: SCY1-like protein 2 [Zea mays]
 tpg|DAA58977.1| TPA: hypothetical protein ZEAMMB73_586293 [Zea mays]
 tpg|DAA58978.1| TPA: hypothetical protein ZEAMMB73_586293 [Zea mays]
Length=959

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETLDFLHNNA L HRAISPETV ITSNG+WKL GF FALS + ++   ++ Q
Sbjct  172  KHGLLQVAETLDFLHNNAHLAHRAISPETVFITSNGSWKLGGFGFALSVDQATGGLTSSQ  231

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             FHY++YDVED+ +PLQPSLNYTAPELVRS  S +G + D+FSFGCL
Sbjct  232  LFHYSDYDVEDTALPLQPSLNYTAPELVRSGDSKVGSACDMFSFGCL  278


 Score =   142 bits (357),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 68/93 (73%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D++RADAARLVRLRHPGV+HVVQALDE+K AMAM TEP+FAS ANALG L
Sbjct  92   LSKAAEDAFLDLVRADAARLVRLRHPGVLHVVQALDETKAAMAMATEPVFASVANALGCL  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            +N+ KVPKELKG+EMGLLE+K  +  V   L F
Sbjct  152  DNVGKVPKELKGMEMGLLEIKHGLLQVAETLDF  184



>ref|XP_010427973.1| PREDICTED: SCY1-like protein 2 [Camelina sativa]
Length=909

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ++ETL+FLHNNA L+HRAISPE VLITS G+WKLAGF FA+S    + +  +MQ
Sbjct  172  KHGLLQISETLNFLHNNANLIHRAISPENVLITSAGSWKLAGFGFAISA-AQAGNLDHMQ  230

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SFHY+EYDVEDSI+P+QPSLNY+APEL+RS + S G SSDIFSFGCL
Sbjct  231  SFHYSEYDVEDSILPVQPSLNYSAPELMRSKSPSAGASSDIFSFGCL  277


 Score =   135 bits (340),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 66/93 (71%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+IRADA +LVRLRHPGVVHVVQALDE+KNAMA+VTEPLFAS ANALG +
Sbjct  92   LSKAAEDAFLDLIRADAGKLVRLRHPGVVHVVQALDENKNAMALVTEPLFASVANALGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+  VPK+LK +EM LLEVK  +  +   L F
Sbjct  152  ENVANVPKDLKSMEMSLLEVKHGLLQISETLNF  184



>ref|XP_010677079.1| PREDICTED: SCY1-like protein 2 [Beta vulgaris subsp. vulgaris]
Length=919

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AE+LDFLHNNA LVHRAISPE+VLIT+ GAWKL GF F +S + +++ PS  Q
Sbjct  175  KHGLLQVAESLDFLHNNANLVHRAISPESVLITAGGAWKLGGFGFTISNDQAAASPS-AQ  233

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             FHY EYDVEDS++PLQPSLNYTAPELVRS     G SSDIFSFGCL
Sbjct  234  VFHYVEYDVEDSVLPLQPSLNYTAPELVRSKDFCGGRSSDIFSFGCL  280


 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 75/94 (80%), Gaps = 1/94 (1%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK  ED+F +++R DAARLVR+RHPGVVH+VQALDE+KNAMA VTEPLFAS ANALG L
Sbjct  94   LSKALEDSFLEVLRNDAARLVRIRHPGVVHLVQALDETKNAMAFVTEPLFASVANALGDL  153

Query  182  ENIEKVPKELKG-IEMGLLEVKQWVTSVGRNLGF  280
             N+  VPKELK  +EMGLLEVK  +  V  +L F
Sbjct  154  HNVGNVPKELKSAMEMGLLEVKHGLLQVAESLDF  187



>gb|EAZ12691.1| hypothetical protein OsJ_02609 [Oryza sativa Japonica Group]
Length=949

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ++ETLDFLHNNA L HRAISPETV IT NG+WKL GF FALS + ++   ++ Q
Sbjct  172  KHGLLQVSETLDFLHNNAHLAHRAISPETVFITLNGSWKLGGFGFALSVDQATGSLTSTQ  231

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             FHY++YDVED+ +PLQPSLNYTAPELVRS  S +G + DIFSFGCL
Sbjct  232  QFHYSDYDVEDTALPLQPSLNYTAPELVRSGDSKVGSACDIFSFGCL  278


 Score =   139 bits (350),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 68/93 (73%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            L+K AEDAF D+ RADAARLVRLRHPGV+HVVQALDE+K AMAM TEP+FAS ANALG L
Sbjct  92   LTKAAEDAFLDLARADAARLVRLRHPGVLHVVQALDETKAAMAMATEPVFASVANALGCL  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            +N+ KVPKELKG+EMGLLEVK  +  V   L F
Sbjct  152  DNVGKVPKELKGMEMGLLEVKHGLLQVSETLDF  184



>ref|XP_004969167.1| PREDICTED: SCY1-like protein 2-like [Setaria italica]
Length=960

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETLDFLHNNA L HRAISPETV ITS+G+WKL GF FALS + ++   ++ Q
Sbjct  172  KHGLLQVAETLDFLHNNAHLAHRAISPETVFITSSGSWKLGGFGFALSVDQATGRLTSSQ  231

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             FHY++YDVED+ +PLQPSLNYTAPELVRS  S +G + D+FSFGCL
Sbjct  232  QFHYSDYDVEDTALPLQPSLNYTAPELVRSGDSKVGSACDMFSFGCL  278


 Score =   140 bits (353),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 67/93 (72%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D++RADAARLVRLRHPGV+HVVQALDE+K AMAM TEP+FAS +NALG L
Sbjct  92   LSKAAEDAFLDLVRADAARLVRLRHPGVLHVVQALDETKAAMAMATEPVFASVSNALGCL  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            +N+ KVPKELKG+EMGLLE+K  +  V   L F
Sbjct  152  DNVGKVPKELKGMEMGLLEIKHGLLQVAETLDF  184



>ref|XP_003569359.1| PREDICTED: SCY1-like protein 2 [Brachypodium distachyon]
Length=965

 Score =   159 bits (402),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETLDFLHNNA L HRAISPE+V ITS+G+WKL GF FALS + ++   ++ Q
Sbjct  172  KHGLLQVAETLDFLHNNAHLAHRAISPESVFITSSGSWKLGGFGFALSVDQATGGLTSSQ  231

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             FHY++YDVED+ +PLQPSLNYTAPELVRS  S +G + DIFSFGCL
Sbjct  232  QFHYSDYDVEDTALPLQPSLNYTAPELVRSGDSKVGSTCDIFSFGCL  278


 Score =   141 bits (355),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 68/93 (73%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+ RADAARLVRLRHPGV+HVVQALDE+K AMAMVTEPLFAS +NALG L
Sbjct  92   LSKAAEDAFLDLTRADAARLVRLRHPGVLHVVQALDETKAAMAMVTEPLFASVSNALGCL  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            +N+ KVPKELKG+EMG+LE+K  +  V   L F
Sbjct  152  DNVGKVPKELKGMEMGILEIKHGLLQVAETLDF  184



>gb|AAB72172.1| hypothetical protein [Arabidopsis thaliana]
Length=759

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 90/118 (76%), Gaps = 12/118 (10%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETL+FLHNNA L+HRA+SPE V ITS G+WKLAGF FA+S      +  N+Q
Sbjct  7    KHGLLQIAETLNFLHNNAHLIHRAVSPENVFITSAGSWKLAGFGFAIS-QAQDGNLDNLQ  65

Query  423  SFHYA-----------EYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SFHY+           EYDVEDSI+PLQPSLNYTAPELVRS TSS G SSDIFSFGCL
Sbjct  66   SFHYSVDEYPMHGSMQEYDVEDSILPLQPSLNYTAPELVRSKTSSAGVSSDIFSFGCL  123



>ref|XP_006646100.1| PREDICTED: SCY1-like protein 2-like [Oryza brachyantha]
Length=913

 Score =   158 bits (399),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ++ETLDFLHNNA L HRAISPETV ITS+G+WKL GF FALS + ++   ++ Q
Sbjct  125  KHGLLQVSETLDFLHNNAHLAHRAISPETVFITSSGSWKLGGFGFALSVDQATGSLTSTQ  184

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             FHY++YDVED+ +PLQPSLNYTAPELVRS  S  G + DIFSFGCL
Sbjct  185  QFHYSDYDVEDTALPLQPSLNYTAPELVRSGDSKAGLACDIFSFGCL  231


 Score =   142 bits (357),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 69/93 (74%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D+ RADAARLVRLRHPGV+HVVQALDE+K AMAM TEPLFAS ANALG L
Sbjct  45   LSKAAEDAFLDLTRADAARLVRLRHPGVLHVVQALDETKAAMAMATEPLFASVANALGCL  104

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            +N+ KVPKELKG+EMGLLE+K  +  V   L F
Sbjct  105  DNVGKVPKELKGMEMGLLEIKHGLLQVSETLDF  137



>gb|KHG23607.1| SCY1-like protein 2 [Gossypium arboreum]
Length=760

 Score =   156 bits (395),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 96/107 (90%), Gaps = 2/107 (2%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AE+L+FLH NARL+HRAISPE VLITS+GAWKL GF FA+ST+ +SSD  +++
Sbjct  7    KHGLLQIAESLEFLHTNARLIHRAISPENVLITSSGAWKLGGFGFAISTDQASSD--SVK  64

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHY+EYD EDS+MPLQPSLNYTAPELVRS +SS+G SSDIFS+GCL
Sbjct  65   AFHYSEYDTEDSVMPLQPSLNYTAPELVRSKSSSVGWSSDIFSYGCL  111



>gb|KJB59598.1| hypothetical protein B456_009G262900 [Gossypium raimondii]
Length=925

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 95/107 (89%), Gaps = 2/107 (2%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AE+L+FLH NARL+HRAISPE VLITS+GAWKL GF FA+ST+ +SSD   ++
Sbjct  172  KHGLLQIAESLEFLHTNARLIHRAISPENVLITSSGAWKLGGFGFAISTDQASSD--FVK  229

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +FHY+EYD EDS+MPLQPSLNYTAPELVRS +SS+G SSDIFS+GCL
Sbjct  230  AFHYSEYDTEDSVMPLQPSLNYTAPELVRSKSSSVGWSSDIFSYGCL  276


 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            +SK  ED+FFD+IRADAARLVRLRHPGVVHVVQALDE+KNAM MVTEPLFAS ANA+G +
Sbjct  92   ISKIVEDSFFDLIRADAARLVRLRHPGVVHVVQALDENKNAMTMVTEPLFASVANAIGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+ KVPK+LKGIEM LLEVK  +  +  +L F
Sbjct  152  ENVAKVPKDLKGIEMSLLEVKHGLLQIAESLEF  184



>ref|XP_006852429.1| hypothetical protein AMTR_s00021p00078920 [Amborella trichopoda]
 gb|ERN13896.1| hypothetical protein AMTR_s00021p00078920 [Amborella trichopoda]
Length=898

 Score =   155 bits (392),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+ E++DFLHNNARL+HRAISPE V ITSNGAWKL  F F +  + +  D S +Q
Sbjct  172  KHGLLQITESIDFLHNNARLIHRAISPEAVFITSNGAWKLGAFGFTIPADQNPGDLSTVQ  231

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             FHY EYDV+D +MPLQPSL+Y+APELVRS     GC SDIFS GCL
Sbjct  232  PFHYPEYDVDDLVMPLQPSLDYSAPELVRSQAGLAGCLSDIFSLGCL  278


 Score =   135 bits (340),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 61/93 (66%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF ++++ADA+RLVRLRHPGVVHVVQ LDE+KN+MAMVTEP+FAS AN LG+ 
Sbjct  92   LSKAAEDAFMELVKADASRLVRLRHPGVVHVVQGLDETKNSMAMVTEPIFASVANVLGVF  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            +NI  VPKELKG+EMG+LE+K  +  +  ++ F
Sbjct  152  DNIGSVPKELKGLEMGVLEIKHGLLQITESIDF  184



>ref|XP_009393077.1| PREDICTED: SCY1-like protein 2 [Musa acuminata subsp. malaccensis]
Length=924

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 89/107 (83%), Gaps = 2/107 (2%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +G+LQ+AETLDFLHN ARLVH++ISPE+V IT +GAWKL GF FA+S + ++    + Q
Sbjct  172  KHGMLQIAETLDFLHNQARLVHQSISPESVFITLSGAWKLGGFGFAISLDQATG--GSTQ  229

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             FHY+EYDVEDS++PLQPSLNYTAPELVR+ T++ G S D+FSFGCL
Sbjct  230  PFHYSEYDVEDSVLPLQPSLNYTAPELVRNKTTTSGSSCDMFSFGCL  276


 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK AEDAF D++RADAARLVR+RHPGV+HVVQALDESKNA+AMVTEP+FAS ANALG L
Sbjct  92   LSKAAEDAFLDLVRADAARLVRIRHPGVLHVVQALDESKNAIAMVTEPVFASVANALGHL  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            +N+ +VPKEL G+EMGLLEVK  +  +   L F
Sbjct  152  DNVPRVPKELNGMEMGLLEVKHGMLQIAETLDF  184



>ref|XP_008654448.1| PREDICTED: uncharacterized protein LOC100194347 isoform X1 [Zea 
mays]
Length=961

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPS--N  416
             +GLLQ+AETLDFLHNNA L HRAISPETV ITSNG+WKL GF FALS + ++   S  +
Sbjct  172  KHGLLQVAETLDFLHNNAHLAHRAISPETVFITSNGSWKLGGFGFALSVDQAAVGLSLTS  231

Query  417  MQSFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             Q FHY++YDVED+ +PLQPSLNYTAPELV+S  S +G + D+FSFGCL
Sbjct  232  SQLFHYSDYDVEDTALPLQPSLNYTAPELVQSRDSKVGSACDMFSFGCL  280


 Score =   139 bits (350),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 66/93 (71%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            +SK AEDAF D++RADAARLVRLRHPGV+HVVQALDE+K AMAM TEP+FAS ANALG L
Sbjct  92   MSKAAEDAFLDLVRADAARLVRLRHPGVLHVVQALDETKAAMAMATEPVFASVANALGCL  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            +N+ KVPKE+KG+EMGLLE+K  +  V   L F
Sbjct  152  DNVGKVPKEVKGMEMGLLEIKHGLLQVAETLDF  184



>emb|CDP07807.1| unnamed protein product [Coffea canephora]
Length=743

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AETLDFLHNNA L+HR+++PET+LITSNGA KL GF FA+ST+ SSS      
Sbjct  174  KHGLLQIAETLDFLHNNAHLIHRSVAPETILITSNGALKLGGFGFAISTDQSSSQFQLKS  233

Query  423  SFH--YAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            S    + EYDVE+SI+PLQP+L+YTAPELVRS TS++G +SDIFSF CL
Sbjct  234  SLMLPFQEYDVENSILPLQPALDYTAPELVRSKTSTVGSASDIFSFACL  282


 Score =   144 bits (363),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 71/93 (76%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LS  AEDAF D++RADA+RLVRLRHPGVVHVV ALDESKNAMAMVT+PLFASAANALG L
Sbjct  94   LSNAAEDAFLDVLRADASRLVRLRHPGVVHVVHALDESKNAMAMVTKPLFASAANALGNL  153

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+EKVPKELKG+EM LLEVK  +  +   L F
Sbjct  154  ENVEKVPKELKGMEMRLLEVKHGLLQIAETLDF  186



>ref|XP_003605398.1| SCY1-like protein [Medicago truncatula]
Length=989

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 91/130 (70%), Gaps = 24/130 (18%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AE+LDFLHN+A L+HRAI+PE V IT +GAWKL GF FA+S+  ++ D SN+ 
Sbjct  172  KHGLLQIAESLDFLHNHAHLIHRAIAPENVFITLSGAWKLGGFGFAISSQ-NTGDSSNLH  230

Query  423  SFHYA-----------------------EYDVEDSIMPLQPSLNYTAPELVRSNTSSIGC  533
            +FHYA                       EYDVEDS++PLQPS+NYTAPE+VRS  SS GC
Sbjct  231  AFHYAVSGTFDKIRIFYIDIVYFTYMFNEYDVEDSVLPLQPSINYTAPEMVRSTASSAGC  290

Query  534  SSDIFSFGCL  563
             SDIFSFGCL
Sbjct  291  YSDIFSFGCL  300


 Score =   138 bits (347),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 64/93 (69%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            L+K AEDAF D+IR DA ++VRLRHPG+VHVVQ LDESKNAMAMVTEPLFAS AN LG L
Sbjct  92   LTKAAEDAFLDLIRMDAGKMVRLRHPGIVHVVQGLDESKNAMAMVTEPLFASVANTLGKL  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            +N++ VPK+LKG+EMGLLEVK  +  +  +L F
Sbjct  152  DNVQSVPKDLKGMEMGLLEVKHGLLQIAESLDF  184



>gb|KDO45470.1| hypothetical protein CISIN_1g0453201mg, partial [Citrus sinensis]
Length=199

 Score =   137 bits (346),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            L+K+AEDAF D++RADA +LVRLRHPG+VHVVQA+DE+KNAMAMVTEPLFAS AN LG  
Sbjct  93   LTKSAEDAFLDLVRADAGKLVRLRHPGIVHVVQAMDENKNAMAMVTEPLFASVANVLGNF  152

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+ KVP+ELKG+EM LLE+K  +  +  +L F
Sbjct  153  ENVSKVPRELKGLEMSLLEMKHGLLQIAESLEF  185


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISP  323
             +GLLQ+AE+L+FLH+NARL+HRAISP
Sbjct  173  KHGLLQIAESLEFLHSNARLIHRAISP  199



>gb|KDO45469.1| hypothetical protein CISIN_1g0453204mg, partial [Citrus sinensis]
Length=140

 Score =   134 bits (338),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  330  VLITSNGAWKLAGFSFALSTNPSSSDPSNMQSFHYAEYDVEDSIMPLQPSLNYTAPELVR  509
            +LITSNGAWKL GF FA+ST+ + SD SN+Q+FHYAEYDVEDS++PLQPSLNYTAPELVR
Sbjct  2    ILITSNGAWKLGGFGFAISTDQAISDSSNVQAFHYAEYDVEDSMLPLQPSLNYTAPELVR  61

Query  510  SNTSSIGCSSDIFSFGCL  563
            S T+S GCSSDIFSFGC+
Sbjct  62   SKTNSFGCSSDIFSFGCV  79



>ref|XP_002525488.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF36846.1| ATP binding protein, putative [Ricinus communis]
Length=916

 Score =   144 bits (364),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 71/93 (76%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK+AED+F D+IRADA +LVRLRHPGVVHVVQALDE+KNAMAMVTEPLFAS ANALG L
Sbjct  93   LSKSAEDSFLDVIRADAGQLVRLRHPGVVHVVQALDENKNAMAMVTEPLFASVANALGNL  152

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+ KVPKELKG+EMGLLEVK  +  +  +L F
Sbjct  153  ENVMKVPKELKGMEMGLLEVKHGLLQIAESLDF  185


 Score =   117 bits (294),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 71/107 (66%), Gaps = 8/107 (7%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQ+AE+LDFLHNNARL+HRAISPE   +            +AL           + 
Sbjct  173  KHGLLQIAESLDFLHNNARLIHRAISPEVFSLH-------ICLKYALCELYLFLLLFFLM  225

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
                 EYDVEDSI+PLQPSLNYTAPELVRS + S GCSSDIFSFGCL
Sbjct  226  GV-IQEYDVEDSILPLQPSLNYTAPELVRSKSPSAGCSSDIFSFGCL  271



>ref|XP_004164535.1| PREDICTED: LOW QUALITY PROTEIN: SCY1-like protein 2-like [Cucumis 
sativus]
Length=927

 Score =   140 bits (354),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 67/93 (72%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LSK+ ED+F D+IRADA RLVRLRHPGVVHVVQALDE+KNAMAMVTEPLFAS AN +G +
Sbjct  92   LSKSVEDSFLDLIRADAGRLVRLRHPGVVHVVQALDENKNAMAMVTEPLFASVANVIGNV  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            ENI KVPKEL G+EMGLLE+K  +  +  +L F
Sbjct  152  ENIAKVPKELNGLEMGLLEIKHGLLQLAESLNF  184


 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 73/115 (63%), Gaps = 20/115 (17%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQLAE+L+FLH+NA L+HRAISPE                F L         + + 
Sbjct  172  KHGLLQLAESLNFLHSNAHLIHRAISPEV------------SILFQLFFFLFLVVXNFLL  219

Query  423  SFH-YA-------EYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SF+ YA       EYDVEDS++PLQPSLNYTAPELVRS +S   CSSDIFSFGCL
Sbjct  220  SFYVYAKFCCIAQEYDVEDSVLPLQPSLNYTAPELVRSKSSLASCSSDIFSFGCL  274



>ref|XP_002980242.1| hypothetical protein SELMODRAFT_178166 [Selaginella moellendorffii]
 gb|EFJ18502.1| hypothetical protein SELMODRAFT_178166 [Selaginella moellendorffii]
Length=866

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 80/107 (75%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQL ETL FLHNNA+LVHRAISPE+V ITS+G+WK  GF FA +   ++++     
Sbjct  172  KHGLLQLTETLSFLHNNAQLVHRAISPESVFITSSGSWKFGGFGFAATVEQTAAEAGAGA  231

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SF Y EYDV++ +MPLQP LNYTAPEL RSN +   C SDIFS GCL
Sbjct  232  SFLYPEYDVDEVVMPLQPPLNYTAPELTRSNGNPGSC-SDIFSLGCL  277


 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            ++K AEDAF +++RADA ++++LRHPGV+ VVQALDESK AMAMVTEP+FA+ AN LG L
Sbjct  92   ITKAAEDAFLEVVRADAGQMLKLRHPGVLRVVQALDESKTAMAMVTEPIFAAVANVLGNL  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+ K PKEL+G+E+GLLE+K  +  +   L F
Sbjct  152  ENVSKTPKELRGLELGLLEIKHGLLQLTETLSF  184



>ref|XP_002963091.1| hypothetical protein SELMODRAFT_165698 [Selaginella moellendorffii]
 gb|EFJ36554.1| hypothetical protein SELMODRAFT_165698 [Selaginella moellendorffii]
Length=866

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 79/107 (74%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQL ETL FLHNNA+LVHRAISPE+V ITS G+WK  GF FA +   ++++     
Sbjct  172  KHGLLQLTETLSFLHNNAQLVHRAISPESVFITSTGSWKFGGFGFAATVEQTAAEAGAGA  231

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            SF Y EYDV++ +MPLQP LNYTAPEL RSN +   C SDIFS GCL
Sbjct  232  SFLYPEYDVDEVVMPLQPPLNYTAPELTRSNGNPGSC-SDIFSLGCL  277


 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            ++K AEDAF +++RADA ++++LRHPGV+ VVQALDESK AMAMVTEP+FAS AN LG L
Sbjct  92   ITKAAEDAFLEVVRADAGQMLKLRHPGVLRVVQALDESKTAMAMVTEPIFASVANVLGNL  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+ K PKEL+G+E+GLLE+K  +  +   L F
Sbjct  152  ENVSKTPKELRGLELGLLEIKHGLLQLTETLSF  184



>ref|XP_001777004.1| predicted protein [Physcomitrella patens]
 gb|EDQ58253.1| predicted protein [Physcomitrella patens]
Length=862

 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GLLQLAETL FLHNNARL HR ISPE+V ITS+GAWKLAGF F++S + + +DP+   
Sbjct  172  KHGLLQLAETLGFLHNNARLSHRGISPESVYITSHGAWKLAGFGFSISLDQTGADPTGGP  231

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             FH+ +YDV+D ++PLQP L+YTAPEL R        S+DIFS   L
Sbjct  232  VFHFPDYDVDDVVLPLQPPLDYTAPELTRKGAGGPFASTDIFSLALL  278


 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            +S+ AE+AF D++R DAA+L+RLRHPGVV V+QALDESK  MAMVTEP+FAS AN LG L
Sbjct  92   ISRAAEEAFLDLVRQDAAQLMRLRHPGVVRVIQALDESKTTMAMVTEPIFASVANVLGRL  151

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            +N+ KVP ELK +E+G LE+K  +  +   LGF
Sbjct  152  DNVGKVPNELKDLELGQLEIKHGLLQLAETLGF  184



>ref|XP_008358266.1| PREDICTED: SCY1-like protein 2 [Malus domestica]
Length=169

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            L+K AED F ++IRADAARLVRLRHPGVVHVVQALDE+KNAMAMVTEPLFAS ANALG +
Sbjct  93   LTKAAEDGFLEIIRADAARLVRLRHPGVVHVVQALDENKNAMAMVTEPLFASVANALGNV  152

Query  182  ENIEKVPKELKGI  220
            +N+ KVPKELKG+
Sbjct  153  ZNVAKVPKELKGM  165



>gb|EMS46807.1| SCY1-like protein 2 [Triticum urartu]
Length=1160

 Score =   124 bits (312),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 59/83 (71%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            LS+ AEDAF D+ RADAARLVRLRHPGV+HVVQALDE+K AMAMVTEPLFAS +NALG L
Sbjct  92   LSRAAEDAFLDLARADAARLVRLRHPGVLHVVQALDETKAAMAMVTEPLFASVSNALGCL  151

Query  182  ENIEKVPKELKGIEMGLLEVKQW  250
            +N+ KVPKELKG+ + +     W
Sbjct  152  DNVGKVPKELKGMTVFITSSGSW  174


 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +3

Query  288  NNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSFHYAEYDVEDSIMP  467
            +N   V + +   TV ITS+G+WKL GF FALS + ++   ++ Q FHY++YDVED+ +P
Sbjct  152  DNVGKVPKELKGMTVFITSSGSWKLGGFGFALSVDQATGGLASSQQFHYSDYDVEDTALP  211

Query  468  LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            LQPSLNYTAPELVRS  S +G + DIFSFGCL
Sbjct  212  LQPSLNYTAPELVRSGDSKVGSTCDIFSFGCL  243



>ref|XP_797681.2| PREDICTED: LOW QUALITY PROTEIN: SCY1-like protein 2-like [Strongylocentrotus 
purpuratus]
Length=972

 Score = 88.6 bits (218),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 64/105 (61%), Gaps = 6/105 (6%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GLLQL + L FLHN+  +VH  I+P ++++ SNGAWKLAGF F +   PSSS P     F
Sbjct  148  GLLQLTDALKFLHNDVHMVHGNITPASIILNSNGAWKLAGFDFVI---PSSSPPDQPAIF  204

Query  429  HYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
               E  + D    LQP+LNY APE +   T S   SSD+FS G L
Sbjct  205  PLREL-MNDVSAVLQPNLNYLAPEYLL--TQSCDMSSDLFSLGML  246


 Score = 56.6 bits (135),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 25/63 (40%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
             +K   D   +++R  + +L RLRHP V+ V   L+E++ ++A  TEP+FAS AN LG  
Sbjct  65   FAKRDRDPLLEILRKGSTQLTRLRHPCVLTVQHPLEETRESLAFATEPVFASLANILGCH  124

Query  182  ENI  190
            +N+
Sbjct  125  DNM  127



>ref|XP_009105807.1| PREDICTED: protein kinase domain-containing protein ppk32-like 
[Brassica rapa]
Length=145

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +3

Query  336  ITSNGAWKLAGFSFALSTNPSSSDPSNMQSFHYAEYDVEDSIMPLQPSLNYTAPELVRSN  515
            I+  G+WKLAGF FA+S    + +  N+QSFHY+EYDVEDS++P+QPSLNYTAPELV S 
Sbjct  26   ISPAGSWKLAGFGFAISA-AQAGNLDNIQSFHYSEYDVEDSMLPVQPSLNYTAPELVCSK  84

Query  516  TSSIGCSSDIFSFGCL  563
            + S G SSDIFSFGCL
Sbjct  85   SPSAGASSDIFSFGCL  100



>gb|EFX89231.1| hypothetical protein DAPPUDRAFT_1152 [Daphnia pulex]
Length=617

 Score = 68.9 bits (167),  Expect(2) = 5e-24, Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 64/107 (60%), Gaps = 11/107 (10%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GL QL E L FLHN+ +L+H  I PE+++I   GA+K+ GF F  S+  ++S     + +
Sbjct  155  GLQQLIEGLIFLHNDVKLLHCNICPESIVINQQGAFKIFGFDFCTSSQDATS-----KLW  209

Query  429  HYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGC--SSDIFSFGCL  563
               E D E S +  Q +L+Y APEL     ++IGC  S D++S GCL
Sbjct  210  PVREPDPELSPVS-QSNLDYLAPEL---GPNAIGCGASVDMYSLGCL  252


 Score = 68.6 bits (166),  Expect(2) = 5e-24, Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = +2

Query  5    SKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILE  184
            SK  +D   +++R   A+L RLRHP ++ V   ++ES+ ++A  TEP+FAS AN LG  E
Sbjct  74   SKKDKDQLVEVLRRGVAQLTRLRHPQILTVQHPVEESRESLAFATEPVFASLANVLGCHE  133

Query  185  NIEKVPKELKGIEMGLLEVK  244
            NI  +P++L+  ++  +E+K
Sbjct  134  NISPLPQQLRDYKLFEVEIK  153



>ref|XP_005185357.1| PREDICTED: SCY1-like protein 2 [Musca domestica]
Length=876

 Score = 83.2 bits (204),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 63/106 (59%), Gaps = 6/106 (6%)
 Frame = +3

Query  246  NGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQS  425
            +GLLQL + L FLHN+A++VHR I  ET++I  N +WKL GF F ++  P    P     
Sbjct  146  HGLLQLFDGLQFLHNDAKIVHRNICAETIVINKNRSWKLFGFDFGVANQP---QPDGKPY  202

Query  426  FHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +   EY     ++  QPSL YTAPE+  +N +S    SD+FS G L
Sbjct  203  WPCKEYSTSMHML-AQPSLEYTAPEIALNNINS--TDSDLFSLGIL  245


 Score = 53.9 bits (128),  Expect(2) = 7e-24, Method: Composition-based stats.
 Identities = 29/79 (37%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = +2

Query  5    SKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILE  184
            SK   +A  + +R    +L ++RHP V+ V   L+ES++++A  TEP+FAS AN +G   
Sbjct  74   SKEDREAILETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLANVVGDQV  133

Query  185  NIEKVPKELKGIEMGLLEV  241
              EK   +++ I  GLL++
Sbjct  134  RAEKKLYDVE-IRHGLLQL  151



>ref|XP_001999469.1| GI23050 [Drosophila mojavensis]
 gb|EDW14930.1| GI23050 [Drosophila mojavensis]
Length=851

 Score = 82.8 bits (203),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 68/107 (64%), Gaps = 8/107 (7%)
 Frame = +3

Query  246  NGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQS  425
            +GLLQL + L FLHN+A++VHR IS ET++I  N +WKL GF F ++  P+S+      +
Sbjct  146  HGLLQLFDGLQFLHNDAKIVHRNISAETIVINKNRSWKLFGFDFCIANQPASNG-----T  200

Query  426  FHYAEYDVEDSIMPL-QPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             H+   +   S+  L QPSL YTAPEL  ++ ++    SD+FS G L
Sbjct  201  PHWPCREYSTSLHVLAQPSLEYTAPELALNSVNT--PDSDLFSLGVL  245


 Score = 51.6 bits (122),  Expect(2) = 4e-23, Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = +2

Query  5    SKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILE  184
            SK   +   + +R    +L ++RHP V+ V   L+ES++++A  TEP+FAS AN +G   
Sbjct  74   SKDDRETMLETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLANVVGDSV  133

Query  185  NIEKVPKELKGIEMGLLEV  241
              EK   +++ I  GLL++
Sbjct  134  RSEKKLYDVE-IRHGLLQL  151



>ref|XP_002054795.1| GJ24635 [Drosophila virilis]
 gb|EDW68315.1| GJ24635 [Drosophila virilis]
Length=854

 Score = 82.8 bits (203),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 67/107 (63%), Gaps = 8/107 (7%)
 Frame = +3

Query  246  NGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQS  425
            +GLLQL + L FLHN+A++VHR IS ET++I  N +WKL GF F ++  PS++      +
Sbjct  146  HGLLQLFDGLQFLHNDAKIVHRNISAETIVINKNRSWKLFGFDFCIANQPSTNG-----T  200

Query  426  FHYAEYDVEDSIMPL-QPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             H+   +   S+  L QPSL YTAPEL  +  ++    SD+FS G L
Sbjct  201  PHWPCREYSTSLHVLAQPSLEYTAPELALNTVNT--PDSDLFSLGVL  245


 Score = 51.2 bits (121),  Expect(2) = 6e-23, Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = +2

Query  5    SKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILE  184
            SK   +   + +R    +L ++RHP V+ V   L+ES++++A  TEP+FAS AN +G   
Sbjct  74   SKDDRETMLETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLANVVGDSV  133

Query  185  NIEKVPKELKGIEMGLLEV  241
              EK   +++ I  GLL++
Sbjct  134  RSEKKLYDVE-IRHGLLQL  151



>ref|XP_002037140.1| GM12753 [Drosophila sechellia]
 gb|EDW53299.1| GM12753 [Drosophila sechellia]
Length=835

 Score = 81.3 bits (199),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 66/106 (62%), Gaps = 6/106 (6%)
 Frame = +3

Query  246  NGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQS  425
            +GLLQL + L FLH +A++VHR IS ET++I  N +WKL GF F ++  P++    +   
Sbjct  146  HGLLQLFDGLQFLHQDAKIVHRNISAETIVINKNRSWKLFGFDFCIANQPATDGTPH---  202

Query  426  FHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            + + EY     ++  QPSL YTAPEL  ++ ++    SD+FS G L
Sbjct  203  WPFREYTTSLHVL-AQPSLEYTAPELALNSVNT--PDSDLFSLGVL  245


 Score = 52.8 bits (125),  Expect(2) = 6e-23, Method: Composition-based stats.
 Identities = 29/81 (36%), Positives = 51/81 (63%), Gaps = 5/81 (6%)
 Frame = +2

Query  5    SKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILE  184
            SK   +   + +R    +L ++RHP V+ V   L+ES++++A  TEP+FAS AN +G  +
Sbjct  74   SKDDRETMLETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLANVVG--D  131

Query  185  NIEKVPKELKGIEM--GLLEV  241
            N+ +  K+L  +E+  GLL++
Sbjct  132  NV-RSEKKLYDVEIRHGLLQL  151



>ref|NP_651655.1| CG1951 [Drosophila melanogaster]
 gb|AAF56841.1| CG1951 [Drosophila melanogaster]
 gb|AAL39769.1| LD39455p [Drosophila melanogaster]
Length=835

 Score = 81.3 bits (199),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 66/106 (62%), Gaps = 6/106 (6%)
 Frame = +3

Query  246  NGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQS  425
            +GLLQL + L FLH +A++VHR IS ET++I  N +WKL GF F ++  P++    +   
Sbjct  146  HGLLQLFDGLQFLHQDAKIVHRNISAETIVINKNRSWKLFGFDFCIANQPATDGTPH---  202

Query  426  FHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            + + EY     ++  QPSL YTAPEL  ++ ++    SD+FS G L
Sbjct  203  WPFREYTTSLHVLA-QPSLEYTAPELALNSVNT--PDSDLFSLGVL  245


 Score = 52.8 bits (125),  Expect(2) = 6e-23, Method: Composition-based stats.
 Identities = 29/81 (36%), Positives = 51/81 (63%), Gaps = 5/81 (6%)
 Frame = +2

Query  5    SKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILE  184
            SK   +   + +R    +L ++RHP V+ V   L+ES++++A  TEP+FAS AN +G  +
Sbjct  74   SKDDRETMLETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLANVVG--D  131

Query  185  NIEKVPKELKGIEM--GLLEV  241
            N+ +  K+L  +E+  GLL++
Sbjct  132  NV-RSEKKLYDVEIRHGLLQL  151



>ref|XP_001634807.1| predicted protein [Nematostella vectensis]
 gb|EDO42744.1| predicted protein, partial [Nematostella vectensis]
Length=608

 Score = 77.8 bits (190),  Expect(2) = 6e-23, Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 63/106 (59%), Gaps = 9/106 (8%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GL QL E L FLHN+A+++   +SPE ++IT NG WK+AG  F  S+ P+  +  +    
Sbjct  145  GLYQLVEGLMFLHNDAKILQGNLSPENIVITKNGQWKIAGLFF--SSTPTIVEGQST---  199

Query  429  HYAEYDVEDSIMPL-QPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             Y+  + E  + PL QP LNY APE + S T     SSD++S G L
Sbjct  200  -YSGCEWEPRLYPLAQPDLNYAAPEFILSRTCDT--SSDMYSLGAL  242


 Score = 55.8 bits (133),  Expect(2) = 6e-23, Method: Composition-based stats.
 Identities = 27/76 (36%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            + K   D   ++++  A +L RLRHP ++ +  A++ES++ +A  TEP+FAS +N LG  
Sbjct  62   VDKRDRDVVLELMKKGAVQLTRLRHPRLLLIQHAMEESRDCLAFATEPIFASLSNVLGRH  121

Query  182  ENI-EKVPKELKGIEM  226
            +N+    P E    EM
Sbjct  122  DNMPSPPPPEFANFEM  137



>ref|XP_002098647.1| GE23820 [Drosophila yakuba]
 gb|EDW98359.1| GE23820 [Drosophila yakuba]
Length=835

 Score = 81.3 bits (199),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 66/106 (62%), Gaps = 6/106 (6%)
 Frame = +3

Query  246  NGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQS  425
            +GLLQL + L FLH +A++VHR IS ET++I  N +WKL GF F ++  P++    +   
Sbjct  146  HGLLQLFDGLQFLHQDAKIVHRNISAETIVINKNRSWKLFGFDFCIANQPATDGTPH---  202

Query  426  FHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            + + EY     ++  QPSL YTAPEL  ++ ++    SD+FS G L
Sbjct  203  WPFREYTTSLHVLA-QPSLEYTAPELALNSVNT--PDSDLFSLGVL  245


 Score = 52.8 bits (125),  Expect(2) = 7e-23, Method: Composition-based stats.
 Identities = 29/81 (36%), Positives = 51/81 (63%), Gaps = 5/81 (6%)
 Frame = +2

Query  5    SKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILE  184
            SK   +   + +R    +L ++RHP V+ V   L+ES++++A  TEP+FAS AN +G  +
Sbjct  74   SKDDRETMLETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLANVVG--D  131

Query  185  NIEKVPKELKGIEM--GLLEV  241
            N+ +  K+L  +E+  GLL++
Sbjct  132  NV-RSEKKLYDVEIRHGLLQL  151



>ref|XP_002105285.1| GD21400 [Drosophila simulans]
 gb|EDX14788.1| GD21400 [Drosophila simulans]
Length=834

 Score = 81.3 bits (199),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 66/106 (62%), Gaps = 6/106 (6%)
 Frame = +3

Query  246  NGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQS  425
            +GLLQL + L FLH +A++VHR IS ET++I  N +WKL GF F ++  P++    +   
Sbjct  146  HGLLQLFDGLQFLHQDAKIVHRNISAETIVINKNRSWKLFGFDFCIANQPATDGTPH---  202

Query  426  FHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            + + EY     ++  QPSL YTAPEL  ++ ++    SD+FS G L
Sbjct  203  WPFREYTTSLHVLA-QPSLEYTAPELALNSVNT--PDSDLFSLGVL  245


 Score = 52.8 bits (125),  Expect(2) = 7e-23, Method: Composition-based stats.
 Identities = 29/81 (36%), Positives = 51/81 (63%), Gaps = 5/81 (6%)
 Frame = +2

Query  5    SKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILE  184
            SK   +   + +R    +L ++RHP V+ V   L+ES++++A  TEP+FAS AN +G  +
Sbjct  74   SKDDRETMLETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLANVVG--D  131

Query  185  NIEKVPKELKGIEM--GLLEV  241
            N+ +  K+L  +E+  GLL++
Sbjct  132  NV-RSEKKLYDVEIRHGLLQL  151



>ref|XP_001981409.1| GG11631 [Drosophila erecta]
 gb|EDV53279.1| GG11631 [Drosophila erecta]
Length=835

 Score = 81.3 bits (199),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 66/106 (62%), Gaps = 6/106 (6%)
 Frame = +3

Query  246  NGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQS  425
            +GLLQL + L FLH +A++VHR IS ET++I  N +WKL GF F ++  P++    +   
Sbjct  146  HGLLQLFDGLQFLHQDAKIVHRNISAETIVINKNRSWKLFGFDFCITNQPATDGTPH---  202

Query  426  FHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            + + EY     ++  QPSL YTAPEL  ++ ++    SD+FS G L
Sbjct  203  WPFREYTTSLHVLA-QPSLEYTAPELALNSVNT--PDSDLFSLGVL  245


 Score = 52.0 bits (123),  Expect(2) = 9e-23, Method: Composition-based stats.
 Identities = 29/81 (36%), Positives = 51/81 (63%), Gaps = 5/81 (6%)
 Frame = +2

Query  5    SKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILE  184
            SK   +   + +R    +L ++RHP V+ V   L+ES++++A  TEP+FAS AN +G  +
Sbjct  74   SKDDRENMLETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLANVVG--D  131

Query  185  NIEKVPKELKGIEM--GLLEV  241
            N+ +  K+L  +E+  GLL++
Sbjct  132  NV-RSEKKLYDVEIRHGLLQL  151



>ref|XP_001994272.1| GH10138 [Drosophila grimshawi]
 gb|EDV95008.1| GH10138 [Drosophila grimshawi]
Length=862

 Score = 81.6 bits (200),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 68/107 (64%), Gaps = 8/107 (7%)
 Frame = +3

Query  246  NGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQS  425
            +GLLQL + L FLHN+A++VHR IS ET++I  N +WKL GF F ++  P+++  +    
Sbjct  146  HGLLQLFDGLQFLHNDAKIVHRNISAETIVINKNRSWKLFGFDFCIANQPATNGTA----  201

Query  426  FHYAEYDVEDSIMPL-QPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             H+   +   S+  L QPSL YTAPEL  ++ ++    SD+F+ G L
Sbjct  202  -HWPCREYSTSLHVLAQPSLEYTAPELALNSVNT--PDSDLFALGVL  245


 Score = 51.2 bits (121),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 28/81 (35%), Positives = 49/81 (60%), Gaps = 5/81 (6%)
 Frame = +2

Query  5    SKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILE  184
            SK   +   + +R    +L ++RHP V+ V   L+ES++++A  TEP+FAS AN +G   
Sbjct  74   SKDDRETMLETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLANVVG---  130

Query  185  NIEKVPKELKGIEM--GLLEV  241
            +  +  K+L  +E+  GLL++
Sbjct  131  DSVRSDKKLYDVEIRHGLLQL  151



>ref|XP_001955375.1| GF16268 [Drosophila ananassae]
 gb|EDV43936.1| GF16268 [Drosophila ananassae]
Length=832

 Score = 81.3 bits (199),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 66/106 (62%), Gaps = 6/106 (6%)
 Frame = +3

Query  246  NGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQS  425
            +GLLQL + L FLH +A++VHR IS ET++I  N +WKL GF F ++  P++    +   
Sbjct  146  HGLLQLFDGLQFLHQDAKIVHRNISAETIVINKNRSWKLFGFDFCIANQPATDGTPH---  202

Query  426  FHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            + + EY     ++  QPSL YTAPEL  ++ ++    SD+FS G L
Sbjct  203  WPFREYTTSLHVLA-QPSLEYTAPELALNSINT--PDSDLFSLGVL  245


 Score = 51.2 bits (121),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 28/81 (35%), Positives = 49/81 (60%), Gaps = 5/81 (6%)
 Frame = +2

Query  5    SKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILE  184
            SK   +   + +R    +L ++RHP V+ V   L+ES++++A  TEP+FAS AN +G   
Sbjct  74   SKDDRETMLETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLANVVG---  130

Query  185  NIEKVPKELKGIEM--GLLEV  241
            +  +  K+L  +E+  GLL++
Sbjct  131  DSVRSDKKLYDVEIRHGLLQL  151



>ref|XP_001358671.1| GA15148 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL27813.1| GA15148 [Drosophila pseudoobscura pseudoobscura]
Length=849

 Score = 81.3 bits (199),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 67/107 (63%), Gaps = 8/107 (7%)
 Frame = +3

Query  246  NGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQS  425
            +GLLQL + L FLHN+A++VHR IS ET++I  N +WKL GF F ++  P++       +
Sbjct  146  HGLLQLFDGLQFLHNDAKIVHRNISAETIVINKNRSWKLFGFDFCIANQPATDG-----T  200

Query  426  FHYAEYDVEDSIMPL-QPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             H+   +   S+  L QPSL YTAPEL  ++ ++    SD+FS G L
Sbjct  201  PHWPCREYTTSMHVLAQPSLEYTAPELALNSVNT--PDSDLFSLGVL  245


 Score = 50.4 bits (119),  Expect(2) = 3e-22, Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = +2

Query  5    SKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILE  184
            SK   +   + +R    +L ++RHP V+ V   L+ES++++A  TEP+FAS +N +G   
Sbjct  74   SKDDRETMLETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLSNVVGDSV  133

Query  185  NIEKVPKELKGIEMGLLEV  241
              EK   +++ I  GLL++
Sbjct  134  RSEKKLYDVE-IRHGLLQL  151



>ref|XP_002013645.1| GL24246 [Drosophila persimilis]
 gb|EDW24631.1| GL24246 [Drosophila persimilis]
Length=818

 Score = 81.3 bits (199),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 67/107 (63%), Gaps = 8/107 (7%)
 Frame = +3

Query  246  NGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQS  425
            +GLLQL + L FLHN+A++VHR IS ET++I  N +WKL GF F ++  P++       +
Sbjct  113  HGLLQLFDGLQFLHNDAKIVHRNISAETIVINKNRSWKLFGFDFCIANQPATDG-----T  167

Query  426  FHYAEYDVEDSIMPL-QPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             H+   +   S+  L QPSL YTAPEL  ++ ++    SD+FS G L
Sbjct  168  PHWPCREYTTSMHVLAQPSLEYTAPELALNSVNT--PDSDLFSLGVL  212


 Score = 50.1 bits (118),  Expect(2) = 3e-22, Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = +2

Query  5    SKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILE  184
            SK   +   + +R    +L ++RHP V+ V   L+ES++++A  TEP+FAS +N +G   
Sbjct  41   SKDDRETMLETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLSNVVGDSV  100

Query  185  NIEKVPKELKGIEMGLLEV  241
              EK   +++ I  GLL++
Sbjct  101  RSEKKLYDVE-IRHGLLQL  118



>ref|XP_002071981.1| GK22563 [Drosophila willistoni]
 gb|EDW82967.1| GK22563 [Drosophila willistoni]
Length=828

 Score = 80.1 bits (196),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 66/107 (62%), Gaps = 8/107 (7%)
 Frame = +3

Query  246  NGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQS  425
            +GLLQL + L FLHN+A++VHR I  ET++I  N +WKL GF F+++  P++   +    
Sbjct  146  HGLLQLFDGLQFLHNDAKIVHRNICAETIVINKNRSWKLFGFDFSIANQPATDGTA----  201

Query  426  FHYAEYDVEDSIMPL-QPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             H+   +   S+  L QPSL YTAPEL  +  ++    SD+FS G L
Sbjct  202  -HWPCREHSTSLHVLAQPSLEYTAPELALNGVNT--PDSDLFSLGVL  245


 Score = 50.1 bits (118),  Expect(2) = 8e-22, Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 49/81 (60%), Gaps = 5/81 (6%)
 Frame = +2

Query  5    SKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILE  184
            S+   +   + +R    +L ++RHP V+ V   L+ES++++A  TEP+FAS AN +G   
Sbjct  74   SRDDRETMLETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLANVVG---  130

Query  185  NIEKVPKELKGIEM--GLLEV  241
            +  +  K+L  +E+  GLL++
Sbjct  131  DSVRSDKKLYDVEIRHGLLQL  151



>ref|XP_011184986.1| PREDICTED: SCY1-like protein 2 [Bactrocera cucurbitae]
Length=859

 Score = 77.0 bits (188),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 62/106 (58%), Gaps = 6/106 (6%)
 Frame = +3

Query  246  NGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQS  425
            +GLLQL + L FLHN+A++VHR I  ET++I  N +WKL GF F ++  P++        
Sbjct  148  HGLLQLFDGLSFLHNDAKIVHRNICAETIVINKNRSWKLFGFDFCIANQPATDGKP---F  204

Query  426  FHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +   EY     ++  QPSL Y APE+  +  +S    SD+FS G L
Sbjct  205  WPCREYSTSMHVLA-QPSLEYCAPEIALNTINS--TESDLFSLGVL  247


 Score = 51.6 bits (122),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 28/81 (35%), Positives = 49/81 (60%), Gaps = 5/81 (6%)
 Frame = +2

Query  5    SKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILE  184
            SK   +   + +R    +L ++RHP V+ V   L+ES++++A  TEP+FAS AN +G   
Sbjct  76   SKDDRETMLETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLANVVG---  132

Query  185  NIEKVPKELKGIEM--GLLEV  241
            +  +  K+L  +E+  GLL++
Sbjct  133  DSVRSDKKLYDVEIRHGLLQL  153



>ref|XP_011206711.1| PREDICTED: SCY1-like protein 2 [Bactrocera dorsalis]
Length=859

 Score = 76.6 bits (187),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 63/106 (59%), Gaps = 6/106 (6%)
 Frame = +3

Query  246  NGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQS  425
            +GLLQL + L FLHN+A++VHR I  ET++I  N +WKL GF F ++  P++        
Sbjct  148  HGLLQLFDGLSFLHNDAKIVHRNICAETIVINKNRSWKLFGFDFCIANQPATDGKP---F  204

Query  426  FHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +   EY     ++  QPSL Y APE+   NT +I   SD+FS G L
Sbjct  205  WPCREYSTSVHVLA-QPSLEYCAPEIAL-NTINI-TESDLFSLGVL  247


 Score = 51.2 bits (121),  Expect(2) = 4e-21, Method: Composition-based stats.
 Identities = 28/81 (35%), Positives = 49/81 (60%), Gaps = 5/81 (6%)
 Frame = +2

Query  5    SKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILE  184
            SK   +   + +R    +L ++RHP V+ V   L+ES++++A  TEP+FAS AN +G   
Sbjct  76   SKDDRETMLETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLANVVG---  132

Query  185  NIEKVPKELKGIEM--GLLEV  241
            +  +  K+L  +E+  GLL++
Sbjct  133  DSVRSDKKLYDVEIRHGLLQL  153



>ref|XP_004529318.1| PREDICTED: SCY1-like protein 2-like [Ceratitis capitata]
Length=887

 Score = 75.9 bits (185),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = +3

Query  246  NGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQS  425
            +GLLQL + L FLHN+A++VHR I  ET++I  N +WKL GF F ++  P+         
Sbjct  174  HGLLQLFDGLSFLHNDAKIVHRNICAETIVINKNRSWKLFGFDFCIANQPAV---DGKPF  230

Query  426  FHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +   EY     ++  QPSL Y APE+  +  +S    SD+FS G L
Sbjct  231  WPCREYSTSVHVLA-QPSLEYCAPEIALNTINS--TESDLFSLGVL  273


 Score = 51.2 bits (121),  Expect(2) = 6e-21, Method: Composition-based stats.
 Identities = 28/81 (35%), Positives = 49/81 (60%), Gaps = 5/81 (6%)
 Frame = +2

Query  5    SKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILE  184
            SK   +   + +R    +L ++RHP V+ V   L+ES++++A  TEP+FAS AN +G   
Sbjct  102  SKDDRETMLETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLANVVG---  158

Query  185  NIEKVPKELKGIEM--GLLEV  241
            +  +  K+L  +E+  GLL++
Sbjct  159  DQVRSDKKLYDVEIRHGLLQL  179



>ref|XP_001662347.1| AAEL012247-PA [Aedes aegypti]
 gb|EAT35602.1| AAEL012247-PA [Aedes aegypti]
Length=782

 Score = 71.2 bits (173),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 61/105 (58%), Gaps = 13/105 (12%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GLLQL E + F+HN  +LVHR ISP +V++ S+G WK+ GF + +S+          ++ 
Sbjct  156  GLLQLIEGIQFIHNETKLVHRNISPHSVVLNSHGIWKIFGFDYCVSS----------ENA  205

Query  429  HYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +  +Y+   +I+ + PSL YTAPE    N  S    +D ++ G L
Sbjct  206  NRYDYNPNQNILAI-PSLEYTAPECALENGYS--SRADYYALGVL  247


 Score = 53.5 bits (127),  Expect(2) = 3e-20, Method: Composition-based stats.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  5    SKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILE  184
            SK   +  F++ R    ++ ++RHP V+ V   L+ES+ + A  TEP++AS AN LG   
Sbjct  74   SKEDREEIFEIARRGVTQITKIRHPQVLTVQHPLEESRESFAFATEPVYASLANVLGDTT  133

Query  185  NI-EKVPKELKGIEMGLLEVK  244
            NI  +V  EL    +   E+K
Sbjct  134  NIPSQVISELGNYSLYETEIK  154



>ref|XP_010736936.1| PREDICTED: SCY1-like protein 2 [Larimichthys crocea]
Length=916

 Score = 68.2 bits (165),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 62/104 (60%), Gaps = 10/104 (10%)
 Frame = +3

Query  258  QLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFAL-STNPSSSDPSNMQSFHY  434
            Q++E L FLH+  ++VH  + PE +++  +GAWK+ GF F++ STNPS ++P       Y
Sbjct  166  QISEGLSFLHSGVKMVHGNLCPENIILNKSGAWKIMGFDFSISSTNPSDAEPK------Y  219

Query  435  AEYDVEDSIMPLQ-PSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
               + E ++ PL  P+  Y APE + S   S   +SD++S G +
Sbjct  220  TCKEWEPNLPPLSLPNPEYLAPEYILS--VSCDSASDMYSLGVV  261


 Score = 55.8 bits (133),  Expect(2) = 5e-20, Method: Composition-based stats.
 Identities = 28/76 (37%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +2

Query  8    KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  187
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS +N LG  EN
Sbjct  76   KFEKDQIIDSLKKGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLSNVLGQWEN  135

Query  188  I-EKVPKELKGIEMGL  232
            +   +P ++K  ++ L
Sbjct  136  LPSPMPTDIKEYKLKL  151



>gb|KFM58356.1| SCY1-like protein 2, partial [Stegodyphus mimosarum]
Length=801

 Score = 75.1 bits (183),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 59/108 (55%), Gaps = 13/108 (12%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSS-SDPSNMQS  425
            GLLQL E L FLH + +L+HR + P++V+I   G WKLAG  FA   N +    P   Q+
Sbjct  149  GLLQLTEALCFLHYSCKLIHRNLCPQSVIINKRGTWKLAGLEFAEKCNETDIMKPVPCQA  208

Query  426  FHYAEYDVEDSIMPL--QPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            F         S +P   QP L+YTAPE+   N S     SD+FS G +
Sbjct  209  F--------TSKLPKMGQPDLDYTAPEI--QNNSKCSPLSDMFSLGLV  246


 Score = 45.8 bits (107),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = +2

Query  32   DMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPKEL  211
            +++R    +L RL+HP ++ +   ++ES + +A  TEP+  + AN LG LE  E++P+ L
Sbjct  75   EILRFSVRQLDRLKHPKLLTLYHPIEESNDTLAFATEPVLGTLANVLGCLE--ERLPQNL  132



>gb|KFB50851.1| AGAP005207-PA-like protein [Anopheles sinensis]
Length=739

 Score = 75.1 bits (183),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 64/106 (60%), Gaps = 9/106 (8%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPS-SSDPSNMQS  425
            G+LQ+ E L FLH + +++H+ + P ++LIT  G WKLAGF F   TN + ++DP   Q 
Sbjct  171  GILQITEALSFLHYSGQVIHKNVCPSSILITKKGTWKLAGFEFTERTNETDATDPVPCQP  230

Query  426  FHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +      +      +QP+L+Y APE+  +++ SI   SD+FS G +
Sbjct  231  WSTRASKL------VQPNLDYMAPEIQINSSCSI--LSDMFSLGMV  268


 Score = 44.7 bits (104),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +2

Query  32   DMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILE  184
            +++RA   +L R RHP ++ ++  ++ES   ++  TEP+ AS AN L   E
Sbjct  80   EILRASVKQLERFRHPKILQIMHTVEESSETLSFATEPVIASLANILAYQE  130



>gb|ERG82889.1| scy1-like protein 2 [Ascaris suum]
Length=941

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 66/107 (62%), Gaps = 6/107 (6%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GL QLAE L FLH +AR++HR I PE+V+I   GAWKLAGF FA+   PSS   S   
Sbjct  154  RHGLFQLAEALSFLHIDARMLHRNICPESVIINEKGAWKLAGFDFAIQATPSS---SGQL  210

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +F   E+D + ++  +QPSL+Y APE V          +DIFS G L
Sbjct  211  TFEMIEWD-QRTMSVVQPSLDYLAPEYVVGGRCD--AYADIFSLGVL  254


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 31/92 (34%), Positives = 54/92 (59%), Gaps = 1/92 (1%)
 Frame = +2

Query  8    KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  187
            K   D F D++R   ++L +LRHP ++ +   L+ES+++ A  TEP+FAS AN LG  +N
Sbjct  75   KHERDLFMDVLRRGVSQLTKLRHPRILVIEHPLEESRDSFAFCTEPVFASLANCLGRHDN  134

Query  188  IE-KVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            +   +P+ L   E+  +E++  +  +   L F
Sbjct  135  LTPSIPRHLVDFELLDVEIRHGLFQLAEALSF  166



>emb|CDS31865.1| scy1 protein 2 [Hymenolepis microstoma]
Length=1663

 Score = 63.5 bits (153),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 56/108 (52%), Gaps = 16/108 (15%)
 Frame = +3

Query  249   GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSS--SDPSNMQ  422
             G++Q+ E L FLH + +  H  +SPE++++   G+WKL GF FA   N     S PS   
Sbjct  970   GIIQICEALTFLHRDGKRFHLNVSPESIVVNVLGSWKLCGFEFAYDRNEGEWVSTPS---  1026

Query  423   SFHYAEYDVEDSIMPL-QPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
                      + SI  L QP L+Y APE+V         +SD+FS G L
Sbjct  1027  --------WQSSIPSLCQPHLDYCAPEVVIEGKGY--AASDMFSVGML  1064


 Score = 55.8 bits (133),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
             SK   +   D ++   A L RLRHP V+ VV  L++S+ ++   TEP+F S ANALG  
Sbjct  887  FSKRERELIIDKLKQGVATLTRLRHPRVLSVVHPLEDSRESLCFATEPVFTSLANALGKT  946

Query  182  ENI  190
            +N+
Sbjct  947  KNL  949



>ref|XP_009061701.1| hypothetical protein LOTGIDRAFT_127669 [Lottia gigantea]
 gb|ESO87504.1| hypothetical protein LOTGIDRAFT_127669 [Lottia gigantea]
Length=631

 Score = 64.3 bits (155),  Expect(2) = 4e-18, Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 56/107 (52%), Gaps = 18/107 (17%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+ Q+ E L FLH++  L+HR + P+++LIT  GAWKLA   F   T       S+ QS+
Sbjct  161  GIFQITEALSFLHSSEHLIHRNVCPQSILITKRGAWKLASLGFVEKTKEGKK--SSCQSW  218

Query  429  HYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCS--SDIFSFG  557
                     + +P   QP LN+ APE+         C+  SD+FS G
Sbjct  219  --------TTKIPKMAQPDLNFIAPEVQLEKI----CTPLSDMFSLG  253


 Score = 53.5 bits (127),  Expect(2) = 4e-18, Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = +2

Query  32   DMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENI-EKVPKE  208
            +++R D  +L R+RHP ++ +   ++E  +++A  TEP+FAS +N LG  E +   +P+E
Sbjct  71   EILRKDVTQLSRIRHPKIISIQHGVEECHDSLAFATEPIFASLSNILGNYERMPANIPQE  130

Query  209  LK  214
            LK
Sbjct  131  LK  132



>gb|KHN80443.1| SCY1-like protein 2 [Toxocara canis]
Length=1422

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 68/110 (62%), Gaps = 12/110 (11%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
             +GL QLAE L FLH +AR++HR I PE+V+I   GAWKLAGF FA+   PSS   S   
Sbjct  184  RHGLFQLAEALSFLHIDARMLHRNICPESVVINDRGAWKLAGFDFAVQATPSS---SGQL  240

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELV---RSNTSSIGCSSDIFSFGCL  563
             F   E++ E ++  +QPSL+Y APE V   R +T      +DIFS G L
Sbjct  241  QFEMVEWE-ERTMSLVQPSLDYLAPEYVLGGRCDT-----YADIFSLGVL  284


 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 67/108 (62%), Gaps = 12/108 (11%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+L LAE L FLH +AR++HR I PE+V+I   GAWKLAGF FA+   PSS   S    F
Sbjct  527  GVLSLAEALSFLHIDARMLHRNICPESVVINDRGAWKLAGFDFAVQATPSS---SGQLQF  583

Query  429  HYAEYDVEDSIMPLQPSLNYTAPELV---RSNTSSIGCSSDIFSFGCL  563
               E++ E ++  +QPSL+Y APE V   R +T      +DIFS G L
Sbjct  584  EMVEWE-ERTMSLVQPSLDYLAPEYVLGGRCDT-----YADIFSLGVL  625


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 31/89 (35%), Positives = 52/89 (58%), Gaps = 1/89 (1%)
 Frame = +2

Query  17   EDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIE-  193
            ++ F +++R   A+L RLRHP ++ +   L+ES+++ A  TEP+FAS AN LG  EN+  
Sbjct  108  KELFTEVLRRGVAQLTRLRHPRILVIEHPLEESRDSFAFCTEPMFASLANCLGRHENLAP  167

Query  194  KVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
             +P  L   E   +E++  +  +   L F
Sbjct  168  AIPTHLIDFEFVDVEIRHGLFQLAEALSF  196



>ref|XP_002172144.1| SCY1 protein kinase Ppk32 [Schizosaccharomyces japonicus yFS275]
 gb|EEB05851.1| SCY1 protein kinase Ppk32 [Schizosaccharomyces japonicus yFS275]
Length=707

 Score = 67.8 bits (164),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 59/107 (55%), Gaps = 11/107 (10%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
              GLLQL + L+FL N+A +VH  + PE+V+I + G WK+ GF ++ +   +        
Sbjct  138  QKGLLQLTDGLEFLSNSAGIVHLNVQPESVVIDAKGDWKICGFGYSQNLTDA--------  189

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +F + E D    I  LQ + N+ APE +      I  ++D+FS GCL
Sbjct  190  TFQFPEMDSRFPI-ELQQNFNFLAPEYLLDEV--ISPANDVFSLGCL  233


 Score = 48.9 bits (115),  Expect(2) = 7e-18, Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = +2

Query  26   FFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  205
              +++R DA+ L RLRHP V+ +++ L+E+ ++M  VTEP+  S +  L           
Sbjct  73   LLNVLRKDASTLARLRHPSVLRLMEPLEETSSSMTFVTEPIEVSLSEKLRSFHQERAESM  132

Query  206  ELKGIEMGLLEV  241
            E   I+ GLL++
Sbjct  133  EELEIQKGLLQL  144



>ref|XP_007384804.1| kinase-like protein [Punctularia strigosozonata HHB-11173 SS5]
 gb|EIN07701.1| kinase-like protein [Punctularia strigosozonata HHB-11173 SS5]
Length=884

 Score = 70.5 bits (171),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 59/109 (54%), Gaps = 10/109 (9%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
              G+LQL + L FLH +ARL+H  ISPE++LI ++G WK+ G    +   P +S   N  
Sbjct  163  QKGILQLCKGLSFLHTSARLIHSNISPESILINNSGDWKIGGLGLTI---PLTSPDGNAT  219

Query  423  SFHYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             + +  +D     +P  +Q S +Y APE        +   SD++S GCL
Sbjct  220  RWEFPTFDGR---VPSYIQRSFDYMAPEYALDEV--LSTDSDMYSLGCL  263


 Score = 46.2 bits (108),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFAS  157
            LS +A+D   ++++ +A  L R+RHP V+ +V+ L+E++N +   TEP+ +S
Sbjct  92   LSPSAKDRVLEVLKTEAQALGRMRHPCVLEMVEPLEETRNELVFATEPVISS  143



>ref|XP_003704464.1| PREDICTED: SCY1-like protein 2-like [Megachile rotundata]
Length=827

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 68/106 (64%), Gaps = 8/106 (8%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSF-ALSTNPSSSDPSNMQS  425
            GLLQL E L FLH + +L+HR + PE++++ S GAWK+ GF F AL+ +     P     
Sbjct  167  GLLQLGEGLAFLHGDVKLLHRNLCPESIVVNSQGAWKIFGFDFCALNQSVEGKQP----Q  222

Query  426  FHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            + Y EYD+  S +  QP+LNY APE + +  SS+G +SDIFS G L
Sbjct  223  WSYMEYDMSISFVA-QPNLNYQAPECILA--SSVGTASDIFSLGML  265


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 69/137 (50%), Gaps = 9/137 (7%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
             SK  ++   + ++   A+L +LRHP ++ V   L+ES++++A  TEP+ AS AN LG  
Sbjct  84   FSKNDKELILETLKRGVAQLTKLRHPQILTVQHPLEESRDSLAFATEPVLASLANVLGNH  143

Query  182  ENI-EKVPKELKGIEMGLLEVKQWVTSVGRNLGFPSQQCPSCSSGYIS*DCPHYLKWSLE  358
            +N+ + +P  LK  ++  +EVK  +  +G  L F                CP  +  + +
Sbjct  144  DNLPQPLPNNLKDYKLHDVEVKYGLLQLGEGLAFLHGDVKLLHRNL----CPESIVVNSQ  199

Query  359  ACW----I*FCIINKSV  397
              W      FC +N+SV
Sbjct  200  GAWKIFGFDFCALNQSV  216



>ref|XP_008192504.1| PREDICTED: SCY1-like protein 2 [Tribolium castaneum]
Length=814

 Score = 68.9 bits (167),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 59/107 (55%), Gaps = 11/107 (10%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+LQ+ E L FLH +  ++HR + P ++L+T  G WKLAG  F    N    D   ++  
Sbjct  169  GILQITEALSFLHYSGHVLHRNVCPASILVTKKGTWKLAGLEFTERVN----DVDGVEPV  224

Query  429  HYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCS--SDIFSFGCL  563
                +    S M  QP+L+YTAPE   + T SI CS  SD+FS G +
Sbjct  225  PCQPWTSRLSKM-AQPNLDYTAPE---TQTQSI-CSILSDMFSLGMV  266


 Score = 47.0 bits (110),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 18/48 (38%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  32   DMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALG  175
            +++R+   +L R RHP ++HV+  ++E  + +A  +EP+FAS AN L 
Sbjct  82   EILRSSVRQLERFRHPKILHVLHPIEECADTLAFASEPVFASLANILA  129



>gb|EFZ10635.1| hypothetical protein SINV_03385 [Solenopsis invicta]
Length=887

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 69/108 (64%), Gaps = 12/108 (11%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSF-ALSTNPSSSDPSNMQS  425
            GLLQL E L FLH + +L+HR + PE+++I  +GAWK+ GF F AL+ N  S  P    S
Sbjct  168  GLLQLGEGLAFLHGDVKLLHRNLCPESIVINVHGAWKIFGFDFCALNQNADSKQP----S  223

Query  426  FHYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            + Y EY   DS +P  +QP LNY APE + +  SS G SSDIF+ G L
Sbjct  224  WSYLEY---DSTIPAVVQPQLNYQAPECILA--SSNGPSSDIFALGML  266


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 54/93 (58%), Gaps = 1/93 (1%)
 Frame = +2

Query  5    SKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILE  184
            ++   +   + ++    +L +LRHP V+ V   L+ES++++A  TEP+FAS AN LG  E
Sbjct  86   ARADRELVLETLKRGVMQLTKLRHPQVLIVQHPLEESRDSLAFATEPVFASLANVLGNYE  145

Query  185  NI-EKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            NI +  P  LK  ++  +E++  +  +G  L F
Sbjct  146  NIPQPTPVNLKDYKLHDIEIRYGLLQLGEGLAF  178



>gb|EEZ99986.1| hypothetical protein TcasGA2_TC002787 [Tribolium castaneum]
Length=793

 Score = 68.6 bits (166),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 59/107 (55%), Gaps = 11/107 (10%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+LQ+ E L FLH +  ++HR + P ++L+T  G WKLAG  F    N    D   ++  
Sbjct  164  GILQITEALSFLHYSGHVLHRNVCPASILVTKKGTWKLAGLEFTERVN----DVDGVEPV  219

Query  429  HYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCS--SDIFSFGCL  563
                +    S M  QP+L+YTAPE   + T SI CS  SD+FS G +
Sbjct  220  PCQPWTSRLSKM-AQPNLDYTAPE---TQTQSI-CSILSDMFSLGMV  261


 Score = 47.0 bits (110),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 18/48 (38%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  32   DMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALG  175
            +++R+   +L R RHP ++HV+  ++E  + +A  +EP+FAS AN L 
Sbjct  77   EILRSSVRQLERFRHPKILHVLHPIEECADTLAFASEPVFASLANILA  124



>ref|XP_011171073.1| PREDICTED: SCY1-like protein 2 [Solenopsis invicta]
Length=859

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 69/108 (64%), Gaps = 12/108 (11%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSF-ALSTNPSSSDPSNMQS  425
            GLLQL E L FLH + +L+HR + PE+++I  +GAWK+ GF F AL+ N  S  P    S
Sbjct  168  GLLQLGEGLAFLHGDVKLLHRNLCPESIVINVHGAWKIFGFDFCALNQNADSKQP----S  223

Query  426  FHYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            + Y EY   DS +P  +QP LNY APE + +  SS G SSDIF+ G L
Sbjct  224  WSYLEY---DSTIPAVVQPQLNYQAPECILA--SSNGPSSDIFALGML  266


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 54/93 (58%), Gaps = 1/93 (1%)
 Frame = +2

Query  5    SKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILE  184
            ++   +   + ++    +L +LRHP V+ V   L+ES++++A  TEP+FAS AN LG  E
Sbjct  86   ARADRELVLETLKRGVMQLTKLRHPQVLIVQHPLEESRDSLAFATEPVFASLANVLGNYE  145

Query  185  NI-EKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            NI +  P  LK  ++  +E++  +  +G  L F
Sbjct  146  NIPQPTPVNLKDYKLHDIEIRYGLLQLGEGLAF  178



>emb|CDJ94235.1| Serine threonine protein kinase-related domain containing protein 
[Haemonchus contortus]
Length=942

 Score = 71.2 bits (173),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 62/106 (58%), Gaps = 10/106 (9%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+LQ+ + L +LHN+A+++H  ++P ++ +T++  WK+AGFSFA++       P      
Sbjct  332  GVLQIIDGLSYLHNSAKILHGNLTPASIYVTNSRLWKIAGFSFAVAAKEPDCYPC-----  386

Query  429  HYAEYDVEDSIMP-LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
                Y     + P LQP L++ APE +  N  ++  ++D+FS G L
Sbjct  387  ----YPWTKKLPPILQPDLDFLAPEYLAPNQQTVTSAADVFSLGVL  428


 Score = 43.5 bits (101),  Expect(2) = 3e-17, Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 46/73 (63%), Gaps = 6/73 (8%)
 Frame = +2

Query  23   AFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVP  202
            A  D+I+ +  +L  L HP ++HV  +L+++K  +A  TE ++AS  N + I E IE++ 
Sbjct  270  ALVDLIKYEVGQLSSLAHPRILHVQHSLEDTKEFLAFGTEAVYASLDNVV-IEEGIERL-  327

Query  203  KELKGIEMGLLEV  241
             E+K   +G+L++
Sbjct  328  -EMK---LGVLQI  336



>ref|XP_011262686.1| PREDICTED: SCY1-like protein 2 [Camponotus floridanus]
 gb|EFN63968.1| SCY1-like protein 2 [Camponotus floridanus]
Length=858

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 69/108 (64%), Gaps = 12/108 (11%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSF-ALSTNPSSSDPSNMQS  425
            GLLQL E L FLH + +L+HR + PE+++I  +GAWK+ GF F AL+ NP S  PS    
Sbjct  168  GLLQLGEGLAFLHGDVKLLHRNLCPESIVINIHGAWKIFGFDFCALNQNPDSKQPS----  223

Query  426  FHYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            + Y EYD     +P  +QP LNY APE + +  SS G +SD+F+ G L
Sbjct  224  WLYQEYD---PTLPAVVQPQLNYQAPECILA--SSNGPASDMFALGML  266


 Score = 64.7 bits (156),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 33/93 (35%), Positives = 55/93 (59%), Gaps = 1/93 (1%)
 Frame = +2

Query  5    SKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILE  184
            +KT  +   + ++    +L +LRHP V+ V   L+ES++++A  TEP+FAS AN LG  E
Sbjct  86   AKTDRELVLETLKRGVMQLTKLRHPQVLIVQHPLEESRDSLAFATEPVFASLANVLGNYE  145

Query  185  NI-EKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            NI +  P  LK  ++  +E++  +  +G  L F
Sbjct  146  NIPQPTPANLKDYKLHDIEIRYGLLQLGEGLAF  178



>ref|XP_395903.3| PREDICTED: SCY1-like protein 2-like [Apis mellifera]
Length=845

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 69/106 (65%), Gaps = 8/106 (8%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSF-ALSTNPSSSDPSNMQS  425
            GLLQL E L FLH + +L+HR + PE++++ S+GAWK+ GF F AL+ +     P     
Sbjct  167  GLLQLGEGLAFLHGDVKLLHRNLCPESIVVNSHGAWKIFGFDFCALNQSIEGKQP----Q  222

Query  426  FHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            + Y EYD+  + +  QP+L+Y APE + +  SS+G +SDIFS G L
Sbjct  223  WSYVEYDISSTSIA-QPNLDYQAPECILA--SSVGTASDIFSLGML  265


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 38/137 (28%), Positives = 68/137 (50%), Gaps = 9/137 (7%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
             SK+ ++   + ++   A+L +LRHP ++ V   L+ES++++A  TEP+ AS AN LG  
Sbjct  84   FSKSDKELILETLKRGVAQLTKLRHPQILIVQHPLEESRDSLAFATEPVLASLANILGNH  143

Query  182  ENI-EKVPKELKGIEMGLLEVKQWVTSVGRNLGFPSQQCPSCSSGYIS*DCPHYLKWSLE  358
             N+ + +P  LK  ++  +E+K  +  +G  L F                CP  +  +  
Sbjct  144  NNLPQSLPMALKDYKLHDIEIKYGLLQLGEGLAFLHGDVKLLHRNL----CPESIVVNSH  199

Query  359  ACW----I*FCIINKSV  397
              W      FC +N+S+
Sbjct  200  GAWKIFGFDFCALNQSI  216



>ref|XP_011387980.1| hypothetical protein UMAG_10800 [Ustilago maydis 521]
 gb|KIS70338.1| hypothetical protein UMAG_10800 [Ustilago maydis 521]
Length=894

 Score = 63.9 bits (154),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 60/108 (56%), Gaps = 8/108 (7%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
              GLLQ+A  L+FLH  A++VH+ +SPE+++I + G WKLAGFSF      +        
Sbjct  147  QKGLLQVARGLEFLHT-AKMVHQNLSPESIMINAKGDWKLAGFSFLTPLELAGG--GGQT  203

Query  423  SFHYAEYDVEDSIMP-LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             + + +YD   S+ P +  + +Y APE        +   +D++S GC+
Sbjct  204  PWTFPDYD--PSLPPAMSRNFDYMAPEYALDE--KLAPENDMYSLGCV  247


 Score = 50.1 bits (118),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +2

Query  32   DMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPKEL  211
            + ++ +A+ L RLRHP ++ VV+ L+ES+N +A  TE +FAS + AL I ++ + V  + 
Sbjct  85   EQLKKEASSLTRLRHPCILEVVEPLEESRNDVAFATEQVFASLSEAL-ISDHRQDVQLDE  143

Query  212  KGIEMGLLEV  241
              I+ GLL+V
Sbjct  144  VEIQKGLLQV  153



>dbj|GAM17573.1| hypothetical protein SAMD00019534_007480, partial [Acytostelium 
subglobosum LB1]
Length=933

 Score = 62.4 bits (150),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+ QL E + FL+  A+L+HR I+PE++ IT N  WK+ G  F+ S +    + S + S 
Sbjct  153  GISQLLEGIHFLNTTAKLLHRNIAPESIFITKNLKWKIGGLGFSCSIDSKEPELSGL-SP  211

Query  429  HYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFG  557
             + EY  E+ +    PS  Y APE V+        +SD++S G
Sbjct  212  DFKEYIYEE-VGSFLPSFCYLAPEYVQQRHWEY--NSDLYSIG  251


 Score = 51.6 bits (122),  Expect(2) = 6e-17, Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANAL  172
            +S++A+D     ++ +A  L+RLRHP +++VV A++E+K ++   TEP+ A+  N +
Sbjct  65   MSRSAQDELLGHLKREAQSLIRLRHPSILNVVNAVEETKISLYFATEPVLATLDNLI  121



>ref|XP_006620198.1| PREDICTED: SCY1-like protein 2-like [Apis dorsata]
Length=797

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 69/106 (65%), Gaps = 8/106 (8%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSF-ALSTNPSSSDPSNMQS  425
            GLLQL E L FLH + +L+HR + PE++++ S+GAWK+ GF F AL+ +     P     
Sbjct  167  GLLQLGEGLTFLHGDVKLLHRNLCPESIVVNSHGAWKIFGFDFCALNQSIEGKQP----Q  222

Query  426  FHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            + Y EYD+  + +  QP+L+Y APE + +  SS+G +SDIFS G +
Sbjct  223  WSYVEYDISSTSIA-QPNLDYQAPECILA--SSVGTASDIFSLGMV  265


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 38/137 (28%), Positives = 68/137 (50%), Gaps = 9/137 (7%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
             SK+ ++   + ++   A+L +LRHP ++ V   L+ES++++A  TEP+ AS AN LG  
Sbjct  84   FSKSDKELILETLKRGIAQLTKLRHPQILIVQHPLEESRDSLAFATEPVLASLANILGNH  143

Query  182  ENI-EKVPKELKGIEMGLLEVKQWVTSVGRNLGFPSQQCPSCSSGYIS*DCPHYLKWSLE  358
             N+ + +P  LK  ++  +E+K  +  +G  L F                CP  +  +  
Sbjct  144  NNLPQPLPIALKDYKLHDIEIKYGLLQLGEGLTFLHGDVKLLHRNL----CPESIVVNSH  199

Query  359  ACW----I*FCIINKSV  397
              W      FC +N+S+
Sbjct  200  GAWKIFGFDFCALNQSI  216



>gb|KIM87600.1| hypothetical protein PILCRDRAFT_284654 [Piloderma croceum F 1598]
Length=820

 Score = 67.0 bits (162),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 59/109 (54%), Gaps = 10/109 (9%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
              G+LQL + L+FLH++ARL+H  ++PETV+I S G WK++G    +    +   PS   
Sbjct  156  QKGILQLCKGLEFLHSSARLIHSNLNPETVIINSAGDWKISGLGQTIPLAGADGKPSRW-  214

Query  423  SFHYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
                 E+   D  +P  +Q S NY APE        +  +SD++S G +
Sbjct  215  -----EFPTFDGRVPSYVQRSFNYMAPEYALDEV--LVTASDMYSLGAI  256


 Score = 46.2 bits (108),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  20   DAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFAS  157
            D+  +M++++A+ L RLRHP ++ +V+ L+E++N +   TEP+ +S
Sbjct  88   DSTLEMLKSEASALGRLRHPSILEMVEPLEETRNELIFATEPILSS  133



>gb|ETN58416.1| hypothetical protein AND_010006 [Anopheles darlingi]
Length=811

 Score = 64.3 bits (155),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 57/105 (54%), Gaps = 11/105 (10%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+ +L + + FLH+ A+L+HR I  E +++   G WKL GF +  S  P +   +N    
Sbjct  154  GVFELLKGVRFLHDEAQLIHRNICTENIIVNRQGVWKLFGFGYCWSKRPPAVPVTN---H  210

Query  429  HYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            H+ +  + +      P+  +TAPELV  N  S   ++DI+S G L
Sbjct  211  HFKQRLLGN------PASRWTAPELVLEN--SCNEATDIYSLGIL  247


 Score = 48.9 bits (115),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
             +K   +   + +R    +L ++RHP V+ V  A++ES++ +A  TEP+ AS AN LG  
Sbjct  73   FTKDEREEICENVRRGVVQLTKIRHPQVLTVQHAMEESRDTIAFATEPVVASLANLLGNT  132

Query  182  ENI  190
             N+
Sbjct  133  TNV  135



>ref|XP_003697658.1| PREDICTED: SCY1-like protein 2 [Apis florea]
Length=845

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 69/106 (65%), Gaps = 8/106 (8%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSF-ALSTNPSSSDPSNMQS  425
            GLLQL E L FLH + +L+HR + PE++++ S+GAWK+ GF F AL+ +     P     
Sbjct  167  GLLQLGEGLAFLHGDVKLLHRNLCPESIVVNSHGAWKIFGFDFCALNQSIEGKQP----Q  222

Query  426  FHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            + Y EYD+  + +  QP+L+Y APE + +  SS+G +SDIFS G +
Sbjct  223  WSYVEYDISSTSVA-QPNLDYQAPECILA--SSVGTASDIFSLGMV  265


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 38/137 (28%), Positives = 69/137 (50%), Gaps = 9/137 (7%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
             SK+ ++   ++++   A+L +LRHP ++ V   L+ES++++A  TEP+ AS AN LG  
Sbjct  84   FSKSDKELILEILKRGVAQLTKLRHPQILIVQHPLEESRDSLAFATEPVLASLANILGNH  143

Query  182  ENI-EKVPKELKGIEMGLLEVKQWVTSVGRNLGFPSQQCPSCSSGYIS*DCPHYLKWSLE  358
             N+ + +P  LK  ++  +E+K  +  +G  L F                CP  +  +  
Sbjct  144  NNLPQPLPVALKDYKLHDIEIKYGLLQLGEGLAFLHGDVKLLHRNL----CPESIVVNSH  199

Query  359  ACW----I*FCIINKSV  397
              W      FC +N+S+
Sbjct  200  GAWKIFGFDFCALNQSI  216



>gb|EYC42611.1| hypothetical protein Y032_0525g2930 [Ancylostoma ceylanicum]
Length=787

 Score = 72.8 bits (177),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 63/106 (59%), Gaps = 10/106 (9%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+LQ+ + L +LHN+A+++H  ++P ++ +T++  WK+AGFSFA++     + P      
Sbjct  166  GVLQIIDGLSYLHNSAKILHGNLTPASIFVTTSRLWKIAGFSFAVAAKEPDTYPC-----  220

Query  429  HYAEYDVEDSIMP-LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
                Y     + P LQP L++ APE +  N  ++  ++D+FS G L
Sbjct  221  ----YPWTKKLPPILQPDLDFLAPEYLAPNQQTVTSAADVFSLGVL  262


 Score = 39.3 bits (90),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 23/73 (32%), Positives = 46/73 (63%), Gaps = 6/73 (8%)
 Frame = +2

Query  23   AFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVP  202
            A  D+I+ + ++L  L HP ++HV  AL+++K  +A  TE +  S  +++ I E +E++ 
Sbjct  104  ALVDLIKYEVSQLSALAHPRILHVQHALEDTKEFLAFATESVCGS-LDSIVIEEGVERL-  161

Query  203  KELKGIEMGLLEV  241
             E+K   +G+L++
Sbjct  162  -EMK---LGVLQI  170



>gb|EYC42610.1| hypothetical protein Y032_0525g2930 [Ancylostoma ceylanicum]
Length=713

 Score = 73.2 bits (178),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 63/106 (59%), Gaps = 10/106 (9%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+LQ+ + L +LHN+A+++H  ++P ++ +T++  WK+AGFSFA++     + P      
Sbjct  183  GVLQIIDGLSYLHNSAKILHGNLTPASIFVTTSRLWKIAGFSFAVAAKEPDTYPC-----  237

Query  429  HYAEYDVEDSIMP-LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
                Y     + P LQP L++ APE +  N  ++  ++D+FS G L
Sbjct  238  ----YPWTKKLPPILQPDLDFLAPEYLAPNQQTVTSAADVFSLGVL  279


 Score = 39.3 bits (90),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 23/73 (32%), Positives = 46/73 (63%), Gaps = 6/73 (8%)
 Frame = +2

Query  23   AFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVP  202
            A  D+I+ + ++L  L HP ++HV  AL+++K  +A  TE +  S  +++ I E +E++ 
Sbjct  121  ALVDLIKYEVSQLSALAHPRILHVQHALEDTKEFLAFATESVCGS-LDSIVIEEGVERL-  178

Query  203  KELKGIEMGLLEV  241
             E+K   +G+L++
Sbjct  179  -EMK---LGVLQI  187



>gb|EYC42609.1| hypothetical protein Y032_0525g2930 [Ancylostoma ceylanicum]
Length=696

 Score = 73.2 bits (178),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 63/106 (59%), Gaps = 10/106 (9%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+LQ+ + L +LHN+A+++H  ++P ++ +T++  WK+AGFSFA++     + P      
Sbjct  166  GVLQIIDGLSYLHNSAKILHGNLTPASIFVTTSRLWKIAGFSFAVAAKEPDTYPC-----  220

Query  429  HYAEYDVEDSIMP-LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
                Y     + P LQP L++ APE +  N  ++  ++D+FS G L
Sbjct  221  ----YPWTKKLPPILQPDLDFLAPEYLAPNQQTVTSAADVFSLGVL  262


 Score = 39.3 bits (90),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 23/73 (32%), Positives = 46/73 (63%), Gaps = 6/73 (8%)
 Frame = +2

Query  23   AFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVP  202
            A  D+I+ + ++L  L HP ++HV  AL+++K  +A  TE +  S  +++ I E +E++ 
Sbjct  104  ALVDLIKYEVSQLSALAHPRILHVQHALEDTKEFLAFATESVCGS-LDSIVIEEGVERL-  161

Query  203  KELKGIEMGLLEV  241
             E+K   +G+L++
Sbjct  162  -EMK---LGVLQI  170



>gb|EYC42608.1| hypothetical protein Y032_0525g2930 [Ancylostoma ceylanicum]
Length=665

 Score = 73.2 bits (178),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 63/106 (59%), Gaps = 10/106 (9%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+LQ+ + L +LHN+A+++H  ++P ++ +T++  WK+AGFSFA++     + P      
Sbjct  135  GVLQIIDGLSYLHNSAKILHGNLTPASIFVTTSRLWKIAGFSFAVAAKEPDTYPC-----  189

Query  429  HYAEYDVEDSIMP-LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
                Y     + P LQP L++ APE +  N  ++  ++D+FS G L
Sbjct  190  ----YPWTKKLPPILQPDLDFLAPEYLAPNQQTVTSAADVFSLGVL  231


 Score = 39.3 bits (90),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 23/73 (32%), Positives = 46/73 (63%), Gaps = 6/73 (8%)
 Frame = +2

Query  23   AFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVP  202
            A  D+I+ + ++L  L HP ++HV  AL+++K  +A  TE +  S  +++ I E +E++ 
Sbjct  73   ALVDLIKYEVSQLSALAHPRILHVQHALEDTKEFLAFATESVCGS-LDSIVIEEGVERL-  130

Query  203  KELKGIEMGLLEV  241
             E+K   +G+L++
Sbjct  131  -EMK---LGVLQI  139



>gb|EJD75769.1| SCY1 protein kinase [Loa loa]
Length=766

 Score = 78.2 bits (191),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 66/105 (63%), Gaps = 8/105 (8%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+LQL + L +LHNNAR++H  ++P  + IT +  WK+AGF+F+++   S+  P     F
Sbjct  143  GILQLIDGLSYLHNNARILHGNLTPSVIYITLSRHWKIAGFAFSVAARESNVFP----CF  198

Query  429  HYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             +    ++   + LQP L++ APE + SNT S+  ++D+FS G L
Sbjct  199  PW----IKKLPVHLQPDLDFLAPEYLLSNTDSVTSAADVFSLGLL  239


 Score = 33.9 bits (76),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 5/58 (9%)
 Frame = +2

Query  26   FFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFAS-----AANALGILE  184
              D+IR D ++L  L HP ++ V+  ++E+K  +   +E + AS       + LG LE
Sbjct  82   LIDLIRYDVSQLSSLAHPRILQVLHDVEENKEMITFASENIQASLEVIVVEDGLGKLE  139



>gb|KDQ33764.1| hypothetical protein PLEOSDRAFT_1073929 [Pleurotus ostreatus 
PC15]
Length=829

 Score = 63.5 bits (153),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 58/109 (53%), Gaps = 10/109 (9%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
              G+LQ+ + L F+H +A+L+H  I PE+++I + G WKLAG    ++       P+   
Sbjct  157  QKGILQICKGLAFIHTSAQLIHSNICPESIVINNAGDWKLAGLGLTIALIGPGGSPARW-  215

Query  423  SFHYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
                 E+   D  +P  +Q S +Y APE       ++  +SD++S GCL
Sbjct  216  -----EFPTFDGRVPPYIQRSFDYMAPEYALDE--ALLTASDMYSLGCL  257


 Score = 48.5 bits (114),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 19/52 (37%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFAS  157
            LS +A+D   ++++A+A+ L RLRHP ++ +V+ L+E+++ +   TEP+ +S
Sbjct  83   LSPSAKDRTLEVLKAEASALGRLRHPSILEMVEPLEETRSEIIFATEPILSS  134



>ref|XP_009763333.1| PREDICTED: SCY1-like protein 2, partial [Nicotiana sylvestris]
Length=723

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  426  FHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             ++ EYDVED I+PLQPSLNYTAPELVRS TSS+GCSSDIFSFGCL
Sbjct  25   MNFQEYDVEDLIIPLQPSLNYTAPELVRSKTSSVGCSSDIFSFGCL  70



>gb|KFB53079.1| AGAP002142-PA-like protein [Anopheles sinensis]
Length=837

 Score = 62.0 bits (149),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 54/105 (51%), Gaps = 11/105 (10%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+ +L + + FLH+ A+L+HR I  E +++   G WKL GF F  S     +   N    
Sbjct  154  GVFELIKGIQFLHDEAQLIHRNICTENIVVNRQGVWKLFGFGFCWSKRTPGAPVMN----  209

Query  429  HYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            HY +  +  +     P   +TAPEL+  N  S   S+DI+S G L
Sbjct  210  HYFKNRLLGN-----PGSKWTAPELILEN--SCNESTDIYSLGIL  247


 Score = 49.3 bits (116),  Expect(2) = 3e-16, Method: Composition-based stats.
 Identities = 23/63 (37%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
             +K   +   + IR    +L ++RHP V+ V  A++ES++ +A  TEP+ AS AN LG  
Sbjct  73   FTKDEREEICENIRRGVVQLTKIRHPQVLTVQHAMEESRDTIAFATEPVVASLANLLGNT  132

Query  182  ENI  190
             N+
Sbjct  133  ANV  135



>ref|XP_007920708.1| hypothetical protein MYCFIDRAFT_114886, partial [Pseudocercospora 
fijiensis CIRAD86]
 gb|EME87168.1| hypothetical protein MYCFIDRAFT_114886, partial [Pseudocercospora 
fijiensis CIRAD86]
Length=708

 Score = 77.0 bits (188),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 72/122 (59%), Gaps = 5/122 (4%)
 Frame = +3

Query  204  RSSKE*KWDY*R*NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFAL  383
            R  +E + D      GLLQLA+ L+FLH +A LVH  ++PE +L+ + G WK++G +FA 
Sbjct  152  RRRRELEIDELEIQKGLLQLAKGLEFLHESAGLVHANLTPEAILVNAKGDWKISGLAFA-  210

Query  384  STNPSSSDPSNMQSFHYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFSFG  557
              + SS+  +++      E    D  +P  +Q +L+YT+P+ V  N  S+  S+D+FS G
Sbjct  211  GPHESSTAATSLHPISLHEVLNHDPRLPRSVQLNLDYTSPDFVLDN--SLAASADMFSLG  268

Query  558  CL  563
             +
Sbjct  269  LI  270


 Score = 34.7 bits (78),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 6/71 (8%)
 Frame = +2

Query  8    KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDE-SKNAMAMVTEPLFASAANALGILE  184
            K A +   + ++ +A+ L RLRHP ++ + + ++E SK  +  V E + +S A   G+LE
Sbjct  72   KRAHEEVVEQLKKEASSLARLRHPSILELAEPVEETSKGGLMFVAESVVSSLA---GLLE  128

Query  185  NIEKVPKELKG  217
              EK  +E  G
Sbjct  129  --EKDQQERSG  137



>gb|KFM57018.1| SCY1-like protein 2, partial [Stegodyphus mimosarum]
Length=867

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 66/109 (61%), Gaps = 13/109 (12%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G LQL E L FLHN+ +++H  I+PE++L+  NGAWKLAGF F  ST  S+S  S  + F
Sbjct  152  GFLQLTEGLAFLHNDVKMIHGNINPESILVNRNGAWKLAGFDF--STQFSNSVDSQGEQF  209

Query  429  HYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCS----SDIFSFGCL  563
             + E ++E    P  P L+Y APE +      +GCS    SD+FS G L
Sbjct  210  SFGEIEIEMP-PPCHPHLDYVAPERI------LGCSNCPASDMFSVGAL  251


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 35/93 (38%), Positives = 53/93 (57%), Gaps = 1/93 (1%)
 Frame = +2

Query  5    SKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILE  184
            SK  ++    +++   A L RLRHP ++ V  +L+ES+ ++A  TEP+FAS AN LG  E
Sbjct  70   SKQEKELILSILKKGVANLTRLRHPSILTVQHSLEESRESLAFATEPVFASLANILGYQE  129

Query  185  NIE-KVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            N+    PK LK  E+  +E+K     +   L F
Sbjct  130  NMPVPPPKSLKDFELYDVEIKYGFLQLTEGLAF  162



>gb|KHJ93653.1| hypothetical protein OESDEN_06432 [Oesophagostomum dentatum]
Length=306

 Score = 74.7 bits (182),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 66/107 (62%), Gaps = 12/107 (11%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+LQ+ + L +LHN+A+++H  ++P ++ +TS+  WK+AGFSFA+    ++ +P     F
Sbjct  95   GVLQIIDGLSYLHNSAKILHGNLTPASIFVTSSRLWKIAGFSFAV----AAKEPDTYPCF  150

Query  429  HYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             + +       +P  LQP L++ APE +  N  ++  ++D+FS G L
Sbjct  151  PWTKK------LPPILQPDLDFLAPEYLAPNQQTVTSAADVFSLGVL  191


 Score = 36.2 bits (82),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 44/73 (60%), Gaps = 6/73 (8%)
 Frame = +2

Query  23   AFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVP  202
            A  D+I+ + ++L  L HP ++HV   L+++K  +A  TE +  S  + + I E +E++ 
Sbjct  33   ALVDLIKYEVSQLSALAHPRILHVQHNLEDTKEFLAFATESVCGS-LDTIVIEEGVERL-  90

Query  203  KELKGIEMGLLEV  241
             E+K   +G+L++
Sbjct  91   -EMK---LGVLQI  99



>ref|NP_491915.2| Protein ZC581.9 [Caenorhabditis elegans]
 emb|CCD64902.1| ZC581.9 [Caenorhabditis elegans]
Length=827

 Score = 67.8 bits (164),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 61/106 (58%), Gaps = 10/106 (9%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+LQ+ + + +LHN+A+++H  ++P+ + +T+   WK+ GFSFA++    +         
Sbjct  178  GVLQIIDGMSYLHNSAKMLHGNLTPDAIYVTATKTWKIGGFSFAVNAKEPNC--------  229

Query  429  HYAEYDVEDSIMP-LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             Y  Y     + P LQP L++ APE +    +++  ++D+FS G L
Sbjct  230  -YPCYPWTKKLPPCLQPDLDFLAPENLAPGQTTVTSAADVFSLGVL  274


 Score = 42.7 bits (99),  Expect(2) = 6e-16, Method: Composition-based stats.
 Identities = 21/80 (26%), Positives = 50/80 (63%), Gaps = 6/80 (8%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            L K+   + FD+I+ +  +L+ L HP ++H+  +L+E+K+ ++  TE +F +  N +   
Sbjct  109  LGKSKTYSMFDLIKYETQQLMGLIHPRILHMEHSLEETKDYISFATEQIFGNLENVV-TD  167

Query  182  ENIEKVPKELKGIEMGLLEV  241
            E+++++      I++G+L++
Sbjct  168  ESLDRLE-----IKLGVLQI  182



>ref|XP_960288.1| protein kinase domain-containing protein ppk32 [Neurospora crassa 
OR74A]
 gb|EAA31052.1| protein kinase domain-containing protein ppk32 [Neurospora crassa 
OR74A]
 emb|CAF06123.1| conserved hypothetical protein [Neurospora crassa]
 gb|KHE88946.1| hypothetical protein GE21DRAFT_8726 [Neurospora crassa]
Length=1015

 Score = 73.6 bits (179),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 71/122 (58%), Gaps = 5/122 (4%)
 Frame = +3

Query  204  RSSKE*KWDY*R*NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFAL  383
            R  +E + D      GLLQ+++ L+FLH NA LVH  ++P+ +LI +   WK++G +F  
Sbjct  154  RRRREVEIDELEYQKGLLQVSKALEFLHENAGLVHGNLTPDAILINAKSDWKVSGLAFC-  212

Query  384  STNPSSSDPSNMQSFHYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFSFG  557
            S    S  P+++Q    AE    +  +P  +Q +L+YT+P+ V  N  ++  S+D+FS G
Sbjct  213  SPQQDSDKPTSIQPISLAEVLHYEPRLPRTVQMNLDYTSPDFVLDN--NLTSSADMFSLG  270

Query  558  CL  563
             L
Sbjct  271  LL  272


 Score = 37.0 bits (84),  Expect(2) = 6e-16, Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 33/56 (59%), Gaps = 1/56 (2%)
 Frame = +2

Query  8    KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESK-NAMAMVTEPLFASAANAL  172
            K   +   + ++ +A+ L RLRHP ++ +V+ ++E++   +  VTEP+  S A  L
Sbjct  72   KKVVEEVVERLKKEASSLARLRHPAILELVEPVEETRGGGLQFVTEPVTTSLAAVL  127



>gb|EGZ68505.1| hypothetical protein NEUTE2DRAFT_160848 [Neurospora tetrasperma 
FGSC 2509]
Length=1089

 Score = 73.6 bits (179),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 71/122 (58%), Gaps = 5/122 (4%)
 Frame = +3

Query  204  RSSKE*KWDY*R*NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFAL  383
            R  +E + D      GLLQ+++ L+FLH NA LVH  ++P+ +LI +   WK++G +F  
Sbjct  154  RRRREVEIDELEYQKGLLQVSKALEFLHENAGLVHGNLTPDAILINAKSDWKVSGLAFC-  212

Query  384  STNPSSSDPSNMQSFHYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFSFG  557
            S    S  P+++Q    AE    +  +P  +Q +L+YT+P+ V  N  ++  S+D+FS G
Sbjct  213  SPQQDSDKPTSIQPISLAEVLHYEPRLPRTVQMNLDYTSPDFVLDN--NLTSSADMFSLG  270

Query  558  CL  563
             L
Sbjct  271  LL  272


 Score = 37.0 bits (84),  Expect(2) = 6e-16, Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 33/56 (59%), Gaps = 1/56 (2%)
 Frame = +2

Query  8    KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESK-NAMAMVTEPLFASAANAL  172
            K   +   + ++ +A+ L RLRHP ++ +V+ ++E++   +  VTEP+  S A  L
Sbjct  72   KKVVEEVVERLKKEASSLARLRHPAILELVEPVEETRGGGLQFVTEPVTTSLAAVL  127



>ref|XP_009854070.1| hypothetical protein NEUTE1DRAFT_124407 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGO54072.1| hypothetical protein NEUTE1DRAFT_124407 [Neurospora tetrasperma 
FGSC 2508]
Length=1017

 Score = 73.6 bits (179),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 71/122 (58%), Gaps = 5/122 (4%)
 Frame = +3

Query  204  RSSKE*KWDY*R*NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFAL  383
            R  +E + D      GLLQ+++ L+FLH NA LVH  ++P+ +LI +   WK++G +F  
Sbjct  154  RRRREVEIDELEYQKGLLQVSKALEFLHENAGLVHGNLTPDAILINAKSDWKVSGLAFC-  212

Query  384  STNPSSSDPSNMQSFHYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFSFG  557
            S    S  P+++Q    AE    +  +P  +Q +L+YT+P+ V  N  ++  S+D+FS G
Sbjct  213  SPQQDSDKPTSIQPISLAEVLHYEPRLPRTVQMNLDYTSPDFVLDN--NLTSSADMFSLG  270

Query  558  CL  563
             L
Sbjct  271  LL  272


 Score = 36.6 bits (83),  Expect(2) = 6e-16, Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 33/56 (59%), Gaps = 1/56 (2%)
 Frame = +2

Query  8    KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESK-NAMAMVTEPLFASAANAL  172
            K   +   + ++ +A+ L RLRHP ++ +V+ ++E++   +  VTEP+  S A  L
Sbjct  72   KKVVEEVVERLKKEASSLARLRHPAILELVEPVEETRGGGLQFVTEPVTTSLAAVL  127



>emb|CCG81569.1| putative Protein kinase Scy1 [Taphrina deformans PYCC 5710]
Length=797

 Score = 64.7 bits (156),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 62/109 (57%), Gaps = 14/109 (13%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
              GLLQ+   L+FL + A++VH  + P  + I + G WKL+GFSFA++      DP +  
Sbjct  147  QKGLLQITIGLEFLQSVAQIVHGNLVPAAIFINAKGDWKLSGFSFAMAMK---EDPRH--  201

Query  423  SFHYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
              +  +Y   D+ +P  +Q +L+Y APE V   T  +   +D+F+ GCL
Sbjct  202  --NPPDY---DNRLPQNVQRNLDYAAPEFVIDET--VSPLNDMFALGCL  243


 Score = 45.8 bits (107),  Expect(2) = 6e-16, Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  20   DAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFA  154
            DA +  ++ +AA L RLRHP ++ VV+ ++ES+N++  VTE + A
Sbjct  71   DAIYTQLKGEAATLARLRHPAMLEVVEPIEESRNSITFVTERVTA  115



>ref|XP_003493344.1| PREDICTED: SCY1-like protein 2-like [Bombus impatiens]
Length=845

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 67/106 (63%), Gaps = 8/106 (8%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSF-ALSTNPSSSDPSNMQS  425
            GLLQL E   FLH + +L+HR + PE++++ S+GAWK+ GF F AL+ +     P     
Sbjct  167  GLLQLGEGFTFLHGDVKLLHRNLCPESIVVNSHGAWKIFGFDFCALNQSAEGKQP----Q  222

Query  426  FHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            + Y EYD+    +  QP+L+Y APE + +  SS+G +SDIFS G +
Sbjct  223  WSYIEYDISAPSIA-QPNLDYQAPECILA--SSVGTASDIFSLGVV  265


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/94 (31%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
             S+  ++   + ++   A+L +LRHP ++ V   L+ES++++A  TEP+ AS AN LG  
Sbjct  84   FSRNDKELILETLKRGIAQLTKLRHPQILTVQHPLEESRDSLAFATEPVLASLANVLGNH  143

Query  182  ENI-EKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
             N+ + +P  LK  ++  +E+K  +  +G    F
Sbjct  144  NNLPQPLPTALKDYKLHDVEIKYGLLQLGEGFTF  177



>ref|XP_003385265.2| PREDICTED: SCY1-like protein 2 [Amphimedon queenslandica]
Length=1106

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 64/105 (61%), Gaps = 12/105 (11%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GLLQLAE L+FLHNN ++ H  +  + + I++NG WKLAGF+FA      SS  S    +
Sbjct  147  GLLQLAEGLNFLHNNVKMRHGNLCIDNITISTNGDWKLAGFNFA------SSIESETPGY  200

Query  429  HYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             + E        PL P+LNY APE+V SNT +  C  D++SFG L
Sbjct  201  SFKETKA----FPLHPTLNYLAPEVVLSNTVNEKC--DLYSFGML  239


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 49/92 (53%), Gaps = 1/92 (1%)
 Frame = +2

Query  8    KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  187
            K   +A F++++     L + RHP ++ V   ++ES + +A  TEP+ AS AN LG   N
Sbjct  66   KKEREALFELLKKGPTHLAKFRHPKILTVDHPVEESSDCLAFATEPIVASLANVLGYYAN  125

Query  188  I-EKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            +   +P ++K  ++  LEV   +  +   L F
Sbjct  126  LPSPLPPDIKEYQVHTLEVHYGLLQLAEGLNF  157



>gb|KHN71737.1| SCY1-like protein 2 [Toxocara canis]
Length=887

 Score = 68.6 bits (166),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 65/107 (61%), Gaps = 12/107 (11%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+LQ+ + L +LHN+ +++H  ++P ++ +T++  WK+AGFSF++    S+ +P     F
Sbjct  177  GILQIIDGLSYLHNSVKILHGNLTPSSIYVTTSRLWKIAGFSFSV----SAKEPGIFPCF  232

Query  429  HYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             + +       +P  LQP L++ APE +  N  ++  ++D+FS G L
Sbjct  233  PWTKK------LPSQLQPDLDFLAPEYLAPNQHTVTPAADVFSLGVL  273


 Score = 40.8 bits (94),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 27/42 (64%), Gaps = 0/42 (0%)
 Frame = +2

Query  32   DMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFAS  157
            D+I+ D  +L  L HP ++HV+ +L+E K  +A  TE + AS
Sbjct  118  DLIKYDVTQLASLAHPRILHVLHSLEEDKEMLAFATERVHAS  159



>ref|XP_011172314.1| PREDICTED: SCY1-like protein 2 [Solenopsis invicta]
Length=851

 Score = 68.9 bits (167),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 58/105 (55%), Gaps = 15/105 (14%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GLLQ+ E L FLH N + +HR + P +++IT  G WKL+GF F      +   P  +QS+
Sbjct  169  GLLQITEALLFLHGNCKFLHRNVCPTSIIITKRGTWKLSGFEF---IEGAKEIPITVQSW  225

Query  429  HYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFSFG  557
                       MP   QP+L+Y APE+ +   +S   SSD+++ G
Sbjct  226  --------TKHMPKMTQPNLDYIAPEVQQKKLASF--SSDMYNLG  260


 Score = 40.4 bits (93),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 19/53 (36%), Positives = 32/53 (60%), Gaps = 1/53 (2%)
 Frame = +2

Query  32   DMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENI  190
            D++RA AAR+ R  HP ++   + ++E  + +A  +EP+ AS AN L   E +
Sbjct  77   DILRASAARMERYSHPKLLQAYK-VEECADTLAFASEPVLASLANVLAYKEQL  128



>ref|XP_002603632.1| hypothetical protein BRAFLDRAFT_101363 [Branchiostoma floridae]
 gb|EEN59643.1| hypothetical protein BRAFLDRAFT_101363, partial [Branchiostoma 
floridae]
Length=1608

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 47/106 (44%), Positives = 64/106 (60%), Gaps = 8/106 (8%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GLLQ+ E L FLHN+ ++VH  ++PE +++  NGAWK+AGF F +   PSS+ P     F
Sbjct  199  GLLQVTEGLAFLHNDVKMVHGNLTPEVIILNKNGAWKVAGFEFCI---PSSNPPDQAAFF  255

Query  429  HYAEYDVEDSIMPL-QPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
               EYD  +++ PL Q +LNY APE V     S     D+FS G L
Sbjct  256  SAKEYD--ENLTPLAQQTLNYHAPEYVLQ--CSCDTPGDLFSLGML  297


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 30/82 (37%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            +++   DA  + ++    +L RLRHP ++ V   L+ES++++A  TEP+FAS AN LG  
Sbjct  73   MNRRDRDAVIEAMKRGVTQLTRLRHPRLLTVQHPLEESRDSLAFATEPVFASLANVLGNY  132

Query  182  ENIEK-VPKELKGIEMGLLEVK  244
            EN+   VP  +K  ++  +E+K
Sbjct  133  ENMPTPVPAAIKDHQLYEVEIK  154



>ref|XP_011065985.1| PREDICTED: SCY1-like protein 2 [Acromyrmex echinatior]
 gb|EGI58244.1| SCY1-like protein 2 [Acromyrmex echinatior]
Length=860

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 67/108 (62%), Gaps = 12/108 (11%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSF-ALSTNPSSSDPSNMQS  425
            GLLQL E L FLH + +L+HR + PE+++I  +GAWK+ GF F AL+ N     P    S
Sbjct  168  GLLQLGEGLAFLHGDVKLLHRNLCPESIVINVHGAWKIFGFDFCALNQNLDGKQP----S  223

Query  426  FHYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            + Y EY   DS +P  +QP L+Y APE + +  SS G  SDIF+ G L
Sbjct  224  WSYLEY---DSTLPAVVQPQLDYQAPECILA--SSNGPPSDIFALGIL  266


 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 55/93 (59%), Gaps = 1/93 (1%)
 Frame = +2

Query  5    SKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILE  184
            S+   +   + ++    +L +LRHP V+ V   L+ES++++A  TEP+FAS AN LG  E
Sbjct  86   SRADRELVLETLKRGVMQLTKLRHPQVLTVQHPLEESRDSLAFATEPVFASLANVLGNYE  145

Query  185  NI-EKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            NI +  P  LKG ++  +E++  +  +G  L F
Sbjct  146  NISQPTPANLKGYKLLDIEIRYGLLQLGEGLAF  178



>ref|XP_003353074.1| hypothetical protein SMAC_03392 [Sordaria macrospora k-hell]
 emb|CCC09836.1| unnamed protein product [Sordaria macrospora k-hell]
Length=1009

 Score = 72.0 bits (175),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 72/122 (59%), Gaps = 5/122 (4%)
 Frame = +3

Query  204  RSSKE*KWDY*R*NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFAL  383
            R  +E + D      GLLQ+++ L+FLH NA LVH  ++P+ +LI +   WK++G +F  
Sbjct  154  RRRREVEIDELEYQKGLLQVSKALEFLHENAGLVHGNLTPDAILINAKSDWKVSGLAFC-  212

Query  384  STNPSSSDPSNMQSFHYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFSFG  557
            S    S+ P+++Q    +E    +  +P  +Q +L+YT+P+ V  N  ++  S+D+FS G
Sbjct  213  SPQQDSNKPTSIQPISLSEVLHYEPRLPRTVQMNLDYTSPDFVLDN--NLTSSADMFSLG  270

Query  558  CL  563
             L
Sbjct  271  LL  272


 Score = 37.0 bits (84),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 33/56 (59%), Gaps = 1/56 (2%)
 Frame = +2

Query  8    KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESK-NAMAMVTEPLFASAANAL  172
            K   +   + ++ +A+ L RLRHP ++ +V+ ++E++   +  VTEP+  S A  L
Sbjct  72   KKVVEEVVERLKKEASSLARLRHPAILELVEPVEETRGGGLQFVTEPVTTSLAAVL  127



>gb|KIJ44257.1| hypothetical protein M422DRAFT_228299 [Sphaerobolus stellatus 
SS14]
Length=827

 Score = 62.8 bits (151),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 57/108 (53%), Gaps = 8/108 (7%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALS-TNPSSSDPSNM  419
              G+LQ+ + L FLH +ARL+H  IS   V+I ++G WK++G    +S T P  S     
Sbjct  151  QKGILQICKGLSFLHTSARLIHSNISSNNVMINASGDWKISGLGLTISLTQPDGSK----  206

Query  420  QSFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
              + +  YD   +   +Q S +Y APE        +  +SD++S GCL
Sbjct  207  TRWEFPTYDSRLTSH-VQRSFDYMAPEYALDE--QLVTASDMYSLGCL  251


 Score = 46.6 bits (109),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 22/77 (29%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = +2

Query  11   TAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENI  190
            TA +   ++++A+A  L RLRHP ++ +V+ L+E+++ +   TEPL +S   ++      
Sbjct  81   TARERVLEVLKAEAGALRRLRHPSILEMVEPLEETRSELIFATEPLLSSLTQSIPGASRS  140

Query  191  EKVPKELKGIEMGLLEV  241
              V  +   I+ G+L++
Sbjct  141  PLVDLDEVEIQKGILQI  157



>gb|EMG47746.1| hypothetical protein G210_1797 [Candida maltosa Xu316]
Length=866

 Score = 71.2 bits (173),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 63/106 (59%), Gaps = 6/106 (6%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GLLQ+A+ L FLH+   +VH  + P ++ I + G WKL GF F  + N  S  PS  ++F
Sbjct  136  GLLQVAKGLQFLHSYGSIVHLNLQPSSIYINNQGDWKLGGFKFLQNLNEIS--PSERENF  193

Query  429  HYAEYDVEDSIMPL-QPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +        S++P    +LN+TAPEL+  + + +  ++DI+SFG L
Sbjct  194  YIMN---NSSVVPFANLNLNFTAPELIIDSHTKLDFANDIWSFGQL  236


 Score = 38.1 bits (87),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 44/76 (58%), Gaps = 13/76 (17%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKV-PK  205
            +++I+ +  +L +L+HP ++ +++ L+E+K     V+EP          + +N+  + PK
Sbjct  77   YELIKYEVNQLSKLKHPQLLQILEVLEETKTKFLFVSEP----------VTDNLLTINPK  126

Query  206  ELK--GIEMGLLEVKQ  247
            +L    I+ GLL+V +
Sbjct  127  DLDSLSIQKGLLQVAK  142



>gb|EJT98337.1| hypothetical protein DACRYDRAFT_57369 [Dacryopinax sp. DJM-731 
SS1]
Length=895

 Score = 70.5 bits (171),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 57/107 (53%), Gaps = 6/107 (6%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
              GLLQ+   L+FLH +ARLVH  + PE +LI S G WKL+G    +  +     P+   
Sbjct  152  QKGLLQVCRGLEFLHTSARLVHSNVCPEAILINSKGDWKLSGLGLTMPLSQPDGTPTR--  209

Query  423  SFHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             + + EYD    ++  Q   +Y APE   +    I  +SD+++ GC+
Sbjct  210  -WEFPEYD-NRLLLYAQRKFDYLAPEY--AIDEQITVASDMYALGCV  252


 Score = 38.1 bits (87),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  32   DMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAA  163
            ++++ +A+ L RLRHP ++ +V+ ++E++  +   TEPL +S A
Sbjct  84   EVLKHEASSLSRLRHPCILEMVEPMEETRGEIIFATEPLTSSLA  127



>gb|EGT38777.1| hypothetical protein CAEBREN_20632 [Caenorhabditis brenneri]
Length=846

 Score = 70.1 bits (170),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 62/106 (58%), Gaps = 10/106 (9%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+LQ+ + + +LHN+A+++H  ++P+ + +T+   WK+ GFSFA++    +  P      
Sbjct  181  GVLQIIDGMSYLHNSAKMLHGNLTPDAIYVTATKTWKIGGFSFAVNAKEPNCYPC-----  235

Query  429  HYAEYDVEDSIMP-LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
                Y     + P LQP L++ APE +  N +++  ++D+FS G L
Sbjct  236  ----YPWTKKLPPCLQPDLDFLAPENLAPNQTTVTSAADVFSLGVL  277


 Score = 38.9 bits (89),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 16/52 (31%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFAS  157
            L K+   + FD+I+ +  +L+ L HP ++H+   L+E+K+  +  TE +F +
Sbjct  112  LGKSKTYSMFDLIKYETQQLMGLIHPRILHMEHNLEETKDYFSFATEQIFGN  163



>gb|EGT41199.1| hypothetical protein CAEBREN_06528 [Caenorhabditis brenneri]
Length=831

 Score = 70.1 bits (170),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 62/106 (58%), Gaps = 10/106 (9%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+LQ+ + + +LHN+A+++H  ++P+ + +T+   WK+ GFSFA++    +  P      
Sbjct  181  GVLQIIDGMSYLHNSAKMLHGNLTPDAIYVTATKTWKIGGFSFAVNAKEPNCYPC-----  235

Query  429  HYAEYDVEDSIMP-LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
                Y     + P LQP L++ APE +  N +++  ++D+FS G L
Sbjct  236  ----YPWTKKLPPCLQPDLDFLAPENLAPNQTTVTSAADVFSLGVL  277


 Score = 38.9 bits (89),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 16/52 (31%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFAS  157
            L K+   + FD+I+ +  +L+ L HP ++H+   L+E+K+  +  TE +F +
Sbjct  112  LGKSKTYSMFDLIKYETQQLMGLIHPRILHMEHNLEETKDYFSFATEQIFGN  163



>ref|XP_011298914.1| PREDICTED: SCY1-like protein 2 [Fopius arisanus]
Length=697

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 68/107 (64%), Gaps = 10/107 (9%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGF-SFALSTNPSSSDPSNMQS  425
            GLLQL E L FLH++ +L+HR + P++++I  +GAWK+ GF S AL+ NP    P    S
Sbjct  81   GLLQLGEGLAFLHSDVKLLHRNLCPDSIVINKHGAWKIFGFDSCALNQNPQDKQP----S  136

Query  426  FHYAEYDVEDSIMPL-QPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            ++Y EYD   SI  + QP L+Y APE + +   S G  SDIFS G L
Sbjct  137  WNYTEYD--PSIPSVGQPHLDYQAPECIVA--GSCGPPSDIFSLGML  179


 Score = 67.8 bits (164),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 33/85 (39%), Positives = 54/85 (64%), Gaps = 1/85 (1%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENI-EKVPK  205
            FD ++    +L +LRHP V+ V   L+ES++++A   EP+FAS +NALG LEN  + +PK
Sbjct  7    FDALKRGITQLTKLRHPQVLTVQHPLEESRDSLAFAAEPVFASLSNALGSLENCPQPIPK  66

Query  206  ELKGIEMGLLEVKQWVTSVGRNLGF  280
             LK  ++  +E++  +  +G  L F
Sbjct  67   SLKDYKLLDVEIRYGLLQLGEGLAF  91



>ref|XP_007863336.1| kinase-like protein [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ58050.1| kinase-like protein [Gloeophyllum trabeum ATCC 11539]
Length=865

 Score = 64.3 bits (155),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 57/109 (52%), Gaps = 10/109 (9%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
              G+LQL + L FLH +ARL+H  ++PE+VLI S+G WK++G    +        P   +
Sbjct  161  QKGILQLCKGLAFLHTSARLIHSNLNPESVLINSSGDWKISGLGLTIPLQ----KPDGTE  216

Query  423  SFHYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +    E+   D   P  +Q S +Y APE        +   SD++S GCL
Sbjct  217  T--RWEFPTFDGRAPSYVQRSFDYMAPEYALDEM--LVTESDMYSLGCL  261


 Score = 44.7 bits (104),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 18/52 (35%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFAS  157
            L+  A +    +++++A+ L RLRHP ++ +V+ L+E++N +   TEPL +S
Sbjct  88   LTAIAREHTLSVLKSEASALSRLRHPCILEMVEPLEETRNELIFATEPLISS  139



>ref|XP_011152169.1| PREDICTED: SCY1-like protein 2 [Harpegnathos saltator]
 ref|XP_011152170.1| PREDICTED: SCY1-like protein 2 [Harpegnathos saltator]
 gb|EFN76018.1| SCY1-like protein 2 [Harpegnathos saltator]
Length=871

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 67/108 (62%), Gaps = 12/108 (11%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSF-ALSTNPSSSDPSNMQS  425
            GLLQL E L FLH + +L+HR + PE+++I  +GAWK+ GF F AL+ +  S  P    S
Sbjct  168  GLLQLGEGLAFLHGDVKLLHRNLCPESIVINIHGAWKIFGFDFCALNQSSDSKQP----S  223

Query  426  FHYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            + Y EY   D  +P  +QP LNY APE + +  SS G  SDIF+ G L
Sbjct  224  WSYVEY---DPTLPAVVQPCLNYQAPECILA--SSNGPPSDIFALGIL  266


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 66/135 (49%), Gaps = 9/135 (7%)
 Frame = +2

Query  5    SKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILE  184
            SK   +   + ++    +L +LRHP ++ V   L+ES++++A  TEP+FAS AN LG  E
Sbjct  86   SKADRELVLETLKRGVTQLTKLRHPQILTVQHPLEESRDSLAFATEPVFASLANVLGNDE  145

Query  185  NI-EKVPKELKGIEMGLLEVKQWVTSVGRNLGFPSQQCPSCSSGYIS*DCPHYLKWSLEA  361
            NI +  P  L+  ++  +E++  +  +G  L F                CP  +  ++  
Sbjct  146  NIPQPTPANLRDYKLHSIEIRYGLLQLGEGLAFLHGDVKLLHRNL----CPESIVINIHG  201

Query  362  CW----I*FCIINKS  394
             W      FC +N+S
Sbjct  202  AWKIFGFDFCALNQS  216



>emb|CDR45825.1| CYFA0S20e00584g1_1 [Cyberlindnera fabianii]
Length=808

 Score = 72.0 bits (175),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 59/108 (55%), Gaps = 15/108 (14%)
 Frame = +3

Query  246  NGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQS  425
             GLLQ+A  L+F+HN AR+VH +I P ++ I  N  WK++G             P   + 
Sbjct  128  KGLLQVANALEFVHNQARMVHLSIQPSSIFINDNSDWKVSGLGHL--------QPVESED  179

Query  426  FHYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +   +YD     MP  +  +LNYTAPE+V  N +    +SD+FS GC+
Sbjct  180  YFIPQYDPR---MPGFININLNYTAPEVVFENKAY--PASDMFSLGCV  222


 Score = 36.6 bits (83),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 24/73 (33%), Positives = 37/73 (51%), Gaps = 12/73 (16%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPKE  208
            ++++R   A L + RHP V+ +++ L+E K +   VTE L     N          VP E
Sbjct  71   YEVLRNQVANLAKFRHPNVLTLIEPLEEHKASFLFVTE-LVTGCLNT---------VPPE  120

Query  209  LK--GIEMGLLEV  241
            L    I+ GLL+V
Sbjct  121  LDDVSIQKGLLQV  133



>gb|EPY54134.1| SCY1 protein kinase Ppk32 [Schizosaccharomyces cryophilus OY26]
Length=699

 Score = 67.4 bits (163),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 56/108 (52%), Gaps = 13/108 (12%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
              GLLQ+   L FL N+A+++H  + P +V+I S G WKL GF F  S          ++
Sbjct  148  QKGLLQIMNGLSFLKNSAKILHLNVQPRSVIIDSKGDWKLCGFGFCQS----------LE  197

Query  423  SFHYAEYDVEDSI-MPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
               Y   D + SI   LQ  L++ APE V      +G  +D+FS GCL
Sbjct  198  CPRYELLDFDFSIPSSLQQCLDFLAPEYVLHEI--VGPENDVFSLGCL  243


 Score = 41.2 bits (95),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  17   EDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGI  178
            E+   + +R D   L RLRHP ++ VV+ L+ESK+ +  VT+ +  S A+ + +
Sbjct  72   ENMILENLRRDVGSLSRLRHPSLLQVVEPLEESKSRLTFVTKRVQFSLADVICV  125



>ref|XP_003293479.1| hypothetical protein DICPUDRAFT_158338 [Dictyostelium purpureum]
 gb|EGC29995.1| hypothetical protein DICPUDRAFT_158338 [Dictyostelium purpureum]
Length=1041

 Score = 64.3 bits (155),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 57/105 (54%), Gaps = 3/105 (3%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+ Q+ + L FL+  A+L+HR ISPE++ +T +  WKL G  F  S        SN+   
Sbjct  158  GVFQILDGLFFLNTTAKLLHRNISPESIYVTKSLKWKLGGLGFTCSIETKEPPISNLSLN  217

Query  429  HYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
               EY  +++   L P L+Y +PE V  N  S   +SD+F+ G L
Sbjct  218  DLKEYLYQEAHNIL-PQLDYLSPEFV--NQKSFSNNSDLFAVGRL  259


 Score = 43.5 bits (101),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 19/52 (37%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFAS  157
            +SK+  +     ++ +A  L RLRHP V+ V   L+E+KN +   TEP+ A+
Sbjct  66   ISKSNLENITTFLKKEATTLQRLRHPSVLQVFSVLEETKNHIYFATEPILAT  117



>gb|KFH73263.1| SCY1 protein kinase [Mortierella verticillata NRRL 6337]
Length=925

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 36/92 (39%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = +2

Query  5    SKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILE  184
            SK  ++  ++ ++ +A++L RLRHP ++ VV+ +DES+ A+A  TEP+FAS +N LG  E
Sbjct  57   SKRDQERVYEFLKKEASQLARLRHPSMLEVVEPVDESRTAIAFATEPIFASLSNLLGNYE  116

Query  185  NIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            N+  VP++++  E+  LEV++ ++ +G+ L F
Sbjct  117  NLASVPEDIRKFELDELEVQKGLSQLGKGLQF  148


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 58/108 (54%), Gaps = 8/108 (7%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
              GL QL + L F HN+A++VH  + P+ + + + G WK+AGF F+      S DP+   
Sbjct  136  QKGLSQLGKGLQFCHNDAKIVHGNLVPDAIFVNAKGDWKIAGFGFSTFM---SRDPNVAT  192

Query  423  SFHYAEYDVEDSIMPL-QPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
               Y +YD E  + P  Q  LNY APE V      +  S+D+F  GCL
Sbjct  193  PVEYWDYDHE--LHPYCQKDLNYQAPEYVLEQ--RLDPSNDMFGIGCL  236



>gb|EUN25037.1| hypothetical protein COCVIDRAFT_28319 [Bipolaris victoriae FI3]
Length=970

 Score = 69.3 bits (168),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 74/124 (60%), Gaps = 7/124 (6%)
 Frame = +3

Query  201  RRSSKE*KWDY*R*NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFA  380
            ++  +E + D      GLLQ+A+ L+FLH +A LVH  ++P+ + I +   WK++G  FA
Sbjct  154  QKRRREFEIDELEIQKGLLQIAKGLEFLHESAGLVHANLTPDAIFINAKSDWKISGLGFA  213

Query  381  LSTNP-SSSDPSNMQSFHYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFS  551
              T P +S+ P+++     AE    D+ +P  +Q +L+Y++P+ V  N  +I  ++D+FS
Sbjct  214  --TPPENSTKPTSVTPISLAEVLNYDARLPRHVQLNLDYSSPDFVMDN--NITPAADMFS  269

Query  552  FGCL  563
             G L
Sbjct  270  LGML  273


 Score = 38.5 bits (88),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 19/56 (34%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = +2

Query  8    KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAM-VTEPLFASAANAL  172
            K A +   + ++ +A+ L RLRHP V+ +V+ ++E++    M  TEP+ AS +  L
Sbjct  72   KRAHEEVVERLKKEASSLARLRHPSVLELVEPVEETRGGGLMFATEPVTASLSGLL  127



>ref|XP_011332287.1| PREDICTED: SCY1-like protein 2 [Cerapachys biroi]
 gb|EZA58274.1| SCY1-like protein [Cerapachys biroi]
Length=867

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 67/108 (62%), Gaps = 12/108 (11%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSF-ALSTNPSSSDPSNMQS  425
            GLLQL E L FLH + +L+HR + PE+++I  +GAWK+ GF F AL+ +  S  P    S
Sbjct  168  GLLQLGEGLAFLHGDVKLLHRNLCPESIVINVHGAWKIFGFDFCALNQSSDSKQP----S  223

Query  426  FHYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            + Y +Y   D  +P  +QP LNY APE V +  SS G  SDIF+ G L
Sbjct  224  WSYLDY---DPTLPAVVQPQLNYQAPECVLA--SSNGPPSDIFALGML  266


 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/135 (30%), Positives = 67/135 (50%), Gaps = 9/135 (7%)
 Frame = +2

Query  5    SKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILE  184
            +K   +   + ++    +L +LRHP V+ V   L+ES++++A  TEP+FAS AN LG  E
Sbjct  86   TKADRELVLETLKRGVMQLTKLRHPQVLTVQHPLEESRDSLAFATEPVFASLANVLGNQE  145

Query  185  NI-EKVPKELKGIEMGLLEVKQWVTSVGRNLGFPSQQCPSCSSGYIS*DCPHYLKWSLEA  361
            NI +  P  LKG ++  +E++  +  +G  L F                CP  +  ++  
Sbjct  146  NIPQPTPMSLKGYKLHDIEIRYGLLQLGEGLAFLHGDVKLLHRNL----CPESIVINVHG  201

Query  362  CW----I*FCIINKS  394
             W      FC +N+S
Sbjct  202  AWKIFGFDFCALNQS  216



>gb|EPX74501.1| SCY1 protein kinase Ppk32 [Schizosaccharomyces octosporus yFS286]
Length=699

 Score = 63.9 bits (154),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 56/108 (52%), Gaps = 13/108 (12%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
              GLLQ+   + FL ++A ++H  I P +V+I S G WKL GF F  S+          +
Sbjct  147  QKGLLQVMNGILFLKDSANILHLNIQPRSVVIDSKGDWKLCGFGFCQSS----------E  196

Query  423  SFHYAEYDVEDSI-MPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            S  Y   D + S    LQ SL++ APE V      +G  +D+FS GCL
Sbjct  197  SPRYELMDFDTSTPSSLQQSLDFLAPEYVLHEI--VGPENDVFSLGCL  242


 Score = 43.9 bits (102),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +2

Query  17   EDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGI  178
            E+   +++R D + L RLRHP ++ VV+ L+ES++ +  VT+ + +S A+ + I
Sbjct  71   ENYILEVLRRDVSSLSRLRHPSLLQVVEPLEESRSRLTFVTKRIQSSLADVICI  124



>ref|XP_002640193.1| Hypothetical protein CBG12696 [Caenorhabditis briggsae]
 emb|CAP31640.1| Protein CBG12696, partial [Caenorhabditis briggsae]
Length=791

 Score = 67.0 bits (162),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 61/106 (58%), Gaps = 10/106 (9%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+LQ+ + L +LHN+A+++H  ++P+ + +T+   WK+ GFSF+++    +  P      
Sbjct  140  GVLQIIDGLSYLHNSAKMLHGNLTPDAIYVTAIKTWKIGGFSFSVNAKEPNCFPC-----  194

Query  429  HYAEYDVEDSIMP-LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
                Y     + P LQP L++ APE +    S++  ++D+FS G L
Sbjct  195  ----YPWTKKLPPCLQPDLDFLAPENLAQGQSTVTSAADVFSLGVL  236


 Score = 40.8 bits (94),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 17/52 (33%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFAS  157
            L KT   + FD+I+ +  +L+ L HP ++H+   L+E+K+  +  TE +F +
Sbjct  71   LGKTKTYSMFDLIKYETQQLMGLVHPRILHMEHNLEETKDYFSFATEQIFGN  122



>gb|KHC83256.1| hypothetical protein W5Q_00468 [Candida albicans SC5314]
 gb|KHC89649.1| hypothetical protein I503_00471 [Candida albicans SC5314]
Length=885

 Score = 65.5 bits (158),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GLLQ+++ L FLH+   ++H  + P +V I + G WKL GF F  + N  S  P   ++F
Sbjct  136  GLLQISKGLQFLHSYGSIIHLNLQPSSVYINNQGDWKLGGFKFLQNLNEIS--PQERENF  193

Query  429  HYAEYDVEDSIMPLQP-SLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +        S++P    +LN+TAPEL+  + + +  ++DI+S G L
Sbjct  194  YILN---NMSVVPFANFNLNFTAPELIIDSHTKLDFANDIWSLGQL  236


 Score = 42.0 bits (97),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 22/76 (29%), Positives = 46/76 (61%), Gaps = 13/76 (17%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKV-PK  205
            +++I+ + ++L +L+HP ++ V + L+E+K+    VTEP          +++N+  V PK
Sbjct  77   YELIKYEVSQLSKLKHPQLLQVYEVLEETKSKFLFVTEP----------VIDNLVTVNPK  126

Query  206  ELK--GIEMGLLEVKQ  247
            +L    I+ GLL++ +
Sbjct  127  DLDDLSIQKGLLQISK  142



>ref|XP_007372470.1| hypothetical protein SPAPADRAFT_48109 [Spathaspora passalidarum 
NRRL Y-27907]
 gb|EGW35058.1| hypothetical protein SPAPADRAFT_48109 [Spathaspora passalidarum 
NRRL Y-27907]
Length=900

 Score = 73.6 bits (179),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 65/106 (61%), Gaps = 7/106 (7%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GLLQ+A+ L FLH+   ++H  + PE+V + S G WKL GF F  + N  S  PS  ++F
Sbjct  135  GLLQIAKGLHFLHSYCSIIHLNLQPESVFVNSQGDWKLGGFRFLQNLNEIS--PSERENF  192

Query  429  HYAEYDVEDSIMPL-QPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
                Y +  S +P    +LN+TAPEL+  + +++  ++DI+SFG L
Sbjct  193  ----YIMNSSFVPFANLNLNFTAPELIIDSHTNLSFANDIWSFGNL  234


 Score = 33.9 bits (76),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 18/80 (23%), Positives = 41/80 (51%), Gaps = 7/80 (9%)
 Frame = +2

Query  8    KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  187
            KT     +++I+ +  +L +L+HP ++ + + L+E+K      +EP+  +       L+ 
Sbjct  69   KTIISECYELIKFEVNQLSKLKHPQILTIFEVLEETKTKFLFASEPVVDN-------LQT  121

Query  188  IEKVPKELKGIEMGLLEVKQ  247
            I     +   I+ GLL++ +
Sbjct  122  ISHNNLDDLSIQKGLLQIAK  141



>gb|KGU19499.1| hypothetical protein MEY_00470 [Candida albicans 19F]
Length=885

 Score = 65.5 bits (158),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GLLQ+++ L FLH+   ++H  + P +V I + G WKL GF F  + N  S  P   ++F
Sbjct  136  GLLQISKGLQFLHSYGSIIHLNLQPSSVYINNQGDWKLGGFKFLQNLNEIS--PQERENF  193

Query  429  HYAEYDVEDSIMPLQP-SLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +        S++P    +LN+TAPEL+  + + +  ++DI+S G L
Sbjct  194  YILN---NMSVVPFANFNLNFTAPELIIDSHTKLDFANDIWSLGQL  236


 Score = 42.0 bits (97),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 22/76 (29%), Positives = 46/76 (61%), Gaps = 13/76 (17%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKV-PK  205
            +++I+ + ++L +L+HP ++ V + L+E+K+    VTEP          +++N+  V PK
Sbjct  77   YELIKYEVSQLSKLKHPQLLQVYEVLEETKSKFLFVTEP----------VIDNLVTVNPK  126

Query  206  ELK--GIEMGLLEVKQ  247
            +L    I+ GLL++ +
Sbjct  127  DLDDLSIQKGLLQISK  142



>gb|KGR23532.1| hypothetical protein MG9_00467 [Candida albicans P37037]
Length=885

 Score = 65.5 bits (158),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GLLQ+++ L FLH+   ++H  + P +V I + G WKL GF F  + N  S  P   ++F
Sbjct  136  GLLQISKGLQFLHSYGSIIHLNLQPSSVYINNQGDWKLGGFKFLQNLNEIS--PQERENF  193

Query  429  HYAEYDVEDSIMPLQP-SLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +        S++P    +LN+TAPEL+  + + +  ++DI+S G L
Sbjct  194  YILN---NMSVVPFANFNLNFTAPELIIDSHTKLDFANDIWSLGQL  236


 Score = 42.0 bits (97),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 22/76 (29%), Positives = 46/76 (61%), Gaps = 13/76 (17%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKV-PK  205
            +++I+ + ++L +L+HP ++ V + L+E+K+    VTEP          +++N+  V PK
Sbjct  77   YELIKYEVSQLSKLKHPQLLQVYEVLEETKSKFLFVTEP----------VIDNLVTVNPK  126

Query  206  ELK--GIEMGLLEVKQ  247
            +L    I+ GLL++ +
Sbjct  127  DLDDLSIQKGLLQISK  142



>gb|KGR21506.1| hypothetical protein MG3_00509 [Candida albicans P78048]
 gb|KHC62092.1| hypothetical protein MGC_00466 [Candida albicans P37039]
Length=885

 Score = 65.5 bits (158),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GLLQ+++ L FLH+   ++H  + P +V I + G WKL GF F  + N  S  P   ++F
Sbjct  136  GLLQISKGLQFLHSYGSIIHLNLQPSSVYINNQGDWKLGGFKFLQNLNEIS--PQERENF  193

Query  429  HYAEYDVEDSIMPLQP-SLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +        S++P    +LN+TAPEL+  + + +  ++DI+S G L
Sbjct  194  YILN---NMSVVPFANFNLNFTAPELIIDSHTKLDFANDIWSLGQL  236


 Score = 42.0 bits (97),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 22/76 (29%), Positives = 46/76 (61%), Gaps = 13/76 (17%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKV-PK  205
            +++I+ + ++L +L+HP ++ V + L+E+K+    VTEP          +++N+  V PK
Sbjct  77   YELIKYEVSQLSKLKHPQLLQVYEVLEETKSKFLFVTEP----------VIDNLVTVNPK  126

Query  206  ELK--GIEMGLLEVKQ  247
            +L    I+ GLL++ +
Sbjct  127  DLDDLSIQKGLLQISK  142



>gb|KGU14816.1| hypothetical protein MEQ_00460 [Candida albicans P87]
Length=885

 Score = 65.5 bits (158),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GLLQ+++ L FLH+   ++H  + P +V I + G WKL GF F  + N  S  P   ++F
Sbjct  136  GLLQISKGLQFLHSYGSIIHLNLQPSSVYINNQGDWKLGGFKFLQNLNEIS--PQERENF  193

Query  429  HYAEYDVEDSIMPLQP-SLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +        S++P    +LN+TAPEL+  + + +  ++DI+S G L
Sbjct  194  YILN---NMSVVPFANFNLNFTAPELIIDSHTKLDFANDIWSLGQL  236


 Score = 42.0 bits (97),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 22/76 (29%), Positives = 46/76 (61%), Gaps = 13/76 (17%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKV-PK  205
            +++I+ + ++L +L+HP ++ V + L+E+K+    VTEP          +++N+  V PK
Sbjct  77   YELIKYEVSQLSKLKHPQLLQVYEVLEETKSKFLFVTEP----------VIDNLVTVNPK  126

Query  206  ELK--GIEMGLLEVKQ  247
            +L    I+ GLL++ +
Sbjct  127  DLDDLSIQKGLLQISK  142



>gb|KGT72667.1| hypothetical protein MEK_00472 [Candida albicans 12C]
 gb|KHC68648.1| hypothetical protein MGE_00469 [Candida albicans P75010]
Length=885

 Score = 65.5 bits (158),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GLLQ+++ L FLH+   ++H  + P +V I + G WKL GF F  + N  S  P   ++F
Sbjct  136  GLLQISKGLQFLHSYGSIIHLNLQPSSVYINNQGDWKLGGFKFLQNLNEIS--PQERENF  193

Query  429  HYAEYDVEDSIMPLQP-SLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +        S++P    +LN+TAPEL+  + + +  ++DI+S G L
Sbjct  194  YILN---NMSVVPFANFNLNFTAPELIIDSHTKLDFANDIWSLGQL  236


 Score = 42.0 bits (97),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 22/76 (29%), Positives = 46/76 (61%), Gaps = 13/76 (17%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKV-PK  205
            +++I+ + ++L +L+HP ++ V + L+E+K+    VTEP          +++N+  V PK
Sbjct  77   YELIKYEVSQLSKLKHPQLLQVYEVLEETKSKFLFVTEP----------VIDNLVTVNPK  126

Query  206  ELK--GIEMGLLEVKQ  247
            +L    I+ GLL++ +
Sbjct  127  DLDDLSIQKGLLQISK  142



>gb|EEQ42696.1| conserved hypothetical protein [Candida albicans WO-1]
Length=885

 Score = 65.5 bits (158),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GLLQ+++ L FLH+   ++H  + P +V I + G WKL GF F  + N  S  P   ++F
Sbjct  136  GLLQISKGLQFLHSYGSIIHLNLQPSSVYINNQGDWKLGGFKFLQNLNEIS--PQERENF  193

Query  429  HYAEYDVEDSIMPLQP-SLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +        S++P    +LN+TAPEL+  + + +  ++DI+S G L
Sbjct  194  YILN---NMSVVPFANFNLNFTAPELIIDSHTKLDFANDIWSLGQL  236


 Score = 42.0 bits (97),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 22/76 (29%), Positives = 46/76 (61%), Gaps = 13/76 (17%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKV-PK  205
            +++I+ + ++L +L+HP ++ V + L+E+K+    VTEP          +++N+  V PK
Sbjct  77   YELIKYEVSQLSKLKHPQLLQVYEVLEETKSKFLFVTEP----------VIDNLVTVNPK  126

Query  206  ELK--GIEMGLLEVKQ  247
            +L    I+ GLL++ +
Sbjct  127  DLDDLSIQKGLLQISK  142



>gb|KGU33852.1| hypothetical protein MG7_00458 [Candida albicans P34048]
Length=885

 Score = 65.5 bits (158),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GLLQ+++ L FLH+   ++H  + P +V I + G WKL GF F  + N  S  P   ++F
Sbjct  136  GLLQISKGLQFLHSYGSIIHLNLQPSSVYINNQGDWKLGGFKFLQNLNEIS--PQERENF  193

Query  429  HYAEYDVEDSIMPLQP-SLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +        S++P    +LN+TAPEL+  + + +  ++DI+S G L
Sbjct  194  YILN---NMSVVPFANFNLNFTAPELIIDSHTKLDFANDIWSLGQL  236


 Score = 42.0 bits (97),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 22/76 (29%), Positives = 46/76 (61%), Gaps = 13/76 (17%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKV-PK  205
            +++I+ + ++L +L+HP ++ V + L+E+K+    VTEP          +++N+  V PK
Sbjct  77   YELIKYEVSQLSKLKHPQLLQVYEVLEETKSKFLFVTEP----------VIDNLVTVNPK  126

Query  206  ELK--GIEMGLLEVKQ  247
            +L    I+ GLL++ +
Sbjct  127  DLDDLSIQKGLLQISK  142



>gb|KHC48991.1| hypothetical protein W5O_00472 [Candida albicans Ca6]
Length=885

 Score = 65.5 bits (158),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GLLQ+++ L FLH+   ++H  + P +V I + G WKL GF F  + N  S  P   ++F
Sbjct  136  GLLQISKGLQFLHSYGSIIHLNLQPSSVYINNQGDWKLGGFKFLQNLNEIS--PQERENF  193

Query  429  HYAEYDVEDSIMPLQP-SLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +        S++P    +LN+TAPEL+  + + +  ++DI+S G L
Sbjct  194  YILN---NMSVVPFANFNLNFTAPELIIDSHTKLDFANDIWSLGQL  236


 Score = 42.0 bits (97),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 22/76 (29%), Positives = 46/76 (61%), Gaps = 13/76 (17%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKV-PK  205
            +++I+ + ++L +L+HP ++ V + L+E+K+    VTEP          +++N+  V PK
Sbjct  77   YELIKYEVSQLSKLKHPQLLQVYEVLEETKSKFLFVTEP----------VIDNLVTVNPK  126

Query  206  ELK--GIEMGLLEVKQ  247
            +L    I+ GLL++ +
Sbjct  127  DLDDLSIQKGLLQISK  142



>gb|KGU18727.1| hypothetical protein MEM_00474 [Candida albicans L26]
Length=885

 Score = 65.5 bits (158),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GLLQ+++ L FLH+   ++H  + P +V I + G WKL GF F  + N  S  P   ++F
Sbjct  136  GLLQISKGLQFLHSYGSIIHLNLQPSSVYINNQGDWKLGGFKFLQNLNEIS--PQERENF  193

Query  429  HYAEYDVEDSIMPLQP-SLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +        S++P    +LN+TAPEL+  + + +  ++DI+S G L
Sbjct  194  YILN---NMSVVPFANFNLNFTAPELIIDSHTKLDFANDIWSLGQL  236


 Score = 42.0 bits (97),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 22/76 (29%), Positives = 46/76 (61%), Gaps = 13/76 (17%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKV-PK  205
            +++I+ + ++L +L+HP ++ V + L+E+K+    VTEP          +++N+  V PK
Sbjct  77   YELIKYEVSQLSKLKHPQLLQVYEVLEETKSKFLFVTEP----------VIDNLVTVNPK  126

Query  206  ELK--GIEMGLLEVKQ  247
            +L    I+ GLL++ +
Sbjct  127  DLDDLSIQKGLLQISK  142



>ref|XP_003114607.1| hypothetical protein CRE_28224 [Caenorhabditis remanei]
 gb|EFP02742.1| hypothetical protein CRE_28224 [Caenorhabditis remanei]
Length=828

 Score = 68.6 bits (166),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 61/106 (58%), Gaps = 10/106 (9%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+LQ+ + + +LHN+A+++H  ++P+ + +T+   WK+ GFSFA++    +  P      
Sbjct  181  GVLQIIDGMSYLHNSAKMLHGNLTPDAIYVTATKTWKIGGFSFAVNAKEPNCYPC-----  235

Query  429  HYAEYDVEDSIMP-LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
                Y     + P LQP L++ APE +    +++  ++D+FS G L
Sbjct  236  ----YPWTKKLPPCLQPDLDFLAPENLTQGQTTVTSAADVFSLGVL  277


 Score = 38.9 bits (89),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 16/52 (31%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFAS  157
            L K+   + FD+I+ +  +L+ L HP ++H+   L+E+K+  +  TE +F +
Sbjct  112  LGKSKTYSMFDLIKYETQQLMGLIHPRILHMEHNLEETKDYFSFATEQIFGN  163



>gb|KHC85073.1| hypothetical protein MGS_00466 [Candida albicans P78042]
Length=885

 Score = 65.1 bits (157),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GLLQ+++ L FLH+   ++H  + P +V I + G WKL GF F  + N  S  P   ++F
Sbjct  136  GLLQISKGLQFLHSYGSIIHLNLQPSSVYINNQGDWKLGGFKFLQNLNEIS--PQERENF  193

Query  429  HYAEYDVEDSIMPLQP-SLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +        S++P    +LN+TAPEL+  + + +  ++DI+S G L
Sbjct  194  YILN---NMSVVPFANFNLNFTAPELIIDSHTKLDFANDIWSLGQL  236


 Score = 42.0 bits (97),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 22/76 (29%), Positives = 46/76 (61%), Gaps = 13/76 (17%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKV-PK  205
            +++I+ + ++L +L+HP ++ V + L+E+K+    VTEP          +++N+  V PK
Sbjct  77   YELIKYEVSQLSKLKHPQLLQVYEVLEETKSKFLFVTEP----------VIDNLVTVNPK  126

Query  206  ELK--GIEMGLLEVKQ  247
            +L    I+ GLL++ +
Sbjct  127  DLDDLSIQKGLLQISK  142



>gb|KHC57438.1| hypothetical protein MEW_00470 [Candida albicans P60002]
Length=885

 Score = 65.1 bits (157),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GLLQ+++ L FLH+   ++H  + P +V I + G WKL GF F  + N  S  P   ++F
Sbjct  136  GLLQISKGLQFLHSYGSIIHLNLQPSSVYINNQGDWKLGGFKFLQNLNEIS--PQERENF  193

Query  429  HYAEYDVEDSIMPLQP-SLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +        S++P    +LN+TAPEL+  + + +  ++DI+S G L
Sbjct  194  YILN---NMSVVPFANFNLNFTAPELIIDSHTKLDFANDIWSLGQL  236


 Score = 42.0 bits (97),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 22/76 (29%), Positives = 46/76 (61%), Gaps = 13/76 (17%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKV-PK  205
            +++I+ + ++L +L+HP ++ V + L+E+K+    VTEP          +++N+  V PK
Sbjct  77   YELIKYEVSQLSKLKHPQLLQVYEVLEETKSKFLFVTEP----------VIDNLVTVNPK  126

Query  206  ELK--GIEMGLLEVKQ  247
            +L    I+ GLL++ +
Sbjct  127  DLDDLSIQKGLLQISK  142



>gb|KGQ91742.1| hypothetical protein MEO_00466 [Candida albicans P94015]
Length=885

 Score = 65.1 bits (157),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GLLQ+++ L FLH+   ++H  + P +V I + G WKL GF F  + N  S  P   ++F
Sbjct  136  GLLQISKGLQFLHSYGSIIHLNLQPSSVYINNQGDWKLGGFKFLQNLNEIS--PQERENF  193

Query  429  HYAEYDVEDSIMPLQP-SLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +        S++P    +LN+TAPEL+  + + +  ++DI+S G L
Sbjct  194  YILN---NMSVVPFANFNLNFTAPELIIDSHTKLDFANDIWSLGQL  236


 Score = 42.0 bits (97),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 22/76 (29%), Positives = 46/76 (61%), Gaps = 13/76 (17%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKV-PK  205
            +++I+ + ++L +L+HP ++ V + L+E+K+    VTEP          +++N+  V PK
Sbjct  77   YELIKYEVSQLSKLKHPQLLQVYEVLEETKSKFLFVTEP----------VIDNLVTVNPK  126

Query  206  ELK--GIEMGLLEVKQ  247
            +L    I+ GLL++ +
Sbjct  127  DLDDLSIQKGLLQISK  142



>gb|KGQ98869.1| hypothetical protein MEU_00465 [Candida albicans P37005]
Length=885

 Score = 65.5 bits (158),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GLLQ+++ L FLH+   ++H  + P +V I + G WKL GF F  + N  S  P   ++F
Sbjct  136  GLLQISKGLQFLHSYGSIIHLNLQPSSVYINNQGDWKLGGFKFLQNLNEIS--PQERENF  193

Query  429  HYAEYDVEDSIMPLQP-SLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +        S++P    +LN+TAPEL+  + + +  ++DI+S G L
Sbjct  194  YILN---NMSVVPFANFNLNFTAPELIIDSHTKLDFANDIWSLGQL  236


 Score = 42.0 bits (97),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 22/76 (29%), Positives = 46/76 (61%), Gaps = 13/76 (17%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKV-PK  205
            +++I+ + ++L +L+HP ++ V + L+E+K+    VTEP          +++N+  V PK
Sbjct  77   YELIKYEVSQLSKLKHPQLLQVYEVLEETKSKFLFVTEP----------VIDNLVTVNPK  126

Query  206  ELK--GIEMGLLEVKQ  247
            +L    I+ GLL++ +
Sbjct  127  DLDDLSIQKGLLQISK  142



>gb|KGR03685.1| hypothetical protein MG1_00467 [Candida albicans GC75]
Length=885

 Score = 65.5 bits (158),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GLLQ+++ L FLH+   ++H  + P +V I + G WKL GF F  + N  S  P   ++F
Sbjct  136  GLLQISKGLQFLHSYGSIIHLNLQPSSVYINNQGDWKLGGFKFLQNLNEIS--PQERENF  193

Query  429  HYAEYDVEDSIMPLQP-SLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +        S++P    +LN+TAPEL+  + + +  ++DI+S G L
Sbjct  194  YILN---NMSVVPFANFNLNFTAPELIIDSHTKLDFANDIWSLGQL  236


 Score = 42.0 bits (97),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 22/76 (29%), Positives = 46/76 (61%), Gaps = 13/76 (17%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKV-PK  205
            +++I+ + ++L +L+HP ++ V + L+E+K+    VTEP          +++N+  V PK
Sbjct  77   YELIKYEVSQLSKLKHPQLLQVYEVLEETKSKFLFVTEP----------VIDNLVTVNPK  126

Query  206  ELK--GIEMGLLEVKQ  247
            +L    I+ GLL++ +
Sbjct  127  DLDDLSIQKGLLQISK  142



>gb|KGR15606.1| hypothetical protein MG5_00459 [Candida albicans P57072]
 gb|KGU37685.1| hypothetical protein MGK_00462 [Candida albicans P57055]
 gb|KHC40515.1| hypothetical protein MGO_00460 [Candida albicans P76055]
 gb|KHC43309.1| hypothetical protein MGQ_00460 [Candida albicans P76067]
Length=885

 Score = 65.1 bits (157),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GLLQ+++ L FLH+   ++H  + P +V I + G WKL GF F  + N  S  P   ++F
Sbjct  136  GLLQISKGLQFLHSYGSIIHLNLQPSSVYINNQGDWKLGGFKFLQNLNEIS--PQERENF  193

Query  429  HYAEYDVEDSIMPLQP-SLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +        S++P    +LN+TAPEL+  + + +  ++DI+S G L
Sbjct  194  YILN---NMSVVPFANFNLNFTAPELIIDSHTKLDFANDIWSLGQL  236


 Score = 42.0 bits (97),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 22/76 (29%), Positives = 46/76 (61%), Gaps = 13/76 (17%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKV-PK  205
            +++I+ + ++L +L+HP ++ V + L+E+K+    VTEP          +++N+  V PK
Sbjct  77   YELIKYEVSQLSKLKHPQLLQVYEVLEETKSKFLFVTEP----------VIDNLVTVNPK  126

Query  206  ELK--GIEMGLLEVKQ  247
            +L    I+ GLL++ +
Sbjct  127  DLDDLSIQKGLLQISK  142



>gb|KHC75891.1| hypothetical protein MGI_00461 [Candida albicans P75016]
Length=885

 Score = 65.5 bits (158),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GLLQ+++ L FLH+   ++H  + P +V I + G WKL GF F  + N  S  P   ++F
Sbjct  136  GLLQISKGLQFLHSYGSIIHLNLQPSSVYINNQGDWKLGGFKFLQNLNEIS--PQERENF  193

Query  429  HYAEYDVEDSIMPLQP-SLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +        S++P    +LN+TAPEL+  + + +  ++DI+S G L
Sbjct  194  YILN---NMSVVPFANFNLNFTAPELIIDSHTKLDFANDIWSLGQL  236


 Score = 42.0 bits (97),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 22/76 (29%), Positives = 46/76 (61%), Gaps = 13/76 (17%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKV-PK  205
            +++I+ + ++L +L+HP ++ V + L+E+K+    VTEP          +++N+  V PK
Sbjct  77   YELIKYEVSQLSKLKHPQLLQVYEVLEETKSKFLFVTEP----------VIDNLVTVNPK  126

Query  206  ELK--GIEMGLLEVKQ  247
            +L    I+ GLL++ +
Sbjct  127  DLDDLSIQKGLLQISK  142



>gb|KGU36063.1| hypothetical protein MGM_00462 [Candida albicans P75063]
Length=885

 Score = 65.5 bits (158),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GLLQ+++ L FLH+   ++H  + P +V I + G WKL GF F  + N  S  P   ++F
Sbjct  136  GLLQISKGLQFLHSYGSIIHLNLQPSSVYINNQGDWKLGGFKFLQNLNEIS--PQERENF  193

Query  429  HYAEYDVEDSIMPLQP-SLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +        S++P    +LN+TAPEL+  + + +  ++DI+S G L
Sbjct  194  YILN---NMSVVPFANFNLNFTAPELIIDSHTKLDFANDIWSLGQL  236


 Score = 42.0 bits (97),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 22/76 (29%), Positives = 46/76 (61%), Gaps = 13/76 (17%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKV-PK  205
            +++I+ + ++L +L+HP ++ V + L+E+K+    VTEP          +++N+  V PK
Sbjct  77   YELIKYEVSQLSKLKHPQLLQVYEVLEETKSKFLFVTEP----------VIDNLVTVNPK  126

Query  206  ELK--GIEMGLLEVKQ  247
            +L    I+ GLL++ +
Sbjct  127  DLDDLSIQKGLLQISK  142



>ref|XP_002417122.1| protein kinase, putative [Candida dubliniensis CD36]
 emb|CAX44712.1| protein kinase, putative [Candida dubliniensis CD36]
Length=879

 Score = 65.1 bits (157),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GLLQ+++ L FLH+   ++H  + P +V I + G WKL GF F  + N  S  P   ++F
Sbjct  136  GLLQISKGLQFLHSYGSIIHLNLQPSSVYINNQGDWKLGGFKFLQNLNEIS--PQERENF  193

Query  429  HYAEYDVEDSIMPLQP-SLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +        S++P    +LN+TAPEL+  + + +  ++DI+S G L
Sbjct  194  YILN---NMSVVPFANFNLNFTAPELIIDSHTKLDFANDIWSLGQL  236


 Score = 42.0 bits (97),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 22/76 (29%), Positives = 46/76 (61%), Gaps = 13/76 (17%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKV-PK  205
            +++I+ + ++L +L+HP ++ V + L+E+K+    VTEP          +++N+  V PK
Sbjct  77   YELIKYEVSQLSKLKHPQLLQVYEVLEETKSKFLFVTEP----------VIDNLVTVNPK  126

Query  206  ELK--GIEMGLLEVKQ  247
            +L    I+ GLL++ +
Sbjct  127  DLDDLSIQKGLLQISK  142



>ref|XP_007338830.1| kinase-like protein [Auricularia delicata TFB-10046 SS5]
 gb|EJD53253.1| kinase-like protein [Auricularia delicata TFB-10046 SS5]
Length=814

 Score = 69.7 bits (169),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 59/108 (55%), Gaps = 10/108 (9%)
 Frame = +3

Query  246  NGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQS  425
             G+LQ+ + L FLH +ARL+H  I+P +V+I + G WK++G    +    +   PS  + 
Sbjct  151  KGILQICKGLSFLHTSARLIHSNITPNSVVINAAGDWKISGLGLTMPLVGTDGSPSRWEY  210

Query  426  FHYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
              Y      DS MP  +Q S +Y  PE   +  + I  +SD++S GCL
Sbjct  211  IQY------DSRMPSYVQHSFDYLPPEY--NADTPISPASDMYSLGCL  250


 Score = 37.7 bits (86),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 16/52 (31%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFAS  157
            L+  A++   ++++A+A+ L RLRHP ++ +V+ ++E+++ +   TE L +S
Sbjct  77   LNGPAKERVLEVLKAEASALGRLRHPCILEMVEPVEETRSELVFATEMLLSS  128



>ref|XP_003336080.2| SCY1 protein kinase [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
 gb|EFP91661.2| SCY1 protein kinase [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
Length=922

 Score = 65.1 bits (157),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 63/107 (59%), Gaps = 10/107 (9%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GL+Q+ + L FLH +A+LVH  ++PE ++I + G WK++G  F LST     D  + + +
Sbjct  220  GLMQIGKGLQFLHESAKLVHCNLTPEAIIINAKGDWKISG--FGLSTYLKQPDGQDSK-W  276

Query  429  HYAEYD--VEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             + EYD  + DS+   Q + +Y APE        +  S+D++S GC+
Sbjct  277  LFPEYDHRLPDSV---QRNFDYLAPEYCLD--EHLSTSNDMYSLGCI  318


 Score = 41.6 bits (96),  Expect(2) = 7e-15, Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +2

Query  8    KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPL  148
            KT  +   ++++ + + L RLRHP ++ VV+ L+E++ +M   TEP+
Sbjct  135  KTPLEKVVEILKKEVSSLSRLRHPCILEVVEPLEETRTSMIFATEPI  181



>ref|XP_008548320.1| PREDICTED: SCY1-like protein 2 [Microplitis demolitor]
 gb|EZA45223.1| SCY1-like protein 2-like protein [Microplitis demolitor]
Length=854

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 66/104 (63%), Gaps = 8/104 (8%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSF-ALSTNPSSSDPSNMQS  425
            GLLQL E L FLH++ +L+HR + PE+V+I  NGAWK+ GF F AL+ +P+  +P    S
Sbjct  168  GLLQLGEGLAFLHSDVKLLHRNLCPESVVINKNGAWKIFGFDFCALNQSPNDKEP----S  223

Query  426  FHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFG  557
            + Y EYD   S +  Q  L+Y APE + +   S G  SDIF+ G
Sbjct  224  WSYIEYDPNVSSIG-QAHLDYQAPESIVA--GSCGPPSDIFALG  264


 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 57/93 (61%), Gaps = 1/93 (1%)
 Frame = +2

Query  5    SKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILE  184
            SK   +   + ++    +L +LRHP ++ V   L+ES++++A  TEP+FAS AN +G +E
Sbjct  86   SKQEREVILEALKRGVTQLTKLRHPQILTVQHPLEESRDSLAFATEPVFASLANVIGNIE  145

Query  185  NIEKV-PKELKGIEMGLLEVKQWVTSVGRNLGF  280
            NI ++  K+LK  ++  +E+K  +  +G  L F
Sbjct  146  NISQISSKDLKDYKLLDVEIKYGLLQLGEGLAF  178



>ref|XP_002591089.1| hypothetical protein BRAFLDRAFT_119065 [Branchiostoma floridae]
 gb|EEN47100.1| hypothetical protein BRAFLDRAFT_119065 [Branchiostoma floridae]
Length=1244

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 46/106 (43%), Positives = 64/106 (60%), Gaps = 8/106 (8%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GLLQ+ E L FLHN+ ++VH  ++PE +++  NGAWK+AGF F +   PSS+ P     F
Sbjct  156  GLLQVTEGLAFLHNDVKMVHGNLTPEVIILNKNGAWKVAGFEFCI---PSSNPPDQAAFF  212

Query  429  HYAEYDVEDSIMPL-QPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
               EYD  +++ PL Q +LNY APE V     +     D+FS G L
Sbjct  213  PAKEYD--ENLTPLAQQTLNYHAPEYVLQ--CACDTPGDLFSLGML  254


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 33/94 (35%), Positives = 55/94 (59%), Gaps = 1/94 (1%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
            +++   DA  + ++    +L RLRHP ++ V   L+ES++++A  TEP+FAS AN LG  
Sbjct  73   MNRRDRDAVIEAMKRGVTQLTRLRHPRLLTVQHPLEESRDSLAFATEPVFASLANVLGNY  132

Query  182  ENIEK-VPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            EN+   VP  +K  ++  +E+K  +  V   L F
Sbjct  133  ENMPTPVPGTIKDHQLYEVEIKYGLLQVTEGLAF  166



>ref|XP_003402082.1| PREDICTED: SCY1-like protein 2-like [Bombus terrestris]
Length=845

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 66/106 (62%), Gaps = 8/106 (8%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSF-ALSTNPSSSDPSNMQS  425
            GLLQL E   FLH + +L+HR + PE++++ S+GAWK+ GF F AL+ +     P     
Sbjct  167  GLLQLGEGFTFLHGDVKLLHRNLCPESIVVNSHGAWKIFGFDFCALNQSAEGKQP----Q  222

Query  426  FHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            + Y EYD+    +  Q +L+Y APE + +  SS+G +SDIFS G +
Sbjct  223  WSYVEYDISAPSIA-QSNLDYQAPECILA--SSVGTASDIFSLGMV  265


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/94 (31%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
             S+  ++   + ++   A+L +LRHP ++ V   L+ES++++A  TEP+ AS AN LG  
Sbjct  84   FSRNDKELILETLKRGIAQLTKLRHPQILTVQHPLEESRDSLAFATEPVLASLANVLGNH  143

Query  182  ENI-EKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
             N+ + +P  LK  ++  +E+K  +  +G    F
Sbjct  144  NNLPQPLPTALKDYKLHDVEIKYGLLQLGEGFTF  177



>ref|XP_006686133.1| kinase-like protein, partial [Candida tenuis ATCC 10573]
 gb|EGV63819.1| kinase-like protein, partial [Candida tenuis ATCC 10573]
Length=327

 Score = 69.7 bits (169),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 56/105 (53%), Gaps = 4/105 (4%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GLL++ + + FLHN   +VH  + P +V I   G WKL GF F  + N  S  P   +SF
Sbjct  135  GLLEVCKGIQFLHNYCSIVHMNLQPSSVFINQQGDWKLTGFRFLQNLNEIS--PQERESF  192

Query  429  HYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
                 +   S+  +  ++N+ APELV    S +   +DI+S GCL
Sbjct  193  FLM--NNTSSVPFMNLNMNFVAPELVIDRQSKLDFGNDIWSLGCL  235


 Score = 36.2 bits (82),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 21/71 (30%), Positives = 43/71 (61%), Gaps = 7/71 (10%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPKE  208
            +++I+ +  ++ +L+HP ++ + + L+E+K+    VTE +     N + +  + EK+  E
Sbjct  76   YELIKYEVGQMAKLKHPQILTIYEVLEETKSKFLFVTESV---TDNLMTV--DFEKL-DE  129

Query  209  LKGIEMGLLEV  241
            L  I+ GLLEV
Sbjct  130  L-SIQKGLLEV  139



>ref|XP_646778.1| SCY1 family protein kinase [Dictyostelium discoideum AX4]
 sp|Q55BQ3.1|SCY2_DICDI RecName: Full=Probable inactive serine/threonine-protein kinase 
scy2; AltName: Full=SCY1-like protein kinase 2 [Dictyostelium 
discoideum]
 gb|EAL72754.1| SCY1 family protein kinase [Dictyostelium discoideum AX4]
Length=1125

 Score = 60.5 bits (145),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 55/114 (48%), Gaps = 11/114 (10%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+ Q+ + L FL+  A+L+HR ISPE++ IT +  WKL G  F  S        SN+   
Sbjct  161  GIFQILDGLLFLNQTAKLLHRNISPESIFITKDLKWKLGGLGFTCSIETKEPPISNLSLQ  220

Query  429  HYAEYD---------VEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
               EY            ++   + P L+Y APE +  +      +SD+FS G L
Sbjct  221  DLREYQYISGGGGGESSNNSNYILPQLDYLAPEFI--SQRKFETNSDLFSIGRL  272


 Score = 45.1 bits (105),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 19/58 (33%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALG  175
            +SK+  +     ++ +A  L RLRHP ++ VV  ++E+K  +   TEP+ A+  + LG
Sbjct  69   VSKSNLENVITFLKKEATTLQRLRHPSILQVVSVMEETKTHIHFATEPILATLEDLLG  126



>gb|ERL86428.1| hypothetical protein D910_03835 [Dendroctonus ponderosae]
Length=446

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 67/106 (63%), Gaps = 8/106 (8%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFAL-STNPSSSDPSNMQS  425
            GLLQ++E L FLHN+ +L+H+ ++PE+++I ++G WKL G  F + + NP    P+   +
Sbjct  158  GLLQISEGLQFLHNDVKLLHKNMTPESIVINASGVWKLFGLDFCVHNINP----PNQATN  213

Query  426  FHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            F + +Y     I+  QPSLNY APE V   + S   +SD+FS G L
Sbjct  214  FPFEDYSPTVPIV-CQPSLNYLAPECVLRQSHS--TASDMFSLGML  256


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 50/93 (54%), Gaps = 1/93 (1%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
             +K   +   + ++    +L ++RHP V+ V   L+ES++++A  TEP+FAS AN LG  
Sbjct  77   FNKNDRELVLESLKHGVQQLTKIRHPQVLTVQHPLEESRDSIAFATEPVFASLANILGET  136

Query  182  ENIEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
             N+ + P  +   +   +E+K  +  +   L F
Sbjct  137  TNMPQ-PANMSDYKFFDIEIKYGLLQISEGLQF  168



>ref|XP_011497019.1| PREDICTED: SCY1-like protein 2 [Ceratosolen solmsi marchali]
Length=823

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 66/105 (63%), Gaps = 8/105 (8%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GL QL E+L FLHN+ +++HR + PE+++I  +G WK+ GF F      S   P    S+
Sbjct  168  GLFQLGESLTFLHNDVKMLHRNLCPESIIINDHGDWKIFGFDFCAINQASEDKP----SW  223

Query  429  HYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             Y +++   SI  ++ S++Y APE V++  ++IG +SDIFS G L
Sbjct  224  LYIDHNSIPSI--IKTSMHYQAPECVKA--TAIGPTSDIFSLGVL  264


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 29/92 (32%), Positives = 56/92 (61%), Gaps = 1/92 (1%)
 Frame = +2

Query  8    KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  187
            K+  D   ++++    +L +L+HP ++ V   L+ES+++++  TEP+FAS AN LG ++N
Sbjct  87   KSIRDNVVEILKKGVIQLTKLKHPQILTVQHPLEESRDSLSFATEPVFASLANLLGCIDN  146

Query  188  IEKVPKE-LKGIEMGLLEVKQWVTSVGRNLGF  280
            +    +  LK  ++  LE+K  +  +G +L F
Sbjct  147  LPYSSQAILKDYKILDLEMKFGLFQLGESLTF  178



>ref|XP_009013981.1| hypothetical protein HELRODRAFT_190932 [Helobdella robusta]
 gb|ESO08192.1| hypothetical protein HELRODRAFT_190932 [Helobdella robusta]
Length=752

 Score = 54.7 bits (130),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFA  380
            G++Q+AE L +LH    ++H  + PE VLIT  G W+L+GF F+
Sbjct  156  GIMQIAEALSYLHTTEHILHNNVCPENVLITKRGMWRLSGFGFS  199


 Score = 50.1 bits (118),  Expect(2) = 3e-14, Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 43/71 (61%), Gaps = 7/71 (10%)
 Frame = +2

Query  32   DMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPKEL  211
            +M+R DA  L  LRHP ++ V++ L+ES +++A  TEP+  S +N LG   N +++P   
Sbjct  89   EMLRKDARLLSELRHPKILRVLRPLEESHDSIAFATEPVIGSLSNLLG---NYDRMPNN-  144

Query  212  KGIEMGLLEVK  244
               E   LEV+
Sbjct  145  ---EHNFLEVE  152



>gb|EQL01093.1| protein kinase domain-containing protein ppk32 [Ophiocordyceps 
sinensis CO18]
Length=675

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 75/122 (61%), Gaps = 5/122 (4%)
 Frame = +3

Query  204  RSSKE*KWDY*R*NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFAL  383
            R  +E + D      GLLQ+++ L+FLH+NA LVH  ++PE +LI S   WK++G SF  
Sbjct  151  RRRREVEIDELEIQKGLLQISKALEFLHDNAGLVHANLTPEAILINSKSDWKISGLSFC-  209

Query  384  STNPSSSDPSNMQSFHYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFSFG  557
            S   +S+ PS++Q  +  E    D ++P  +Q +L+YT+P+ V  N  S+  S+D++S G
Sbjct  210  SPAENSTKPSSIQGINLHEVLNMDPMLPGFVQLNLDYTSPDFVLDN--SLTPSADMYSLG  267

Query  558  CL  563
             L
Sbjct  268  LL  269



>gb|KJB60123.1| hypothetical protein B456_009G290500 [Gossypium raimondii]
Length=701

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +3

Query  438  EYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            EYD EDS++PLQPSLNYTAPELVRS  SS GCSSDIFSFGCL
Sbjct  6    EYDTEDSVIPLQPSLNYTAPELVRSKASSAGCSSDIFSFGCL  47



>ref|XP_503708.2| YALI0E08866p [Yarrowia lipolytica]
 emb|CAG79297.2| YALI0E08866p [Yarrowia lipolytica CLIB122]
Length=860

 Score = 65.5 bits (158),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 59/106 (56%), Gaps = 8/106 (8%)
 Frame = +3

Query  246  NGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQS  425
             GLLQ++E L F+H +A++VH  ++  TV + S G WKL G  +A     S S     + 
Sbjct  142  KGLLQVSEGLKFMHEDAKMVHMNLNLNTVFVDSLGDWKLGGCGYACEVAGSES-----RD  196

Query  426  FHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            F   ++D       +Q +L+Y+APELV     ++  S+D+FS  CL
Sbjct  197  FFIPQFDARYPRF-VQINLDYSAPELVLD--KNLDFSADVFSLACL  239


 Score = 39.3 bits (90),  Expect(2) = 3e-14, Method: Composition-based stats.
 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +2

Query  20   DAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTE  142
            D  +  +R +A  L RLRHP  + +V+ L E K++++ VTE
Sbjct  66   DEIYSRLRNEATNLARLRHPNFLRIVEPLYEGKSSLSFVTE  106



>ref|XP_004361630.1| SCY1 family protein kinase [Dictyostelium fasciculatum]
 gb|EGG23779.1| SCY1 family protein kinase [Dictyostelium fasciculatum]
Length=1057

 Score = 58.2 bits (139),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 55/105 (52%), Gaps = 5/105 (5%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+ QL E + FL+  A+L+HR ISP+++ IT    WK+ G  F  S+     D  +  S 
Sbjct  149  GISQLIEGVHFLNQTAKLLHRNISPKSIFITKTLKWKIGGLGF--SSGIDKQDSIHGLSH  206

Query  429  HYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
               EY  ++  + L P L+Y  PE V+        +SD+FS G +
Sbjct  207  DMKEYGYDEGSIIL-PDLDYLPPEYVQQKKWE--YNSDLFSIGRI  248


 Score = 46.2 bits (108),  Expect(2) = 3e-14, Method: Composition-based stats.
 Identities = 19/52 (37%), Positives = 30/52 (58%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFAS  157
            L K  +    D ++ +A  L RLRHP ++ VV  ++E+K  M   TEP+ A+
Sbjct  61   LPKANQTEIIDYLKKEAQSLQRLRHPAILQVVSPIEETKTTMYFATEPILAT  112



>ref|XP_002550183.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
 gb|EER31698.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
Length=885

 Score = 68.2 bits (165),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 62/107 (58%), Gaps = 6/107 (6%)
 Frame = +3

Query  246  NGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQS  425
             GLLQ+A+ L FLH+   ++H  + P +V + + G WKL GF F  + N  S  PS  ++
Sbjct  136  KGLLQIAKGLQFLHSYGSIIHLNLQPSSVFVNNQGDWKLGGFKFLQNLNEIS--PSEREN  193

Query  426  FHYAEYDVEDSIMPL-QPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            F+        S++P    +LN+TAPEL+  + + +  ++DI+S G +
Sbjct  194  FYIMN---NSSVVPFANLNLNFTAPELIVDSHTKLDFANDIWSLGQM  237


 Score = 36.2 bits (82),  Expect(2) = 3e-14, Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 42/76 (55%), Gaps = 13/76 (17%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKV-PK  205
            +++I+ +  +L +L+HP ++ + + L+E+K      +EP          + +N+  + PK
Sbjct  78   YELIKFEVNQLSKLKHPQLLQIFEVLEETKTKFLFASEP----------VTDNLLTINPK  127

Query  206  ELK--GIEMGLLEVKQ  247
            EL    I+ GLL++ +
Sbjct  128  ELDSLSIQKGLLQIAK  143



>gb|AJR81481.1| Scy1p [Saccharomyces cerevisiae YJM451]
 gb|AJS09035.1| Scy1p [Saccharomyces cerevisiae YJM1615]
Length=804

 Score = 72.8 bits (177),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 55/106 (52%), Gaps = 9/106 (8%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+LQL   LDF+HN A  VH  I P  + I  N  WK++G  + + T P     +N   +
Sbjct  152  GILQLVNALDFVHNRASFVHLNIQPRAIFINENSDWKISGLGYLVKTPPG----TNTSEY  207

Query  429  HYAEYDVE-DSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
               +YD      M LQ  LNYTAPE+V  NT  +   +D FS G L
Sbjct  208  FLPQYDPRVPPFMHLQ--LNYTAPEIVFENT--LTFKNDYFSLGLL  249


 Score = 31.6 bits (70),  Expect(2) = 4e-14, Method: Composition-based stats.
 Identities = 12/43 (28%), Positives = 26/43 (60%), Gaps = 0/43 (0%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFAS  157
            ++++R  A  L +L+HP ++ +++ L+E       VTE + +S
Sbjct  81   YEILRNQANNLAKLKHPNILTLIEPLEEHSKNFMFVTEFVTSS  123



>ref|XP_011103446.1| scy1p [Saccharomyces arboricola H-6]
 gb|EJS43747.1| scy1p [Saccharomyces arboricola H-6]
Length=805

 Score = 72.4 bits (176),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 55/106 (52%), Gaps = 9/106 (8%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+LQL   LDF+HN A  VH  I P+ V I  N  WK++G  + +   P     +N   +
Sbjct  152  GILQLTNALDFIHNRASFVHLNIQPKAVFINENSDWKISGLGYLVKIPPG----TNTSEY  207

Query  429  HYAEYDVE-DSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
               +YD      M LQ  LNYTAPE+V  NT  +   +D FS G L
Sbjct  208  FLPQYDPRVPPFMHLQ--LNYTAPEIVFENT--LAYKNDYFSLGLL  249


 Score = 32.0 bits (71),  Expect(2) = 4e-14, Method: Composition-based stats.
 Identities = 18/70 (26%), Positives = 34/70 (49%), Gaps = 10/70 (14%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPKE  208
            ++++R  A  L +L+HP ++ +++ L+E       VTE +  S          +E V KE
Sbjct  81   YEILRNQANNLAKLKHPNILTLIEPLEEHSKNFMFVTEFVTGS----------LETVFKE  130

Query  209  LKGIEMGLLE  238
             +  E   L+
Sbjct  131  TEDEEQNFLQ  140



>ref|XP_007764881.1| kinase-like protein [Coniophora puteana RWD-64-598 SS2]
 gb|EIW85378.1| kinase-like protein [Coniophora puteana RWD-64-598 SS2]
Length=892

 Score = 66.2 bits (160),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 54/109 (50%), Gaps = 10/109 (9%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
              G++QL   L FLH +ARL+H  I P+TV+I   G WK++G    +        P+   
Sbjct  162  QKGIIQLCSGLSFLHTSARLIHSNIRPDTVIINDAGDWKISGLGLTIPLTSPEGRPTRW-  220

Query  423  SFHYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
                 E+   D  MP  +Q S +Y APE       ++   SD++S GCL
Sbjct  221  -----EFPTFDGRMPAYVQRSFDYMAPEYALDEQHTV--LSDMYSLGCL  262


 Score = 37.7 bits (86),  Expect(2) = 4e-14, Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFA  154
            L+  A D   ++++ +++ L + RHP ++ +V+ L++++  +   TEP+ A
Sbjct  81   LTGAARDKVLEVLKLESSALSKFRHPCILEMVEPLEDTRTELIFATEPILA  131



>ref|XP_003664227.1| hypothetical protein MYCTH_116348 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO58982.1| hypothetical protein MYCTH_116348 [Myceliophthora thermophila 
ATCC 42464]
Length=1024

 Score = 69.3 bits (168),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 70/122 (57%), Gaps = 5/122 (4%)
 Frame = +3

Query  204  RSSKE*KWDY*R*NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFAL  383
            R  +E + D      GLLQ+++ L+FLH NA +VH  ++P+ +LI +   WKL+G +F  
Sbjct  153  RRRREIEIDELEIQKGLLQVSKALEFLHENAGIVHGNLTPDAILINAKSDWKLSGLAFCG  212

Query  384  STNPSSSDPSNMQSFHYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFSFG  557
              + S+S  S++Q  +  E       +P  +Q +L+YT+P+ V  N  ++   +D+FS G
Sbjct  213  PVDNSTSH-SSIQPINLRELLRHTPTLPRTVQLNLDYTSPDFVMDN--NLTAPADMFSLG  269

Query  558  CL  563
             L
Sbjct  270  LL  271


 Score = 34.7 bits (78),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 22/71 (31%), Positives = 44/71 (62%), Gaps = 6/71 (8%)
 Frame = +2

Query  8    KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESK-NAMAMVTEPLFASAANALGILE  184
            K A +A  + ++ +A+ + +LRHPG++ VV+ ++E++   +  V E + AS +   G+L+
Sbjct  71   KKAVEAVVERLKKEASAIAKLRHPGILEVVEPVEETRGGGLQFVAEAVTASLS---GLLQ  127

Query  185  NIEKVPKELKG  217
              EK  +E +G
Sbjct  128  --EKDDQERRG  136



>emb|CCD49499.1| hypothetical protein BofuT4_P100090.1 [Botrytis cinerea T4]
Length=971

 Score = 71.2 bits (173),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 72/122 (59%), Gaps = 5/122 (4%)
 Frame = +3

Query  204  RSSKE*KWDY*R*NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFAL  383
            R  KE + D      GLLQ+++ L+FLH+NA LVH  ++P+ V + +   WKL+G SF  
Sbjct  153  RRRKEVEVDELEIQKGLLQISKALEFLHDNAGLVHGNLTPDAVFVNAKSDWKLSGLSFC-  211

Query  384  STNPSSSDPSNMQSFHYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFSFG  557
            S   +S+  S++Q  + +E    D  +P  +Q +L+Y +P+ V    S++  S+D+FS G
Sbjct  212  SPPDNSTKASSVQPINLSEVLNIDPRLPRSVQINLDYCSPDFVLD--SNLNVSADMFSLG  269

Query  558  CL  563
             L
Sbjct  270  LL  271


 Score = 32.7 bits (73),  Expect(2) = 5e-14, Method: Composition-based stats.
 Identities = 20/71 (28%), Positives = 38/71 (54%), Gaps = 6/71 (8%)
 Frame = +2

Query  8    KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESK-NAMAMVTEPLFASAANALGILE  184
            K A +   + ++ +A+ L RLRHP ++ +V+ ++E +   +   TE + AS +  L    
Sbjct  70   KRATEEVIERLKKEASSLARLRHPSILELVEPVEELRGGGLQFATETVTASLSGLL----  125

Query  185  NIEKVPKELKG  217
             +EK  +E  G
Sbjct  126  -LEKDEQERAG  135



>ref|XP_001546912.1| hypothetical protein BC1G_14726 [Botrytis cinerea B05.10]
 gb|EMR83970.1| putative protein kinase domain-containing protein ppk32 protein 
[Botrytis cinerea BcDW1]
Length=971

 Score = 70.9 bits (172),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 72/122 (59%), Gaps = 5/122 (4%)
 Frame = +3

Query  204  RSSKE*KWDY*R*NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFAL  383
            R  KE + D      GLLQ+++ L+FLH+NA LVH  ++P+ V + +   WKL+G SF  
Sbjct  153  RRRKEVEVDELEIQKGLLQISKALEFLHDNAGLVHGNLTPDAVFVNAKSDWKLSGLSFC-  211

Query  384  STNPSSSDPSNMQSFHYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFSFG  557
            S   +S+  S++Q  + +E    D  +P  +Q +L+Y +P+ V    S++  S+D+FS G
Sbjct  212  SPPDNSTKASSVQPINLSEVLNIDPRLPRSVQINLDYCSPDFVLD--SNLNVSADMFSLG  269

Query  558  CL  563
             L
Sbjct  270  LL  271


 Score = 32.7 bits (73),  Expect(2) = 6e-14, Method: Composition-based stats.
 Identities = 20/71 (28%), Positives = 38/71 (54%), Gaps = 6/71 (8%)
 Frame = +2

Query  8    KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESK-NAMAMVTEPLFASAANALGILE  184
            K A +   + ++ +A+ L RLRHP ++ +V+ ++E +   +   TE + AS +  L    
Sbjct  70   KRATEEVIERLKKEASSLARLRHPSILELVEPVEELRGGGLQFATETVTASLSGLL----  125

Query  185  NIEKVPKELKG  217
             +EK  +E  G
Sbjct  126  -LEKDEQERAG  135



>gb|EDK41031.2| hypothetical protein PGUG_05129 [Meyerozyma guilliermondii ATCC 
6260]
Length=837

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 66/108 (61%), Gaps = 6/108 (6%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
              GLLQ+++ L FLHN   +VH  + P +V I + G WK+AGF F+ + N  S  P + +
Sbjct  132  QKGLLQVSKGLQFLHNQCHVVHFNLQPSSVFINTQGDWKIAGFRFSQNLNDLS--PEDRE  189

Query  423  SFHYAEYDVEDSIMPL-QPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +F         SI+P    +LNYTAPEL+ S+TS +  ++D++S GCL
Sbjct  190  NFFIMN---NASIVPFANLNLNYTAPELLISSTSKLDTANDLWSLGCL  234



>ref|XP_005991381.1| PREDICTED: LOW QUALITY PROTEIN: SCY1-like protein 2 [Latimeria 
chalumnae]
Length=936

 Score = 72.8 bits (177),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 64/105 (61%), Gaps = 14/105 (13%)
 Frame = +3

Query  255  LQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFAL-STNPSSSDPSNMQSFH  431
            LQ+AE L FLHN+ ++VHR ++PE V++  +GAWK+ GF F + S NPS  +P     F 
Sbjct  159  LQVAEGLCFLHNSVKMVHRNLTPENVILNKSGAWKIMGFDFCIPSLNPSEQEP----KFS  214

Query  432  YAEYDVEDSIMPL-QPSLNYTAPELVRSNTSSIGC--SSDIFSFG  557
              E+D   ++ PL  P+  Y APE +     S+ C  +SD++S G
Sbjct  215  CKEWD--PNLPPLCLPNPEYLAPEYIL----SVSCDQASDMYSLG  253


 Score = 30.8 bits (68),  Expect(2) = 7e-14, Method: Composition-based stats.
 Identities = 13/45 (29%), Positives = 25/45 (56%), Gaps = 0/45 (0%)
 Frame = +2

Query  8    KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTE  142
            K  +D   D ++    +L RLRHP ++ V   L+ES+    ++++
Sbjct  76   KFDKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRXCATLLSQ  120



>gb|EJW76801.1| other/SCY1 protein kinase [Wuchereria bancrofti]
Length=480

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 64/109 (59%), Gaps = 14/109 (13%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GL Q+ E L FLH + R++HR ISPE+V+I   G WKLAGF FA+     +   +N   +
Sbjct  160  GLFQVVEALSFLHIDVRMMHRNISPESVIINEKGEWKLAGFDFAVQ---GTQGTNNQVMY  216

Query  429  HYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIG--CS--SDIFSFGCL  563
               E++ + ++  +QP L+Y APE V      IG  C   +DIFSFG +
Sbjct  217  EMLEWN-QRTMSVVQPLLDYLAPEYV------IGGRCDPYADIFSFGIM  258


 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 55/91 (60%), Gaps = 0/91 (0%)
 Frame = +2

Query  8    KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  187
            +  ++ F ++++   ++L RLRHP ++ +   L+ES+++ A  TEP+FAS AN LG L+N
Sbjct  80   RYEKELFSEILKRGVSQLTRLRHPRILVIEHPLEESRDSYAFCTEPVFASLANVLGGLDN  139

Query  188  IEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            I   PK L   E+  +E++  +  V   L F
Sbjct  140  ISPYPKHLDEFELLDIEIRYGLFQVVEALSF  170



>ref|XP_308053.4| AGAP002142-PA [Anopheles gambiae str. PEST]
 gb|EAA03816.4| AGAP002142-PA [Anopheles gambiae str. PEST]
Length=810

 Score = 53.5 bits (127),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 43/90 (48%), Gaps = 9/90 (10%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+ +L + + FLH+  +LVHR +  E +++   G WKL GF F  S   +   P     F
Sbjct  154  GIFELIKGIRFLHDEVQLVHRHLCTENIIVNKQGVWKLFGFGFCWSKR-APGTPVGNHPF  212

Query  429  HYAEYDVEDSIMPLQPSLNYTAPELVRSNT  518
                     S +   P   +TAPEL+  NT
Sbjct  213  K--------SRLLGNPGSKWTAPELILENT  234


 Score = 49.3 bits (116),  Expect(2) = 9e-14, Method: Composition-based stats.
 Identities = 23/63 (37%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGIL  181
             +K   +   + IR    +L ++RHP V+ V  A++ES++ +A  TEP+ AS AN LG  
Sbjct  73   FTKDEREEICENIRRGVVQLTKIRHPQVLTVQHAMEESRDTIAFATEPVVASLANLLGNT  132

Query  182  ENI  190
             N+
Sbjct  133  TNV  135



>ref|XP_011399866.1| SCY1-like protein 2 [Auxenochlorella protothecoides]
 gb|KFM26918.1| SCY1-like protein 2 [Auxenochlorella protothecoides]
Length=612

 Score = 70.1 bits (170),  Expect(2) = 9e-14, Method: Composition-based stats.
 Identities = 41/109 (38%), Positives = 57/109 (52%), Gaps = 5/109 (5%)
 Frame = +3

Query  246  NGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQS  425
            +G+LQ+A+ + FLH+ A + HR I P  V I   G WKLA F+FA   +    + S    
Sbjct  149  HGVLQMADAIHFLHSGASMAHRGICPHAVFIARAGGWKLACFAFATPLDFRDGEASG--G  206

Query  426  FHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIG---CSSDIFSFGCL  563
            F +++         L+PSL Y APELV S  +S G    + D FS   L
Sbjct  207  FDFSDRHPSMLAAALKPSLAYCAPELVASGAASAGGMLSACDAFSMAAL  255


 Score = 33.1 bits (74),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 0/43 (0%)
 Frame = +2

Query  59   LVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  187
            L RL+HP V+ ++  L+E++  M  VTE +  S A+ L   E 
Sbjct  79   LARLKHPLVLRLLSPLEETRTQMVFVTEAVVTSLADYLAACEG  121



>ref|XP_007837082.1| hypothetical protein PFICI_10310 [Pestalotiopsis fici W106-1]
 gb|ETS78248.1| hypothetical protein PFICI_10310 [Pestalotiopsis fici W106-1]
Length=1010

 Score = 71.6 bits (174),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 72/122 (59%), Gaps = 5/122 (4%)
 Frame = +3

Query  204  RSSKE*KWDY*R*NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFAL  383
            R  +E + D      GLLQ+++ L+FLH NA L H  ++P+ +L+ +   WK++G +F  
Sbjct  153  RRRRELEIDELEIQKGLLQVSKALEFLHENAGLAHGNLTPDAILVNAKSDWKISGLAFC-  211

Query  384  STNPSSSDPSNMQSFHYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFSFG  557
            S    S+ P+++Q+   +E    D  +P  +Q +L+YT+P+ V  N  ++  S+D+FS G
Sbjct  212  SPPEGSTKPTSVQAISLSEALNLDPRLPKYVQLNLDYTSPDFVLDN--NLTTSADMFSLG  269

Query  558  CL  563
             L
Sbjct  270  LL  271


 Score = 31.2 bits (69),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 31/51 (61%), Gaps = 1/51 (2%)
 Frame = +2

Query  8    KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESK-NAMAMVTEPLFAS  157
            K A +   + ++ + + L RLRHP V+ +V+ ++E++   +  VTE + AS
Sbjct  70   KRATEEVVERLKKEVSCLARLRHPSVLELVEPVEETRGGGLQFVTEAVTAS  120



>gb|AJS02698.1| Scy1p [Saccharomyces cerevisiae YJM1447]
Length=804

 Score = 71.2 bits (173),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 55/106 (52%), Gaps = 9/106 (8%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+LQL   LDF+HN A  VH  I P  + I  N  WK++G  + +   P     +N   +
Sbjct  152  GILQLVNALDFVHNRASFVHLNIQPRAIFINENSDWKISGLGYLVKIPPG----TNTSEY  207

Query  429  HYAEYDVEDS-IMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
               +YD   S  M LQ  LNYTAPE+V  NT  +   +D FS G L
Sbjct  208  LLPQYDPRVSPFMHLQ--LNYTAPEIVFENT--LTFKNDYFSLGLL  249


 Score = 31.6 bits (70),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 12/43 (28%), Positives = 26/43 (60%), Gaps = 0/43 (0%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFAS  157
            ++++R  A  L +L+HP ++ +++ L+E       VTE + +S
Sbjct  81   YEILRNQANNLAKLKHPNILTLIEPLEEHSKNFMFVTEFVTSS  123



>emb|CCU82686.1| protein kinase Scy1 [Blumeria graminis f. sp. hordei DH14]
Length=980

 Score = 65.5 bits (158),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 66/108 (61%), Gaps = 4/108 (4%)
 Frame = +3

Query  246  NGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQS  425
             GL Q+++ L+FLH+NA+L+H  ++P+ + I S   WK++G SF+   + S++  S +  
Sbjct  161  KGLEQMSKALEFLHDNAQLIHGNLTPDAIFINSKSDWKISGLSFSCPPDGSTTKISTIPP  220

Query  426  FHYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             +  +    DS +P  +Q +L+Y +P+ V    S++  ++D+FS G +
Sbjct  221  LNLPQALNIDSRLPRCVQMNLDYCSPDFVLD--SNLNVAADMFSLGLI  266


 Score = 37.4 bits (85),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 21/66 (32%), Positives = 38/66 (58%), Gaps = 2/66 (3%)
 Frame = +2

Query  2    LSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKN-AMAMVTEPLFASAANALGI  178
            L K  ED   + ++ +A+ L RLRHP ++ +V+ ++E++N  +   TE + AS +  L  
Sbjct  69   LKKDTEDVV-ERLKKEASSLARLRHPNILELVEPIEETRNGGLQFATEMVTASLSGLLKE  127

Query  179  LENIEK  196
             +  EK
Sbjct  128  KDEREK  133



>emb|CDQ03616.1| Protein Bm9111, isoform b [Brugia malayi]
Length=880

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 64/109 (59%), Gaps = 14/109 (13%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GL Q+ E L FLH + R++HR ISPE+V+I   G WKLAGF FA+     +   +N   +
Sbjct  160  GLFQIVEALSFLHIDVRMMHRNISPESVIINEKGEWKLAGFDFAVQ---GTQGANNQVMY  216

Query  429  HYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIG--CS--SDIFSFGCL  563
               E++ + ++  +QP L+Y APE V      IG  C   +DIFSFG +
Sbjct  217  EMLEWN-QRTMSVVQPLLDYLAPEYV------IGGRCDPYADIFSFGIM  258


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 31/91 (34%), Positives = 53/91 (58%), Gaps = 0/91 (0%)
 Frame = +2

Query  8    KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  187
            K   + F ++++   ++L RLRHP ++ +   L+ES+++ A  TEP+FAS AN LG L+N
Sbjct  80   KYERELFSEILKRGVSQLTRLRHPRILVIEHPLEESRDSYAFCTEPVFASLANVLGHLDN  139

Query  188  IEKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            I   P  L   E+  +E++  +  +   L F
Sbjct  140  ISPYPTHLDEFELLDIEIRYGLFQIVEALSF  170



>ref|XP_458583.2| DEHA2D02640p [Debaryomyces hansenii CBS767]
 emb|CAG86717.2| DEHA2D02640p [Debaryomyces hansenii CBS767]
Length=844

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 65/106 (61%), Gaps = 6/106 (6%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GLLQ+A+ L FLHN  +++H  + P ++ I S G WKL+GF F  + N  S  PS+  +F
Sbjct  136  GLLQMAKGLQFLHNYCQIIHLNLQPSSIFINSQGDWKLSGFRFLQNLNEIS--PSDRDNF  193

Query  429  HYAEYDVEDSIMPL-QPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +        S++P    +LN+TAPEL+  ++  +  ++DI+S GCL
Sbjct  194  YIMN---NSSVVPFANLNLNFTAPELIVDSSQKLDTANDIWSLGCL  236



>gb|KEF56467.1| SCY1 protein kinase [Exophiala aquamarina CBS 119918]
Length=906

 Score = 64.7 bits (156),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 66/109 (61%), Gaps = 5/109 (5%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
              GLLQ+A+ L+FLH++A+LVH  ++P+ ++I +   WK++G +FA   + +      + 
Sbjct  165  QKGLLQVAKGLEFLHDSAKLVHGNLNPDAIIINAKSDWKISGLAFAGPPDGAEGH-QPVP  223

Query  423  SFHYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
                +E    D+ +P  +Q +L+YT+P+ V    S+I  S+DIFS G +
Sbjct  224  QISLSEVLHNDARIPRSVQLNLDYTSPDFVLD--SNINFSADIFSLGLV  270


 Score = 38.1 bits (87),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +2

Query  8    KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAM-VTEPLFASAANAL  172
            + A++   + ++ +A+ L RLRHP ++ +V+ +++++N   M  TEP+  S + AL
Sbjct  71   RKAQEEVVERLKKEASSLARLRHPSILQLVEPVEDTRNGGLMFATEPIQCSLSAAL  126



>gb|ELU10963.1| hypothetical protein CAPTEDRAFT_109432 [Capitella teleta]
Length=901

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 62/106 (58%), Gaps = 8/106 (8%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALS-TNPSSSDPSNMQS  425
            GLLQ+ E L F+HN+ +++H  ISPE+++I   G WKL GF F ++ +NP+   P     
Sbjct  150  GLLQVTEGLAFIHNSVKMIHGGISPESIMINGRGTWKLFGFDFCIANSNPADQAP----Y  205

Query  426  FHYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            F + E+     ++  QP L+Y APE     T S   SSD++S G L
Sbjct  206  FTFREWRANAPVLS-QPKLDYLAPEYAL--TQSCDTSSDMYSLGVL  248


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 52/93 (56%), Gaps = 1/93 (1%)
 Frame = +2

Query  5    SKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILE  184
            SK  ++   +  +   ++L RLRHP ++ ++  L+ES+ ++A   EP+FAS AN L   +
Sbjct  68   SKYEKEKILESFKRGVSQLTRLRHPKILSILHPLEESRESLAFAAEPVFASLANVLHQHD  127

Query  185  NI-EKVPKELKGIEMGLLEVKQWVTSVGRNLGF  280
            N+   +P  ++  ++  +E+K  +  V   L F
Sbjct  128  NMPSPIPPVIQSFKLYDVEIKYGLLQVTEGLAF  160



>ref|XP_003143373.1| SCY1 protein kinase [Loa loa]
 gb|EFO20697.1| SCY1 protein kinase [Loa loa]
Length=880

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 65/109 (60%), Gaps = 14/109 (13%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GL Q+ E L FLH + R++HR ISPE+V+I   G WKLAGF FA+    ++   +N   +
Sbjct  160  GLFQVVEALSFLHIDVRMMHRNISPESVIINEKGEWKLAGFDFAVQ---ATQGTNNQVMY  216

Query  429  HYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIG--CS--SDIFSFGCL  563
               E++ + ++  +QP L+Y APE V      IG  C   +DIFSFG +
Sbjct  217  EMLEWN-QRTMSVVQPLLDYLAPEYV------IGGRCDPYADIFSFGIM  258


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 31/87 (36%), Positives = 53/87 (61%), Gaps = 0/87 (0%)
 Frame = +2

Query  20   DAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKV  199
            + F ++++   ++L RLRHP ++ +   L+ES+++ A  TEP+FAS ANA+G L+NI   
Sbjct  84   ELFSEILKRGVSQLTRLRHPRILIIEHPLEESRDSYAFCTEPVFASLANAVGRLDNISPC  143

Query  200  PKELKGIEMGLLEVKQWVTSVGRNLGF  280
            P  L   E+  +E++  +  V   L F
Sbjct  144  PVHLNEFELLDIEIRYGLFQVVEALSF  170



>gb|KIX94417.1| hypothetical protein Z520_09803 [Fonsecaea multimorphosa CBS 
102226]
Length=914

 Score = 65.9 bits (159),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 64/109 (59%), Gaps = 5/109 (5%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
              GLLQ+A+ L+FLH++A+LVH  ++P+ ++I +   WK++G  FA   + +      + 
Sbjct  166  QKGLLQVAKGLEFLHDSAKLVHGNLTPDAIMINAKSDWKISGLGFAGPPDGAEGH-QPVP  224

Query  423  SFHYAEYDVEDSIMP--LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
                +E    DS +P  +Q  L+YT+P+ V    S+I  S+DIFS G +
Sbjct  225  QISLSEVLHHDSRIPRTVQLDLDYTSPDFVLD--SNINFSADIFSLGLV  271


 Score = 37.0 bits (84),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 34/53 (64%), Gaps = 1/53 (2%)
 Frame = +2

Query  17   EDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAM-VTEPLFASAANAL  172
            +D   + ++ +A+ L RLRHP ++ +++ ++E+++   M  TEP+  S + AL
Sbjct  75   QDEVVERLKKEASSLARLRHPSILQLLEPVEETRSGGLMFATEPVLCSLSAAL  127



>gb|AJR99248.1| Scy1p [Saccharomyces cerevisiae YJM1418]
Length=804

 Score = 70.5 bits (171),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 54/106 (51%), Gaps = 9/106 (8%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+LQL   LDF+HN A  VH  I P  + I  N  WK++G  + +   P     +N   +
Sbjct  152  GILQLVNALDFVHNRASFVHLNIQPRAIFINENSDWKISGLGYLVKIPPG----TNTSEY  207

Query  429  HYAEYDVE-DSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
               +YD      M LQ  LNYTAPE+V  NT  +   +D FS G L
Sbjct  208  FLPQYDPRVPPFMHLQ--LNYTAPEIVFENT--LTFKNDYFSLGLL  249


 Score = 31.6 bits (70),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 12/43 (28%), Positives = 26/43 (60%), Gaps = 0/43 (0%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFAS  157
            ++++R  A  L +L+HP ++ +++ L+E       VTE + +S
Sbjct  81   YEILRNQANNLAKLKHPNILTLIEPLEEHSKNFMFVTEFVTSS  123



>ref|XP_002498357.1| ZYRO0G08316p [Zygosaccharomyces rouxii]
 emb|CAR29424.1| ZYRO0G08316p [Zygosaccharomyces rouxii]
Length=780

 Score = 62.0 bits (149),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 55/108 (51%), Gaps = 9/108 (8%)
 Frame = +3

Query  243  NNGLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQ  422
              G+L++ + L+F+HN A  VH  I P +V I  N  WK++GF    +       P +  
Sbjct  150  QRGILEITQALEFIHNRASCVHLDIQPRSVFINDNSDWKVSGFGHLWNL------PQSTN  203

Query  423  SFHYAEYDVEDSIMP-LQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            S  Y     +  + P +  +L+YTAPE+V    S++   SD FS G L
Sbjct  204  SAEYFMQQFDPRVPPFMHLALDYTAPEIVLD--STVSFKSDYFSLGSL  249


 Score = 40.0 bits (92),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 22/80 (28%), Positives = 41/80 (51%), Gaps = 10/80 (13%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPKE  208
            ++++R     L +L+HP ++HVV+ L+E       VTE +  S  +   +  N+++    
Sbjct  82   YEVLRNQVGNLAKLKHPNILHVVEPLEEHSKNFMFVTEYVTGSLES---VFTNVDEELNF  138

Query  209  LKG-------IEMGLLEVKQ  247
             KG       I+ G+LE+ Q
Sbjct  139  FKGHVREDIVIQRGILEITQ  158



>gb|EDV10307.1| protein SCY1 [Saccharomyces cerevisiae RM11-1a]
Length=804

 Score = 70.5 bits (171),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 54/106 (51%), Gaps = 9/106 (8%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+LQL   LDF+HN A  VH  I P  + I  N  WK++G  + +   P     +N   +
Sbjct  152  GILQLVNALDFVHNRASFVHLNIQPRAIFINENSDWKISGLGYLVKIPPG----TNTSEY  207

Query  429  HYAEYDVE-DSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
               +YD      M LQ  LNYTAPE+V  NT  +   +D FS G L
Sbjct  208  FLPQYDPRVPPFMHLQ--LNYTAPEIVFENT--LTFKNDYFSLGLL  249


 Score = 31.6 bits (70),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 12/43 (28%), Positives = 26/43 (60%), Gaps = 0/43 (0%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFAS  157
            ++++R  A  L +L+HP ++ +++ L+E       VTE + +S
Sbjct  81   YEILRNQANNLAKLKHPNILTLIEPLEEHSKNFMFVTEFVTSS  123



>emb|CDQ05208.1| Protein Bm7414, isoform a, partial [Brugia malayi]
Length=589

 Score = 68.9 bits (167),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 65/105 (62%), Gaps = 8/105 (8%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+LQL + L +LHN+A+++H  ++P  + IT +  WK+AGF+F++    ++ +P+    F
Sbjct  88   GILQLIDGLSYLHNSAKILHGNLTPSVIYITLSRHWKIAGFAFSV----AAREPNVFPCF  143

Query  429  HYAEYDVEDSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
             +     +   + LQP L++ APE + +N + +  ++D+FS G L
Sbjct  144  PWT----KKLSVHLQPDLDFLAPEYLLANKNLVTSAADVFSLGVL  184


 Score = 33.5 bits (75),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 13/44 (30%), Positives = 27/44 (61%), Gaps = 0/44 (0%)
 Frame = +2

Query  26   FFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFAS  157
              D+IR D ++L  L HP ++ ++  ++E+K  ++  +E + AS
Sbjct  27   LIDLIRYDISQLSSLAHPRILQILHDIEENKEMISFASEHIQAS  70



>gb|AJS29195.1| Scy1p [Saccharomyces cerevisiae YJM1401]
Length=804

 Score = 70.5 bits (171),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 54/106 (51%), Gaps = 9/106 (8%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+LQL   LDF+HN A  VH  I P  + I  N  WK++G  + +   P     +N   +
Sbjct  152  GILQLVNALDFVHNRASFVHLNIQPRAIFINENSDWKISGLGYLVKIPPG----TNTSEY  207

Query  429  HYAEYDVE-DSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
               +YD      M LQ  LNYTAPE+V  NT  +   +D FS G L
Sbjct  208  FLPQYDPRVPPFMHLQ--LNYTAPEIVFENT--LTFKNDYFSLGLL  249


 Score = 31.6 bits (70),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 12/43 (28%), Positives = 26/43 (60%), Gaps = 0/43 (0%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFAS  157
            ++++R  A  L +L+HP ++ +++ L+E       VTE + +S
Sbjct  81   YEILRNQANNLAKLKHPNILTLIEPLEEHSKNFMFVTEFVTSS  123



>gb|AJR83965.1| Scy1p [Saccharomyces cerevisiae YJM554]
 gb|AJR85465.1| Scy1p [Saccharomyces cerevisiae YJM681]
 gb|AJR93860.1| Scy1p [Saccharomyces cerevisiae YJM1190]
Length=804

 Score = 70.5 bits (171),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 54/106 (51%), Gaps = 9/106 (8%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+LQL   LDF+HN A  VH  I P  + I  N  WK++G  + +   P     +N   +
Sbjct  152  GILQLVNALDFVHNRASFVHLNIQPRAIFINENSDWKISGLGYLVKIPPG----TNTSEY  207

Query  429  HYAEYDVE-DSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
               +YD      M LQ  LNYTAPE+V  NT  +   +D FS G L
Sbjct  208  FLPQYDPRVPPFMHLQ--LNYTAPEIVFENT--LTFKNDYFSLGLL  249


 Score = 31.6 bits (70),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 12/43 (28%), Positives = 26/43 (60%), Gaps = 0/43 (0%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFAS  157
            ++++R  A  L +L+HP ++ +++ L+E       VTE + +S
Sbjct  81   YEILRNQANNLAKLKHPNILTLIEPLEEHSKNFMFVTEFVTSS  123



>gb|ACX93858.1| Scy1-like 2, partial [Heliconius melpomene aglaope]
Length=176

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 66/106 (62%), Gaps = 8/106 (8%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            GL+Q+AE L FLHN+ +L+H  I PE++++   GAWK+ GF F ++ N S +  +    F
Sbjct  25   GLMQIAEGLAFLHNDVKLLHHNICPESIIVNQQGAWKIXGFDFCIA-NQSMAGSAPFWPF  83

Query  429  HYAEYDVEDSIMPL-QPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
            +  EY    ++ PL QP L+Y APE + S T S   +SDI+S G L
Sbjct  84   N--EYC--QAMPPLTQPILDYLAPEYILSATHS--PASDIYSLGML  123



>gb|EDN62034.1| conserved protein [Saccharomyces cerevisiae YJM789]
 gb|EEU04990.1| Scy1p [Saccharomyces cerevisiae JAY291]
 gb|EWG90929.1| Scy1p [Saccharomyces cerevisiae P301]
 gb|EWH18640.1| Scy1p [Saccharomyces cerevisiae P283]
 gb|AHY79296.1| Scy1p [Saccharomyces cerevisiae YJM993]
 gb|AJR79015.1| Scy1p [Saccharomyces cerevisiae YJM271]
 gb|AJR79515.1| Scy1p [Saccharomyces cerevisiae YJM320]
 gb|AJR83464.1| Scy1p [Saccharomyces cerevisiae YJM541]
 gb|AJR86452.1| Scy1p [Saccharomyces cerevisiae YJM683]
 gb|AJR90378.1| Scy1p [Saccharomyces cerevisiae YJM984]
 gb|AJR90864.1| Scy1p [Saccharomyces cerevisiae YJM987]
 gb|AJR94356.1| Scy1p [Saccharomyces cerevisiae YJM1199]
 gb|AJR94860.1| Scy1p [Saccharomyces cerevisiae YJM1202]
 gb|AJR96273.1| Scy1p [Saccharomyces cerevisiae YJM1244]
 gb|AJR97752.1| Scy1p [Saccharomyces cerevisiae YJM1252]
 gb|AJR98252.1| Scy1p [Saccharomyces cerevisiae YJM1415]
 gb|AJS04649.1| Scy1p [Saccharomyces cerevisiae YJM1477]
 gb|AJS05125.1| Scy1p [Saccharomyces cerevisiae YJM1478]
 gb|AJS06611.1| Scy1p [Saccharomyces cerevisiae YJM1527]
 gb|AJS07114.1| Scy1p [Saccharomyces cerevisiae YJM1549]
 gb|AJS20754.1| Scy1p [Saccharomyces cerevisiae YJM1326]
 gb|AJS24253.1| Scy1p [Saccharomyces cerevisiae YJM1356]
Length=804

 Score = 70.5 bits (171),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 54/106 (51%), Gaps = 9/106 (8%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+LQL   LDF+HN A  VH  I P  + I  N  WK++G  + +   P     +N   +
Sbjct  152  GILQLVNALDFVHNRASFVHLNIQPRAIFINENSDWKISGLGYLVKIPPG----TNTSEY  207

Query  429  HYAEYDVE-DSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
               +YD      M LQ  LNYTAPE+V  NT  +   +D FS G L
Sbjct  208  FLPQYDPRVPPFMHLQ--LNYTAPEIVFENT--LTFKNDYFSLGLL  249


 Score = 31.6 bits (70),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 12/43 (28%), Positives = 26/43 (60%), Gaps = 0/43 (0%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFAS  157
            ++++R  A  L +L+HP ++ +++ L+E       VTE + +S
Sbjct  81   YEILRNQANNLAKLKHPNILTLIEPLEEHSKNFMFVTEFVTSS  123



>gb|AJR97253.1| Scy1p [Saccharomyces cerevisiae YJM1250]
Length=804

 Score = 70.5 bits (171),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 54/106 (51%), Gaps = 9/106 (8%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+LQL   LDF+HN A  VH  I P  + I  N  WK++G  + +   P     +N   +
Sbjct  152  GILQLVNALDFVHNRASFVHLNIQPRAIFINENSDWKISGLGYLVKIPPG----TNTSEY  207

Query  429  HYAEYDVE-DSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
               +YD      M LQ  LNYTAPE+V  NT  +   +D FS G L
Sbjct  208  FLPQYDPRVPPFMHLQ--LNYTAPEIVFENT--LTFKNDYFSLGLL  249


 Score = 31.6 bits (70),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 12/43 (28%), Positives = 26/43 (60%), Gaps = 0/43 (0%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFAS  157
            ++++R  A  L +L+HP ++ +++ L+E       VTE + +S
Sbjct  81   YEILRNQANNLAKLKHPNILTLIEPLEEHSKNFMFVTEFVTSS  123



>gb|AJR84465.1| Scy1p [Saccharomyces cerevisiae YJM555]
 gb|AJS02220.1| Scy1p [Saccharomyces cerevisiae YJM1444]
Length=804

 Score = 70.5 bits (171),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 54/106 (51%), Gaps = 9/106 (8%)
 Frame = +3

Query  249  GLLQLAETLDFLHNNARLVHRAISPETVLITSNGAWKLAGFSFALSTNPSSSDPSNMQSF  428
            G+LQL   LDF+HN A  VH  I P  + I  N  WK++G  + +   P     +N   +
Sbjct  152  GILQLVNALDFVHNRASFVHLNIQPRAIFINENSDWKISGLGYLVKIPPG----TNTSEY  207

Query  429  HYAEYDVE-DSIMPLQPSLNYTAPELVRSNTSSIGCSSDIFSFGCL  563
               +YD      M LQ  LNYTAPE+V  NT  +   +D FS G L
Sbjct  208  FLPQYDPRVPPFMHLQ--LNYTAPEIVFENT--LTFKNDYFSLGLL  249


 Score = 31.6 bits (70),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 12/43 (28%), Positives = 26/43 (60%), Gaps = 0/43 (0%)
 Frame = +2

Query  29   FDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFAS  157
            ++++R  A  L +L+HP ++ +++ L+E       VTE + +S
Sbjct  81   YEILRNQANNLAKLKHPNILTLIEPLEEHSKNFMFVTEFVTSS  123



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920