BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS032H01

Length=575
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHG04887.1|  Phenylalanine ammonia-lyase                             302   1e-94   Gossypium arboreum [tree cotton]
gb|KJB16792.1|  hypothetical protein B456_002G248000                    301   1e-94   Gossypium raimondii
gb|AER12109.1|  PAL                                                     301   2e-94   Gossypium hirsutum [American cotton]
gb|AGY49231.1|  phenylalanine ammonia lyase                             301   3e-94   Ricinus communis
ref|XP_002519521.1|  Phenylalanine ammonia-lyase, putative              301   3e-94   Ricinus communis
emb|CAB97358.1|  phenylalanine ammonia-lyase                            287   4e-94   Juglans nigra
gb|KJB62426.1|  hypothetical protein B456_009G416300                    300   5e-94   Gossypium raimondii
dbj|BAA31258.1|  phenylalanine ammonia-lyase                            288   5e-94   Vitis vinifera
ref|XP_006345786.1|  PREDICTED: phenylalanine ammonia-lyase-like        300   5e-94   Solanum tuberosum [potatoes]
gb|AFN85669.1|  phenylalanine ammonia-lyase                             300   8e-94   Hibiscus cannabinus [bimli-jute]
dbj|BAF96940.1|  phenylalanine ammonia lyase                            290   2e-93   Nicotiana tabacum [American tobacco]
gb|KHG18863.1|  Phenylalanine ammonia-lyase                             298   4e-93   Gossypium arboreum [tree cotton]
gb|KJB36583.1|  hypothetical protein B456_006G166000                    297   7e-93   Gossypium raimondii
ref|XP_007027354.1|  PHE ammonia lyase 1                                297   7e-93   Theobroma cacao [chocolate]
gb|KHG29664.1|  Phenylalanine ammonia-lyase                             296   1e-92   Gossypium arboreum [tree cotton]
gb|AAK60275.1|AF383152_1  phenylalanine ammonia-lyase 2                 296   1e-92   Manihot esculenta [manioc]
ref|XP_009606373.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     296   2e-92   Nicotiana tomentosiformis
gb|ABI93975.1|  putative phenylalanine ammonia-lyase                    293   2e-92   Rhizophora mangle
ref|XP_004239660.1|  PREDICTED: phenylalanine ammonia-lyase-like        296   2e-92   
gb|ABI33979.1|  phenylalanine ammonia lyase                             296   2e-92   Jatropha curcas
ref|XP_009794410.1|  PREDICTED: phenylalanine ammonia-lyase-like        295   4e-92   Nicotiana sylvestris
gb|KHG30005.1|  Phenylalanine ammonia-lyase                             295   5e-92   Gossypium arboreum [tree cotton]
gb|KJB46525.1|  hypothetical protein B456_007G373600                    295   5e-92   Gossypium raimondii
gb|AAG49585.1|AF325496_1  phenylalanine ammonia-lyase                   295   6e-92   Ipomoea nil [qian niu]
gb|KDP29132.1|  hypothetical protein JCGZ_16521                         295   7e-92   Jatropha curcas
emb|CDP20698.1|  unnamed protein product                                293   1e-91   Coffea canephora [robusta coffee]
gb|AEO92028.1|  phenylalanine ammonia-lyase 2                           294   1e-91   Coffea canephora [robusta coffee]
emb|CAN61378.1|  hypothetical protein VITISV_032212                     293   1e-91   Vitis vinifera
ref|XP_004143259.1|  PREDICTED: phenylalanine ammonia-lyase-like        293   1e-91   
gb|ABV26012.1|  phenylalanine ammonia-lyase                             288   2e-91   Musa acuminata [banana]
gb|AGH13333.1|  phenylalanine ammonia-lyase                             293   2e-91   Rhus chinensis
ref|XP_002281799.1|  PREDICTED: phenylalanine ammonia-lyase             293   2e-91   Vitis vinifera
gb|KJB46526.1|  hypothetical protein B456_007G373700                    292   2e-91   Gossypium raimondii
ref|XP_010662075.1|  PREDICTED: phenylalanine ammonia-lyase             293   3e-91   Vitis vinifera
ref|XP_002268181.1|  PREDICTED: phenylalanine ammonia-lyase             293   4e-91   Vitis vinifera
emb|CAN77065.1|  hypothetical protein VITISV_009233                     292   4e-91   Vitis vinifera
sp|P45730.1|PALY_POPTR  RecName: Full=Phenylalanine ammonia-lyase       292   6e-91   Populus trichocarpa [western balsam poplar]
gb|AEL21617.1|  phenylalanine ammonia lyase 2                           292   7e-91   Coffea arabica [arabica coffee]
ref|XP_008449236.1|  PREDICTED: phenylalanine ammonia-lyase-like        292   7e-91   Cucumis melo [Oriental melon]
ref|XP_002322884.2|  phenylalanine ammonia-lyase family protein         292   7e-91   Populus trichocarpa [western balsam poplar]
gb|ABM67591.1|  phenylalanin ammonia-lyase                              292   7e-91   Vitis vinifera
ref|XP_011077338.1|  PREDICTED: phenylalanine ammonia-lyase             292   7e-91   Sesamum indicum [beniseed]
ref|XP_003633985.1|  PREDICTED: phenylalanine ammonia-lyase-like        291   1e-90   Vitis vinifera
gb|AAW51923.2|  phenylalanine ammonia-lyase 2                           292   1e-90   Rhizophora mangle
ref|XP_003633987.1|  PREDICTED: phenylalanine ammonia-lyase-like        291   1e-90   Vitis vinifera
emb|CBI26455.3|  unnamed protein product                                291   1e-90   Vitis vinifera
ref|XP_002268256.1|  PREDICTED: phenylalanine ammonia-lyase             291   1e-90   Vitis vinifera
ref|XP_003635657.2|  PREDICTED: phenylalanine ammonia-lyase-like        291   1e-90   Vitis vinifera
ref|XP_002268732.1|  PREDICTED: phenylalanine ammonia-lyase             291   1e-90   Vitis vinifera
ref|XP_008449237.1|  PREDICTED: phenylalanine ammonia-lyase-like        291   1e-90   Cucumis melo [Oriental melon]
ref|XP_003633986.1|  PREDICTED: phenylalanine ammonia-lyase-like        291   1e-90   Vitis vinifera
gb|AFZ78650.1|  phenylalanine ammonia-lyase                             291   1e-90   Populus tomentosa [Chinese white poplar]
ref|XP_011048535.1|  PREDICTED: phenylalanine ammonia-lyase-like        291   2e-90   Populus euphratica
ref|XP_006381441.1|  phenylalanine ammonia-lyase family protein         291   2e-90   Populus trichocarpa [western balsam poplar]
ref|XP_004143256.1|  PREDICTED: phenylalanine ammonia-lyase-like        291   2e-90   
ref|XP_009759945.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     291   2e-90   Nicotiana sylvestris
gb|AEX32784.1|  phenylalanine ammonia-lyase                             291   2e-90   Vitis vinifera
ref|XP_011010447.1|  PREDICTED: phenylalanine ammonia-lyase             291   2e-90   Populus euphratica
gb|AEV53411.1|  phenylalanine ammonia-lyase 3                           291   2e-90   Populus tomentosa [Chinese white poplar]
emb|CBI31445.3|  unnamed protein product                                287   3e-90   Vitis vinifera
gb|AAR31107.1|  phenylalanine ammonia-lyase                             290   3e-90   Quercus suber [cork oak]
emb|CDY66761.1|  BnaCnng52250D                                          285   3e-90   Brassica napus [oilseed rape]
gb|ABS58596.1|  phenylalanine ammonia-lyase                             276   3e-90   Scutellaria baicalensis [Baikal skullcap]
ref|XP_002267953.1|  PREDICTED: phenylalanine ammonia-lyase             290   4e-90   Vitis vinifera
gb|KGN52974.1|  hypothetical protein Csa_4G008770                       286   5e-90   Cucumis sativus [cucumbers]
gb|AAV98199.1|  phenylalanine ammonialyase 1                            290   6e-90   Petunia x hybrida [garden petunia]
ref|XP_004143356.1|  PREDICTED: phenylalanine ammonia-lyase-like        290   6e-90   
sp|P45733.1|PAL3_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       290   6e-90   Nicotiana tabacum [American tobacco]
gb|KGN48164.1|  hypothetical protein Csa_6G445770                       290   6e-90   Cucumis sativus [cucumbers]
ref|XP_011094662.1|  PREDICTED: phenylalanine ammonia-lyase             289   8e-90   Sesamum indicum [beniseed]
ref|XP_008449239.1|  PREDICTED: phenylalanine ammonia-lyase-like        289   1e-89   Cucumis melo [Oriental melon]
gb|ACE95170.1|  phenylalanine ammonia-lyase                             289   1e-89   Populus tomentosa [Chinese white poplar]
ref|XP_009596642.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     289   1e-89   Nicotiana tomentosiformis
sp|O49836.1|PAL2_LITER  RecName: Full=Phenylalanine ammonia-lyase...    288   1e-89   Lithospermum erythrorhizon
gb|KGN52975.1|  hypothetical protein Csa_4G008780                       287   1e-89   Cucumis sativus [cucumbers]
gb|KGN48162.1|  hypothetical protein Csa_6G445750                       288   2e-89   Cucumis sativus [cucumbers]
gb|KDP44384.1|  hypothetical protein JCGZ_20064                         288   2e-89   Jatropha curcas
ref|XP_008449238.1|  PREDICTED: phenylalanine ammonia-lyase             288   2e-89   Cucumis melo [Oriental melon]
dbj|BAA21643.1|  phenylalanine ammonia-lyase                            288   2e-89   Populus sieboldii x Populus grandidentata
gb|ACF94716.1|  phenylalanine ammonia lyase                             288   2e-89   Robinia pseudoacacia [black locust]
gb|AAN52279.1|AF480619_1  phenylalanine ammonia-lyase                   288   2e-89   Populus tremuloides
gb|ABG75910.1|  phenylalanine ammonia-lyase 1                           288   2e-89   Nicotiana attenuata
ref|XP_010067315.1|  PREDICTED: phenylalanine ammonia-lyase             288   2e-89   Eucalyptus grandis [rose gum]
gb|KCW65428.1|  hypothetical protein EUGRSUZ_G02848                     288   2e-89   Eucalyptus grandis [rose gum]
gb|ADO64252.1|  PAL                                                     288   2e-89   Epimedium sagittatum
gb|AEZ67457.1|  phenylalanine ammonia-lyase                             288   3e-89   Perilla frutescens [beefsteak-mint]
ref|XP_004156293.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    288   3e-89   
gb|AEC11891.1|  PAL1                                                    288   3e-89   Petunia exserta
gb|AEE81750.1|  phenylalanine ammonia lyase                             288   4e-89   Morus alba var. multicaulis
dbj|BAJ17655.1|  phenylalanine ammonia lyase                            287   5e-89   Gynura bicolor
gb|AEX32790.1|  phenylalanine ammonia-lyase                             287   5e-89   Vitis vinifera
ref|XP_004167356.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    286   5e-89   
dbj|BAL49995.1|  phenylalanine ammonia-lyase                            287   5e-89   Eucalyptus robusta [swamp messmate]
ref|XP_010658395.1|  PREDICTED: phenylalanine ammonia-lyase G1          287   6e-89   Vitis vinifera
gb|AJO53273.1|  phenylalanine ammonia-lyase                             287   6e-89   Pogostemon cablin
gb|ACS71953.1|  phenylalanine ammonia-lyase                             287   6e-89   Euphorbia pulcherrima
gb|AAL14120.1|  phenylalanine ammonia-lyase                             273   6e-89   Brassica rapa subsp. pekinensis [bai cai]
gb|ADY02661.1|  phenylalanine ammonia lyase                             286   7e-89   Parrya nudicaulis
ref|XP_009625397.1|  PREDICTED: phenylalanine ammonia-lyase             286   8e-89   Nicotiana tomentosiformis
ref|XP_004143257.1|  PREDICTED: phenylalanine ammonia-lyase-like        286   8e-89   
sp|P35513.2|PAL2_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       286   9e-89   Nicotiana tabacum [American tobacco]
ref|XP_004152158.1|  PREDICTED: phenylalanine ammonia-lyase-like        286   1e-88   
gb|ADA81868.1|  phenylalanine ammonia-lyase                             286   1e-88   Brassica rapa subsp. chinensis [bok-choy]
gb|AID16077.1|  phenylalanine ammonium lyase                            286   1e-88   Morus alba
gb|AER58180.1|  phenylalanine ammonia lyase                             286   1e-88   Cucumis sativus [cucumbers]
ref|XP_009781653.1|  PREDICTED: phenylalanine ammonia-lyase             286   1e-88   Nicotiana sylvestris
ref|XP_010528074.1|  PREDICTED: phenylalanine ammonia-lyase 1           286   1e-88   Tarenaya hassleriana [spider flower]
gb|ADY02660.1|  phenylalanine ammonia lyase                             286   1e-88   Parrya nudicaulis
ref|XP_004152155.1|  PREDICTED: phenylalanine ammonia-lyase-like        286   1e-88   
ref|XP_002531677.1|  Phenylalanine ammonia-lyase, putative              286   1e-88   Ricinus communis
gb|AIB06732.1|  phenylalanine ammonia lyase                             286   1e-88   Mangifera indica
sp|O49835.1|PAL1_LITER  RecName: Full=Phenylalanine ammonia-lyase...    286   1e-88   Lithospermum erythrorhizon
gb|ADY02662.1|  phenylalanine ammonia lyase                             285   1e-88   Parrya nudicaulis
gb|AAK60274.1|AF383151_1  phenylalanine ammonia-lyase 1                 285   2e-88   Manihot esculenta [manioc]
gb|ACR56688.1|  phenylalanine ammonia-lyase                             285   2e-88   Scutellaria viscidula [zhan mao huang qin]
ref|XP_010032174.1|  PREDICTED: phenylalanine ammonia-lyase-like        285   2e-88   Eucalyptus grandis [rose gum]
gb|AAO13347.1|  phenylalanine ammonia-lyase2                            285   2e-88   Lactuca sativa [cultivated lettuce]
ref|XP_004246650.1|  PREDICTED: phenylalanine ammonia-lyase-like        285   2e-88   
gb|AFJ80777.1|  phenylalanine ammonia-lyase                             285   2e-88   Camellia japonica [common camellia]
ref|XP_010112228.1|  Phenylalanine ammonia-lyase                        285   2e-88   
ref|XP_004246649.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    285   3e-88   Solanum lycopersicum
gb|AFZ94859.1|  phenylalanine ammonia-lyase                             285   3e-88   Plectranthus scutellarioides
gb|ADN32767.1|  phenylalanine ammonia-lyase 1                           285   3e-88   Scutellaria baicalensis [Baikal skullcap]
gb|ACT21093.1|  phenylalanine ammonia-lyase                             285   3e-88   Camellia oleifera [abura-tsubaki]
ref|XP_009143533.1|  PREDICTED: phenylalanine ammonia-lyase 1           285   3e-88   Brassica rapa
gb|ABD42947.1|  phenylalanine ammonia lyase                             285   3e-88   Acacia auriculiformis x Acacia mangium
ref|XP_008454138.1|  PREDICTED: phenylalanine ammonia-lyase-like        285   3e-88   Cucumis melo [Oriental melon]
gb|AIA24411.1|  phenylalanine ammonia-lyase                             285   3e-88   Sinopodophyllum hexandrum [Himalayan mayapple]
gb|ABC69917.1|  phenylalanine ammonia-lyase                             285   3e-88   Brassica napus [oilseed rape]
emb|CAL91169.1|  phenylalanine ammonia-lyase 3                          285   3e-88   Cynara cardunculus var. scolymus [artichoke]
ref|XP_008454139.1|  PREDICTED: phenylalanine ammonia-lyase-like        285   3e-88   Cucumis melo [Oriental melon]
gb|ACR10243.1|  phenylalanine ammonia-lyase                             283   4e-88   Canarium album [Chinese white-olive]
ref|XP_008449240.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      285   5e-88   Cucumis melo [Oriental melon]
gb|AAK62030.1|  phenylalanine ammonia-lyase 1                           284   5e-88   Manihot esculenta [manioc]
gb|ACM44926.1|  phenylalanine ammonia-lyase                             285   5e-88   Euphorbia pulcherrima
gb|ACM62741.1|  phenylalanine ammonia-lyase                             285   5e-88   Garcinia mangostana [mangosteen]
gb|AAX22053.1|  phenylalanine ammonia-lyase                             285   6e-88   Brassica napus [oilseed rape]
ref|XP_004143258.1|  PREDICTED: phenylalanine ammonia-lyase-like        284   8e-88   Cucumis sativus [cucumbers]
ref|XP_004249558.1|  PREDICTED: phenylalanine ammonia-lyase             284   8e-88   Solanum lycopersicum
gb|ACR15762.1|  phenylalanine ammonia-lyase                             284   8e-88   Litchi chinensis [litchi]
dbj|BAA95629.1|  phenylalanine ammonia lyase                            284   8e-88   Catharanthus roseus [chatas]
ref|XP_010262867.1|  PREDICTED: phenylalanine ammonia-lyase             284   8e-88   Nelumbo nucifera [Indian lotus]
ref|XP_010253912.1|  PREDICTED: phenylalanine ammonia-lyase             284   8e-88   Nelumbo nucifera [Indian lotus]
gb|AFK43896.1|  unknown                                                 274   9e-88   Medicago truncatula
ref|XP_007009873.1|  Phenylalanine ammonia-lyase 2                      284   9e-88   
gb|ACX31148.1|  phenylalanine ammonialyase                              282   9e-88   Brassica juncea subsp. napiformis [jie cai ge da]
ref|XP_009103852.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      284   9e-88   Brassica rapa
ref|XP_010107520.1|  Phenylalanine ammonia-lyase                        284   1e-87   Morus notabilis
gb|AEM63671.1|  phenylalanine ammonia lyase 2                           283   1e-87   Platycodon grandiflorus [balloon-flower]
ref|XP_010067319.1|  PREDICTED: phenylalanine ammonia-lyase-like        283   2e-87   Eucalyptus grandis [rose gum]
gb|ADI40166.1|  phenylalanine ammonia-lyase                             283   2e-87   Morus alba
emb|CBI26448.3|  unnamed protein product                                276   2e-87   Vitis vinifera
ref|XP_004246651.1|  PREDICTED: phenylalanine ammonia-lyase             283   2e-87   
ref|XP_006354337.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    283   2e-87   Solanum tuberosum [potatoes]
sp|O04058.2|PALY_HELAN  RecName: Full=Phenylalanine ammonia-lyase       282   2e-87   Helianthus annuus
sp|P26600.1|PAL5_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    283   2e-87   Solanum lycopersicum
gb|AFP49807.1|  phenylalanine ammonialyase 4                            283   2e-87   Coffea arabica [arabica coffee]
gb|AJO53274.1|  phenylalanine ammonia-lyase                             283   2e-87   Pogostemon cablin
ref|XP_009629066.1|  PREDICTED: phenylalanine ammonia-lyase             283   2e-87   Nicotiana tomentosiformis
ref|XP_004143255.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      282   3e-87   Cucumis sativus [cucumbers]
gb|AAX22055.1|  phenylalanine ammonia-lyase                             283   3e-87   Brassica napus [oilseed rape]
gb|AGT63063.1|  phenylalanine ammonia-lyase                             282   3e-87   Solanum tuberosum [potatoes]
gb|AIA66448.1|  PAL1                                                    282   3e-87   Capsicum annuum
gb|ACF17667.1|  putative phenylalanine ammonia-lyase                    282   4e-87   Capsicum annuum
ref|XP_008454137.1|  PREDICTED: phenylalanine ammonia-lyase-like        282   4e-87   Cucumis melo [Oriental melon]
sp|O23924.1|PALY_DIGLA  RecName: Full=Phenylalanine ammonia-lyase       282   4e-87   Digitalis lanata [Grecian foxglove]
gb|AIZ76766.1|  PAL2                                                    275   4e-87   Pyrus pyrifolia [sha li]
ref|XP_003554382.1|  PREDICTED: phenylalanine ammonia-lyase 1-lik...    282   5e-87   
gb|ABG75911.1|  phenylalanine ammonia-lyase 2                           282   5e-87   Nicotiana attenuata
ref|XP_010684079.1|  PREDICTED: phenylalanine ammonia-lyase             282   5e-87   Beta vulgaris subsp. vulgaris [field beet]
sp|P45726.1|PALY_CAMSI  RecName: Full=Phenylalanine ammonia-lyase       282   5e-87   Camellia sinensis [black tea]
ref|XP_010553331.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      282   6e-87   Tarenaya hassleriana [spider flower]
gb|ABC69916.1|  phenylalanine ammonia-lyase                             281   7e-87   Brassica napus [oilseed rape]
gb|AEO92029.1|  phenylalanine ammonia-lyase 3                           281   7e-87   Coffea canephora [robusta coffee]
emb|CBI26446.3|  unnamed protein product                                274   8e-87   Vitis vinifera
gb|ABR14606.1|  phenylalanine ammonia-lyase                             281   8e-87   Salvia miltiorrhiza [Chinese salvia]
emb|CAL91037.1|  phenylalanine ammonia-lyase 1                          281   9e-87   Cynara cardunculus var. scolymus [artichoke]
ref|XP_006290660.1|  hypothetical protein CARUB_v10016752mg             281   1e-86   Capsella rubella
gb|AEM63670.1|  phenylalanine ammonia lyase 1                           281   1e-86   Platycodon grandiflorus [balloon-flower]
emb|CAL91171.1|  phenylalanine ammonia-lyase 2                          271   1e-86   Cynara cardunculus var. scolymus [artichoke]
ref|XP_010067318.1|  PREDICTED: phenylalanine ammonia-lyase             281   1e-86   Eucalyptus grandis [rose gum]
gb|ABD73282.1|  phenylalanine ammonia-lyase                             281   1e-86   Salvia miltiorrhiza [Chinese salvia]
ref|XP_011031723.1|  PREDICTED: phenylalanine ammonia-lyase G4          281   1e-86   Populus euphratica
gb|AID51445.1|  phenylalanine ammonia-lyase 2                           281   1e-86   Astragalus membranaceus
gb|AAL55242.1|AF299330_1  phenylalanine ammonia-lyase                   281   1e-86   Lactuca sativa [cultivated lettuce]
ref|XP_002312013.1|  phenylalanine ammonia-lyase family protein         281   1e-86   Populus trichocarpa [western balsam poplar]
gb|AAM12956.1|  phenylalanine ammonia-lyase                             281   1e-86   Arabidopsis thaliana [mouse-ear cress]
gb|AAF27654.1|  phenylalanine ammonia lyase                             266   1e-86   Coffea arabica [arabica coffee]
gb|AFZ78651.1|  phenylalanine ammonia-lyase                             281   1e-86   Populus tomentosa [Chinese white poplar]
ref|NP_190894.1|  phenylalanine ammonia-lyase 2                         281   1e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006364021.1|  PREDICTED: phenylalanine ammonia-lyase-like        281   1e-86   Solanum tuberosum [potatoes]
gb|KFK34576.1|  hypothetical protein AALP_AA5G163700                    281   1e-86   Arabis alpina [alpine rockcress]
ref|XP_002877909.1|  phenylalanine ammonia-lyase 2                      281   1e-86   Arabidopsis lyrata subsp. lyrata
emb|CBI26454.3|  unnamed protein product                                274   1e-86   Vitis vinifera
emb|CDX76219.1|  BnaA04g04830D                                          276   1e-86   
gb|ADL09136.1|  phenylanlanine ammonia-lyase                            281   2e-86   Brassica oleracea var. botrytis [cauliflower]
gb|AHA42445.1|  phenylalanine ammonia lyase                             276   2e-86   Cannabis sativa
ref|XP_009141625.1|  PREDICTED: phenylalanine ammonia-lyase 1           281   2e-86   Brassica rapa
emb|CBI26453.3|  unnamed protein product                                274   2e-86   Vitis vinifera
gb|ABY89690.1|  phenylalanine ammonialyase 1 protein                    281   2e-86   Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_003556238.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      280   2e-86   Glycine max [soybeans]
ref|XP_007162754.1|  hypothetical protein PHAVU_001G1777001g            272   2e-86   Phaseolus vulgaris [French bean]
emb|CBI26450.3|  unnamed protein product                                274   2e-86   Vitis vinifera
gb|KHN09507.1|  Phenylalanine ammonia-lyase 1                           280   2e-86   Glycine soja [wild soybean]
emb|CBJ23826.1|  phenylalanine ammonia-lyase                            280   2e-86   Melissa officinalis [sweet balm]
ref|XP_004493977.1|  PREDICTED: phenylalanine ammonia-lyase-like        280   2e-86   Cicer arietinum [garbanzo]
ref|XP_011077265.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    280   2e-86   
ref|XP_010067316.1|  PREDICTED: phenylalanine ammonia-lyase             280   2e-86   Eucalyptus grandis [rose gum]
ref|XP_003521397.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      280   3e-86   
emb|CBI26447.3|  unnamed protein product                                274   3e-86   Vitis vinifera
gb|EPS61109.1|  phenylalanine ammonia-lyase                             279   3e-86   Genlisea aurea
emb|CDO99754.1|  unnamed protein product                                278   3e-86   Coffea canephora [robusta coffee]
gb|AFU90757.1|  phenylalanine ammonia-lyase                             280   3e-86   Epimedium sagittatum
ref|XP_003521396.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      280   3e-86   
dbj|BAO01110.1|  phenylalanine ammonia-lyase                            280   3e-86   Vigna radiata [mung bean]
emb|CBI32748.3|  unnamed protein product                                273   3e-86   Vitis vinifera
gb|ABF50788.1|  phenylalanine ammonia-lyase                             280   4e-86   Isatis tinctoria [woad]
ref|XP_006354339.1|  PREDICTED: phenylalanine ammonia-lyase-like        280   4e-86   Solanum tuberosum [potatoes]
gb|AJR20994.1|  phenylalanine ammonia-lyase                             279   4e-86   Populus szechuanica
gb|ABY89691.1|  phenylalanine ammonialyase 2 protein                    280   5e-86   Brassica rapa subsp. oleifera [biennial turnip rape]
gb|ACC63889.1|  phenylalanine ammonia-lyase                             279   5e-86   Populus trichocarpa [western balsam poplar]
ref|XP_002315308.1|  phenylalanine ammonia-lyase family protein         279   6e-86   Populus trichocarpa [western balsam poplar]
emb|CAL91170.1|  phenylalanine ammonia-lyase 3                          266   6e-86   Cynara cardunculus var. scolymus [artichoke]
ref|XP_006589419.1|  PREDICTED: phenylalanine ammonia-lyase 2-lik...    279   6e-86   Glycine max [soybeans]
ref|XP_002285277.1|  PREDICTED: phenylalanine ammonia-lyase             279   6e-86   Vitis vinifera
gb|ACT53399.1|  phenylalanine ammonia-lyase 2                           279   7e-86   Ageratina adenophora
emb|CAC81822.1|  phenylalanine ammonia-lyase                            270   7e-86   Beta vulgaris [beet]
ref|XP_009766905.1|  PREDICTED: phenylalanine ammonia-lyase             279   8e-86   Nicotiana sylvestris
gb|KGN52973.1|  hypothetical protein Csa_4G008760                       271   8e-86   Cucumis sativus [cucumbers]
gb|AEH02821.1|  phenylalanine ammonia lyase                             279   8e-86   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_006364022.1|  PREDICTED: phenylalanine ammonia-lyase-like        279   9e-86   Solanum tuberosum [potatoes]
gb|ACZ51372.1|  phenylalanine ammonia-lyase                             278   9e-86   Dianthus caryophyllus [carnation]
sp|P45732.1|PALY_STYHU  RecName: Full=Phenylalanine ammonia-lyase       278   1e-85   Stylosanthes humilis [alfafinha do nordeste]
ref|XP_004246652.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    278   1e-85   
gb|AAN52280.1|AF480620_1  phenylalanine ammonia-lyase                   278   1e-85   Populus tremuloides
gb|AFP49806.1|  phenylalanine ammonialyase 1                            278   1e-85   Coffea arabica [arabica coffee]
gb|KJB73539.1|  hypothetical protein B456_011G238400                    278   1e-85   Gossypium raimondii
ref|XP_010325983.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    278   1e-85   
gb|AEL21616.1|  phenylalanine ammonia lyase 1                           278   1e-85   Coffea arabica [arabica coffee]
gb|AAK84225.1|AF401636_1  phenylalanine ammonia-lyase                   278   1e-85   Rehmannia glutinosa [Chinese foxglove]
ref|XP_006436446.1|  hypothetical protein CICLE_v10030821mg             278   1e-85   Citrus clementina [clementine]
gb|AAN32866.1|AF460203_1  phenylalanine ammonia-lyase 1                 278   1e-85   Coffea canephora [robusta coffee]
ref|XP_010515816.1|  PREDICTED: phenylalanine ammonia-lyase 2           278   1e-85   Camelina sativa [gold-of-pleasure]
gb|KDO46246.1|  hypothetical protein CISIN_1g004955mg                   278   2e-85   Citrus sinensis [apfelsine]
gb|KHG26972.1|  Phenylalanine ammonia-lyase                             278   2e-85   Gossypium arboreum [tree cotton]
sp|P45734.1|PALY_TRISU  RecName: Full=Phenylalanine ammonia-lyase       278   2e-85   Trifolium subterraneum
ref|XP_006424540.1|  hypothetical protein CICLE_v10027912mg             278   2e-85   Citrus clementina [clementine]
emb|CBI26457.3|  unnamed protein product                                271   2e-85   Vitis vinifera
gb|ABN79671.2|  phenylalanine ammonia-lyase                             278   2e-85   Rudbeckia hirta
ref|XP_009116020.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    278   2e-85   Brassica rapa
gb|AAA34179.2|  phenylalanine ammonia lyase                             277   2e-85   Solanum lycopersicum
gb|AAW78932.1|  phenylalanine-ammonia lyase                             277   2e-85   Rhodiola sachalinensis
gb|AAF40224.1|AF237955_1  phenylalanine ammonia-lyase 2                 278   2e-85   Rubus idaeus [European raspberry]
dbj|BAC56977.1|  phenylalanine ammonia-lyase                            277   2e-85   Daucus carota [carrots]
sp|P35511.1|PAL1_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    277   3e-85   Solanum lycopersicum
dbj|BAG31930.1|  phenylalanine ammonia-lyase                            277   3e-85   Daucus carota [carrots]
gb|EYU34451.1|  hypothetical protein MIMGU_mgv1a002104mg                277   3e-85   Erythranthe guttata [common monkey flower]
gb|AFI71896.1|  phenylalanine ammonia-lyase                             277   3e-85   Paeonia lactiflora [common garden peony]
ref|XP_010504083.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      277   3e-85   Camelina sativa [gold-of-pleasure]
gb|AAZ29733.1|  phenylalanine ammonia lyase                             277   4e-85   Trifolium pratense [peavine clover]
gb|AAF27655.1|  phenylalanine ammonia lyase                             261   4e-85   Coffea arabica [arabica coffee]
emb|CBI26445.3|  unnamed protein product                                273   4e-85   Vitis vinifera
ref|XP_010426963.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      277   5e-85   Camelina sativa [gold-of-pleasure]
dbj|BAE71252.1|  putative phenylalanine ammonia lyase                   276   5e-85   Trifolium pratense [peavine clover]
ref|XP_010067317.1|  PREDICTED: phenylalanine ammonia-lyase-like        276   5e-85   Eucalyptus grandis [rose gum]
dbj|BAF36972.1|  phenylalanine ammonia-lyase                            276   5e-85   Lotus japonicus
gb|AIL23235.1|  phenylalanine ammonia-lyase                             276   5e-85   Astragalus chrysochlorus
gb|KDO50673.1|  hypothetical protein CISIN_1g005031mg                   276   5e-85   Citrus sinensis [apfelsine]
sp|P45729.1|PAL3_PETCR  RecName: Full=Phenylalanine ammonia-lyase 3     276   5e-85   Petroselinum crispum
ref|XP_006428759.1|  hypothetical protein CICLE_v10011175mg             276   6e-85   Citrus clementina [clementine]
sp|Q43052.1|PAL2_POPKI  RecName: Full=Phenylalanine ammonia-lyase...    276   6e-85   Populus sieboldii x Populus grandidentata
gb|AAC18870.1|  phenylalanine ammonia lyase                             276   7e-85   Arabidopsis thaliana [mouse-ear cress]
ref|NP_181241.1|  phenylalanine ammonia-lyase 1                         276   7e-85   Arabidopsis thaliana [mouse-ear cress]
gb|ADN32768.1|  phenylalanine ammonia-lyase 2                           276   8e-85   Scutellaria baicalensis [Baikal skullcap]
ref|XP_008463969.1|  PREDICTED: phenylalanine ammonia-lyase-like        276   8e-85   Cucumis melo [Oriental melon]
gb|AFF60415.1|  phenylalanine ammonia lyase                             274   8e-85   Pyrus pyrifolia [sha li]
gb|AAC18871.1|  phenylalanine ammonia lyase                             276   8e-85   Arabidopsis thaliana [mouse-ear cress]
sp|Q42858.1|PAL2_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       276   8e-85   Ipomoea batatas [batate]
gb|AHY94892.1|  phenylalanine ammonia lyase                             276   8e-85   Prunella vulgaris
ref|XP_011041025.1|  PREDICTED: phenylalanine ammonia-lyase G2B         276   9e-85   
ref|XP_004234632.2|  PREDICTED: phenylalanine ammonia-lyase             276   9e-85   
ref|XP_008449235.1|  PREDICTED: phenylalanine ammonia-lyase-like        275   1e-84   
gb|AEA72280.1|  phenylalanine ammonia-lyase                             275   1e-84   
gb|AAZ29735.1|  phenylalanine ammonia lyase                             276   1e-84   
gb|ACT32033.1|  phenylalanine ammonia-lyase                             276   1e-84   
ref|XP_006410883.1|  hypothetical protein EUTSA_v10016314mg             276   1e-84   
gb|AHA42443.1|  phenylalanine ammonia lyase                             275   1e-84   
sp|P27991.1|PAL1_SOYBN  RecName: Full=Phenylalanine ammonia-lyase 1     275   1e-84   
gb|AHJ60264.1|  phenylalanine ammonia-lyase 1                           275   1e-84   
gb|AGU91428.1|  phenylalanine ammonia-lyase                             275   1e-84   
ref|XP_006424538.1|  hypothetical protein CICLE_v10027913mg             275   1e-84   
ref|XP_002881488.1|  hypothetical protein ARALYDRAFT_482690             276   1e-84   
ref|XP_006354336.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    275   2e-84   
sp|P45728.1|PAL2_PETCR  RecName: Full=Phenylalanine ammonia-lyase 2     275   2e-84   
sp|P24481.1|PAL1_PETCR  RecName: Full=Phenylalanine ammonia-lyase 1     275   2e-84   
ref|XP_010505261.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      275   2e-84   
gb|AJO53272.1|  phenylalanine ammonia-lyase                             275   2e-84   
gb|AAZ29732.1|  phenylalanine ammonia lyase                             275   2e-84   
gb|AAQ74878.1|  phenylalanine ammonia lyase                             275   2e-84   
sp|P31426.1|PAL2_SOLTU  RecName: Full=Phenylalanine ammonia-lyase 2     272   2e-84   
gb|AAZ29734.1|  phenylalanine ammonia lyase                             275   2e-84   
gb|KFK36594.1|  hypothetical protein AALP_AA4G144000                    275   2e-84   
ref|XP_003542541.1|  PREDICTED: phenylalanine ammonia-lyase class...    275   2e-84   
ref|XP_006403711.1|  hypothetical protein EUTSA_v10010153mg             275   2e-84   
dbj|BAF36974.1|  phenylalanine ammonia-lyase                            274   3e-84   
gb|ABE03772.1|  phenylalanine ammonia-lyase                             275   3e-84   
gb|AAY82486.1|  phenylalanine ammonia-lyase                             272   3e-84   
ref|XP_003590471.1|  Phenylalanine ammonia-lyase                        274   3e-84   
prf||2006271A  Phe ammonia lyase                                        275   3e-84
sp|Q42667.1|PALY_CITLI  RecName: Full=Phenylalanine ammonia-lyase       275   4e-84   
gb|ABQ63094.1|  phenylalanine ammonia-lyase                             274   4e-84   
gb|ACT53398.1|  phenylalanine ammonia-lyase 1                           274   4e-84   
gb|AGW27206.1|  phenylalanine ammonia-lyase 3                           275   4e-84   
ref|XP_010509401.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      274   5e-84   
ref|XP_008387584.1|  PREDICTED: phenylalanine ammonia-lyase 1           274   5e-84   
gb|AIY26016.1|  PAL                                                     274   5e-84   
ref|XP_010516949.1|  PREDICTED: phenylalanine ammonia-lyase 1           274   6e-84   
gb|ACA30407.1|  phenylalanine ammonia-lyase                             274   6e-84   
ref|NP_001236956.1|  phenylalanine ammonia-lyase 2                      274   7e-84   
ref|XP_004145752.1|  PREDICTED: phenylalanine ammonia-lyase-like        273   7e-84   
gb|ADC34597.1|  phenylalanine ammonia-lyase                             273   8e-84   
gb|AGL50914.1|  phenylalanine ammonia lyase                             273   8e-84   
ref|XP_009342990.1|  PREDICTED: phenylalanine ammonia-lyase 1           273   8e-84   
dbj|BAF36968.1|  phenylalanine ammonia-lyase                            273   9e-84   
gb|ADQ28104.1|  phenylalanine ammonia-lyase                             273   1e-83   
ref|XP_004304440.1|  PREDICTED: phenylalanine ammonia-lyase 1           273   1e-83   
ref|XP_010529727.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      273   1e-83   
sp|P31425.1|PAL1_SOLTU  RecName: Full=Phenylalanine ammonia-lyase 1     273   1e-83   
gb|ABL14039.1|  phenylalanine ammonia lyase                             260   1e-83   
gb|AGE10589.1|  phenylalanine amononia-lyase                            273   2e-83   
ref|XP_006293761.1|  hypothetical protein CARUB_v10022721mg             273   2e-83   
dbj|BAF36971.1|  phenylalanine ammonia-lyase                            273   2e-83   
gb|ACT68010.1|  phenylalanine ammonia-lyase                             273   2e-83   
dbj|BAF36970.1|  phenylalanine ammonia-lyase                            272   2e-83   
gb|KEH24018.1|  phenylalanine ammonia-lyase-like protein                272   3e-83   
gb|AHZ31605.1|  phenylalanine ammonia-lyase                             272   3e-83   
gb|AFG30054.1|  phenylalanine ammonialyase                              272   3e-83   
ref|XP_004497516.1|  PREDICTED: phenylalanine ammonia-lyase-like        272   3e-83   
ref|XP_007144370.1|  hypothetical protein PHAVU_007G150500g             272   3e-83   
ref|XP_006488063.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      272   3e-83   
gb|ADA72014.1|  phenylalanine ammonia-lyase                             271   3e-83   
gb|AFZ78653.1|  phenylalanine ammonia-lyase                             271   4e-83   
gb|EYU38541.1|  hypothetical protein MIMGU_mgv1a001582mg                273   4e-83   
sp|O23865.1|PAL1_DAUCA  RecName: Full=Phenylalanine ammonia-lyase 1     271   4e-83   
gb|KEH24019.1|  phenylalanine ammonia-lyase-like protein                271   5e-83   
ref|XP_002529414.1|  Phenylalanine ammonia-lyase, putative              271   5e-83   
ref|XP_006354338.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    271   5e-83   
gb|AAK15640.1|AF326116_1  phenylalanine ammonia-lyase                   271   6e-83   
ref|XP_007162756.1|  hypothetical protein PHAVU_001G177800g             271   7e-83   
ref|XP_006481493.1|  PREDICTED: phenylalanine ammonia-lyase-like        271   7e-83   
ref|XP_007220629.1|  hypothetical protein PRUPE_ppa002328mg             269   8e-83   
ref|XP_007016787.1|  PHE ammonia lyase 1                                271   9e-83   
ref|XP_010543544.1|  PREDICTED: phenylalanine ammonia-lyase 4           271   1e-82   
ref|XP_004156289.1|  PREDICTED: phenylalanine ammonia-lyase-like        270   1e-82   
sp|P19142.1|PAL2_PHAVU  RecName: Full=Phenylalanine ammonia-lyase...    270   1e-82   
gb|AFP86474.1|  phenylalanine ammonia-lyase                             271   2e-82   
ref|XP_011041027.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    270   2e-82   
ref|XP_006428758.1|  hypothetical protein CICLE_v10011134mg             270   2e-82   
ref|XP_008355619.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    270   2e-82   
ref|XP_008369679.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      270   3e-82   
ref|XP_004171092.1|  PREDICTED: phenylalanine ammonia-lyase-like        269   3e-82   
gb|ADD12041.1|  phenylalanine ammonia lyase                             269   3e-82   
gb|AGL81344.1|  phenylalanine ammonia lyase                             269   3e-82   
gb|AGE10590.1|  phenylalanine amononia-lyase                            269   3e-82   
ref|XP_007220630.1|  hypothetical protein PRUPE_ppa002328mg             268   3e-82   
gb|AAX84839.1|  phenylalanine ammonia-lyase                             269   3e-82   
emb|CDP07088.1|  unnamed protein product                                265   3e-82   
ref|XP_007143727.1|  hypothetical protein PHAVU_007G096300g             269   4e-82   
gb|KGN48167.1|  hypothetical protein Csa_6G446290                       269   4e-82   
gb|KHN02334.1|  Phenylalanine ammonia-lyase 1                           266   5e-82   
gb|AGZ59813.1|  phenylalanine ammonia lyase                             265   7e-82   
gb|AAD45384.1|  phenylalanine ammonia-lyase                             267   7e-82   
gb|AEJ88223.1|  phenylalanine ammonia lyase                             268   7e-82   
gb|ADN32766.1|  phenylalanine ammonia-lyase                             268   8e-82   
ref|XP_008233304.1|  PREDICTED: phenylalanine ammonia-lyase 1           268   8e-82   
ref|XP_004149916.1|  PREDICTED: phenylalanine ammonia-lyase-like        268   1e-81   
gb|AAR19393.1|  phenylalanine ammonia-lyase                             267   1e-81   
gb|ABB70117.2|  phenylalanine ammonia lyase                             268   1e-81   
gb|AHZ30594.1|  phenylalanine ammonia lyase-2                           267   2e-81   
emb|CBI16336.3|  unnamed protein product                                262   2e-81   
dbj|BAF36967.1|  phenylalanine ammonia-lyase                            268   2e-81   
gb|AFP24940.1|  phenylalanine ammonia lyase                             267   2e-81   
gb|ADF59061.1|  phenylalanine ammonia-lyase 1 precursor                 267   2e-81   
ref|XP_008805217.1|  PREDICTED: phenylalanine ammonia-lyase             267   2e-81   
ref|XP_008243955.1|  PREDICTED: phenylalanine ammonia-lyase 1           267   2e-81   
ref|XP_007208432.1|  hypothetical protein PRUPE_ppa002099mg             267   2e-81   
sp|O64963.1|PAL1_PRUAV  RecName: Full=Phenylalanine ammonia-lyase 1     267   2e-81   
gb|AHG06397.1|  phenylalanine ammonia lyase 62                          266   3e-81   
gb|AHG06396.1|  phenylalanine ammonia lyase 2                           266   3e-81   
emb|CAB42793.1|  phenylalanine-ammonia lyase                            266   4e-81   
gb|KHN00850.1|  Phenylalanine ammonia-lyase 2                           264   5e-81   
gb|ABL14040.1|  phenylalanine ammonia lyase                             253   6e-81   
gb|AGE10591.1|  phenylalanine amononia-lyase                            265   6e-81   
gb|AFG26322.1|  phenylalanine ammonia-lyase                             265   7e-81   
gb|AGZ59814.1|  phenylalanine ammonia lyase                             262   8e-81   
ref|NP_001266106.1|  phenylalanine ammonia-lyase 2                      266   8e-81   
gb|ACG56647.1|  phenylalanine ammonia lyase                             265   8e-81   
emb|CAB42794.1|  phenylalanine-ammonia lyase                            265   1e-80   
sp|Q04593.1|PAL2_PEA  RecName: Full=Phenylalanine ammonia-lyase 2       265   1e-80   
ref|XP_008366650.1|  PREDICTED: phenylalanine ammonia-lyase 1           265   1e-80   
pdb|1W27|A  Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petro...    265   1e-80   
gb|ACG56648.1|  phenylalanine ammonia lyase                             265   1e-80   
gb|AGA84059.1|  phenylalanine ammonia lyase                             265   1e-80   
ref|XP_009399473.1|  PREDICTED: phenylalanine ammonia-lyase             265   2e-80   
dbj|BAM28964.1|  phenylalanine ammonia lyase                            265   2e-80   
gb|KHN17149.1|  Phenylalanine ammonia-lyase 2                           263   2e-80   
gb|AHB18376.1|  phenylalanine ammonia-lyase 4                           263   2e-80   
ref|XP_008456500.1|  PREDICTED: phenylalanine ammonia-lyase G4          265   2e-80   
ref|XP_006358655.1|  PREDICTED: phenylalanine ammonia-lyase-like        265   2e-80   
sp|Q01861.1|PAL1_PEA  RecName: Full=Phenylalanine ammonia-lyase 1       265   2e-80   
prf||2001451A  Phe ammonia lyase                                        265   2e-80
gb|AGO01927.1|  phenylalanine ammonia-lyase 4                           260   3e-80   
gb|ADF59062.1|  phenylalanine ammonia-lyase 2 precursor                 264   4e-80   
dbj|BAB19128.1|  phenylalanine ammonia-lyase                            261   4e-80   
gb|AHB18375.1|  phenylalanine ammonia-lyase 3                           262   5e-80   
gb|AEZ01784.1|  phenylalanine ammonia-lyase                             263   5e-80   
ref|XP_009392118.1|  PREDICTED: phenylalanine ammonia-lyase-like        263   9e-80   
ref|XP_009373523.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    263   1e-79   
ref|XP_010107518.1|  Phenylalanine ammonia-lyase                        263   2e-79   
ref|XP_010935894.1|  PREDICTED: phenylalanine ammonia-lyase             261   3e-79   
ref|XP_010482945.1|  PREDICTED: phenylalanine ammonia-lyase 4-like      261   3e-79   
ref|XP_009401948.1|  PREDICTED: phenylalanine ammonia-lyase-like        261   5e-79   
dbj|BAG70992.1|  phenylalanine ammonia-lyase                            261   5e-79   
ref|XP_003591877.1|  Phenylalanine ammonia-lyase                        261   5e-79   
sp|P27990.1|PALY_MEDSA  RecName: Full=Phenylalanine ammonia-lyase       260   8e-79   
ref|XP_002315309.2|  hypothetical protein POPTR_0010s23110g             260   9e-79   
ref|XP_010464706.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    259   9e-79   
gb|KFK38414.1|  hypothetical protein AALP_AA3G110100                    260   1e-78   
gb|KFK38413.1|  hypothetical protein AALP_AA3G110100                    259   1e-78   
ref|NP_187645.1|  phenylalanine ammonia-lyase 4                         259   1e-78   
ref|XP_009421282.1|  PREDICTED: phenylalanine ammonia-lyase-like        259   1e-78   
ref|XP_006297083.1|  hypothetical protein CARUB_v10013086mg             259   1e-78   
dbj|BAM28963.1|  phenylalanine ammonia lyase                            259   2e-78   
ref|XP_009384657.1|  PREDICTED: phenylalanine ammonia-lyase-like        259   2e-78   
gb|ADA72013.1|  phenylalanine ammonia-lyase                             259   2e-78   
gb|AGZ59815.1|  phenylalanine ammonia lyase                             256   2e-78   
gb|AGO01926.1|  phenylalanine ammonia-lyase 3                           255   2e-78   
gb|AGO01924.1|  phenylalanine ammonia-lyase 1                           255   3e-78   
gb|AGO01925.1|  phenylalanine ammonia-lyase 2                           255   3e-78   
ref|XP_004143260.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    256   3e-78   
ref|XP_010031967.1|  PREDICTED: phenylalanine ammonia-lyase-like        259   3e-78   
sp|P45731.1|PAL1_POPKI  RecName: Full=Phenylalanine ammonia-lyase G1    258   3e-78   
gb|AAU08174.1|  phenylalanine ammonia-lyase                             258   4e-78   
ref|XP_002454199.1|  hypothetical protein SORBIDRAFT_04g026520          258   4e-78   
gb|ACZ44834.1|  phenylalanine ammonia-lyase                             258   4e-78   
gb|AFW72411.1|  phenylalanine ammonia-lyase                             258   5e-78   
gb|AAN32867.1|AF460204_1  phenylalanine ammonia-lyase 2                 256   5e-78   
ref|XP_008785254.1|  PREDICTED: phenylalanine ammonia-lyase-like        258   5e-78   
gb|AAP34199.1|  phenylalanine ammonia-lyase                             258   5e-78   
ref|XP_002882662.1|  hypothetical protein ARALYDRAFT_897210             258   5e-78   
gb|AHC29062.1|  phenylalanine ammonia lyase                             255   6e-78   
ref|NP_001053326.1|  Os04g0518400                                       258   6e-78   
gb|AIC66437.1|  phenylalanine ammonia lyase                             258   7e-78   
gb|ACZ36441.1|  phenylalanine ammonialyase                              258   7e-78   
ref|XP_004173912.1|  PREDICTED: phenylalanine ammonia-lyase-like        244   8e-78   
ref|XP_004307376.1|  PREDICTED: phenylalanine ammonia-lyase 1           258   8e-78   
dbj|BAF36976.1|  phenylalanine ammonia-lyase                            258   8e-78   
emb|CAA53733.1|  phenylanaline ammonia-lyase                            255   9e-78   
gb|ADQ39192.1|  phenylalanine ammonia lyase 6                           258   9e-78   
ref|XP_006407581.1|  hypothetical protein EUTSA_v10020168mg             257   1e-77   
gb|ACM61988.1|  phenylalanine ammonia-lyase                             257   1e-77   
ref|XP_006407580.1|  hypothetical protein EUTSA_v10020168mg             257   1e-77   
gb|AGZ95689.1|  phenylalanine ammonia-lyase                             257   1e-77   
sp|Q42609.1|PALY_BROFI  RecName: Full=Phenylalanine ammonia-lyase       256   3e-77   
gb|AID51446.1|  phenylalanine ammonia-lyase 3                           256   3e-77   
gb|EMS62198.1|  Phenylalanine ammonia-lyase                             255   4e-77   
ref|XP_004953154.1|  PREDICTED: phenylalanine ammonia-lyase-like        256   5e-77   
sp|Q9M568.1|PAL1_RUBID  RecName: Full=Phenylalanine ammonia-lyase...    255   5e-77   
dbj|BAM28967.1|  phenylalanine ammonia lyase                            255   6e-77   
dbj|BAJ87394.1|  predicted protein                                      255   6e-77   
gb|KHN39030.1|  Phenylalanine ammonia-lyase class 2                     253   6e-77   
gb|EMT07759.1|  Phenylalanine ammonia-lyase                             255   6e-77   
emb|CAA89007.1|  phenylalanine ammonia-lyase                            251   7e-77   
gb|AGZ59812.1|  phenylalanine ammonia lyase                             252   7e-77   
ref|NP_001047483.2|  Os02g0626600                                       255   7e-77   
gb|AHC29063.1|  phenylalanine ammonia lyase                             252   7e-77   
ref|NP_001168086.1|  phenylalanine ammonia-lyase                        255   8e-77   
gb|ACM45589.1|  phenylalanine ammonia-lyase                             255   9e-77   
gb|EAY86765.1|  hypothetical protein OsI_08145                          255   9e-77   
ref|XP_010934327.1|  PREDICTED: phenylalanine ammonia-lyase-like        254   9e-77   
gb|ACZ44833.1|  phenylalanine ammonia-lyase                             254   1e-76   
ref|XP_007143725.1|  hypothetical protein PHAVU_007G096100g             254   1e-76   
emb|CDY00922.1|  BnaC05g42780D                                          254   1e-76   
gb|EYU39613.1|  hypothetical protein MIMGU_mgv1a019971mg                254   1e-76   
sp|P45727.1|PALY_PERAE  RecName: Full=Phenylalanine ammonia-lyase       252   1e-76   
ref|XP_008645952.1|  PREDICTED: phenylalanine ammonia-lyase             254   2e-76   
ref|NP_001047482.1|  Os02g0626400                                       254   2e-76   
ref|XP_003575400.1|  PREDICTED: phenylalanine ammonia-lyase-like        254   2e-76   
ref|XP_006647543.1|  PREDICTED: phenylalanine ammonia-lyase-like        253   3e-76   
sp|P14166.1|PAL1_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       253   3e-76   
dbj|BAM28966.1|  phenylalanine ammonia lyase                            253   3e-76   
ref|XP_006652523.1|  PREDICTED: phenylalanine ammonia-lyase-like        253   3e-76   
gb|AAR24505.1|  phenylalanine ammonia-lyase                             253   3e-76   
gb|ACM16588.1|  phenylalanine ammonia-lyase                             253   4e-76   
ref|NP_001151482.1|  phenylalanine ammonia-lyase                        253   4e-76   
dbj|BAJ87762.1|  predicted protein                                      253   4e-76   
ref|XP_010906526.1|  PREDICTED: phenylalanine ammonia-lyase-like        253   4e-76   
gb|EMS63272.1|  Phenylalanine ammonia-lyase                             251   4e-76   
ref|NP_001147433.1|  phenylalanine ammonia-lyase                        253   5e-76   
ref|XP_006647544.1|  PREDICTED: phenylalanine ammonia-lyase-like        253   5e-76   



>gb|KHG04887.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=728

 Score =   302 bits (773),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA+ DWV+ GM+ GT+SYGVTTGFGATS RRTKQGAALQKELIR LNAG+FGNG E 
Sbjct  100  AGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFGNGTES  159

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL 
Sbjct  160  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLV  219

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG++LDAEEAFR AGI+SGFF L PKE LA+ NGTA GS 
Sbjct  220  PLSYIAGLLTGRPNSKAVGPNGESLDAEEAFRVAGIDSGFFVLQPKEGLALVNGTAVGSG  279

Query  541  LACMVLYEANI  573
            LA MVL+EANI
Sbjct  280  LASMVLFEANI  290



>gb|KJB16792.1| hypothetical protein B456_002G248000 [Gossypium raimondii]
Length=721

 Score =   301 bits (772),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA+ DWV+ GM+ GT+SYGVTTGFGATS RRTKQGAALQKELIR LNAG+FGNG E 
Sbjct  93   AGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFGNGTES  152

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL 
Sbjct  153  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLV  212

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG++LDAEEAFR AGI+SGFF L PKE LA+ NGTA GS 
Sbjct  213  PLSYIAGLLTGRPNSKAVGPNGESLDAEEAFRVAGIDSGFFVLQPKEGLALVNGTAVGSG  272

Query  541  LACMVLYEANI  573
            LA MVL+EANI
Sbjct  273  LASMVLFEANI  283



>gb|AER12109.1| PAL [Gossypium hirsutum]
Length=721

 Score =   301 bits (772),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA+ DWV+ GM+ GT+SYGVTTGFGATS RRTKQGAALQKELIR LNAG+FGNG E 
Sbjct  93   AGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFGNGTES  152

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL 
Sbjct  153  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLV  212

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG++LDAEEAFR AGI+SGFF L PKE LA+ NGTA GS 
Sbjct  213  PLSYIAGLLTGRPNSKAVGPNGESLDAEEAFRVAGIDSGFFVLQPKEGLALVNGTAVGSG  272

Query  541  LACMVLYEANI  573
            LA MVL+EANI
Sbjct  273  LASMVLFEANI  283



>gb|AGY49231.1| phenylalanine ammonia lyase [Ricinus communis]
Length=714

 Score =   301 bits (770),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  86   AGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTES  145

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGTITASGDL 
Sbjct  146  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLV  205

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GPNG+++DA EAFR AGIESGFF L PKE LA+ NGTA GS 
Sbjct  206  PLSYIAGLLTGRPNSKAIGPNGESMDALEAFRLAGIESGFFELQPKEGLALVNGTAVGSG  265

Query  541  LACMVLYEANI  573
            LA MVL+EANI
Sbjct  266  LASMVLFEANI  276



>ref|XP_002519521.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF42935.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=714

 Score =   301 bits (770),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  86   AGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTES  145

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGTITASGDL 
Sbjct  146  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLV  205

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GPNG+++DA EAFR AGIESGFF L PKE LA+ NGTA GS 
Sbjct  206  PLSYIAGLLTGRPNSKAIGPNGESMDALEAFRLAGIESGFFELQPKEGLALVNGTAVGSG  265

Query  541  LACMVLYEANI  573
            LA MVL+EANI
Sbjct  266  LASMVLFEANI  276



>emb|CAB97358.1| phenylalanine ammonia-lyase [Juglans nigra]
Length=285

 Score =   287 bits (735),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  ++NGT+SYGVTTGFGATS RRTKQG ALQKELIR LN+G+FGNG E 
Sbjct  46   AGVKASSDWVMNSVNNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNSGIFGNGTES  105

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FE++EAI  L+NHN+TP LPLRGTI+ASGDL 
Sbjct  106  CHTLPHSATRAAMLVRINTLLQGYSGIRFEVMEAIAKLINHNVTPCLPLRGTISASGDLV  165

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+ GR NSKAVGPNG++LDA +AF+ AGI+ GFF L PKE LA+ NGTA GS 
Sbjct  166  PLSYIAGLLIGRPNSKAVGPNGESLDAAKAFQLAGIDGGFFELQPKEGLALVNGTAVGSG  225

Query  541  LACMVLYEANI  573
            LA MVL+EANI
Sbjct  226  LASMVLFEANI  236



>gb|KJB62426.1| hypothetical protein B456_009G416300 [Gossypium raimondii]
Length=721

 Score =   300 bits (769),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA+ DWV+ GM+ GT+SYGVTTGFGATS RRTKQGAALQKELIR LNAG+FGNG E 
Sbjct  93   AGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFGNGIES  152

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHN+TP LPLRGTITASGDL 
Sbjct  153  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNVTPCLPLRGTITASGDLV  212

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+ LDA+EAF  AGI+SGFF L PKE LA+ NGTA GS 
Sbjct  213  PLSYIAGLLTGRPNSKAVGPNGEPLDAQEAFHVAGIDSGFFVLQPKEGLALVNGTAVGSG  272

Query  541  LACMVLYEANI  573
            LA MVL+EANI
Sbjct  273  LASMVLFEANI  283



>dbj|BAA31258.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=319

 Score =   288 bits (738),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGV A+++WVM  M  GT+SYGVTTGFGATS RRTKQG ALQKELI+ LNAG+FGNG E 
Sbjct  82   AGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIKFLNAGIFGNGRES  141

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGT+TASGDL 
Sbjct  142  CHTLPHSTTRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTVTASGDLV  201

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP+G+ ++AEEAF+ AGIESGFF L PKE LA+ NGTA GS 
Sbjct  202  PLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGLALVNGTAVGSG  261

Query  541  LACMVLYEANI  573
            LA +VL+E N+
Sbjct  262  LASVVLFETNV  272



>ref|XP_006345786.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=707

 Score =   300 bits (768),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM GM NGT+SYGVTTGFGATS RRTKQGAALQKELIR LNAG+FGNG E 
Sbjct  85   AGVKASSDWVMEGMRNGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGVFGNGTES  144

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CH L HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL 
Sbjct  145  CHMLPHSTTRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLV  204

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGRTNSKA GPNG+ LDA  AF+RAGIESGFF L PKE LA+ NGTA GS 
Sbjct  205  PLSYIAGLLTGRTNSKATGPNGELLDAVNAFQRAGIESGFFELQPKEGLALVNGTAVGSG  264

Query  541  LACMVLYEANI  573
            LA MVL+EANI
Sbjct  265  LASMVLFEANI  275



>gb|AFN85669.1| phenylalanine ammonia-lyase [Hibiscus cannabinus]
Length=715

 Score =   300 bits (767),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA+ DWV+ GM+ GT+SYGVTTGFGATS RRT QGAALQKELIR LNAG+FGNG E 
Sbjct  87   AGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTNQGAALQKELIRFLNAGIFGNGTES  146

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNH ITP LPLRGTITASGDL 
Sbjct  147  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHGITPCLPLRGTITASGDLV  206

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+ LDA+EAFR AGI+SGFF L PKE LA+ NGTA GS 
Sbjct  207  PLSYIAGLLTGRPNSKAVGPNGEPLDAQEAFRLAGIDSGFFVLQPKESLALVNGTAVGSG  266

Query  541  LACMVLYEANI  573
            LA MVL+EANI
Sbjct  267  LASMVLFEANI  277



>dbj|BAF96940.1| phenylalanine ammonia lyase [Nicotiana tabacum]
Length=410

 Score =   290 bits (742),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FGNG E 
Sbjct  39   AGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGVFGNGTES  98

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL  S T+AA+LVRINTLLQGY  I+FEILEAIT LLNHN+TP LPLRGTITASGDL 
Sbjct  99   CHTLPQSGTRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNVTPCLPLRGTITASGDLV  158

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GPNG+ L+AEEAFR AG+ SGFF L PKE LA+ NGTA GS 
Sbjct  159  PLSYIAGLLTGRPNSKAIGPNGETLNAEEAFRVAGVNSGFFELQPKEGLALVNGTAVGSG  218

Query  541  LACMVLYEANI  573
            LA MVL++ANI
Sbjct  219  LASMVLFDANI  229



>gb|KHG18863.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=720

 Score =   298 bits (762),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA+ DWV+ GM+ GT+SYGVTTGFGATS RRTKQGAALQKELIR LNAG+FG+G E 
Sbjct  92   AGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFGHGTES  151

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT L+N NITP LPLRGTITASGDL 
Sbjct  152  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNITPCLPLRGTITASGDLV  211

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+ LDAEEAFR AGI+SGFF L PKE LA+ NGTA GS 
Sbjct  212  PLSYIAGLLTGRPNSKAVGPNGEPLDAEEAFRVAGIDSGFFVLQPKEGLALVNGTAVGSG  271

Query  541  LACMVLYEANI  573
            +A MVL+EANI
Sbjct  272  MASMVLFEANI  282



>gb|KJB36583.1| hypothetical protein B456_006G166000 [Gossypium raimondii]
Length=720

 Score =   297 bits (761),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA+ DWV+ GM+ GT+SYGVTTGFGATS RRTKQGAALQKELIR LNAG+FG+G E 
Sbjct  92   AGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGVFGHGTES  151

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT L+N NITP LPLRGTITASGDL 
Sbjct  152  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNITPCLPLRGTITASGDLV  211

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+ LDAEEAFR AGI+SGFF L PKE LA+ NGTA GS 
Sbjct  212  PLSYIAGLLTGRPNSKAVGPNGEPLDAEEAFRVAGIDSGFFVLQPKEGLALVNGTAVGSG  271

Query  541  LACMVLYEANI  573
            +A MVL+EANI
Sbjct  272  MASMVLFEANI  282



>ref|XP_007027354.1| PHE ammonia lyase 1 [Theobroma cacao]
 gb|EOY07856.1| PHE ammonia lyase 1 [Theobroma cacao]
Length=722

 Score =   297 bits (761),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA+ DWV+ GM+ GT+SYGVTTGFGATS RRTKQGAALQKELIR LNAG+FGNG E 
Sbjct  94   AGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFGNGTES  153

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGTITASGDL 
Sbjct  154  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLV  213

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP G++LDA+EAF  AGI++GFF L PKE LA+ NGTA GS 
Sbjct  214  PLSYIAGLLTGRPNSKAVGPKGESLDAQEAFCVAGIDTGFFVLQPKEGLALVNGTAVGSG  273

Query  541  LACMVLYEANI  573
            LA MVL+EANI
Sbjct  274  LASMVLFEANI  284



>gb|KHG29664.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=721

 Score =   296 bits (759),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA+ DWV+ GM+ GT+SYGVTTGFGATS RRTKQGAALQKELIR LNAG+FGNG E 
Sbjct  93   AGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFGNGIES  152

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHN+TP LPLRGTITASGDL 
Sbjct  153  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNVTPCLPLRGTITASGDLV  212

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPN + LDA+EAF  AGI SGFF L PKE LA+ NGTA GS 
Sbjct  213  PLSYIAGLLTGRPNSKAVGPNEEPLDAQEAFHVAGINSGFFVLQPKEGLALVNGTAVGSG  272

Query  541  LACMVLYEANI  573
            LA MVL+EANI
Sbjct  273  LASMVLFEANI  283



>gb|AAK60275.1|AF383152_1 phenylalanine ammonia-lyase 2 [Manihot esculenta]
Length=712

 Score =   296 bits (758),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTKQG ALQ+ELIR LNAG+FGN  E 
Sbjct  84   AGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGALQRELIRFLNAGIFGNKTES  143

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL+HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGTITASGDL 
Sbjct  144  CHTLSHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLV  203

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG++LDA++AF  AGI+SGFF L PKE LA+ NGTA GS 
Sbjct  204  PLSYIAGLLTGRPNSKAVGPNGESLDAQQAFHSAGIDSGFFELQPKEGLALVNGTAVGSG  263

Query  541  LACMVLYEANI  573
            LA MVL+EAN+
Sbjct  264  LASMVLFEANV  274



>ref|XP_009606373.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana tomentosiformis]
Length=717

 Score =   296 bits (758),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM GM+ GT+SYGVTTGFGATS RRTKQGAALQKELIR LNAG+FGNG E 
Sbjct  89   AGVKASSDWVMEGMNKGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFGNGTES  148

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN NITP LPLRGTITASGDL 
Sbjct  149  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNSNITPCLPLRGTITASGDLV  208

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA GP+G+ LDA +AF+RAGIE+GFF L PKE LA+ NGTA GS 
Sbjct  209  PLSYIAGLLTGRPNSKATGPDGELLDAVQAFQRAGIETGFFELQPKEGLALVNGTAVGSG  268

Query  541  LACMVLYEANI  573
            +A MVL+EANI
Sbjct  269  MASMVLFEANI  279



>gb|ABI93975.1| putative phenylalanine ammonia-lyase, partial [Rhizophora mangle]
Length=579

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM GM  GT+SYGVTTGFGATS RRTKQG+ALQ+ELIR LNAG+FG+G + 
Sbjct  90   AGVKASSDWVMDGMTKGTDSYGVTTGFGATSHRRTKQGSALQRELIRFLNAGIFGHGTDS  149

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL H+ T+AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGTITASGDL 
Sbjct  150  CHTLPHAATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLI  209

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GP+G +L+A EAFR AGIESGFF L PKE LA+ NGTA GS 
Sbjct  210  PLSYIAGLLTGRPNSKAIGPDGQSLNAGEAFRLAGIESGFFELQPKEGLALVNGTAVGSG  269

Query  541  LACMVLYEANI  573
            LA MVL+EANI
Sbjct  270  LASMVLFEANI  280



>ref|XP_004239660.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum lycopersicum]
Length=709

 Score =   296 bits (757),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM GM NGT+SYGVTTGFGATS RRTKQGAALQKELIR LNAG+FG G E 
Sbjct  87   AGVKASSDWVMEGMRNGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGVFGKGTES  146

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL 
Sbjct  147  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLV  206

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA GPNG+ LDA  AF++AGIESGFF L PKE LA+ NGTA GS 
Sbjct  207  PLSYIAGLLTGRPNSKATGPNGELLDAINAFQQAGIESGFFELQPKEGLALVNGTAVGSG  266

Query  541  LACMVLYEANI  573
            LA MVL+EANI
Sbjct  267  LASMVLFEANI  277



>gb|ABI33979.1| phenylalanine ammonia lyase [Jatropha curcas]
Length=713

 Score =   296 bits (757),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQGAALQ+ELIR LNAG+FGNG E 
Sbjct  85   AGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGAALQRELIRFLNAGIFGNGTET  144

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGTITASGDL 
Sbjct  145  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLV  204

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GP+G++LDA EAFR A I+SGFF L PKE LA+ NGTA GS 
Sbjct  205  PLSYIAGLLTGRPNSKAIGPSGESLDAVEAFRLADIDSGFFELQPKEGLALVNGTAVGSG  264

Query  541  LACMVLYEANI  573
            LA MVL+EAN+
Sbjct  265  LASMVLFEANV  275



>ref|XP_009794410.1| PREDICTED: phenylalanine ammonia-lyase-like [Nicotiana sylvestris]
Length=717

 Score =   295 bits (756),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM GM+ GT+SYGVTTGFGATS RRTKQGAALQKELIR LNAG+FGNG E 
Sbjct  89   AGVKASSDWVMEGMNKGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFGNGTES  148

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN NITP LPLRGTITASGDL 
Sbjct  149  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNSNITPCLPLRGTITASGDLV  208

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA GP+G+ LDA ++F+RAGIE+GFF L PKE LA+ NGTA GS 
Sbjct  209  PLSYIAGLLTGRPNSKATGPDGELLDAVQSFQRAGIETGFFELQPKEGLALVNGTAVGSG  268

Query  541  LACMVLYEANI  573
            +A MVL+EANI
Sbjct  269  MASMVLFEANI  279



>gb|KHG30005.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=718

 Score =   295 bits (755),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            A VKA+ DWV+ GM+ GT+SYGVTTGFGATS RRTKQGAALQKELIR LNAG+FGNG E 
Sbjct  90   AAVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFGNGTES  149

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            C+TL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGTITASGDL 
Sbjct  150  CNTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLV  209

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP+G +L+AEEAFR AGI+SGFF L PKE LA+ NGTA GS 
Sbjct  210  PLSYIAGLLTGRPNSKAVGPDGKSLNAEEAFRVAGIDSGFFMLQPKEGLALVNGTAVGSG  269

Query  541  LACMVLYEANI  573
            LA MVL+EAN+
Sbjct  270  LASMVLFEANV  280



>gb|KJB46525.1| hypothetical protein B456_007G373600 [Gossypium raimondii]
Length=718

 Score =   295 bits (755),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            A VKA+ DWV+ GM+ GT+SYGVTTGFGATS RRTKQGAALQKELIR LNAG+FGNG E 
Sbjct  90   AAVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFGNGTES  149

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            C+TL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGTITASGDL 
Sbjct  150  CNTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLV  209

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP+G +L+AEEAFR AGI+SGFF L PKE LA+ NGTA GS 
Sbjct  210  PLSYIAGLLTGRPNSKAVGPDGKSLNAEEAFRVAGIDSGFFMLQPKEGLALVNGTAVGSG  269

Query  541  LACMVLYEANI  573
            LA MVL+EAN+
Sbjct  270  LASMVLFEANV  280



>gb|AAG49585.1|AF325496_1 phenylalanine ammonia-lyase [Ipomoea nil]
Length=711

 Score =   295 bits (754),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  83   AGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTES  142

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGTITASGDL 
Sbjct  143  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLV  202

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GLITGR NSKAVGPNG+ L+AEEA R AG+  GFF L PKE LA+ NGTA GS 
Sbjct  203  PLSYIAGLITGRPNSKAVGPNGETLNAEEALRLAGVNGGFFELQPKEGLALVNGTAVGSG  262

Query  541  LACMVLYEANI  573
            +A MVL+EAN+
Sbjct  263  MASMVLFEANV  273



>gb|KDP29132.1| hypothetical protein JCGZ_16521 [Jatropha curcas]
Length=713

 Score =   295 bits (754),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQGAALQ+ELIR LNAG+FGNG E 
Sbjct  85   AGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGAALQRELIRFLNAGIFGNGTET  144

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGTITASGDL 
Sbjct  145  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLV  204

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GP G++LDA EAF  AGI+SGFF L PKE LA+ NGTA GS 
Sbjct  205  PLSYIAGLLTGRPNSKAIGPTGESLDAVEAFCLAGIDSGFFELQPKEGLALVNGTAVGSG  264

Query  541  LACMVLYEANI  573
            LA MVL+EAN+
Sbjct  265  LASMVLFEANV  275



>emb|CDP20698.1| unnamed protein product [Coffea canephora]
Length=674

 Score =   293 bits (750),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRT QG ALQKELIR LNAG+FGNG E 
Sbjct  46   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTNQGGALQKELIRFLNAGIFGNGTET  105

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAITT LNHNITP LPLRGTITASGDL 
Sbjct  106  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITTFLNHNITPCLPLRGTITASGDLV  165

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+A +AEEAFR AG+  GFF L PKE LA+ NGTA GS 
Sbjct  166  PLSYIAGLLTGRPNSKAVGPNGEAFNAEEAFRLAGLSGGFFELQPKEGLALVNGTAVGSG  225

Query  541  LACMVLYEANI  573
            LA +VL+EAN+
Sbjct  226  LASIVLFEANV  236



>gb|AEO92028.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
 gb|AEO94540.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
Length=711

 Score =   294 bits (752),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRT QG ALQKELIR LNAG+FGNG E 
Sbjct  83   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTNQGGALQKELIRFLNAGIFGNGTET  142

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAITT LNHNITP LPLRGTITASGDL 
Sbjct  143  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITTFLNHNITPCLPLRGTITASGDLV  202

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+A +AEEAFR AG+  GFF L PKE LA+ NGTA GS 
Sbjct  203  PLSYIAGLLTGRPNSKAVGPNGEAFNAEEAFRLAGLSGGFFELQPKEGLALVNGTAVGSG  262

Query  541  LACMVLYEANI  573
            LA +VL+EAN+
Sbjct  263  LASIVLFEANV  273



>emb|CAN61378.1| hypothetical protein VITISV_032212 [Vitis vinifera]
Length=686

 Score =   293 bits (750),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  G +SYGVTTGFGATS RRTKQG ALQKELIRVLNAG+FGNG E 
Sbjct  58   AGVKASSDWVMESMKKGIDSYGVTTGFGATSHRRTKQGGALQKELIRVLNAGIFGNGRES  117

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRIN+LLQGY  I+FEILEAIT LLNHNITP LPLRGT+TASGDL 
Sbjct  118  CHTLPHSATRAAMLVRINSLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTVTASGDLV  177

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP+G+ ++AEEAF+ AGIESGFF L PKE  A+ NGTA GS 
Sbjct  178  PLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGFALVNGTAVGSG  237

Query  541  LACMVLYEANI  573
            LA MVL+E N+
Sbjct  238  LASMVLFETNV  248



>ref|XP_004143259.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 ref|XP_004156290.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=705

 Score =   293 bits (751),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FGNGAE 
Sbjct  77   AGVKASSDWVMESMKKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGIFGNGAES  136

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL+ S T+AA+LVRINTLLQGY  I+FEILEAIT LLNHN+TP LPLRGTITASGDL 
Sbjct  137  CHTLSRSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNVTPCLPLRGTITASGDLV  196

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GPN ++LDA EAF+RAGI SGFF L PKE LA+ NGTA GS 
Sbjct  197  PLSYIAGLLTGRPNSKAIGPNEESLDANEAFQRAGIPSGFFELQPKEGLALVNGTAVGSG  256

Query  541  LACMVLYEANI  573
            LA +VL+EANI
Sbjct  257  LASIVLFEANI  267



>gb|ABV26012.1| phenylalanine ammonia-lyase [Musa acuminata]
Length=501

 Score =   288 bits (736),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 161/189 (85%), Gaps = 2/189 (1%)
 Frame = +1

Query  7    VKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*CH  186
            VKA++DWVM  M+NGT+SYGVTTGFGATS RRTKQGAALQ+ELIR LNAG+FGNG E CH
Sbjct  1    VKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTKQGAALQRELIRFLNAGVFGNGTESCH  60

Query  187  TLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGPL  366
            TL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGTITASGDL PL
Sbjct  61   TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLVPL  120

Query  367  SYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRLA  546
            SYI GL+TGR NSKA GPNG+ LDA+EA +RAG   GFF L PKE LA+ NGTA GS LA
Sbjct  121  SYIAGLLTGRPNSKATGPNGETLDAKEASQRAGF--GFFELQPKEGLALVNGTAVGSGLA  178

Query  547  CMVLYEANI  573
             MVL+EANI
Sbjct  179  SMVLFEANI  187



>gb|AGH13333.1| phenylalanine ammonia-lyase [Rhus chinensis]
Length=707

 Score =   293 bits (751),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GV+A++DWVM  M+NGT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E C
Sbjct  80   GVQASSDWVMESMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTESC  139

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL HS T+AA+LVRINTLLQGY  I+F+ILEAIT  LNHNITP LPLRGTITASGDL P
Sbjct  140  HTLPHSATRAAMLVRINTLLQGYSGIRFDILEAITKFLNHNITPCLPLRGTITASGDLVP  199

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKAVGPNG  LDA EAF+ AGI SGFF L PKE LA+ NGTA GS L
Sbjct  200  LSYIAGLLTGRPNSKAVGPNGQVLDASEAFQLAGITSGFFELQPKEGLALVNGTAVGSGL  259

Query  544  ACMVLYEANI  573
            A MVL+EAN+
Sbjct  260  ASMVLFEANV  269



>ref|XP_002281799.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA++DWVM  M+ GT+SYGVTTGFGATS RRTK+G ALQKELIR LNAG+FGNG + C
Sbjct  83   GVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKEGGALQKELIRFLNAGIFGNGTDSC  142

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGTITASGDL P
Sbjct  143  HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPSLPLRGTITASGDLVP  202

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKAVGP G+ ++AEEAF+ AGIESGFF L PKE LA+ NGTA GS L
Sbjct  203  LSYIAGLLTGRPNSKAVGPTGEVVNAEEAFKMAGIESGFFELQPKEGLALVNGTAVGSGL  262

Query  544  ACMVLYEANI  573
            A MVL+EAN+
Sbjct  263  ASMVLFEANV  272



>gb|KJB46526.1| hypothetical protein B456_007G373700 [Gossypium raimondii]
Length=670

 Score =   292 bits (747),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            A VKA+ DWV+ GM+ GT+SYGVTTGFG+TS RRTKQGAALQKELIR LNAG+FGNG E 
Sbjct  42   AAVKASADWVLDGMNKGTDSYGVTTGFGSTSHRRTKQGAALQKELIRFLNAGIFGNGTES  101

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            C+TL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGTITASGDL 
Sbjct  102  CNTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLV  161

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP+G +L+AEEAFR AGI+SGFF L PKE  A+ NGTA GS 
Sbjct  162  PLSYIAGLLTGRPNSKAVGPDGKSLNAEEAFRVAGIDSGFFMLRPKEGFALVNGTAVGSG  221

Query  541  LACMVLYEANI  573
            LA MVL+EAN+
Sbjct  222  LASMVLFEANV  232



>ref|XP_010662075.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   293 bits (749),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  G +SYGVTTGFGATS RRTKQG ALQKELIRVLNAG+FGNG E 
Sbjct  82   AGVKASSDWVMESMKKGIDSYGVTTGFGATSHRRTKQGGALQKELIRVLNAGIFGNGRES  141

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRIN+LLQGY  I+FEILEAIT LLNHNITP LPLRGT+TASGDL 
Sbjct  142  CHTLPHSATRAAMLVRINSLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTVTASGDLV  201

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP+G+ ++AEEAF+ AGIESGFF L PKE  A+ NGTA GS 
Sbjct  202  PLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGFALVNGTAVGSG  261

Query  541  LACMVLYEANI  573
            LA MVL+E N+
Sbjct  262  LASMVLFETNV  272



>ref|XP_002268181.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
 ref|XP_010662070.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   293 bits (749),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGV A+++WVM  M  GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  82   AGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTES  141

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGT+TASGDL 
Sbjct  142  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTVTASGDLV  201

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP+G+ ++AEEAF+ AGIESGFF L PKE LA+ NGTA GS 
Sbjct  202  PLSYISGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGLALVNGTAVGSG  261

Query  541  LACMVLYEANI  573
            LA MVL+E N+
Sbjct  262  LASMVLFETNV  272



>emb|CAN77065.1| hypothetical protein VITISV_009233 [Vitis vinifera]
Length=707

 Score =   292 bits (748),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGV A+++WVM  M  GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  79   AGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTES  138

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGT+TASGDL 
Sbjct  139  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTVTASGDLV  198

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP+G+ ++AEEAF+ AGIESGFF L PKE LA+ NGTA GS 
Sbjct  199  PLSYIXGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGLALVNGTAVGSG  258

Query  541  LACMVLYEANI  573
            LA MVL+E N+
Sbjct  259  LASMVLFETNV  269



>sp|P45730.1|PALY_POPTR RecName: Full=Phenylalanine ammonia-lyase [Populus trichocarpa]
 pir||JQ2265 phenylalanine ammonia-lyase (EC 4.3.1.5) - western balsam poplar 
x cottonwood
 gb|AAA33805.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=715

 Score =   292 bits (748),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA++DWVM  MD GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E C
Sbjct  88   GVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTETC  147

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL P
Sbjct  148  HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITRLLNNNITPCLPLRGTITASGDLVP  207

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKA GP G+ LDA EAF+ AGIESGFF L PKE LA+ NGTA GS L
Sbjct  208  LSYIAGLLTGRPNSKATGPTGEVLDAAEAFKAAGIESGFFELQPKEGLALVNGTAVGSGL  267

Query  544  ACMVLYEANI  573
            A MVL+E N+
Sbjct  268  ASMVLFETNV  277



>gb|AEL21617.1| phenylalanine ammonia lyase 2 [Coffea arabica]
Length=711

 Score =   292 bits (747),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRT QG ALQKELIR LNAG+FGNG E 
Sbjct  83   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTNQGGALQKELIRFLNAGIFGNGTET  142

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CH L HS T+AA+LVRINTLLQGY  I+FEILEAITT LNHNITP LPLRGTITASGDL 
Sbjct  143  CHMLPHSATRAAMLVRINTLLQGYSGIRFEILEAITTFLNHNITPCLPLRGTITASGDLV  202

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+A +AEEAFR AG+  GFF L PKE LA+ NGTA GS 
Sbjct  203  PLSYIAGLLTGRPNSKAVGPNGEAFNAEEAFRLAGLSGGFFLLQPKEGLALVNGTAVGSG  262

Query  541  LACMVLYEANI  573
            LA +VL+EAN+
Sbjct  263  LASIVLFEANV  273



>ref|XP_008449236.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=705

 Score =   292 bits (747),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  77   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGVES  136

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL+ S T+AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGTITASGDL 
Sbjct  137  SHTLSRSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLV  196

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPN ++LDA EAF+RAGI SGFF L PKE LA+ NGTA GS 
Sbjct  197  PLSYIAGLLTGRPNSKAVGPNEESLDANEAFQRAGIPSGFFELQPKEGLALVNGTAVGSG  256

Query  541  LACMVLYEANI  573
            LA +VL+EANI
Sbjct  257  LASIVLFEANI  267



>ref|XP_002322884.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63887.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF04645.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=715

 Score =   292 bits (747),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA++DWVM  MD GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E C
Sbjct  88   GVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTETC  147

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL P
Sbjct  148  HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITRLLNNNITPCLPLRGTITASGDLVP  207

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKA GP G+ LDA EAF+ AGIESGFF L PKE LA+ NGTA GS L
Sbjct  208  LSYIAGLLTGRPNSKATGPTGEVLDAAEAFKAAGIESGFFELQPKEGLALVNGTAVGSGL  267

Query  544  ACMVLYEANI  573
            A MVL+E N+
Sbjct  268  ASMVLFETNV  277



>gb|ABM67591.1| phenylalanin ammonia-lyase [Vitis vinifera]
Length=710

 Score =   292 bits (747),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGV A+++WVM  M  GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  82   AGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTES  141

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGT+TASGDL 
Sbjct  142  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTVTASGDLV  201

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP+G+ ++AEEAF+ AGIESGFF L PKE LA+ NGTA GS 
Sbjct  202  PLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGLALVNGTAVGSG  261

Query  541  LACMVLYEANI  573
            LA MVL+E N+
Sbjct  262  LASMVLFETNV  272



>ref|XP_011077338.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=712

 Score =   292 bits (747),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FG G E 
Sbjct  84   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGQGTES  143

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT  LNHNITP LPLRGTITASGDL 
Sbjct  144  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNITPCLPLRGTITASGDLV  203

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+AL+AEEAF+ AG+  GFF L PKE LA+ NGTA GS 
Sbjct  204  PLSYIAGLLTGRPNSKAVGPNGEALNAEEAFKLAGVVGGFFELQPKEGLALVNGTAVGSG  263

Query  541  LACMVLYEANI  573
            LA + LYEANI
Sbjct  264  LASIALYEANI  274



>ref|XP_003633985.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGV A+++WVM  M  GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  82   AGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGRES  141

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGT+TASGDL 
Sbjct  142  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTVTASGDLV  201

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+ GR NSKAVGP+GD ++AEEAF+ AGIESGFF L PKE LA+ NGTA GS 
Sbjct  202  PLSYIAGLLIGRPNSKAVGPSGDVVNAEEAFKMAGIESGFFELQPKEGLALVNGTAVGSG  261

Query  541  LACMVLYEANI  573
            LA MVL+E N+
Sbjct  262  LASMVLFETNV  272



>gb|AAW51923.2| phenylalanine ammonia-lyase 2 [Rhizophora mangle]
Length=723

 Score =   292 bits (747),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM GM  GT+SYGVTTGFGATS RRTKQG+ALQ+ELIR LNAG+FG+G + 
Sbjct  90   AGVKASSDWVMDGMTKGTDSYGVTTGFGATSHRRTKQGSALQRELIRFLNAGIFGHGTDS  149

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL H+ T+AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGTITASGDL 
Sbjct  150  CHTLPHAATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLI  209

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GP+G +L+A EAFR AGIESGFF L PKE LA+ NGTA GS 
Sbjct  210  PLSYIAGLLTGRPNSKAIGPDGQSLNAGEAFRLAGIESGFFELQPKEGLALVNGTAVGSG  269

Query  541  LACMVLYEANI  573
            LA MVL+EANI
Sbjct  270  LASMVLFEANI  280



>ref|XP_003633987.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGV A+++WVM  M  GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  82   AGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGRES  141

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGT+TASGDL 
Sbjct  142  CHTLPHSTTRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTVTASGDLV  201

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP+G+ ++AEEAF+ AGIESGFF L PKE LA+ NGTA GS 
Sbjct  202  PLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGLALVNGTAVGSG  261

Query  541  LACMVLYEANI  573
            LA MVL+E N+
Sbjct  262  LASMVLFETNV  272



>emb|CBI26455.3| unnamed protein product [Vitis vinifera]
Length=679

 Score =   291 bits (744),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGV A+++WVM  M  GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  106  AGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGRES  165

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGT+TASGDL 
Sbjct  166  CHTLPHSTTRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTVTASGDLV  225

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP+G+ ++AEEAF+ AGIESGFF L PKE LA+ NGTA GS 
Sbjct  226  PLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGLALVNGTAVGSG  285

Query  541  LACMVLYEANI  573
            LA MVL+E N+
Sbjct  286  LASMVLFETNV  296



>ref|XP_002268256.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGV A+++WVM  M  GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  82   AGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGRES  141

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGT+TASGDL 
Sbjct  142  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTVTASGDLV  201

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP+G+ ++AEEAF+ AGIESGFF L PKE LA+ NGTA GS 
Sbjct  202  PLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGLALVNGTAVGSG  261

Query  541  LACMVLYEANI  573
            LA MVL+E N+
Sbjct  262  LASMVLFETNV  272



>ref|XP_003635657.2| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGV A+++WVM  M  GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  82   AGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGRES  141

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGT+TASGDL 
Sbjct  142  CHTLPHSTTRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTVTASGDLV  201

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP+G+ ++AEEAF+ AGIESGFF L PKE LA+ NGTA GS 
Sbjct  202  PLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGLALVNGTAVGSG  261

Query  541  LACMVLYEANI  573
            LA MVL+E N+
Sbjct  262  LASMVLFETNV  272



>ref|XP_002268732.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGV A+++WVM  M  GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  82   AGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGRES  141

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGT+TASGDL 
Sbjct  142  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTVTASGDLV  201

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP+G+ ++AEEAF+ AGIESGFF L PKE LA+ NGTA GS 
Sbjct  202  PLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGLALVNGTAVGSG  261

Query  541  LACMVLYEANI  573
            LA MVL+E N+
Sbjct  262  LASMVLFETNV  272



>ref|XP_008449237.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=717

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNGAE 
Sbjct  89   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGAES  148

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN N+TP LPLRGTITASGDL 
Sbjct  149  NHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNENVTPCLPLRGTITASGDLV  208

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GPNG+ LDAE AF++AGI SGFF L PKE LA+ NGTA GS 
Sbjct  209  PLSYIAGLLTGRPNSKAIGPNGETLDAEAAFKQAGIPSGFFELQPKEGLALVNGTAVGSG  268

Query  541  LACMVLYEANI  573
            LA +VL+EANI
Sbjct  269  LASIVLFEANI  279



>ref|XP_003633986.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGV A+++WVM  M  GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  82   AGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGRES  141

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGT+TASGDL 
Sbjct  142  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTVTASGDLV  201

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP+G+ ++AEEAF+ AGIESGFF L PKE LA+ NGTA GS 
Sbjct  202  PLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGLALVNGTAVGSG  261

Query  541  LACMVLYEANI  573
            LA MVL+E N+
Sbjct  262  LASMVLFETNV  272



>gb|AFZ78650.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=714

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +1

Query  7    VKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*CH  186
            VKA++DWVM  MD GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E CH
Sbjct  88   VKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTETCH  147

Query  187  TLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGPL  366
            TL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL PL
Sbjct  148  TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLVPL  207

Query  367  SYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRLA  546
            SYI GL+TGR NSKA GPNG+ LDA EAF+ AGI+SGFF L PKE LA+ NGTA GS LA
Sbjct  208  SYIAGLLTGRPNSKATGPNGEVLDAVEAFKAAGIDSGFFELQPKEGLALVNGTAVGSGLA  267

Query  547  CMVLYEANI  573
             MVL+E N+
Sbjct  268  SMVLFETNV  276



>ref|XP_011048535.1| PREDICTED: phenylalanine ammonia-lyase-like [Populus euphratica]
Length=714

 Score =   291 bits (744),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +1

Query  7    VKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*CH  186
            VKA++DWVM  MD GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E CH
Sbjct  88   VKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTETCH  147

Query  187  TLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGPL  366
            TL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL PL
Sbjct  148  TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLVPL  207

Query  367  SYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRLA  546
            SYI GL+TGR NSKA GPNG+ LDA EAF+ AGI+SGFF L PKE LA+ NGTA GS LA
Sbjct  208  SYIAGLLTGRPNSKATGPNGEVLDAVEAFKAAGIDSGFFELQPKEGLALVNGTAVGSGLA  267

Query  547  CMVLYEANI  573
             MVL+E N+
Sbjct  268  SMVLFETNV  276



>ref|XP_006381441.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63888.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|ERP59238.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=714

 Score =   291 bits (744),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +1

Query  7    VKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*CH  186
            VKA++DWVM  MD GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E CH
Sbjct  88   VKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTETCH  147

Query  187  TLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGPL  366
            TL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL PL
Sbjct  148  TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLVPL  207

Query  367  SYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRLA  546
            SYI GL+TGR NSKA GPNG+ LDA EAF+ AGI+SGFF L PKE LA+ NGTA GS LA
Sbjct  208  SYIAGLLTGRPNSKATGPNGEVLDAVEAFKAAGIDSGFFELQPKEGLALVNGTAVGSGLA  267

Query  547  CMVLYEANI  573
             MVL+E N+
Sbjct  268  SMVLFETNV  276



>ref|XP_004143256.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=712

 Score =   291 bits (744),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FG+GAE 
Sbjct  84   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGSGAES  143

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL 
Sbjct  144  DHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLV  203

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GPNG++LDA+EAF++AGI SGFF L PKE LA+ NGTA GS 
Sbjct  204  PLSYIAGLLTGRPNSKAIGPNGESLDAKEAFQQAGIPSGFFELQPKEGLALVNGTAVGSG  263

Query  541  LACMVLYEANI  573
            LA +VL+EANI
Sbjct  264  LASIVLFEANI  274



>ref|XP_009759945.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana sylvestris]
Length=718

 Score =   291 bits (744),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWV+ GM NGT+SYGVTTGFGATS RRTKQGAALQKELIR LNAG+FGNG E 
Sbjct  90   AGVKASSDWVIEGMKNGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFGNGTES  149

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL 
Sbjct  150  SHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLV  209

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA GPNG+ LDA +AF+ AGI++GFF L PKE LAM NGTA GS 
Sbjct  210  PLSYIAGLLTGRPNSKATGPNGELLDAVKAFQWAGIDTGFFELQPKEGLAMVNGTAVGSG  269

Query  541  LACMVLYEANI  573
            LA MVL+EANI
Sbjct  270  LASMVLFEANI  280



>gb|AEX32784.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   291 bits (744),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGV A+++WVM  M  GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  82   AGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTES  141

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGT+TASGDL 
Sbjct  142  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTVTASGDLV  201

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP+G+ ++AEEAF+ AGI+SGFF L PKE LA+ NGTA GS 
Sbjct  202  PLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIQSGFFELQPKEGLALVNGTAVGSG  261

Query  541  LACMVLYEANI  573
            LA MVL+E N+
Sbjct  262  LASMVLFETNV  272



>ref|XP_011010447.1| PREDICTED: phenylalanine ammonia-lyase [Populus euphratica]
Length=715

 Score =   291 bits (744),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 159/190 (84%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA++DWVM  MD GT+SYGVTTGFGATS RRTKQG ALQ+ELIR LNAG+FGNG E C
Sbjct  88   GVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTKQGGALQRELIRFLNAGIFGNGTETC  147

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL P
Sbjct  148  HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLVP  207

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKA GP G+ LDA EAF  AGIESGFF L PKE LA+ NGTA GS L
Sbjct  208  LSYIAGLLTGRPNSKATGPTGEVLDAAEAFEAAGIESGFFELQPKEGLALVNGTAVGSGL  267

Query  544  ACMVLYEANI  573
            A MVL+E N+
Sbjct  268  ASMVLFETNV  277



>gb|AEV53411.1| phenylalanine ammonia-lyase 3 [Populus tomentosa]
 gb|AFZ78652.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=715

 Score =   291 bits (744),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA++DWVM  MD GT+SYGVTTGFGATS RRTKQG ALQ+ELIR LNAG+FGNG E C
Sbjct  88   GVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTKQGGALQRELIRFLNAGIFGNGTETC  147

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN+N+TP LPLRGTITASGDL P
Sbjct  148  HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNVTPCLPLRGTITASGDLVP  207

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKA GP+G+ LDA EAF+ AGIESGFF L PKE LA+ NGTA GS L
Sbjct  208  LSYIAGLLTGRPNSKATGPSGEVLDAVEAFKTAGIESGFFELQPKEGLALVNGTAVGSGL  267

Query  544  ACMVLYEANI  573
            A MVL+E N+
Sbjct  268  ASMVLFETNV  277



>emb|CBI31445.3| unnamed protein product [Vitis vinifera]
Length=578

 Score =   287 bits (734),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA++DWVM  M+NGT+SYGVTTGFGATS RRTKQG ALQ ELIR LNAG+FGNG E C
Sbjct  96   GVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTKQGGALQMELIRFLNAGIFGNGTESC  155

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL HS T+A++LVRINTLLQGY  I+FEILEAIT L+NHNITP LPLRGTI+ASGDL P
Sbjct  156  HTLPHSATRASMLVRINTLLQGYSGIRFEILEAITKLINHNITPCLPLRGTISASGDLVP  215

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+ GR++ KAVGPNG+ L AEEAFR AGI+ GFF L PKE LA+ NGTA GS +
Sbjct  216  LSYIAGLLLGRSSCKAVGPNGEPLSAEEAFRVAGIKGGFFELQPKEGLALVNGTAVGSGM  275

Query  544  ACMVLYEANI  573
            A MVL+EANI
Sbjct  276  ASMVLFEANI  285



>gb|AAR31107.1| phenylalanine ammonia-lyase [Quercus suber]
Length=709

 Score =   290 bits (743),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  MD G +SYGVTTGFGATS RRTKQG ALQ+ELIR LNAG+FGNG E 
Sbjct  81   AGVKASSDWVMGSMDKGKDSYGVTTGFGATSHRRTKQGGALQRELIRFLNAGIFGNGTES  140

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL H+ T+AA+LVRINTLLQGY  I+FEI+EAIT  LNHNITP LPLRGTITASGDL 
Sbjct  141  CHTLPHTATRAAMLVRINTLLQGYSGIRFEIMEAITKFLNHNITPCLPLRGTITASGDLV  200

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG++LDA +AF  AGI+ GFF L PKE LA+ NGTA GS 
Sbjct  201  PLSYIAGLLTGRPNSKAVGPNGESLDATKAFELAGIDGGFFELQPKEGLALVNGTAVGSG  260

Query  541  LACMVLYEANI  573
            LA MVL+EAN+
Sbjct  261  LASMVLFEANV  271



>emb|CDY66761.1| BnaCnng52250D [Brassica napus]
Length=519

 Score =   285 bits (730),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK GAALQ ELIR LNAG+FGN  E 
Sbjct  96   AGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGAALQTELIRFLNAGIFGNTKET  155

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL  S T+AA+LVR+NTLLQGY  I+FEILEAIT+LLNHNI+P LPLRGTITASGDL 
Sbjct  156  CHTLPESATRAAMLVRVNTLLQGYSGIRFEILEAITSLLNHNISPSLPLRGTITASGDLV  215

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA GPNG++L AEEAF++AGI SGFF L PKE LA+ NGTA GS 
Sbjct  216  PLSYIAGLLTGRPNSKATGPNGESLTAEEAFKKAGITSGFFDLQPKEGLALVNGTAVGSG  275

Query  541  LACMVLYEANI  573
            +A MVL+EAN+
Sbjct  276  MASMVLFEANV  286



>gb|ABS58596.1| phenylalanine ammonia-lyase [Scutellaria baicalensis]
Length=233

 Score =   276 bits (705),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = +1

Query  22   DWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*CHTLTHS  201
            DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FG G E CHTL H+
Sbjct  1    DWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGKGTEGCHTLPHT  60

Query  202  LTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGPLSYIDG  381
             T+AA+LVRINTLLQGY  I+FEILEA+T  LNHNITP LPLRGTITASGDL PLSYI G
Sbjct  61   ATRAAMLVRINTLLQGYSGIRFEILEALTKFLNHNITPCLPLRGTITASGDLVPLSYIAG  120

Query  382  LITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRLACMVLY  561
            L+TGR NSKAVGP G+ L+AEEAF+ AG+  GFF L PKE LA+ NGTA GS LA + LY
Sbjct  121  LLTGRPNSKAVGPKGEELNAEEAFKLAGVSGGFFELQPKEGLALVNGTAVGSGLASIALY  180

Query  562  EANI  573
            EAN+
Sbjct  181  EANV  184



>ref|XP_002267953.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   290 bits (742),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGV A+++WVM  M  GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  82   AGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTES  141

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL +S T+AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGT+TASGDL 
Sbjct  142  CHTLPYSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTVTASGDLV  201

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP+G+ ++AEEAF+ AGIESGFF L PKE LA+ NGTA GS 
Sbjct  202  PLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGLALVNGTAVGSG  261

Query  541  LACMVLYEANI  573
            LA MVL+E N+
Sbjct  262  LASMVLFETNV  272



>gb|KGN52974.1| hypothetical protein Csa_4G008770 [Cucumis sativus]
Length=592

 Score =   286 bits (733),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRT QG ALQKELIR LN+G+FGNG+E 
Sbjct  85   AGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQKELIRFLNSGIFGNGSES  144

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHN+TP LPLRGTITASGDL 
Sbjct  145  NHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNHNVTPCLPLRGTITASGDLV  204

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GPNG+ LDA+ AF +AGI+SGFF L PKE LA+ NGTA GS 
Sbjct  205  PLSYIAGLLTGRHNSKAIGPNGEILDAKVAFEQAGIDSGFFELQPKEGLALVNGTAVGSG  264

Query  541  LACMVLYEANI  573
            LA +VL+EANI
Sbjct  265  LASIVLFEANI  275



>gb|AAV98199.1| phenylalanine ammonialyase 1 [Petunia x hybrida]
Length=718

 Score =   290 bits (741),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWV+ GM NGT+SYGVTTGFGATS RRTK+GAALQKELIR LNAG+FGNG E 
Sbjct  90   AGVKASSDWVLQGMINGTDSYGVTTGFGATSHRRTKEGAALQKELIRFLNAGIFGNGTES  149

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL 
Sbjct  150  SHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLV  209

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA GPNG+ LDA +AF+RAGI++GFF L PKE LA+ NGTA GS 
Sbjct  210  PLSYIAGLLTGRPNSKATGPNGELLDAVKAFQRAGIDTGFFELQPKEGLALVNGTAVGSG  269

Query  541  LACMVLYEANI  573
            LA MVL++ANI
Sbjct  270  LASMVLFDANI  280



>ref|XP_004143356.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 ref|XP_004156338.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=717

 Score =   290 bits (741),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNGAE 
Sbjct  89   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGAES  148

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN N+TP LPLRGTITASGDL 
Sbjct  149  NHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNENVTPCLPLRGTITASGDLV  208

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GPNG+ LDAE AF++AGI S FF L PKE LA+ NGTA GS 
Sbjct  209  PLSYIAGLLTGRPNSKAIGPNGETLDAEAAFKQAGIPSSFFELQPKEGLALVNGTAVGSG  268

Query  541  LACMVLYEANI  573
            LA +VL+EANI
Sbjct  269  LASIVLFEANI  279



>sp|P45733.1|PAL3_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 emb|CAA55075.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   290 bits (741),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FGNG E 
Sbjct  84   AGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGVFGNGTES  143

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL  S T+AA+LVRINTLLQGY  I+FEILEAIT LLNHN+TP LPLRGTITASGDL 
Sbjct  144  CHTLPQSGTRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNVTPCLPLRGTITASGDLV  203

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GPNG+ L+AEEAFR AG+ SGFF L PKE LA+ NGTA GS 
Sbjct  204  PLSYIAGLLTGRPNSKAIGPNGETLNAEEAFRVAGVNSGFFELQPKEGLALVNGTAVGSG  263

Query  541  LACMVLYEANI  573
            LA MVL++ANI
Sbjct  264  LASMVLFDANI  274



>gb|KGN48164.1| hypothetical protein Csa_6G445770 [Cucumis sativus]
Length=717

 Score =   290 bits (741),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNGAE 
Sbjct  89   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGAES  148

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN N+TP LPLRGTITASGDL 
Sbjct  149  NHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNENVTPCLPLRGTITASGDLV  208

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GPNG+ LDAE AF++AGI S FF L PKE LA+ NGTA GS 
Sbjct  209  PLSYIAGLLTGRPNSKAIGPNGETLDAEAAFKQAGIPSSFFELQPKEGLALVNGTAVGSG  268

Query  541  LACMVLYEANI  573
            LA +VL+EANI
Sbjct  269  LASIVLFEANI  279



>ref|XP_011094662.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=711

 Score =   289 bits (740),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGN  E C
Sbjct  84   GVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNATESC  143

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT  LNHNITP LPLRGTITASGDL P
Sbjct  144  HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNITPCLPLRGTITASGDLVP  203

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKAVGPNG+AL+A+EAF+ AG+  GFF L PKE LA+ NGTA GS L
Sbjct  204  LSYIAGLLTGRPNSKAVGPNGEALNADEAFKLAGVHGGFFELQPKEGLALVNGTAVGSGL  263

Query  544  ACMVLYEANI  573
            A + LYEAN+
Sbjct  264  ASIALYEANV  273



>ref|XP_008449239.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=711

 Score =   289 bits (739),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FG+GAE 
Sbjct  83   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGSGAES  142

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             H L HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL 
Sbjct  143  NHILPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLV  202

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GPNG++LDA+EAF++AGI SGFF L PKE LA+ NGTA GS 
Sbjct  203  PLSYIAGLLTGRPNSKAIGPNGESLDAKEAFQQAGIPSGFFELQPKEGLALVNGTAVGSG  262

Query  541  LACMVLYEANI  573
            LA +VL+EANI
Sbjct  263  LASIVLFEANI  273



>gb|ACE95170.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=714

 Score =   289 bits (739),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = +1

Query  7    VKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*CH  186
            VKA++DWVM  MD GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E CH
Sbjct  88   VKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTETCH  147

Query  187  TLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGPL  366
            TL HS T+AA+LVRINTLLQGY  I FEILEAIT LLN+NITP LPLRGTITASGDL PL
Sbjct  148  TLPHSATRAAMLVRINTLLQGYSGICFEILEAITKLLNNNITPCLPLRGTITASGDLVPL  207

Query  367  SYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRLA  546
            SYI GL+TGR NSKA GPNG+ LDA EAF+ AGI+SGFF L PKE LA+ NGTA GS LA
Sbjct  208  SYIAGLLTGRPNSKATGPNGEVLDAVEAFKAAGIDSGFFELQPKEGLALVNGTAVGSGLA  267

Query  547  CMVLYEANI  573
             MVL+E N+
Sbjct  268  SMVLFETNV  276



>ref|XP_009596642.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana tomentosiformis]
Length=719

 Score =   289 bits (739),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWV+ GM NGT+SYGVTTGFGATS RRTKQGAALQKELIR LNAG+FGNG E 
Sbjct  91   AGVKASSDWVIEGMKNGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFGNGTES  150

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL 
Sbjct  151  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLV  210

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA G NG+ LDA  AF+ AGI++GFF L PKE LA+ NGTA GS 
Sbjct  211  PLSYIAGLLTGRPNSKATGANGELLDAVMAFQLAGIDTGFFELQPKEGLALVNGTAVGSG  270

Query  541  LACMVLYEANI  573
            LA MVL+EANI
Sbjct  271  LASMVLFEANI  281



>sp|O49836.1|PAL2_LITER RecName: Full=Phenylalanine ammonia-lyase 2; Short=PAL-2 [Lithospermum 
erythrorhizon]
 dbj|BAA24929.1| phenylalanine ammonia-lyase [Lithospermum erythrorhizon]
Length=705

 Score =   288 bits (738),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 159/190 (84%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E  
Sbjct  78   GVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTETS  137

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT  LN NITP LPLRGTITASGDL P
Sbjct  138  HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNTNITPCLPLRGTITASGDLVP  197

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKAVGP G+ L+AEEAFR AGI SGFF L PKE LA+ NGTA GS +
Sbjct  198  LSYIAGLLTGRPNSKAVGPTGEKLNAEEAFRLAGISSGFFELQPKEGLALVNGTAVGSGM  257

Query  544  ACMVLYEANI  573
            A MVLYEANI
Sbjct  258  ASMVLYEANI  267



>gb|KGN52975.1| hypothetical protein Csa_4G008780 [Cucumis sativus]
Length=646

 Score =   287 bits (734),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRT QG ALQKELIR LN+G+FGNG+E 
Sbjct  85   AGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQKELIRFLNSGIFGNGSES  144

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHN+TP LPLRGTITASGDL 
Sbjct  145  NHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNHNVTPCLPLRGTITASGDLV  204

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GPNG+ LDA+ AF +AGI+SGFF L PKE LA+ NGTA GS 
Sbjct  205  PLSYIAGLLTGRHNSKAIGPNGEILDAKVAFEQAGIDSGFFELQPKEGLALVNGTAVGSG  264

Query  541  LACMVLYEANI  573
            LA +VL+EANI
Sbjct  265  LASIVLFEANI  275



>gb|KGN48162.1| hypothetical protein Csa_6G445750 [Cucumis sativus]
Length=708

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FG+GAE  
Sbjct  81   GVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGSGAESD  140

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL P
Sbjct  141  HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLVP  200

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKAVGPNG++ DA+EAF++AGI SGFF L PKE LA+ NGTA GS L
Sbjct  201  LSYIAGLLTGRPNSKAVGPNGESFDAKEAFQQAGIPSGFFELQPKEGLALVNGTAVGSGL  260

Query  544  ACMVLYEANI  573
            A +VL+EANI
Sbjct  261  ASIVLFEANI  270



>gb|KDP44384.1| hypothetical protein JCGZ_20064 [Jatropha curcas]
Length=712

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQ+ELIR LNAG+FGNG E 
Sbjct  84   AGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQRELIRFLNAGIFGNGTET  143

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CH L HS T+AA+LVRINTLLQGY  I+FEILEAIT  +NHNITP LPLRGTITASGDL 
Sbjct  144  CHILPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFINHNITPCLPLRGTITASGDLV  203

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+ GR NSK+VGPNG++LD  EAF  AGI+SGFF L PKE LA+ NGTA GS 
Sbjct  204  PLSYIAGLLIGRPNSKSVGPNGESLDPSEAFELAGIDSGFFELQPKEGLALVNGTAVGSG  263

Query  541  LACMVLYEANI  573
            LA MVL+EAN+
Sbjct  264  LASMVLFEANV  274



>ref|XP_008449238.1| PREDICTED: phenylalanine ammonia-lyase [Cucumis melo]
Length=708

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FG+GAE 
Sbjct  80   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGSGAES  139

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL 
Sbjct  140  NHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLV  199

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GPNG+  DA+EAF++AGI SGFF L PKE LA+ NGTA GS 
Sbjct  200  PLSYIAGLLTGRPNSKAIGPNGENFDAKEAFQQAGIPSGFFELQPKEGLALVNGTAVGSG  259

Query  541  LACMVLYEANI  573
            LA +VL+EANI
Sbjct  260  LASIVLFEANI  270



>dbj|BAA21643.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=715

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = +1

Query  7    VKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*CH  186
            VKA++DWVM  MD GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E CH
Sbjct  88   VKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTETCH  147

Query  187  TLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGPL  366
            TL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL PL
Sbjct  148  TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLVPL  207

Query  367  SYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRLA  546
            SYI GL+TG  NSKA GPNG+ LDA EAF+ AGI+SGFF L PKE LA+ NGTA GS LA
Sbjct  208  SYIAGLLTGSPNSKATGPNGEVLDAVEAFKAAGIDSGFFELQPKEGLALVNGTAVGSGLA  267

Query  547  CMVLYEANI  573
             MVL+E N+
Sbjct  268  SMVLFETNV  276



>gb|ACF94716.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=719

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+NGT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNGA  
Sbjct  91   AGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGAVS  150

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL 
Sbjct  151  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLV  210

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP+G+ L+A+EAF+ AGI S FF L PKE LA+ NGTA GS 
Sbjct  211  PLSYIAGLLTGRPNSKAVGPSGEVLNAKEAFQLAGINSEFFELQPKEGLALVNGTAVGSG  270

Query  541  LACMVLYEANI  573
            LA +VL+EANI
Sbjct  271  LASIVLFEANI  281



>gb|AAN52279.1|AF480619_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=714

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = +1

Query  7    VKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*CH  186
            VKA++DWVM  MD GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E CH
Sbjct  88   VKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTETCH  147

Query  187  TLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGPL  366
            TL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL PL
Sbjct  148  TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLVPL  207

Query  367  SYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRLA  546
            SYI GL+TG  NSKA GPNG+ LDA EAF+ AGI+SGFF L PKE LA+ NGTA GS LA
Sbjct  208  SYIAGLLTGSPNSKATGPNGEVLDAVEAFKAAGIDSGFFELQPKEGLALVNGTAVGSGLA  267

Query  547  CMVLYEANI  573
             MVL+E N+
Sbjct  268  SMVLFETNV  276



>gb|ABG75910.1| phenylalanine ammonia-lyase 1 [Nicotiana attenuata]
Length=712

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FGNG E 
Sbjct  84   AGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGVFGNGTES  143

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL  S T+AA+LVRINTLLQGY  I+FEILEAIT LLNHN+TP LPLRGTITASGDL 
Sbjct  144  CHTLPQSGTRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNVTPCLPLRGTITASGDLV  203

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+ L+AEEAFR AG+  GFF L PKE LA+ NGTA GS 
Sbjct  204  PLSYIAGLLTGRPNSKAVGPNGETLNAEEAFRVAGVNGGFFELQPKEGLALVNGTAVGSG  263

Query  541  LACMVLYEANI  573
            LA MVL++ANI
Sbjct  264  LASMVLFDANI  274



>ref|XP_010067315.1| PREDICTED: phenylalanine ammonia-lyase [Eucalyptus grandis]
 gb|KCW65427.1| hypothetical protein EUGRSUZ_G02848 [Eucalyptus grandis]
Length=714

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTKQG ALQ+ELIR LNAG+FGNG E 
Sbjct  86   AGVKASSDWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQRELIRFLNAGIFGNGTES  145

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILE +  LLN NITP LPLRGTITASGDL 
Sbjct  146  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILETMAKLLNRNITPCLPLRGTITASGDLV  205

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG++L+A EAFR AGIE GFF L PKE LA+ NGTA GS 
Sbjct  206  PLSYIAGLLTGRPNSKAVGPNGESLNAVEAFRLAGIEHGFFDLQPKEGLALVNGTAVGSG  265

Query  541  LACMVLYEANI  573
            LA +VLYEANI
Sbjct  266  LASIVLYEANI  276



>gb|KCW65428.1| hypothetical protein EUGRSUZ_G02848 [Eucalyptus grandis]
Length=701

 Score =   288 bits (736),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTKQG ALQ+ELIR LNAG+FGNG E 
Sbjct  86   AGVKASSDWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQRELIRFLNAGIFGNGTES  145

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILE +  LLN NITP LPLRGTITASGDL 
Sbjct  146  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILETMAKLLNRNITPCLPLRGTITASGDLV  205

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG++L+A EAFR AGIE GFF L PKE LA+ NGTA GS 
Sbjct  206  PLSYIAGLLTGRPNSKAVGPNGESLNAVEAFRLAGIEHGFFDLQPKEGLALVNGTAVGSG  265

Query  541  LACMVLYEANI  573
            LA +VLYEANI
Sbjct  266  LASIVLYEANI  276



>gb|ADO64252.1| PAL [Epimedium sagittatum]
Length=708

 Score =   288 bits (736),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  80   AGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGVFGNGTET  139

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT  LNHNITP LPLRGTITASGDL 
Sbjct  140  SHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNITPCLPLRGTITASGDLV  199

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP G+ L+A+EAF  AGI++GFF L PKE LA+ NGTA GS 
Sbjct  200  PLSYIAGLLTGRPNSKAVGPKGEPLNAQEAFTLAGIDTGFFELQPKEGLALVNGTAVGSG  259

Query  541  LACMVLYEANI  573
            LA MVL+EANI
Sbjct  260  LASMVLFEANI  270



>gb|AEZ67457.1| phenylalanine ammonia-lyase [Perilla frutescens]
Length=711

 Score =   288 bits (736),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  83   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTES  142

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEI+EAIT  LNHNITP LPLRGTITASGDL 
Sbjct  143  NHTLPHSATRAAMLVRINTLLQGYSGIRFEIMEAITKFLNHNITPCLPLRGTITASGDLV  202

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG++L AEEAF+ AG+  GFF L PKE LA+ NGTA GS 
Sbjct  203  PLSYIAGLLTGRPNSKAVGPNGESLSAEEAFKLAGVSGGFFELQPKEGLALVNGTAVGSG  262

Query  541  LACMVLYEANI  573
            LA + LYEANI
Sbjct  263  LASIALYEANI  273



>ref|XP_004156293.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase-like 
[Cucumis sativus]
Length=712

 Score =   288 bits (736),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FG+GAE 
Sbjct  84   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGSGAES  143

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL 
Sbjct  144  DHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLV  203

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GPNG++LDA+EAF++AGI SG F L PKE LA+ NGTA GS 
Sbjct  204  PLSYIAGLLTGRPNSKAIGPNGESLDAKEAFQQAGIPSGXFELQPKEGLALVNGTAVGSG  263

Query  541  LACMVLYEANI  573
            LA +VL+EANI
Sbjct  264  LASIVLFEANI  274



>gb|AEC11891.1| PAL1 [Petunia exserta]
 gb|AEC11892.1| PAL1 [Petunia axillaris]
Length=718

 Score =   288 bits (736),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWV+ GM NGT+SYGVTTGFGATS RRTK+GAALQKELIR LNAG+FGNG E 
Sbjct  90   AGVKASSDWVLQGMINGTDSYGVTTGFGATSHRRTKEGAALQKELIRFLNAGIFGNGTES  149

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL 
Sbjct  150  SHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLV  209

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA GPNG+ L+A +AF+RAGI++GFF L PKE LA+ NGTA GS 
Sbjct  210  PLSYIAGLLTGRPNSKATGPNGELLNAVKAFQRAGIDTGFFELQPKEGLALVNGTAVGSG  269

Query  541  LACMVLYEANI  573
            LA MVL++ANI
Sbjct  270  LASMVLFDANI  280



>gb|AEE81750.1| phenylalanine ammonia lyase [Morus alba var. multicaulis]
Length=726

 Score =   288 bits (736),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA++DWVM  MD GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E C
Sbjct  99   GVKASSDWVMESMDKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTESC  158

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL H+ T+AA+LVRINTLLQGY  I+FEILEA+T LLN N+TP LPLRGT+TASGDL P
Sbjct  159  HTLPHTTTRAALLVRINTLLQGYSGIRFEILEAMTKLLNSNVTPCLPLRGTVTASGDLVP  218

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKAVGPNG++L A +AF+ AGI SGFF L PKE LA+ NGTA GS L
Sbjct  219  LSYIAGLLTGRPNSKAVGPNGESLTATQAFKVAGINSGFFELQPKEGLALVNGTAVGSGL  278

Query  544  ACMVLYEANI  573
            A MVL++ANI
Sbjct  279  ASMVLFDANI  288



>dbj|BAJ17655.1| phenylalanine ammonia lyase [Gynura bicolor]
Length=726

 Score =   287 bits (735),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  MD GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  98   AGVKASSDWVMESMDKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTES  157

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT  LN+N+TP LPLRGTITASGDL 
Sbjct  158  SHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNNVTPCLPLRGTITASGDLV  217

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR+NSKAVGP G+ L+AE+AF +AG+E GFF L PKE LA+ NGTA GS 
Sbjct  218  PLSYIAGLLTGRSNSKAVGPTGEILNAEQAFAKAGVEGGFFELQPKEGLALVNGTAVGSG  277

Query  541  LACMVLYEANI  573
            +A MVL+EAN+
Sbjct  278  MASMVLFEANV  288



>gb|AEX32790.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   287 bits (734),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGV A+++WVM  M  GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  82   AGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGRES  141

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGT+TASGDL 
Sbjct  142  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTVTASGDLV  201

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLS I GL+TGR NSKAVGP+G+ ++AEEAF+ AGIESGFF L PKE LA+ NGTA GS 
Sbjct  202  PLSDIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGLALVNGTAVGSG  261

Query  541  LACMVLYEANI  573
            LA MVL+E N+
Sbjct  262  LASMVLFETNV  272



>ref|XP_004167356.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase-like, 
partial [Cucumis sativus]
Length=673

 Score =   286 bits (732),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRT QG ALQKELIR LN+G+FGNG+E 
Sbjct  45   AGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQKELIRFLNSGIFGNGSES  104

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHN+TP LPLRGTITASGDL 
Sbjct  105  NHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNHNVTPCLPLRGTITASGDLV  164

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GPNG+ LDA+ AF +AGI+SGFF L PKE LA+ NGTA GS 
Sbjct  165  PLSYIAGLLTGRHNSKAIGPNGETLDAKAAFTQAGIDSGFFELQPKEGLALVNGTAVGSG  224

Query  541  LACMVLYEANI  573
            LA +VL+EANI
Sbjct  225  LASIVLFEANI  235



>dbj|BAL49995.1| phenylalanine ammonia-lyase [Eucalyptus robusta]
 dbj|BAL63070.1| phenylalanine ammonia-lyase [Eucalyptus robusta]
Length=715

 Score =   287 bits (734),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +1

Query  7    VKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*CH  186
            VKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E CH
Sbjct  89   VKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTESCH  148

Query  187  TLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGPL  366
            TL  S T+AA+LVR+NTLLQGY  I+FEILEAIT  LNHNITP LPLRGTITASGDL PL
Sbjct  149  TLPQSSTRAAMLVRVNTLLQGYSGIRFEILEAITKFLNHNITPCLPLRGTITASGDLVPL  208

Query  367  SYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRLA  546
            SYI GL+TGR NSKAVGP+G +LDA EAFR AGI++GFF L PKE LA+ NGTA GS LA
Sbjct  209  SYIAGLLTGRPNSKAVGPDGKSLDAVEAFRLAGIDTGFFELQPKEGLALVNGTAVGSGLA  268

Query  547  CMVLYEANI  573
             +VL+EANI
Sbjct  269  SIVLFEANI  277



>ref|XP_010658395.1| PREDICTED: phenylalanine ammonia-lyase G1 [Vitis vinifera]
Length=723

 Score =   287 bits (735),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA++DWVM  M+NGT+SYGVTTGFGATS RRTKQG ALQ ELIR LNAG+FGNG E C
Sbjct  96   GVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTKQGGALQMELIRFLNAGIFGNGTESC  155

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL HS T+A++LVRINTLLQGY  I+FEILEAIT L+NHNITP LPLRGTI+ASGDL P
Sbjct  156  HTLPHSATRASMLVRINTLLQGYSGIRFEILEAITKLINHNITPCLPLRGTISASGDLVP  215

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+ GR++ KAVGPNG+ L AEEAFR AGI+ GFF L PKE LA+ NGTA GS +
Sbjct  216  LSYIAGLLLGRSSCKAVGPNGEPLSAEEAFRVAGIKGGFFELQPKEGLALVNGTAVGSGM  275

Query  544  ACMVLYEANI  573
            A MVL+EANI
Sbjct  276  ASMVLFEANI  285



>gb|AJO53273.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=711

 Score =   287 bits (734),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  MD GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FG G E 
Sbjct  83   AGVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGKGTES  142

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT  LNHN+TP LPLRGTITASGDL 
Sbjct  143  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNVTPCLPLRGTITASGDLV  202

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP+G+ L++EEAF+ AG+  GFF L PKE LA+ NGTA GS 
Sbjct  203  PLSYIAGLLTGRPNSKAVGPSGEDLNSEEAFKLAGVTGGFFELQPKEGLALVNGTAVGSG  262

Query  541  LACMVLYEANI  573
            LA + LYEAN+
Sbjct  263  LASIALYEANV  273



>gb|ACS71953.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   287 bits (734),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+NGT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  93   AGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTET  152

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             H L HS TKAA++VRINTLLQGY  I+FEILEAIT LLN NITP LPLRGTITASGDL 
Sbjct  153  SHILPHSATKAAMIVRINTLLQGYSGIRFEILEAITKLLNTNITPCLPLRGTITASGDLV  212

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR+NSKA GPNG++LDA++AF  AGI+SG F L PKE LA+ NGTA GS 
Sbjct  213  PLSYIAGLLTGRSNSKATGPNGESLDAQQAFSEAGIDSGLFELQPKEGLALVNGTAVGSG  272

Query  541  LACMVLYEANI  573
            LA MVL++ANI
Sbjct  273  LASMVLFDANI  283



>gb|AAL14120.1| phenylalanine ammonia-lyase [Brassica rapa subsp. pekinensis]
Length=240

 Score =   273 bits (697),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = +1

Query  22   DWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*CHTLTHS  201
            DWVM  M  GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FG+  E  HTL HS
Sbjct  1    DWVMESMGKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGSTKETSHTLPHS  60

Query  202  LTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGPLSYIDG  381
             T+AA+LVRINTLLQGY  I+FEILEAIT+ LN NITP LPLRGTITASGDL PLSYI G
Sbjct  61   ATRAAMLVRINTLLQGYSGIRFEILEAITSFLNTNITPSLPLRGTITASGDLVPLSYIAG  120

Query  382  LITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRLACMVLY  561
            L+TGR NSKA GPNG+AL AEEAF++AGI SGFF L PKE LA+ NGTA GS +A MVL+
Sbjct  121  LLTGRPNSKATGPNGEALTAEEAFKQAGITSGFFDLQPKEGLALVNGTAVGSGMASMVLF  180

Query  562  EANI  573
            EAN+
Sbjct  181  EANV  184



>gb|ADY02661.1| phenylalanine ammonia lyase [Parrya nudicaulis]
Length=673

 Score =   286 bits (731),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FG+  E 
Sbjct  65   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGSTKET  124

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT+ LN+NITP LPLRGTITASGDL 
Sbjct  125  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITSFLNNNITPSLPLRGTITASGDLV  184

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA GPNG+AL+AEEAF+ AGI SGFF L PKE LA+ NGTA GS 
Sbjct  185  PLSYIAGLLTGRPNSKATGPNGEALNAEEAFKMAGISSGFFDLQPKEGLALVNGTAVGSG  244

Query  541  LACMVLYEANI  573
            +A MVL+E N+
Sbjct  245  MASMVLFETNV  255



>ref|XP_009625397.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
Length=712

 Score =   286 bits (733),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FGNG E 
Sbjct  84   AGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGVFGNGTES  143

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL  S T+AA+LVRINTLLQGY  I+FEILEAIT LLNHN+TP LPLRGTITASGDL 
Sbjct  144  CHTLPQSGTRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNVTPCLPLRGTITASGDLV  203

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+ L+AEEAFR AG+  GFF L PKE LA+ NGTA GS 
Sbjct  204  PLSYIAGLLTGRPNSKAVGPNGETLNAEEAFRVAGVNGGFFELQPKEGLALVNGTAVGSG  263

Query  541  LACMVLYEANI  573
            LA MVL++AN+
Sbjct  264  LASMVLFDANV  274



>ref|XP_004143257.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 ref|XP_004156292.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=710

 Score =   286 bits (733),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA++DWVM  M+ GT+SYGVTTGFGATS RRTK+G ALQKELIR LNAG+FG+GAE  
Sbjct  83   GVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKEGGALQKELIRFLNAGIFGSGAESD  142

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL P
Sbjct  143  HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLVP  202

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKAVGPNG++ DA+EAF++AGI SGFF L PKE LA+ NGTA GS L
Sbjct  203  LSYIAGLLTGRPNSKAVGPNGESFDAKEAFQQAGIPSGFFELQPKEGLALVNGTAVGSGL  262

Query  544  ACMVLYEANI  573
            A +VL+EANI
Sbjct  263  ASIVLFEANI  272



>sp|P35513.2|PAL2_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22947.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22963.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   286 bits (733),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FGNG E 
Sbjct  84   AGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGVFGNGTES  143

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL  S T+AA+LVRINTLLQGY  I+FEILEAIT LLNHN+TP LPLRGTITASGDL 
Sbjct  144  CHTLPQSGTRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNVTPCLPLRGTITASGDLV  203

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+ L+AEEAFR AG+  GFF L PKE LA+ NGTA GS 
Sbjct  204  PLSYIAGLLTGRPNSKAVGPNGETLNAEEAFRVAGVNGGFFELQPKEGLALVNGTAVGSG  263

Query  541  LACMVLYEANI  573
            LA MVL++AN+
Sbjct  264  LASMVLFDANV  274



>ref|XP_004152158.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=713

 Score =   286 bits (732),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRT QG ALQKELIR LN+G+FGNG+E 
Sbjct  85   AGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQKELIRFLNSGIFGNGSES  144

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHN+TP LPLRGTITASGDL 
Sbjct  145  NHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNHNVTPCLPLRGTITASGDLV  204

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GPNG+ LDA+ AF +AGI+SGFF L PKE LA+ NGTA GS 
Sbjct  205  PLSYIAGLLTGRHNSKAIGPNGETLDAKAAFTQAGIDSGFFELQPKEGLALVNGTAVGSG  264

Query  541  LACMVLYEANI  573
            LA +VL+EANI
Sbjct  265  LASIVLFEANI  275



>gb|ADA81868.1| phenylalanine ammonia-lyase [Brassica rapa subsp. chinensis]
Length=721

 Score =   286 bits (733),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FG+  E 
Sbjct  93   AGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGSTKET  152

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT+ LN NITP LPLRGTITASGDL 
Sbjct  153  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITSFLNTNITPSLPLRGTITASGDLV  212

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA GPNG+AL+AEEAF++AGI SGFF L PKE LA+ NGTA GS 
Sbjct  213  PLSYIAGLLTGRPNSKATGPNGEALNAEEAFKKAGIPSGFFDLQPKEGLALVNGTAVGSG  272

Query  541  LACMVLYEANI  573
            +A MVL+EAN+
Sbjct  273  MASMVLFEANV  283



>gb|AID16077.1| phenylalanine ammonium lyase [Morus alba]
Length=726

 Score =   286 bits (733),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA++DWVM  MD GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E C
Sbjct  99   GVKASSDWVMESMDKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTESC  158

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL H+ T+AA+LVRINTLLQGY  I+FEILEA+T LLN N+TP LPLRGT+TASGDL P
Sbjct  159  HTLPHTTTRAALLVRINTLLQGYSGIRFEILEAMTKLLNGNVTPCLPLRGTVTASGDLVP  218

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKAVGPNG++L A +AF+ AGI SGFF L PKE LA+ NGTA GS L
Sbjct  219  LSYIAGLLTGRPNSKAVGPNGESLTATQAFKVAGINSGFFELQPKEGLALVNGTAVGSGL  278

Query  544  ACMVLYEANI  573
            A MVL++ANI
Sbjct  279  ASMVLFDANI  288



>gb|AER58180.1| phenylalanine ammonia lyase [Cucumis sativus]
Length=713

 Score =   286 bits (732),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRT QG ALQKELIR LN+G+FGNG+E 
Sbjct  85   AGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQKELIRFLNSGIFGNGSES  144

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHN+TP LPLRGTITASGDL 
Sbjct  145  NHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNHNVTPCLPLRGTITASGDLV  204

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GPNG+ LDA+ AF +AGI+SGFF L PKE LA+ NGTA GS 
Sbjct  205  PLSYIAGLLTGRHNSKAIGPNGEILDAKVAFEQAGIDSGFFELQPKEGLALVNGTAVGSG  264

Query  541  LACMVLYEANI  573
            LA +VL+EANI
Sbjct  265  LASIVLFEANI  275



>ref|XP_009781653.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
Length=712

 Score =   286 bits (732),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FGNG E 
Sbjct  84   AGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGVFGNGTES  143

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL  S T+AA+LVRINTLLQGY  I+FEILEAIT LLNHN+TP LPLRGTITASGDL 
Sbjct  144  CHTLPQSGTRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNVTPCLPLRGTITASGDLV  203

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GPNG+ L+AEEAF  AG+ SGFF L PKE LA+ NGTA GS 
Sbjct  204  PLSYIAGLLTGRPNSKAIGPNGETLNAEEAFGVAGVNSGFFELQPKEGLALVNGTAVGSG  263

Query  541  LACMVLYEANI  573
            LA MVL++ANI
Sbjct  264  LASMVLFDANI  274



>ref|XP_010528074.1| PREDICTED: phenylalanine ammonia-lyase 1 [Tarenaya hassleriana]
Length=720

 Score =   286 bits (732),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FG+ AE 
Sbjct  92   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGSAAEK  151

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT+LLNHNI P LPLRGTITASGDL 
Sbjct  152  SHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITSLLNHNIAPCLPLRGTITASGDLV  211

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA GPNG+ L AEEAF+ AGI SGFF L PKE LA+ NGTA GS 
Sbjct  212  PLSYIAGLLTGRPNSKATGPNGETLTAEEAFKLAGITSGFFDLQPKEGLALVNGTAVGSG  271

Query  541  LACMVLYEANI  573
            LA MVL+EAN+
Sbjct  272  LASMVLFEANV  282



>gb|ADY02660.1| phenylalanine ammonia lyase [Parrya nudicaulis]
Length=693

 Score =   286 bits (731),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FG+  E 
Sbjct  65   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGSTKET  124

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT+ LN+NITP LPLRGTITASGDL 
Sbjct  125  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITSFLNNNITPSLPLRGTITASGDLV  184

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA GPNG+AL+AEEAF+ AGI SGFF L PKE LA+ NGTA GS 
Sbjct  185  PLSYIAGLLTGRPNSKATGPNGEALNAEEAFKMAGISSGFFDLQPKEGLALVNGTAVGSG  244

Query  541  LACMVLYEANI  573
            +A MVL+E N+
Sbjct  245  MASMVLFETNV  255



>ref|XP_004152155.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=713

 Score =   286 bits (732),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRT QG ALQKELIR LN+G+FGNG+E 
Sbjct  85   AGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQKELIRFLNSGIFGNGSES  144

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHN+TP LPLRGTITASGDL 
Sbjct  145  NHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNHNVTPCLPLRGTITASGDLV  204

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GPNG+ LDA+ AF +AGI+SGFF L PKE LA+ NGTA GS 
Sbjct  205  PLSYIAGLLTGRHNSKAIGPNGEILDAKVAFEQAGIDSGFFELQPKEGLALVNGTAVGSG  264

Query  541  LACMVLYEANI  573
            LA +VL+EANI
Sbjct  265  LASIVLFEANI  275



>ref|XP_002531677.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF30696.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=719

 Score =   286 bits (732),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQ+ELIR LNAG+FGNG E 
Sbjct  91   AGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQRELIRFLNAGIFGNGTES  150

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT  +NHN+TP LPLRGTITASGDL 
Sbjct  151  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFINHNVTPSLPLRGTITASGDLV  210

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+ GR NSK VGPNG++LD  EAF  AGI SGFF L PKE LA+ NGTA GS 
Sbjct  211  PLSYIAGLLIGRPNSKCVGPNGESLDPTEAFTLAGINSGFFDLQPKEGLALVNGTAVGSG  270

Query  541  LACMVLYEANI  573
            LA MVL+EAN+
Sbjct  271  LASMVLFEANV  281



>gb|AIB06732.1| phenylalanine ammonia lyase [Mangifera indica]
Length=707

 Score =   286 bits (731),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGV+A++DWVM  M NGT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FG+G E 
Sbjct  79   AGVQASSDWVMESMKNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGSGTES  138

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+F+ILEAIT  LNHNITP LPLRGTITASGDL 
Sbjct  139  CHTLPHSATRAAMLVRINTLLQGYSGIRFDILEAITKFLNHNITPCLPLRGTITASGDLV  198

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG  L+A  AF+ AGI SGFF L PKE LA+ NGTA GS 
Sbjct  199  PLSYIVGLLTGRPNSKAVGPNGQVLNASAAFQLAGISSGFFELQPKEGLALVNGTAVGSG  258

Query  541  LACMVLYEANI  573
            LA  VL+EANI
Sbjct  259  LASTVLFEANI  269



>sp|O49835.1|PAL1_LITER RecName: Full=Phenylalanine ammonia-lyase 1; Short=PAL-1 [Lithospermum 
erythrorhizon]
 dbj|BAA24928.1| phenylalanine ammonia-lyase [Lithospermum erythrorhizon]
Length=710

 Score =   286 bits (731),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 159/190 (84%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E  
Sbjct  83   GVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTETS  142

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT  LN NITP LPLRGTITASGDL P
Sbjct  143  HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNTNITPCLPLRGTITASGDLVP  202

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKAVGP G+ ++AEEAFR AGI +GFF L PKE LA+ NGTA GS +
Sbjct  203  LSYIAGLLTGRPNSKAVGPTGEKINAEEAFRLAGISTGFFELQPKEGLALVNGTAVGSGM  262

Query  544  ACMVLYEANI  573
            A MVLYEANI
Sbjct  263  ASMVLYEANI  272



>gb|ADY02662.1| phenylalanine ammonia lyase [Parrya nudicaulis]
Length=693

 Score =   285 bits (730),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FG+  E 
Sbjct  65   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGSTKET  124

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT+ LN+NITP LPLRGTITASGDL 
Sbjct  125  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITSFLNNNITPSLPLRGTITASGDLV  184

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA GPNG+AL+AE+AF+ AGI SGFF L PKE LA+ NGTA GS 
Sbjct  185  PLSYIAGLLTGRPNSKATGPNGEALNAEZAFKMAGISSGFFDLQPKEGLALVNGTAVGSG  244

Query  541  LACMVLYEANI  573
            +A MVL+E N+
Sbjct  245  MASMVLFETNV  255



>gb|AAK60274.1|AF383151_1 phenylalanine ammonia-lyase 1 [Manihot esculenta]
Length=687

 Score =   285 bits (729),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWV+  M+ GT+SYGVTTGFGATS RRTKQG ALQ+ELIR LNAG+FGNG E 
Sbjct  82   AGVKASSDWVLDSMNKGTDSYGVTTGFGATSHRRTKQGGALQRELIRFLNAGIFGNGQES  141

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL+H+ T+AA+LVRINTLLQGY  I+FEILEAIT  +N+N+TP LPLRGTITASGDL 
Sbjct  142  CHTLSHTATRAAMLVRINTLLQGYSGIRFEILEAITKFINNNVTPRLPLRGTITASGDLV  201

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSK++GPNG++LDA EAF+ AGI  GFF L PKE LA+ NGTA GS 
Sbjct  202  PLSYIAGLLTGRPNSKSLGPNGESLDAAEAFKLAGINGGFFELQPKEGLALVNGTAVGSG  261

Query  541  LACMVLYEANI  573
            LA MVL+EAN+
Sbjct  262  LASMVLFEANV  272



>gb|ACR56688.1| phenylalanine ammonia-lyase [Scutellaria viscidula]
Length=711

 Score =   285 bits (730),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FG G E 
Sbjct  83   AGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGKGTEG  142

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL H+ T+AA+LVRINTLLQGY  I+FEILEA+T  LNHNITP LPLRGTITASGDL 
Sbjct  143  CHTLPHTATRAAMLVRINTLLQGYSGIRFEILEALTKFLNHNITPCLPLRGTITASGDLV  202

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP G+ L+AEEAF+ AG+  GFF L PKE LA+ NGTA GS 
Sbjct  203  PLSYIAGLLTGRPNSKAVGPKGEELNAEEAFKLAGVSGGFFELQPKEGLALVNGTAVGSG  262

Query  541  LACMVLYEANI  573
            LA + LYEAN+
Sbjct  263  LASIALYEANV  273



>ref|XP_010032174.1| PREDICTED: phenylalanine ammonia-lyase-like [Eucalyptus grandis]
 gb|KCW51577.1| hypothetical protein EUGRSUZ_J01079 [Eucalyptus grandis]
Length=715

 Score =   285 bits (730),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +1

Query  7    VKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*CH  186
            VKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E CH
Sbjct  89   VKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTESCH  148

Query  187  TLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGPL  366
            TL  S T+AA+LVR+NTLLQGY  I+FEILEAIT  LNHNITP LPLRGTITASGDL PL
Sbjct  149  TLPQSSTRAAMLVRVNTLLQGYSGIRFEILEAITKFLNHNITPCLPLRGTITASGDLVPL  208

Query  367  SYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRLA  546
            SYI GL+TGR NSKAVGP+G +LDA EAFR AGI++GFF L PKE LA+ NGTA GS LA
Sbjct  209  SYIAGLLTGRPNSKAVGPDGKSLDAVEAFRLAGIDTGFFELQPKEGLALVNGTAVGSGLA  268

Query  547  CMVLYEANI  573
             +VL++ANI
Sbjct  269  SIVLFDANI  277



>gb|AAO13347.1| phenylalanine ammonia-lyase2 [Lactuca sativa]
Length=713

 Score =   285 bits (730),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTK+G ALQKELIR LNAG+FGNG E 
Sbjct  88   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKEGGALQKELIRFLNAGIFGNGTES  147

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT  LNHN+TP+LPLRGTITASGDL 
Sbjct  148  THTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNVTPFLPLRGTITASGDLV  207

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP G+ L+AE+AF  AG+E GFF L PKE LA+ NGTA GS 
Sbjct  208  PLSYIAGLLTGRANSKAVGPTGEVLNAEKAFAEAGVEGGFFELQPKEGLALVNGTAVGSG  267

Query  541  LACMVLYEANI  573
            +A MVL++AN+
Sbjct  268  MASMVLFDANV  278



>ref|XP_004246650.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum lycopersicum]
Length=721

 Score =   285 bits (730),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FGNG E 
Sbjct  93   AGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGVFGNGTES  152

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT L+N NITP LPLRGTITASGDL 
Sbjct  153  SHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNITPCLPLRGTITASGDLV  212

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+ L+AEEAFR AG+ SGFF L PKE LA+ NGTA GS 
Sbjct  213  PLSYIAGLLTGRPNSKAVGPNGEKLNAEEAFRVAGVTSGFFELQPKEGLALVNGTAVGSG  272

Query  541  LACMVLYEANI  573
            +A MVL+E+NI
Sbjct  273  MASMVLFESNI  283



>gb|AFJ80777.1| phenylalanine ammonia-lyase [Camellia japonica]
Length=706

 Score =   285 bits (729),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            A V+A+++WVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  78   AAVQASSEWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTES  137

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEA+T L+NHNITP LPLRGTITASGDL 
Sbjct  138  CHTLPHSSTRAAMLVRINTLLQGYSGIRFEILEALTKLINHNITPCLPLRGTITASGDLV  197

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI G++TGR NSK VGP G+ LDA EAFRRAGI+ GFF L PKE LA+ NGTA GS 
Sbjct  198  PLSYIAGVLTGRPNSKCVGPTGEPLDATEAFRRAGIDGGFFELQPKEGLALVNGTAVGSG  257

Query  541  LACMVLYEANI  573
            LA +VL++AN+
Sbjct  258  LASIVLFDANV  268



>ref|XP_010112228.1| Phenylalanine ammonia-lyase [Morus notabilis]
 gb|EXC32937.1| Phenylalanine ammonia-lyase [Morus notabilis]
Length=696

 Score =   285 bits (729),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+NGT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  82   AGVKASSDWVMESMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTES  141

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL  S T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL 
Sbjct  142  CHTLPRSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLV  201

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+ L   EAF++A IE+ FF L PKE LA+ NGTA GS 
Sbjct  202  PLSYIAGLLTGRPNSKAVGPNGELLTPTEAFKQAQIETDFFELQPKEGLALVNGTAVGSG  261

Query  541  LACMVLYEANI  573
            LA +VL+EANI
Sbjct  262  LASVVLFEANI  272



>ref|XP_004246649.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
lycopersicum]
Length=721

 Score =   285 bits (730),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FGNG E 
Sbjct  93   AGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGVFGNGTES  152

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT L+N NITP LPLRGTITASGDL 
Sbjct  153  SHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNITPCLPLRGTITASGDLV  212

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+ L+AEEAFR AG+ SGFF L PKE LA+ NGTA GS 
Sbjct  213  PLSYIAGLLTGRPNSKAVGPNGEKLNAEEAFRVAGVTSGFFELQPKEGLALVNGTAVGSG  272

Query  541  LACMVLYEANI  573
            +A MVL+E+NI
Sbjct  273  MASMVLFESNI  283



>gb|AFZ94859.1| phenylalanine ammonia-lyase [Solenostemon scutellarioides]
Length=711

 Score =   285 bits (729),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 157/191 (82%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQ ELIR LNAG+FG G E 
Sbjct  83   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQTELIRFLNAGIFGKGTET  142

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT  LNHNITP LPLRGTITASGDL 
Sbjct  143  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNITPCLPLRGTITASGDLV  202

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP G  L+AEEAF+ AG+  GFF L PKE LA+ NGTA GS 
Sbjct  203  PLSYIAGLLTGRPNSKAVGPTGSELNAEEAFKLAGVSGGFFELQPKEGLALVNGTAVGSG  262

Query  541  LACMVLYEANI  573
            LA + LYEANI
Sbjct  263  LASIALYEANI  273



>gb|ADN32767.1| phenylalanine ammonia-lyase 1 [Scutellaria baicalensis]
Length=711

 Score =   285 bits (729),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FG G E 
Sbjct  83   AGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGKGTEG  142

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL H+ T+AA+LVRINTLLQGY  I+FEILEA+T  LNHNITP LPLRGTITASGDL 
Sbjct  143  CHTLPHTATRAAMLVRINTLLQGYSGIRFEILEALTKFLNHNITPCLPLRGTITASGDLV  202

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP G+ L+AEEAF+ AG+  GFF L PKE LA+ NGTA GS 
Sbjct  203  PLSYIAGLLTGRPNSKAVGPKGEELNAEEAFKLAGVSGGFFELQPKEGLALVNGTAVGSG  262

Query  541  LACMVLYEANI  573
            LA + LYEAN+
Sbjct  263  LASIALYEANV  273



>gb|ACT21093.1| phenylalanine ammonia-lyase [Camellia oleifera]
Length=706

 Score =   285 bits (729),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            A V+A+++WVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  78   AAVQASSEWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTES  137

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEA+T L+NHNITP LPLRGTITASGDL 
Sbjct  138  CHTLPHSSTRAAMLVRINTLLQGYSGIRFEILEALTKLINHNITPCLPLRGTITASGDLV  197

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI G++TGR NSK VGP G+ LDA EAFRRAGI+ GFF L PKE LA+ NGTA GS 
Sbjct  198  PLSYIAGVLTGRPNSKCVGPTGEPLDATEAFRRAGIDGGFFELQPKEGLALVNGTAVGSG  257

Query  541  LACMVLYEANI  573
            LA +VL++AN+
Sbjct  258  LASIVLFDANV  268



>ref|XP_009143533.1| PREDICTED: phenylalanine ammonia-lyase 1 [Brassica rapa]
Length=719

 Score =   285 bits (730),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FG+  E 
Sbjct  91   AGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGSTKET  150

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT+ LN NITP LPLRGTITASGDL 
Sbjct  151  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITSFLNTNITPSLPLRGTITASGDLV  210

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA GPNG+AL+AEEAF++AGI SGFF L PKE LA+ NGTA GS 
Sbjct  211  PLSYIAGLLTGRPNSKATGPNGEALNAEEAFKKAGIPSGFFDLQPKEGLALVNGTAVGSG  270

Query  541  LACMVLYEANI  573
            +A MVL+E N+
Sbjct  271  MASMVLFETNV  281



>gb|ABD42947.1| phenylalanine ammonia lyase [Acacia auriculiformis x Acacia mangium]
Length=714

 Score =   285 bits (729),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQGAALQKELIR LNAG+FGNG E 
Sbjct  87   AGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFGNGTES  146

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT  LNHNITP LPLRGTIT SGDL 
Sbjct  147  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNITPCLPLRGTITTSGDLV  206

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVG +G+ L  +EAF+ AGI+S FF L PKE LA+ NGTA GS 
Sbjct  207  PLSYIAGLLTGRPNSKAVGTSGELLTPKEAFQLAGIDSDFFGLQPKEGLALVNGTAVGSG  266

Query  541  LACMVLYEANI  573
            LA MVL+EANI
Sbjct  267  LASMVLFEANI  277



>ref|XP_008454138.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=713

 Score =   285 bits (729),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRT QG ALQKELIR LN+G+FGNG+E 
Sbjct  85   AGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQKELIRFLNSGIFGNGSES  144

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAI  LLNHN+TP LPLRGTITASGDL 
Sbjct  145  NHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIANLLNHNVTPCLPLRGTITASGDLV  204

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GPNG+ LDA+ AF +AGI+SGFF L PKE LA+ NGTA GS 
Sbjct  205  PLSYIAGLLTGRHNSKAIGPNGETLDAKAAFEQAGIDSGFFELQPKEGLALVNGTAVGSG  264

Query  541  LACMVLYEANI  573
            LA +VL+EANI
Sbjct  265  LASIVLFEANI  275



>gb|AIA24411.1| phenylalanine ammonia-lyase [Sinopodophyllum hexandrum]
Length=709

 Score =   285 bits (729),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  83   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGVFGNGTES  142

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEA+T  L+HNITP LPLRGTITASGDL 
Sbjct  143  THTLPHSATRAAMLVRINTLLQGYSGIRFEILEALTKFLDHNITPCLPLRGTITASGDLV  202

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP G+ L+AEEAF  AGI  GFF L PKE LA+ NGTA GS 
Sbjct  203  PLSYIAGLLTGRPNSKAVGPKGETLNAEEAFTLAGINGGFFELQPKEGLALVNGTAVGSG  262

Query  541  LACMVLYEANI  573
            LA MVL+EANI
Sbjct  263  LASMVLFEANI  273



>gb|ABC69917.1| phenylalanine ammonia-lyase [Brassica napus]
Length=719

 Score =   285 bits (729),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FG+  E 
Sbjct  91   AGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGSTKET  150

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT+ LN NITP LPLRGTITASGDL 
Sbjct  151  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITSFLNTNITPSLPLRGTITASGDLV  210

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA GPNG+AL+AEEAF++AGI SGFF L PKE LA+ NGTA GS 
Sbjct  211  PLSYIAGLLTGRPNSKATGPNGEALNAEEAFKKAGIPSGFFDLQPKEGLALVNGTAVGSG  270

Query  541  LACMVLYEANI  573
            +A MVL+E N+
Sbjct  271  MASMVLFETNV  281



>emb|CAL91169.1| phenylalanine ammonia-lyase 3 [Cynara cardunculus var. scolymus]
Length=713

 Score =   285 bits (729),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  85   AGVKASSDWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTES  144

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT  LN N+TP LPLRGTITASGDL 
Sbjct  145  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNTNVTPCLPLRGTITASGDLV  204

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+ L+AE+AF  AG+  GFF L PKE LA+ NGTA GS 
Sbjct  205  PLSYIAGLLTGRPNSKAVGPNGEILNAEKAFSLAGVSGGFFELQPKEGLALVNGTAVGSG  264

Query  541  LACMVLYEANI  573
            +A MVL+EAN+
Sbjct  265  MASMVLFEANV  275



>ref|XP_008454139.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=708

 Score =   285 bits (728),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRT QG ALQKELIR LN+G+FGNG+E 
Sbjct  80   AGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQKELIRFLNSGIFGNGSES  139

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAI  LLNHN+TP LPLRGTITASGDL 
Sbjct  140  NHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIANLLNHNVTPCLPLRGTITASGDLV  199

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GPNG+ LDA+ AF +AGI+SGFF L PKE LA+ NGTA GS 
Sbjct  200  PLSYIAGLLTGRHNSKAIGPNGETLDAKAAFEQAGIDSGFFELQPKEGLALVNGTAVGSG  259

Query  541  LACMVLYEANI  573
            LA +VL+EANI
Sbjct  260  LASIVLFEANI  270



>gb|ACR10243.1| phenylalanine ammonia-lyase [Canarium album]
Length=639

 Score =   283 bits (724),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 157/191 (82%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGV+A++DWVM  M  GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  38   AGVQASSDWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGVFGNGTET  97

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVR NTLLQGY  I+F+ILEAIT  LNHNITP LPLRGTITASGDL 
Sbjct  98   CHTLPHSATRAAMLVRTNTLLQGYSGIRFDILEAITKFLNHNITPCLPLRGTITASGDLV  157

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG  L+  EAF+ AG+  GFF L PKE LA+ NGTA GS 
Sbjct  158  PLSYIAGLLTGRPNSKAVGPNGRVLNPTEAFQLAGVNGGFFELQPKEGLALVNGTAVGSG  217

Query  541  LACMVLYEANI  573
            LA MVL+EAN+
Sbjct  218  LASMVLFEANV  228



>ref|XP_008449240.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Cucumis melo]
Length=714

 Score =   285 bits (728),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GV+A++ WVM  M+ GT+SYGVTTGFGATS RRTK+G ALQ+ELIR LNAG+FG G E  
Sbjct  87   GVEASSKWVMDSMNQGTDSYGVTTGFGATSHRRTKEGGALQRELIRFLNAGVFGRGTESS  146

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHN+TP LPLRGTITASGDL P
Sbjct  147  HTLPHSSTRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNVTPCLPLRGTITASGDLVP  206

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR+NSKA+GPNG++LDA+EAF++AGI SGFF L PKE LA+ NGTA GS L
Sbjct  207  LSYIAGLLTGRSNSKAIGPNGESLDAKEAFKQAGIPSGFFELQPKEGLALVNGTAVGSGL  266

Query  544  ACMVLYEANI  573
            A +VL+EANI
Sbjct  267  ASIVLFEANI  276



>gb|AAK62030.1| phenylalanine ammonia-lyase 1 [Manihot esculenta]
Length=710

 Score =   284 bits (727),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWV+  M+ GT+SYGVTTGFGATS RRTKQG ALQ+ELIR LNAG+FGNG E 
Sbjct  82   AGVKASSDWVLDSMNKGTDSYGVTTGFGATSHRRTKQGGALQRELIRFLNAGIFGNGQES  141

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL+H+ T+AA+LVRINTLLQGY  I+FEILEAIT  +N+N+TP LPLRGTITASGDL 
Sbjct  142  CHTLSHTATRAAMLVRINTLLQGYSGIRFEILEAITKFINNNVTPRLPLRGTITASGDLV  201

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSK++GPNG++LDA EAF+ AGI  GFF L PKE LA+ NGTA GS 
Sbjct  202  PLSYIAGLLTGRPNSKSLGPNGESLDAAEAFKLAGINGGFFELQPKEGLALVNGTAVGSG  261

Query  541  LACMVLYEANI  573
            LA MVL+EAN+
Sbjct  262  LASMVLFEANV  272



>gb|ACM44926.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   285 bits (728),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+NGT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  93   AGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTET  152

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             H L HS TKAA++VRINTLLQGY  I+FEILEAIT LLN NITP LPLRGTITASGDL 
Sbjct  153  SHILPHSATKAAMIVRINTLLQGYSGIRFEILEAITKLLNTNITPCLPLRGTITASGDLV  212

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR+NSKA GPNG++LDA++AF  AGI+SG F L PKE LA+ NGTA GS 
Sbjct  213  PLSYIAGLLTGRSNSKATGPNGESLDAQQAFSEAGIDSGLFELQPKEGLALVNGTAVGSG  272

Query  541  LACMVLYEANI  573
             A MVL++ANI
Sbjct  273  SASMVLFDANI  283



>gb|ACM62741.1| phenylalanine ammonia-lyase [Garcinia mangostana]
Length=718

 Score =   285 bits (728),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+NGT+SYGVTTGFGATS RRTKQGAALQKELIR LNAG+FGNG E 
Sbjct  90   AGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFGNGTET  149

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEA+T  LN+NITP LPLRGTITASGDL 
Sbjct  150  SHTLPHSATRAAMLVRINTLLQGYSGIRFEILEALTKFLNYNITPCLPLRGTITASGDLV  209

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR+N+KAVGPNG  L+AEEAF  AG+   FF L PKE LA+ NGTA GS 
Sbjct  210  PLSYIAGLLTGRSNAKAVGPNGQTLNAEEAFSLAGVGYQFFELQPKEGLALVNGTAVGSG  269

Query  541  LACMVLYEANI  573
            LA MVL+EANI
Sbjct  270  LASMVLFEANI  280



>gb|AAX22053.1| phenylalanine ammonia-lyase [Brassica napus]
 gb|AAX22054.1| phenylalanine ammonia-lyase [Brassica napus]
Length=724

 Score =   285 bits (728),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQ ELIR LNAG+FGN  E 
Sbjct  96   AGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGTALQTELIRFLNAGIFGNTKET  155

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL  S T+AA+LVR+NTLLQGY  I+FEILEAIT+LLNHNI+P LPLRGTITASGDL 
Sbjct  156  CHTLPESATRAAMLVRVNTLLQGYSGIRFEILEAITSLLNHNISPSLPLRGTITASGDLV  215

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA GPNG++L AEEAF++AGI SGFF L PKE LA+ NGTA GS 
Sbjct  216  PLSYIAGLLTGRPNSKATGPNGESLTAEEAFKKAGITSGFFDLQPKEGLALVNGTAVGSG  275

Query  541  LACMVLYEANI  573
            +A MVL+EAN+
Sbjct  276  MASMVLFEANV  286



>ref|XP_004143258.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 ref|XP_004156291.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 gb|KGN48163.1| hypothetical protein Csa_6G445760 [Cucumis sativus]
Length=713

 Score =   284 bits (726),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FG+GAE 
Sbjct  85   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGSGAES  144

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL 
Sbjct  145  DHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLV  204

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GPNG+ + A+EAF++A I SGFF L PKE LA+ NGTA GS 
Sbjct  205  PLSYIAGLLTGRPNSKAIGPNGERITAKEAFQQADIPSGFFELQPKEGLALVNGTAVGSG  264

Query  541  LACMVLYEANI  573
            LA +VL+EANI
Sbjct  265  LASIVLFEANI  275



>ref|XP_004249558.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=711

 Score =   284 bits (726),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FGNG E 
Sbjct  83   AGVKASSDWVMESMSKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGVFGNGTES  142

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL  S T+AA+LVRINTLLQGY  I+FEILEAIT L+NHN+TP LPLRGTITASGDL 
Sbjct  143  CHTLPQSSTRAAMLVRINTLLQGYSGIRFEILEAITKLINHNVTPCLPLRGTITASGDLV  202

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+ L+AEEAF  AG+  GFF L PKE LA+ NGTA GS 
Sbjct  203  PLSYIAGLLTGRPNSKAVGPNGETLNAEEAFHVAGVNGGFFELQPKEGLALVNGTAVGSG  262

Query  541  LACMVLYEANI  573
            LA +VL++AN+
Sbjct  263  LASIVLFDANV  273



>gb|ACR15762.1| phenylalanine ammonia-lyase [Litchi chinensis]
Length=723

 Score =   284 bits (727),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 160/190 (84%), Gaps = 2/190 (1%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA++DWVM  M+NGT+ YGVTTG GATS RRTKQGAALQ+ELIR LNAG+FGNG E C
Sbjct  99   GVKASSDWVMDSMNNGTDCYGVTTGSGATSHRRTKQGAALQRELIRFLNAGVFGNGTESC  158

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGTITASGDL P
Sbjct  159  HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLVP  218

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKA GPNG+ LDA+EA +RAG   GFF L PKE LA+ NGTA GS L
Sbjct  219  LSYIAGLLTGRPNSKATGPNGETLDAKEASQRAGF--GFFELQPKEGLALVNGTAVGSGL  276

Query  544  ACMVLYEANI  573
            A MVL+EANI
Sbjct  277  ASMVLFEANI  286



>dbj|BAA95629.1| phenylalanine ammonia lyase [Catharanthus roseus]
Length=716

 Score =   284 bits (726),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  88   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTES  147

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT  LNHNITP LPLRGTITASGDL 
Sbjct  148  SHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNITPCLPLRGTITASGDLV  207

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+ ++ E+AF+ AG+  G F L PKE LA+ NGTA GS 
Sbjct  208  PLSYIAGLLTGRPNSKAVGPNGEIVNPEQAFKMAGVNDGLFELQPKEGLALVNGTAVGSG  267

Query  541  LACMVLYEANI  573
            +A MVL+EANI
Sbjct  268  MASMVLFEANI  278



>ref|XP_010262867.1| PREDICTED: phenylalanine ammonia-lyase [Nelumbo nucifera]
Length=715

 Score =   284 bits (726),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  87   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTES  146

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT  LN+NITP LPLRGTITASGDL 
Sbjct  147  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNNITPCLPLRGTITASGDLV  206

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP+G  L+A EAF  AG+  GFF L PKE LA+ NGTA GS 
Sbjct  207  PLSYIAGLLTGRPNSKAVGPDGHILNASEAFNLAGVNDGFFELQPKEGLALVNGTAVGSG  266

Query  541  LACMVLYEANI  573
            LA MVL+E NI
Sbjct  267  LASMVLFETNI  277



>ref|XP_010253912.1| PREDICTED: phenylalanine ammonia-lyase [Nelumbo nucifera]
Length=713

 Score =   284 bits (726),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  85   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGVES  144

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLN NITP LPLRGTITASGDL 
Sbjct  145  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNSNITPCLPLRGTITASGDLV  204

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NS AVGP+G  L+A EAF  AGI  GFF L PKE LA+ NGTA GS 
Sbjct  205  PLSYIAGLLTGRPNSVAVGPDGQNLNAAEAFSLAGINGGFFELQPKEGLALVNGTAVGSG  264

Query  541  LACMVLYEANI  573
            LA MVL+EAN+
Sbjct  265  LASMVLFEANV  275



>gb|AFK43896.1| unknown [Medicago truncatula]
Length=374

 Score =   274 bits (701),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  84   AGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTES  143

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
              TL H+ T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL 
Sbjct  144  NCTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLV  203

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP+G+ L+A+EAF+ AGI S FF L PKE LA+ NGTA GS 
Sbjct  204  PLSYIAGLLTGRPNSKAVGPSGEILNAKEAFQLAGIGSDFFELQPKEGLALVNGTAVGSG  263

Query  541  LACMVLYEANI  573
            LA +VL+EAN+
Sbjct  264  LASIVLFEANV  274



>ref|XP_007009873.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
 gb|EOY18683.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
Length=713

 Score =   284 bits (726),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 159/190 (84%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
             VKA++DWVM GM+ GT+SYGVTTGFGATS RRTKQGAALQKELIR LNAG+FG G E C
Sbjct  86   AVKASSDWVMEGMNRGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGVFGQGTESC  145

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL H+ T+AA+LVRINTLLQGY  I+FEILEAIT LLN NITP LPLRGTITASGDL P
Sbjct  146  HTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNVNITPCLPLRGTITASGDLVP  205

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKAVGP G+AL+  EAF RAGI  GFF L PKE LA+ NGTA GS L
Sbjct  206  LSYIAGLLTGRPNSKAVGPKGEALNPTEAFSRAGINGGFFELQPKEGLALVNGTAVGSGL  265

Query  544  ACMVLYEANI  573
            A +VL+EAN+
Sbjct  266  ASLVLFEANV  275



>gb|ACX31148.1| phenylalanine ammonialyase, partial [Brassica juncea var. napiformis]
Length=635

 Score =   282 bits (721),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FG+  E 
Sbjct  22   AGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGSTKET  81

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT+ LN+NITP LPLRGTITASGDL 
Sbjct  82   SHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITSFLNNNITPSLPLRGTITASGDLV  141

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA GPNG+AL+AEEAF+ AG+ SGFF L PKE LA+ NGTA GS 
Sbjct  142  PLSYIAGLLTGRPNSKATGPNGEALNAEEAFKMAGVTSGFFDLQPKEGLALVNGTAVGSG  201

Query  541  LACMVLYEANI  573
            +A MVL+EAN+
Sbjct  202  MASMVLFEANV  212



>ref|XP_009103852.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Brassica rapa]
Length=718

 Score =   284 bits (726),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQ ELIR LNAG+FGN  E 
Sbjct  90   AGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGVALQTELIRFLNAGIFGNTKET  149

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL  S T+AA+LVR+NTLLQGY  I+FEILEAIT+LLNHNI+P LPLRGTITASGDL 
Sbjct  150  CHTLPESATRAAMLVRVNTLLQGYSGIRFEILEAITSLLNHNISPSLPLRGTITASGDLV  209

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA GPNG++L AEEAF++AGI SGFF L PKE LA+ NGTA GS 
Sbjct  210  PLSYIAGLLTGRPNSKATGPNGESLTAEEAFKQAGIASGFFDLQPKEGLALVNGTAVGSG  269

Query  541  LACMVLYEANI  573
            +A MVL+EAN+
Sbjct  270  MASMVLFEANV  280



>ref|XP_010107520.1| Phenylalanine ammonia-lyase [Morus notabilis]
 gb|EXC16202.1| Phenylalanine ammonia-lyase [Morus notabilis]
Length=725

 Score =   284 bits (726),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA++DWVM  M  GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E C
Sbjct  99   GVKASSDWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTESC  158

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL H+ T++A+LVRINTLLQGY  I+FEILEA+T LLN N+TP LPLRGT+TASGDL P
Sbjct  159  HTLPHTATRSALLVRINTLLQGYSGIRFEILEAMTKLLNSNVTPCLPLRGTVTASGDLVP  218

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKAVGPNG++L A +AF+ AGI SGFF L PKE LA+ NGTA GS L
Sbjct  219  LSYIAGLLTGRPNSKAVGPNGESLTATQAFKVAGINSGFFELQPKEGLALVNGTAVGSGL  278

Query  544  ACMVLYEANI  573
            A MVL++ANI
Sbjct  279  ASMVLFDANI  288



>gb|AEM63671.1| phenylalanine ammonia lyase 2 [Platycodon grandiflorus]
Length=708

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+NGT+SYGVTTGFGATS RRTK+G ALQKELIR LNAG+FGNG E 
Sbjct  80   AGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTKEGGALQKELIRFLNAGIFGNGTES  139

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+A++LVRINTLLQGY  I+FEILEAIT  LNHNITP LPLRGTITASGDL 
Sbjct  140  SHTLPHSTTRASMLVRINTLLQGYSGIRFEILEAITEFLNHNITPCLPLRGTITASGDLV  199

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP+G +L A EAF  AG+ SGFF L PKE LA+ NGTA GS 
Sbjct  200  PLSYIAGLLTGRPNSKAVGPDGQSLTAAEAFELAGLSSGFFELQPKEGLALVNGTAVGSG  259

Query  541  LACMVLYEANI  573
            +A +VL+EANI
Sbjct  260  MASVVLFEANI  270



>ref|XP_010067319.1| PREDICTED: phenylalanine ammonia-lyase-like [Eucalyptus grandis]
 gb|KCW65432.1| hypothetical protein EUGRSUZ_G02852 [Eucalyptus grandis]
Length=714

 Score =   283 bits (724),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            A VKA++DWVM  M NGT+SYG+TTGFGATS RRTKQG ALQ ELIR LNAG+FGNG E 
Sbjct  86   AAVKASSDWVMESMSNGTDSYGITTGFGATSHRRTKQGGALQMELIRFLNAGIFGNGTES  145

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILE +  LLN NITP LPLRGT+TASGDL 
Sbjct  146  CHTLPHSTTRAAMLVRINTLLQGYSGIRFEILETMAKLLNRNITPCLPLRGTVTASGDLV  205

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG++L+A EAFR AGIE GFF L PKE LA+ NGTA GS 
Sbjct  206  PLSYIAGLLTGRPNSKAVGPNGESLNAVEAFRLAGIEHGFFDLQPKEGLAIVNGTAVGSG  265

Query  541  LACMVLYEANI  573
            LA +VL+EANI
Sbjct  266  LASIVLFEANI  276



>gb|ADI40166.1| phenylalanine ammonia-lyase [Morus alba]
Length=726

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 159/190 (84%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA++DWVM  MD GT+SYGVTTGFGATS RRTKQG A QKELIR LNAG+FGNG E C
Sbjct  99   GVKASSDWVMESMDKGTDSYGVTTGFGATSHRRTKQGVAFQKELIRFLNAGIFGNGTESC  158

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL H+ T AA+LVRINTLLQGY  I+FEILEA+T LLN N+TP LPLRGT+TASGDL P
Sbjct  159  HTLPHTTTGAALLVRINTLLQGYSGIRFEILEAMTKLLNGNVTPCLPLRGTVTASGDLVP  218

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKAVGPNG++L A +AF+ AGI SGFF L PKE LA+ NGTA GS L
Sbjct  219  LSYIAGLLTGRPNSKAVGPNGESLTATQAFKVAGINSGFFELQPKEGLALVNGTAVGSGL  278

Query  544  ACMVLYEANI  573
            A MVL++ANI
Sbjct  279  ASMVLFDANI  288



>emb|CBI26448.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = +1

Query  40   MDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*CHTLTHSLTKAAV  219
            M  GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E CHTL HS T+AA+
Sbjct  1    MSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTESCHTLPHSATRAAM  60

Query  220  LVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGPLSYIDGLITGRT  399
            LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGT+TASGDL PLSYI GL+TGR 
Sbjct  61   LVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTVTASGDLVPLSYISGLLTGRP  120

Query  400  NSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRLACMVLYEANI  573
            NSKAVGP+G+ ++AEEAF+ AGIESGFF L PKE LA+ NGTA GS LA MVL+E N+
Sbjct  121  NSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGLALVNGTAVGSGLASMVLFETNV  178



>ref|XP_004246651.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   283 bits (724),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FGNG E 
Sbjct  93   AGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGVFGNGTES  152

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT L+N NITP LPLRGTITASGDL 
Sbjct  153  SHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNITPCLPLRGTITASGDLV  212

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+ L+AEEAF  AG+ SGFF L PKE LA+ NGTA GS 
Sbjct  213  PLSYIAGLLTGRPNSKAVGPNGEKLNAEEAFHVAGVTSGFFELQPKEGLALVNGTAVGSG  272

Query  541  LACMVLYEANI  573
            +A MVL+E+NI
Sbjct  273  MASMVLFESNI  283



>ref|XP_006354337.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X2 [Solanum 
tuberosum]
Length=719

 Score =   283 bits (724),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FGNG E 
Sbjct  91   AGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGVFGNGTES  150

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT L+N NITP LPLRGT+TASGDL 
Sbjct  151  SHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNITPCLPLRGTVTASGDLV  210

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+ LDA+EAFR AG+  GFF L PKE LA+ NGTA GS 
Sbjct  211  PLSYIAGLLTGRPNSKAVGPNGEKLDADEAFRVAGVSGGFFELQPKEGLALVNGTAVGSG  270

Query  541  LACMVLYEANI  573
            +A +VLY++NI
Sbjct  271  MASIVLYDSNI  281



>sp|O04058.2|PALY_HELAN RecName: Full=Phenylalanine ammonia-lyase [Helianthus annuus]
 emb|CAA73065.1| phenylalanine ammonia lyase [Helianthus annuus]
Length=667

 Score =   282 bits (721),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FGNG E 
Sbjct  83   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGIFGNGTES  142

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT  LN+NITP LPLRGTITASGDL 
Sbjct  143  SHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNNITPCLPLRGTITASGDLV  202

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP G+ L+AE AF +AG+E GFF L PKE LA+ NGTA GS 
Sbjct  203  PLSYIAGLLTGRPNSKAVGPAGEVLNAESAFAQAGVEGGFFELQPKEGLALVNGTAVGSG  262

Query  541  LACMVLYEANI  573
            +A MVL+EAN+
Sbjct  263  MASMVLFEANV  273



>sp|P26600.1|PAL5_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
 gb|AAA34176.1| phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   283 bits (724),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FGNG E 
Sbjct  93   AGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGVFGNGTES  152

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT L+N NITP LPLRGTITASGDL 
Sbjct  153  SHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNITPCLPLRGTITASGDLV  212

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+ L+AEE FR AG+ SGFF L PKE LA+ NGTA GS 
Sbjct  213  PLSYIAGLLTGRPNSKAVGPNGEKLNAEERFRVAGVTSGFFELQPKEGLALVNGTAVGSG  272

Query  541  LACMVLYEANI  573
            +A MVL+E+NI
Sbjct  273  MASMVLFESNI  283



>gb|AFP49807.1| phenylalanine ammonialyase 4 [Coffea arabica]
Length=713

 Score =   283 bits (723),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA+++WV+  M+NGT+SYGVTTGFGATS RRTKQG ALQ ELIR LNAG+FGNGAE 
Sbjct  86   AGVKASSEWVVESMNNGTDSYGVTTGFGATSHRRTKQGTALQTELIRFLNAGIFGNGAES  145

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEA+T LLNHNITP LPLRGTITASGDL 
Sbjct  146  GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEALTRLLNHNITPCLPLRGTITASGDLV  205

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NS+ VGPNG +LDA EAF+ AG+ SGFF L PKE LA+ NGTA GS 
Sbjct  206  PLSYIAGLLTGRPNSRCVGPNGRSLDATEAFQIAGMNSGFFELQPKEGLALVNGTAVGSG  265

Query  541  LACMVLYEANI  573
            LA MVL+EAN+
Sbjct  266  LASMVLFEANL  276



>gb|AJO53274.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=715

 Score =   283 bits (723),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FG+G E 
Sbjct  87   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRSLNAGIFGSGTES  146

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT  LN NITP LPLRGTITASGDL 
Sbjct  147  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNKNITPCLPLRGTITASGDLV  206

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP+G  L+AEEAF+  G+  GFF L PKE LA+ NGTA GS 
Sbjct  207  PLSYIAGLLTGRPNSKAVGPDGATLNAEEAFKLVGVNGGFFELQPKEGLALVNGTAVGSG  266

Query  541  LACMVLYEANI  573
            LA + LYEANI
Sbjct  267  LASIALYEANI  277



>ref|XP_009629066.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
 sp|P25872.1|PAL1_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 gb|AAA34122.1| phenylalanine ammonia lyase [Nicotiana tabacum]
 dbj|BAA22948.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=715

 Score =   283 bits (723),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FGNG E 
Sbjct  87   AGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGVFGNGTET  146

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT L+N NITP LPLRGTITASGDL 
Sbjct  147  SHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNITPCLPLRGTITASGDLV  206

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+ L+AEEAFR AG+  GFF L PKE LA+ NGTA GS 
Sbjct  207  PLSYIAGLLTGRPNSKAVGPNGETLNAEEAFRVAGVNGGFFELQPKEGLALVNGTAVGSG  266

Query  541  LACMVLYEANI  573
            +A MVL+++NI
Sbjct  267  MASMVLFDSNI  277



>ref|XP_004143255.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Cucumis sativus]
 gb|KGN48160.1| Phenylalanine ammonia-lyase [Cucumis sativus]
Length=714

 Score =   282 bits (722),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GV+A++ WVM  M+ GT+SYGVTTGFGATS RRTK+G ALQ+ELIR LNAG+FGNG E  
Sbjct  87   GVEASSKWVMDSMNQGTDSYGVTTGFGATSHRRTKEGGALQRELIRFLNAGVFGNGTESS  146

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL H  T+AA+LVRINTLLQGY  I+FEILEAIT LLNHN+TP LPLRGTITASGDL P
Sbjct  147  HTLPHLATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNVTPCLPLRGTITASGDLVP  206

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR+NSKA+GPNG++LDA+EAF++A I SGFF L PKE LA+ NGTA GS L
Sbjct  207  LSYIAGLLTGRSNSKAIGPNGESLDAKEAFKQASIPSGFFELQPKEGLALVNGTAVGSGL  266

Query  544  ACMVLYEANI  573
            A +VL+EANI
Sbjct  267  ASIVLFEANI  276



>gb|AAX22055.1| phenylalanine ammonia-lyase [Brassica napus]
 gb|AAX22056.1| phenylalanine ammonia-lyase [Brassica napus]
Length=723

 Score =   283 bits (723),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQ ELIR LNAG+FGN  E 
Sbjct  95   AGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGTALQTELIRFLNAGIFGNTKET  154

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL  S T+AA+LVR+NTLLQGY  I+FEILEAIT+ LNHNI+P LPLRGTITASGDL 
Sbjct  155  CHTLPESATRAAMLVRVNTLLQGYSGIRFEILEAITSFLNHNISPSLPLRGTITASGDLV  214

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA GPNG++L AEEAF++AGI SGFF L PKE LA+ NGTA GS 
Sbjct  215  PLSYIAGLLTGRPNSKATGPNGESLTAEEAFKQAGIASGFFDLQPKEGLALVNGTAVGSG  274

Query  541  LACMVLYEANI  573
            +A MVL+EAN+
Sbjct  275  MASMVLFEANV  285



>gb|AGT63063.1| phenylalanine ammonia-lyase [Solanum tuberosum]
Length=722

 Score =   282 bits (722),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FGNG E 
Sbjct  94   AGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGVFGNGTES  153

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT L+N NITP LPLRGTITASGDL 
Sbjct  154  SHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNITPCLPLRGTITASGDLV  213

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+ L+AEEAFR AG+  GFF L PKE LA+ NGTA GS 
Sbjct  214  PLSYIAGLLTGRPNSKAVGPNGEKLNAEEAFRVAGVTGGFFELQPKEGLALVNGTAVGSG  273

Query  541  LACMVLYEANI  573
            +A MVL+++NI
Sbjct  274  MASMVLFDSNI  284



>gb|AIA66448.1| PAL1 [Capsicum annuum]
Length=717

 Score =   282 bits (722),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FGNG   
Sbjct  89   AGVKASSDWVMDSMCKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGVFGNGTGS  148

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT L+N NITP LPLRGTITASGDL 
Sbjct  149  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNITPCLPLRGTITASGDLV  208

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR N+KAVGPNG+ L+AEEAFR AG+  GFF L PKE LA+ NGTA GS 
Sbjct  209  PLSYIAGLLTGRPNAKAVGPNGEKLNAEEAFRVAGVSGGFFELQPKEGLALVNGTAVGSG  268

Query  541  LACMVLYEANI  573
            +A MVL+E+NI
Sbjct  269  MASMVLFESNI  279



>gb|ACF17667.1| putative phenylalanine ammonia-lyase [Capsicum annuum]
Length=717

 Score =   282 bits (722),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FGNG   
Sbjct  89   AGVKASSDWVMDSMCKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGVFGNGTGS  148

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT L+N NITP LPLRGTITASGDL 
Sbjct  149  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNITPCLPLRGTITASGDLV  208

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR N+KAVGPNG+ L+AEEAFR AG+  GFF L PKE LA+ NGTA GS 
Sbjct  209  PLSYIAGLLTGRPNAKAVGPNGEKLNAEEAFRVAGVSGGFFELQPKEGLALVNGTAVGSG  268

Query  541  LACMVLYEANI  573
            +A MVL+E+NI
Sbjct  269  MASMVLFESNI  279



>ref|XP_008454137.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=713

 Score =   282 bits (722),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRT QG ALQKELIR LN+G+FGN +E 
Sbjct  85   AGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQKELIRFLNSGIFGNESES  144

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAI  LLNHN+TP LPLRGTITASGDL 
Sbjct  145  NHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIANLLNHNVTPCLPLRGTITASGDLV  204

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GPNG+ LDA+ AF +AGI+SGFF L PKE LA+ NGTA GS 
Sbjct  205  PLSYIAGLLTGRHNSKAIGPNGETLDAKAAFEQAGIDSGFFELQPKEGLALVNGTAVGSG  264

Query  541  LACMVLYEANI  573
            LA +VL+EANI
Sbjct  265  LASIVLFEANI  275



>sp|O23924.1|PALY_DIGLA RecName: Full=Phenylalanine ammonia-lyase [Digitalis lanata]
 emb|CAA05251.1| phenylalanine ammonia lyase [Digitalis lanata]
Length=713

 Score =   282 bits (722),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 160/192 (83%), Gaps = 1/192 (1%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  84   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTES  143

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILE IT  LNHNITP LPLRGTITASGDL 
Sbjct  144  THTLPHSATRAAMLVRINTLLQGYSGIRFEILETITKFLNHNITPCLPLRGTITASGDLV  203

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESG-FF*LHPKERLAMANGTADGS  537
            PLSYI GL+TGR NSKAVGPNG++L+AE+AF+ AG  SG FF L PKE LA+ NGTA GS
Sbjct  204  PLSYIAGLLTGRPNSKAVGPNGESLNAEQAFKLAGANSGLFFELQPKEGLALVNGTAVGS  263

Query  538  RLACMVLYEANI  573
             LA + LYEANI
Sbjct  264  GLASIALYEANI  275



>gb|AIZ76766.1| PAL2, partial [Pyrus pyrifolia]
Length=433

 Score =   275 bits (702),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 154/191 (81%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTKQGAALQKELIR LNAG+FG+  E 
Sbjct  48   AGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGVFGSATES  107

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL H  T+AA+LVRINTLLQGY  I+FEILEAIT  LN+N+TP LPLRGTITASGDL 
Sbjct  108  GHTLPHQATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNNVTPCLPLRGTITASGDLV  167

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG  L+A EAF   GI SGFF L PKE LA+ NGTA GS 
Sbjct  168  PLSYIAGLLTGRPNSKAVGPNGQTLNASEAFELVGINSGFFELQPKEGLALVNGTAVGSG  227

Query  541  LACMVLYEANI  573
            LA  VL+E NI
Sbjct  228  LASTVLFETNI  238



>ref|XP_003554382.1| PREDICTED: phenylalanine ammonia-lyase 1-like isoform 1 [Glycine 
max]
Length=712

 Score =   282 bits (721),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA+++WVM  M+NGT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E  
Sbjct  85   GVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTESS  144

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL H+ T+AA+LVRINTLLQGY  I+FEILEAIT LLN+N+TP LPLRGTITASGDL P
Sbjct  145  HTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNVTPCLPLRGTITASGDLVP  204

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKAVGPNG+ L+A+EAF  A I S FF L PKE LA+ NGTA GS L
Sbjct  205  LSYIAGLLTGRPNSKAVGPNGEVLNAKEAFELASINSEFFELQPKEGLALVNGTAVGSGL  264

Query  544  ACMVLYEANI  573
            A MVL+EANI
Sbjct  265  ASMVLFEANI  274



>gb|ABG75911.1| phenylalanine ammonia-lyase 2 [Nicotiana attenuata]
Length=717

 Score =   282 bits (721),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FGNG E 
Sbjct  89   AGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGVFGNGTET  148

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT L+N NITP LPLRGTITASGDL 
Sbjct  149  NHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNITPCLPLRGTITASGDLV  208

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+ L+AEEAFR AG+  GFF L PKE LA+ NGTA GS 
Sbjct  209  PLSYIAGLLTGRPNSKAVGPNGETLNAEEAFRVAGVNGGFFELQPKEGLALVNGTAVGSG  268

Query  541  LACMVLYEANI  573
            +A MVL+++NI
Sbjct  269  MASMVLFDSNI  279



>ref|XP_010684079.1| PREDICTED: phenylalanine ammonia-lyase [Beta vulgaris subsp. 
vulgaris]
 emb|CAH17686.1| phenylalanine ammonia lyase [Beta vulgaris]
Length=719

 Score =   282 bits (721),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  91   AGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGVFGNGTES  150

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL H+ T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL 
Sbjct  151  SHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITGLLNNNITPCLPLRGTITASGDLV  210

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+ L+AE+AF+ A I SGFF L PKE LA+ NGTA GS 
Sbjct  211  PLSYIAGLLTGRPNSKAVGPNGEVLNAEQAFKAAQISSGFFELQPKEGLALVNGTAVGSG  270

Query  541  LACMVLYEANI  573
            +A +VL+E NI
Sbjct  271  MASIVLFETNI  281



>sp|P45726.1|PALY_CAMSI RecName: Full=Phenylalanine ammonia-lyase [Camellia sinensis]
 dbj|BAA05643.1| phenylalanine ammonia-lyase [Camellia sinensis]
Length=714

 Score =   282 bits (721),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA++DWVM  M+ GT+SYGVTTGFGATS RRTK+G ALQKELIR LNAG+FGNG E C
Sbjct  87   GVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKEGGALQKELIRFLNAGIFGNGTESC  146

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL  S T+AA+LVRINTLLQGY  I+FEILEAI+  LN+NITP LPLRGTITASGDL P
Sbjct  147  HTLPQSATRAAMLVRINTLLQGYSGIRFEILEAISKFLNNNITPCLPLRGTITASGDLVP  206

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKAVGP G+ L  +EAFR AG+E GFF L PKE LA+ NGTA GS L
Sbjct  207  LSYIAGLLTGRHNSKAVGPTGEILHPKEAFRLAGVEGGFFELQPKEGLALVNGTAVGSGL  266

Query  544  ACMVLYEANI  573
            A MVL+EANI
Sbjct  267  ASMVLFEANI  276



>ref|XP_010553331.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Tarenaya hassleriana]
Length=725

 Score =   282 bits (721),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FG+  E 
Sbjct  97   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGSATEK  156

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL  S T+AA+LVRINTLLQGY  I+FEILEAIT+LLNHNI P LPLRGTITASGDL 
Sbjct  157  SHTLPQSTTRAAMLVRINTLLQGYSGIRFEILEAITSLLNHNIAPCLPLRGTITASGDLV  216

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA GPNG+ L AEEAFR AGI SGFF L PKE LA+ NGTA GS 
Sbjct  217  PLSYIAGLLTGRPNSKATGPNGETLTAEEAFRSAGITSGFFDLQPKEGLALVNGTAVGSG  276

Query  541  LACMVLYEANI  573
            LA MVL++AN+
Sbjct  277  LASMVLFDANV  287



>gb|ABC69916.1| phenylalanine ammonia-lyase [Brassica napus]
Length=722

 Score =   281 bits (720),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FG+  E 
Sbjct  94   AGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGSTKET  153

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT+ LN+NITP LPLRGTITASGDL 
Sbjct  154  SHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITSFLNNNITPSLPLRGTITASGDLV  213

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA GPNG+AL+AEEAF+ AG+ SGFF L PKE LA+ NGTA GS 
Sbjct  214  PLSYIAGLLTGRPNSKATGPNGEALNAEEAFKMAGVTSGFFDLQPKESLALVNGTAVGSG  273

Query  541  LACMVLYEANI  573
            +A MVL+EAN+
Sbjct  274  MASMVLFEANV  284



>gb|AEO92029.1| phenylalanine ammonia-lyase 3 [Coffea canephora]
 gb|AEO94541.1| phenylalanine ammonia-lyase 3 [Coffea canephora]
Length=713

 Score =   281 bits (720),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA+++WV+  M+NGT+SYGVTTGFGATS RRTKQG ALQ ELIR LNAG+FGNG E 
Sbjct  86   AGVKASSEWVVESMNNGTDSYGVTTGFGATSHRRTKQGTALQTELIRFLNAGIFGNGTES  145

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEA+T LLNHNITP LPLRGTITASGDL 
Sbjct  146  GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEALTKLLNHNITPCLPLRGTITASGDLV  205

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NS+ VGPNG +LDA EAF+ AG+ SGFF L PKE LA+ NGTA GS 
Sbjct  206  PLSYIAGLLTGRPNSRCVGPNGRSLDATEAFQIAGMNSGFFELQPKEGLALVNGTAVGSG  265

Query  541  LACMVLYEANI  573
            LA MVL+EAN+
Sbjct  266  LASMVLFEANL  276



>emb|CBI26446.3| unnamed protein product [Vitis vinifera]
Length=440

 Score =   274 bits (701),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = +1

Query  40   MDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*CHTLTHSLTKAAV  219
            M  GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E CHTL HS T+AA+
Sbjct  1    MSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTESCHTLPHSATRAAM  60

Query  220  LVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGPLSYIDGLITGRT  399
            LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGT+TASGDL PLSYI GL+TGR 
Sbjct  61   LVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTVTASGDLVPLSYIAGLLTGRP  120

Query  400  NSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRLACMVLYEANI  573
            NSKAVGP+G+ ++AEEAF+ AGIESGFF L PKE LA+ NGTA GS LA MVL+E N+
Sbjct  121  NSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGLALVNGTAVGSGLASMVLFETNV  178



>gb|ABR14606.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza]
Length=711

 Score =   281 bits (719),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  83   AGVKASSDWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTES  142

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL H+ T+AA+LVRINTLLQGY  I+FEILEAIT  LN NITP LPLRGTITASGDL 
Sbjct  143  NHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKFLNENITPCLPLRGTITASGDLV  202

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+ L+AEEAF+ AG++ GFF L PKE LA+ NGTA GS 
Sbjct  203  PLSYIAGLLTGRPNSKAVGPNGEPLNAEEAFKLAGVKGGFFELQPKEGLALVNGTAVGSG  262

Query  541  LACMVLYEANI  573
            LA + L++ANI
Sbjct  263  LASIALFDANI  273



>emb|CAL91037.1| phenylalanine ammonia-lyase 1 [Cynara cardunculus var. scolymus]
Length=694

 Score =   281 bits (718),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 161/192 (84%), Gaps = 1/192 (1%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIR-VLNAGLFGNGAE  177
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK+G ALQKELIR  LNAG+FGNG E
Sbjct  65   AGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKEGGALQKELIRRFLNAGIFGNGTE  124

Query  178  *CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDL  357
              HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT  LNHN+TP+LPLRGTITASGDL
Sbjct  125  SSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNVTPFLPLRGTITASGDL  184

Query  358  GPLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGS  537
             PLSYI GL+TGR+NSKA+GP G+ L+AE+AF  AG+E GFF L PKE LA+ NGTA GS
Sbjct  185  VPLSYIAGLLTGRSNSKAIGPTGEVLNAEKAFAEAGVEGGFFELQPKEGLALVNGTAVGS  244

Query  538  RLACMVLYEANI  573
             +A MVL+EAN+
Sbjct  245  GMASMVLFEANV  256



>ref|XP_006290660.1| hypothetical protein CARUB_v10016752mg [Capsella rubella]
 gb|EOA23558.1| hypothetical protein CARUB_v10016752mg [Capsella rubella]
Length=718

 Score =   281 bits (719),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTK G ALQ ELIR LNAG+FGN  E 
Sbjct  90   AGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKNGTALQTELIRFLNAGIFGNTKEA  149

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL  S T+AA+LVR+NTLLQGY  I+FEILEAIT+LLNHNI+P LPLRGTITASGDL 
Sbjct  150  CHTLPQSATRAAMLVRVNTLLQGYSGIRFEILEAITSLLNHNISPSLPLRGTITASGDLV  209

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA GP+G++L A+EAF +AGI +GFF L PKE LA+ NGTA GS 
Sbjct  210  PLSYIAGLLTGRPNSKATGPDGESLTAKEAFEKAGISTGFFDLQPKEGLALVNGTAVGSG  269

Query  541  LACMVLYEANI  573
            +A MVL+EAN+
Sbjct  270  MASMVLFEANV  280



>gb|AEM63670.1| phenylalanine ammonia lyase 1 [Platycodon grandiflorus]
Length=710

 Score =   281 bits (719),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  84   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTES  143

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVR+NTLLQGY  I+FEILEAIT  LNHN+TP LPLRGTITASGDL 
Sbjct  144  SHTLPHSATRAAMLVRVNTLLQGYSGIRFEILEAITKFLNHNVTPVLPLRGTITASGDLV  203

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP G  L+AE+AF  AG+E GFF L PKE LA+ NG A GS 
Sbjct  204  PLSYIAGLLTGRPNSKAVGPTGQVLNAEQAFGLAGVEDGFFELQPKEGLALVNGAAVGSG  263

Query  541  LACMVLYEANI  573
            +A MVL++AN+
Sbjct  264  MASMVLFDANV  274



>emb|CAL91171.1| phenylalanine ammonia-lyase 2 [Cynara cardunculus var. scolymus]
Length=373

 Score =   271 bits (694),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 156/190 (82%), Gaps = 1/190 (1%)
 Frame = +1

Query  7    VKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIR-VLNAGLFGNGAE*C  183
            VKA++DWVM  M  GT+SYGVTTGFGATS RRTK+G ALQ ELIR  LNAG+FG+G E C
Sbjct  1    VKASSDWVMESMGKGTDSYGVTTGFGATSRRRTKEGGALQTELIRRFLNAGIFGSGTESC  60

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT  LN N+TP LPLRGTITASGDL P
Sbjct  61   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNTNVTPCLPLRGTITASGDLVP  120

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKAVGPNGD L+AE+AF  AG+  GFF L PKE LA+ NGTA GS +
Sbjct  121  LSYIAGLLTGRPNSKAVGPNGDLLNAEKAFSLAGVSGGFFDLQPKEGLALVNGTAVGSGM  180

Query  544  ACMVLYEANI  573
            A MVL+EAN+
Sbjct  181  ASMVLFEANV  190



>ref|XP_010067318.1| PREDICTED: phenylalanine ammonia-lyase [Eucalyptus grandis]
 gb|KCW65431.1| hypothetical protein EUGRSUZ_G02851 [Eucalyptus grandis]
Length=714

 Score =   281 bits (719),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            A VKA++DWVM  M NGT+SYGVTTGFGATS RRTKQG ALQ ELIR LNAG+FGNG E 
Sbjct  86   AAVKASSDWVMESMSNGTDSYGVTTGFGATSHRRTKQGGALQTELIRFLNAGIFGNGTES  145

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CH L HS T+AA+LVRINTLLQGY  I+FEILE +  LLN NITP LPLRGT+TASGDL 
Sbjct  146  CHVLPHSATRAAMLVRINTLLQGYSGIRFEILETMAKLLNRNITPCLPLRGTVTASGDLV  205

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG++L+A EAFR AGI+ GFF L PKE LA+ NGTA GS 
Sbjct  206  PLSYIAGLLTGRPNSKAVGPNGESLNAVEAFRLAGIKHGFFDLQPKEGLAIVNGTAVGSG  265

Query  541  LACMVLYEANI  573
            LA +VL+EANI
Sbjct  266  LASIVLFEANI  276



>gb|ABD73282.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza]
Length=711

 Score =   281 bits (719),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  83   AGVKASSDWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTES  142

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL H+ T+AA+LVRINTLLQGY  I+FEILEAIT  LN NITP LPLRGTITASGDL 
Sbjct  143  NHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKFLNENITPCLPLRGTITASGDLV  202

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+ L+AEEAF+ AG++ GFF L PKE LA+ NGTA GS 
Sbjct  203  PLSYIAGLLTGRPNSKAVGPNGEPLNAEEAFKLAGVKGGFFELQPKEGLALVNGTAVGSG  262

Query  541  LACMVLYEANI  573
            LA + L++ANI
Sbjct  263  LASIALFDANI  273



>ref|XP_011031723.1| PREDICTED: phenylalanine ammonia-lyase G4 [Populus euphratica]
Length=711

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG  LQKELIR LNAG+FGNG E  
Sbjct  84   GVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNGTEST  143

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL HS ++AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGTITASGDL P
Sbjct  144  HTLPHSASRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLVP  203

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKAVGPNG+ L A EAF  AGI  GFF L PKE LA+ NGTA GS L
Sbjct  204  LSYIAGLLTGRPNSKAVGPNGETLAAAEAFTLAGINGGFFELQPKEGLALVNGTAVGSGL  263

Query  544  ACMVLYEANI  573
            A MVL+EAN+
Sbjct  264  ASMVLFEANV  273



>gb|AID51445.1| phenylalanine ammonia-lyase 2 [Astragalus membranaceus]
Length=718

 Score =   281 bits (719),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+NGT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  90   AGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTES  149

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL  + T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL 
Sbjct  150  SHTLPQTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLV  209

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP+G+ L+A+EAF+ AGI  GFF L PKE LA+ NGTA GS 
Sbjct  210  PLSYIAGLLTGRPNSKAVGPSGEVLNAKEAFQLAGINDGFFELQPKEGLALVNGTAVGSA  269

Query  541  LACMVLYEANI  573
            LA +VL++ANI
Sbjct  270  LASIVLFDANI  280



>gb|AAL55242.1|AF299330_1 phenylalanine ammonia-lyase [Lactuca sativa]
Length=711

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  83   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTET  142

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA++VRINTLLQGY  I+FEILEAIT  LN+NITP LPLRGTITASGDL 
Sbjct  143  SHTLPHSATRAAMIVRINTLLQGYSGIRFEILEAITKFLNNNITPCLPLRGTITASGDLV  202

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP G+ L+AE+AF  AG+E GFF L PKE LA+ NGTA GS 
Sbjct  203  PLSYIAGLLTGRPNSKAVGPTGEVLNAEKAFAAAGVEGGFFELQPKEGLALVNGTAVGSG  262

Query  541  LACMVLYEANI  573
            +A MVL++AN+
Sbjct  263  MASMVLFDANV  273



>ref|XP_002312013.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63890.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEE89380.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG  LQKELIR LNAG+FGNG E  
Sbjct  84   GVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNGTEST  143

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL HS ++AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGTITASGDL P
Sbjct  144  HTLPHSASRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLVP  203

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKAVGPNG+ L A EAF  AGI  GFF L PKE LA+ NGTA GS L
Sbjct  204  LSYIAGLLTGRPNSKAVGPNGETLAAAEAFTLAGINGGFFELQPKEGLALVNGTAVGSGL  263

Query  544  ACMVLYEANI  573
            A MVL+EAN+
Sbjct  264  ASMVLFEANV  273



>gb|AAM12956.1| phenylalanine ammonia-lyase [Arabidopsis thaliana]
 gb|AAN15354.1| phenylalanine ammonia-lyase [Arabidopsis thaliana]
Length=717

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTK G ALQ ELIR LNAG+FGN  E 
Sbjct  89   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGTALQTELIRFLNAGIFGNTKET  148

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL  S T+AA+LVR+NTLLQGY  I+FEILEAIT+LLNHNI+P LPLRGTITASGDL 
Sbjct  149  CHTLPQSATRAAMLVRVNTLLQGYSGIRFEILEAITSLLNHNISPSLPLRGTITASGDLV  208

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA GP+G++L A+EAF +AGI +GFF L PKE LA+ NGTA GS 
Sbjct  209  PLSYIAGLLTGRPNSKATGPDGESLTAKEAFEKAGISTGFFDLQPKEGLALVNGTAVGSG  268

Query  541  LACMVLYEANI  573
            +A MVL+EAN+
Sbjct  269  MASMVLFEANV  279



>gb|AAF27654.1| phenylalanine ammonia lyase [Coffea arabica]
Length=217

 Score =   266 bits (680),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = +1

Query  22   DWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*CHTLTHS  201
            DWVM  M  GT+SYG+TTGFGATS RRTKQG ALQ+ELIR LNAG FGNG E CHTL HS
Sbjct  1    DWVMDCMRKGTDSYGITTGFGATSHRRTKQGGALQEELIRFLNAGTFGNGTETCHTLPHS  60

Query  202  LTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGPLSYIDG  381
             T+A++LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL PLSYI G
Sbjct  61   ATRASMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLVPLSYIVG  120

Query  382  LITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRLACMVLY  561
            L+TGR NSKAVGP+G  ++A EAF  AGI++GFF L  KE LA+ NGTA GS LA MVL+
Sbjct  121  LLTGRPNSKAVGPDGKFVNATEAFSLAGIDTGFFELQAKEGLALVNGTAVGSALASMVLF  180

Query  562  EANI  573
            EANI
Sbjct  181  EANI  184



>gb|AFZ78651.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=711

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG  LQKELIR LNAG+FGNG E  
Sbjct  84   GVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNGTEST  143

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL HS ++AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGTITASGDL P
Sbjct  144  HTLPHSASRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLVP  203

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKAVGPNG+ L A EAF  AGI  GFF L PKE LA+ NGTA GS L
Sbjct  204  LSYIAGLLTGRPNSKAVGPNGETLAAAEAFTLAGINGGFFELQPKEGLALVNGTAVGSGL  263

Query  544  ACMVLYEANI  573
            A MVL+EAN+
Sbjct  264  ASMVLFEANV  273



>ref|NP_190894.1| phenylalanine ammonia-lyase 2 [Arabidopsis thaliana]
 sp|P45724.2|PAL2_ARATH RecName: Full=Phenylalanine ammonia-lyase 2 [Arabidopsis thaliana]
 gb|AAK32895.1|AF367308_1 AT3g53260/T4D2_190 [Arabidopsis thaliana]
 emb|CAB64229.1| phenylalanine ammonia-lyase [Arabidopsis thaliana]
 gb|AAM91425.1| AT3g53260/T4D2_190 [Arabidopsis thaliana]
 gb|AAP59439.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
 gb|AEE79055.1| phenylalanine ammonia-lyase 2 [Arabidopsis thaliana]
Length=717

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTK G ALQ ELIR LNAG+FGN  E 
Sbjct  89   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGTALQTELIRFLNAGIFGNTKET  148

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL  S T+AA+LVR+NTLLQGY  I+FEILEAIT+LLNHNI+P LPLRGTITASGDL 
Sbjct  149  CHTLPQSATRAAMLVRVNTLLQGYSGIRFEILEAITSLLNHNISPSLPLRGTITASGDLV  208

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA GP+G++L A+EAF +AGI +GFF L PKE LA+ NGTA GS 
Sbjct  209  PLSYIAGLLTGRPNSKATGPDGESLTAKEAFEKAGISTGFFDLQPKEGLALVNGTAVGSG  268

Query  541  LACMVLYEANI  573
            +A MVL+EAN+
Sbjct  269  MASMVLFEANV  279



>ref|XP_006364021.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   281 bits (719),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FGNG E 
Sbjct  95   AGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGVFGNGTET  154

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT L+N NITP LPLRGTITASGDL 
Sbjct  155  SHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNITPCLPLRGTITASGDLV  214

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSK VGPNG+ L+AEEAFR AG+  GFF L PKE LA+ NGTA GS 
Sbjct  215  PLSYIAGLLTGRPNSKVVGPNGEKLNAEEAFRVAGVTGGFFELQPKEGLALVNGTAVGSA  274

Query  541  LACMVLYEANI  573
            +A +VL+E+NI
Sbjct  275  MASIVLFESNI  285



>gb|KFK34576.1| hypothetical protein AALP_AA5G163700 [Arabis alpina]
Length=707

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FGN  E 
Sbjct  79   AGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGNTKET  138

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL  + T+AA+LVR+NTLLQGY  I+FEILEAIT+LLN+NITP LPLRGTITASGDL 
Sbjct  139  CHTLPETATRAAMLVRVNTLLQGYSGIRFEILEAITSLLNNNITPSLPLRGTITASGDLV  198

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GPNG+ L A EAF +AGI SGFF L PKE LA+ NGTA GS 
Sbjct  199  PLSYIAGLLTGRPNSKAIGPNGETLTAAEAFSKAGITSGFFDLQPKEGLALVNGTAVGSG  258

Query  541  LACMVLYEANI  573
            +A MVL+EAN+
Sbjct  259  MASMVLFEANV  269



>ref|XP_002877909.1| phenylalanine ammonia-lyase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54168.1| phenylalanine ammonia-lyase 2 [Arabidopsis lyrata subsp. lyrata]
Length=717

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTK G ALQ ELIR LNAG+FGN  E 
Sbjct  89   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGTALQTELIRFLNAGIFGNTKET  148

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL  S T+AA+LVR+NTLLQGY  I+FEILEAIT+LLNHNI+P LPLRGTITASGDL 
Sbjct  149  CHTLPQSATRAAMLVRVNTLLQGYSGIRFEILEAITSLLNHNISPSLPLRGTITASGDLV  208

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA GP+G++L A+EAF +AGI +GFF L PKE LA+ NGTA GS 
Sbjct  209  PLSYIAGLLTGRPNSKATGPDGESLTAKEAFEKAGISTGFFDLQPKEGLALVNGTAVGSG  268

Query  541  LACMVLYEANI  573
            +A MVL+EAN+
Sbjct  269  MASMVLFEANV  279



>emb|CBI26454.3| unnamed protein product [Vitis vinifera]
Length=464

 Score =   274 bits (701),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = +1

Query  40   MDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*CHTLTHSLTKAAV  219
            M  GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E CHTL HS T+AA+
Sbjct  1    MSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGRESCHTLPHSATRAAM  60

Query  220  LVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGPLSYIDGLITGRT  399
            LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGT+TASGDL PLSYI GL+TGR 
Sbjct  61   LVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTVTASGDLVPLSYIAGLLTGRP  120

Query  400  NSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRLACMVLYEANI  573
            NSKAVGP+G+ ++AEEAF+ AGIESGFF L PKE LA+ NGTA GS LA MVL+E N+
Sbjct  121  NSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGLALVNGTAVGSGLASMVLFETNV  178



>emb|CDX76219.1| BnaA04g04830D [Brassica napus]
Length=522

 Score =   276 bits (705),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 160/194 (82%), Gaps = 3/194 (2%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQ ELIR LNAG+FGN  E 
Sbjct  96   AGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGTALQTELIRFLNAGIFGNTKET  155

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL  S T+AA+LVR+NTLLQGY  I+FEILEAIT+LLNHNI+P LPLRGTITASGDL 
Sbjct  156  CHTLPESATRAAMLVRVNTLLQGYSGIRFEILEAITSLLNHNISPSLPLRGTITASGDLV  215

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMA---NGTAD  531
            PLSYI GL+TGR NSKA GP+G++L AEEAF++AGI SGFF L PKE LA+    NGTA 
Sbjct  216  PLSYIAGLLTGRPNSKATGPSGESLTAEEAFKKAGITSGFFDLQPKEGLALISQYNGTAV  275

Query  532  GSRLACMVLYEANI  573
            GS +A MVL+EAN+
Sbjct  276  GSGMASMVLFEANV  289



>gb|ADL09136.1| phenylanlanine ammonia-lyase [Brassica oleracea var. botrytis]
Length=723

 Score =   281 bits (718),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVT GFGATS RRTK G ALQ ELIR LNAG+FGN  E 
Sbjct  95   AGVKASSDWVMESMGKGTDSYGVTAGFGATSHRRTKNGTALQTELIRFLNAGIFGNTKET  154

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL  S T+AA+LVR+NTLLQGY  I+FEILEAIT+ LNHNI+P LPLRGTITASGDL 
Sbjct  155  CHTLPESATRAAMLVRVNTLLQGYSGIRFEILEAITSFLNHNISPSLPLRGTITASGDLV  214

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA GPNG++L AEEAF++AGI SGFF L PKE LA+ NGTA GS 
Sbjct  215  PLSYIAGLLTGRPNSKATGPNGESLTAEEAFKQAGIASGFFDLQPKEGLALVNGTAVGSG  274

Query  541  LACMVLYEANI  573
            +A MVL+EAN+
Sbjct  275  MASMVLFEANV  285



>gb|AHA42445.1| phenylalanine ammonia lyase, partial [Cannabis sativa]
Length=528

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FG+G E 
Sbjct  79   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGIFGHGTES  138

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+A +LVRINTLLQGY  I+FEILEA+  LLN+N+TP LPLRGTITASGDL 
Sbjct  139  CHTLPHSSTRAGLLVRINTLLQGYSGIRFEILEAMAKLLNNNVTPCLPLRGTITASGDLV  198

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG++L A+EAF+ A I S FF L PKE LA+ NGTA GS 
Sbjct  199  PLSYIAGLLTGRPNSKAVGPNGESLTAKEAFKVADINSSFFELQPKEGLALVNGTAVGSG  258

Query  541  LACMVLYEANI  573
            +A  VL+EANI
Sbjct  259  VASTVLFEANI  269



>ref|XP_009141625.1| PREDICTED: phenylalanine ammonia-lyase 1 [Brassica rapa]
Length=722

 Score =   281 bits (718),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FG+  E 
Sbjct  94   AGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGSTKET  153

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT+ LN+NITP LPLRGTITASGDL 
Sbjct  154  SHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITSFLNNNITPSLPLRGTITASGDLV  213

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA GPNG+AL+AEEAF+ AG+ SGFF L PKE LA+ NGTA GS 
Sbjct  214  PLSYIAGLLTGRPNSKATGPNGEALNAEEAFKMAGVTSGFFDLQPKEGLALVNGTAVGSG  273

Query  541  LACMVLYEANI  573
            +A MVL+EAN+
Sbjct  274  MASMVLFEANV  284



>emb|CBI26453.3| unnamed protein product [Vitis vinifera]
Length=464

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = +1

Query  40   MDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*CHTLTHSLTKAAV  219
            M  GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E CHTL HS T+AA+
Sbjct  1    MSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGRESCHTLPHSATRAAM  60

Query  220  LVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGPLSYIDGLITGRT  399
            LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGT+TASGDL PLSYI GL+TGR 
Sbjct  61   LVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTVTASGDLVPLSYIAGLLTGRP  120

Query  400  NSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRLACMVLYEANI  573
            NSKAVGP+G+ ++AEEAF+ AGIESGFF L PKE LA+ NGTA GS LA MVL+E N+
Sbjct  121  NSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGLALVNGTAVGSGLASMVLFETNV  178



>gb|ABY89690.1| phenylalanine ammonialyase 1 protein [Brassica rapa subsp. oleifera]
Length=722

 Score =   281 bits (718),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FG+  E 
Sbjct  94   AGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGSTKET  153

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT+ LN+NITP LPLRGTITASGDL 
Sbjct  154  SHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITSFLNNNITPSLPLRGTITASGDLV  213

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA GPNG+AL+AEEAF+ AG+ SGFF L PKE LA+ NGTA GS 
Sbjct  214  PLSYIAGLLTGRPNSKATGPNGEALNAEEAFKMAGVTSGFFDLQPKEGLALVNGTAVGSG  273

Query  541  LACMVLYEANI  573
            +A MVL+EAN+
Sbjct  274  MASMVLFEANV  284



>ref|XP_003556238.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Glycine max]
Length=717

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 159/190 (84%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA++DWVM  M  GT+SYGVTTGFGATS RRTKQGAALQ ELIR LNAG+FGNG E C
Sbjct  90   GVKASSDWVMDSMVKGTDSYGVTTGFGATSHRRTKQGAALQNELIRFLNAGIFGNGTESC  149

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL HS T+AA+LVRINTLLQGY  I+FEI+EAI+  LNHNITP LPLRGTITASGDL P
Sbjct  150  HTLPHSATRAAMLVRINTLLQGYSGIRFEIMEAISKFLNHNITPCLPLRGTITASGDLVP  209

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSY+ GL+ GR NSK++GPNG  L+A+EAF+ AGI+ GFF L PKE LA+ NGTA GS L
Sbjct  210  LSYVAGLLIGRPNSKSIGPNGQVLNAKEAFQLAGIDGGFFELQPKEGLALVNGTAVGSGL  269

Query  544  ACMVLYEANI  573
            A +VL+EAN+
Sbjct  270  ASVVLFEANL  279



>ref|XP_007162754.1| hypothetical protein PHAVU_001G1777001g, partial [Phaseolus vulgaris]
 gb|ESW34748.1| hypothetical protein PHAVU_001G1777001g, partial [Phaseolus vulgaris]
Length=411

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 159/190 (84%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA++DWVM  M+NGT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E  
Sbjct  88   GVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTESS  147

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL H+ T+AA+LVRINTLLQGY  I+FEILE+IT LLN+N+TP LPLRGTITASGDL P
Sbjct  148  HTLPHTATRAAMLVRINTLLQGYSGIRFEILESITKLLNNNVTPCLPLRGTITASGDLVP  207

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKAVGP+G+ L A++AF  A I S F+ L PKE LA+ NGTA GS +
Sbjct  208  LSYIAGLLTGRPNSKAVGPSGEVLTAKQAFELANINSEFYELQPKEGLALVNGTAVGSGM  267

Query  544  ACMVLYEANI  573
            A +VL++ANI
Sbjct  268  ASIVLFDANI  277



>emb|CBI26450.3| unnamed protein product [Vitis vinifera]
Length=464

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = +1

Query  40   MDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*CHTLTHSLTKAAV  219
            M  GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E CHTL HS T+AA+
Sbjct  1    MSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGRESCHTLPHSATRAAM  60

Query  220  LVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGPLSYIDGLITGRT  399
            LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGT+TASGDL PLSYI GL+TGR 
Sbjct  61   LVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTVTASGDLVPLSYIAGLLTGRP  120

Query  400  NSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRLACMVLYEANI  573
            NSKAVGP+G+ ++AEEAF+ AGIESGFF L PKE LA+ NGTA GS LA MVL+E N+
Sbjct  121  NSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGLALVNGTAVGSGLASMVLFETNV  178



>gb|KHN09507.1| Phenylalanine ammonia-lyase 1 [Glycine soja]
Length=701

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA+++WVM  M+NGT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E  
Sbjct  74   GVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTESS  133

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL H+ T+AA+LVRINTLLQGY  I+FEILEAIT LLN+N+TP LPLRGTITASGDL P
Sbjct  134  HTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNVTPCLPLRGTITASGDLVP  193

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKAVGP+G+ L+A+EAF  A I S FF L PKE LA+ NGTA GS L
Sbjct  194  LSYIAGLLTGRPNSKAVGPSGEVLNAKEAFELASINSEFFELQPKEGLALVNGTAVGSGL  253

Query  544  ACMVLYEANI  573
            A MVL+EANI
Sbjct  254  ASMVLFEANI  263



>emb|CBJ23826.1| phenylalanine ammonia-lyase [Melissa officinalis]
Length=709

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  81   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTET  140

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL H+ T+AA+LVRINTLLQGY  I+FEILEAIT  LN NITP LPLRGTITASGDL 
Sbjct  141  NHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKFLNQNITPCLPLRGTITASGDLV  200

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+ L AE+AF+ AG+  GFF L PKE LA+ NGTA GS 
Sbjct  201  PLSYIAGLLTGRPNSKAVGPNGEPLTAEQAFKLAGVNGGFFELQPKEGLALVNGTAVGSG  260

Query  541  LACMVLYEANI  573
            LA + L+EANI
Sbjct  261  LASIALFEANI  271



>ref|XP_004493977.1| PREDICTED: phenylalanine ammonia-lyase-like [Cicer arietinum]
Length=723

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA++DWVM  M+NGT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E  
Sbjct  96   GVKASSDWVMESMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTESN  155

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL H+ T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL P
Sbjct  156  HTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITNLLNNNITPCLPLRGTITASGDLVP  215

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKAVGP+G+ L+A++AF+ AGI S FF L PKE LA+ NGTA GS L
Sbjct  216  LSYIAGLLTGRPNSKAVGPSGEVLNAKQAFQMAGINSEFFELQPKEGLALVNGTAVGSAL  275

Query  544  ACMVLYEANI  573
            A +VL++ANI
Sbjct  276  ASIVLFDANI  285



>ref|XP_011077265.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase-like 
[Sesamum indicum]
Length=714

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 159/190 (84%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA+++WVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E  
Sbjct  87   GVKASSEWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTESS  146

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL HS T+A++LVRINTLLQGY  I+FE+LEAIT LLNHNITP LPLRGTITASGDL P
Sbjct  147  HTLPHSATRASMLVRINTLLQGYSGIRFEVLEAITKLLNHNITPCLPLRGTITASGDLVP  206

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+ GR NSKA+GPNG+ LD  +AF  AGI++GFF L PKE LA+ NGTA GS L
Sbjct  207  LSYIAGLLLGRPNSKAIGPNGEVLDPAQAFTLAGIDTGFFELQPKEGLALVNGTAVGSGL  266

Query  544  ACMVLYEANI  573
            A +VL+EAN+
Sbjct  267  ASIVLFEANV  276



>ref|XP_010067316.1| PREDICTED: phenylalanine ammonia-lyase [Eucalyptus grandis]
 gb|KCW65429.1| hypothetical protein EUGRSUZ_G02849 [Eucalyptus grandis]
Length=714

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            A VKA++DWVM  M NGT+SYGVTTGFGATS RRTKQG ALQ ELIR LNAG+FGNG E 
Sbjct  86   AAVKASSDWVMESMRNGTDSYGVTTGFGATSHRRTKQGGALQTELIRFLNAGIFGNGTES  145

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CH L HS T+AA+LVRINTLLQGY  I+FEILE +  LLN NITP LPLRGT+TASGDL 
Sbjct  146  CHMLPHSATRAAMLVRINTLLQGYSGIRFEILETMAKLLNRNITPCLPLRGTVTASGDLV  205

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG++L+A EAFR AGI+ GFF L PKE LA+ NGTA GS 
Sbjct  206  PLSYIAGLLTGRPNSKAVGPNGESLNAVEAFRLAGIKHGFFDLQPKEGLAIVNGTAVGSG  265

Query  541  LACMVLYEANI  573
            LA +VL+EANI
Sbjct  266  LASIVLFEANI  276



>ref|XP_003521397.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Glycine max]
Length=713

 Score =   280 bits (716),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA+++WVM  M+NGT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E  
Sbjct  86   GVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTESS  145

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL H+ T+AA+LVRINTLLQGY  I+FEILEAIT LLN+N+TP LPLRGTITASGDL P
Sbjct  146  HTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNVTPCLPLRGTITASGDLVP  205

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKAVGP+G+ L+A+EAF  A I S FF L PKE LA+ NGTA GS L
Sbjct  206  LSYIAGLLTGRPNSKAVGPSGEVLNAKEAFELASINSEFFELQPKEGLALVNGTAVGSGL  265

Query  544  ACMVLYEANI  573
            A MVL+EANI
Sbjct  266  ASMVLFEANI  275



>emb|CBI26447.3| unnamed protein product [Vitis vinifera]
Length=474

 Score =   274 bits (700),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 151/178 (85%), Gaps = 0/178 (0%)
 Frame = +1

Query  40   MDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*CHTLTHSLTKAAV  219
            M  GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E CHTL HS T+AA+
Sbjct  1    MSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGRESCHTLPHSATRAAM  60

Query  220  LVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGPLSYIDGLITGRT  399
            LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGT+TASGDL PLSYI GL+ GR 
Sbjct  61   LVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTVTASGDLVPLSYIAGLLIGRP  120

Query  400  NSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRLACMVLYEANI  573
            NSKAVGP+GD ++AEEAF+ AGIESGFF L PKE LA+ NGTA GS LA MVL+E N+
Sbjct  121  NSKAVGPSGDVVNAEEAFKMAGIESGFFELQPKEGLALVNGTAVGSGLASMVLFETNV  178



>gb|EPS61109.1| phenylalanine ammonia-lyase, partial [Genlisea aurea]
Length=678

 Score =   279 bits (714),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  MD GT+SYGVTTGFG+TS RRTKQGAALQKELIR LNAG+FGNGAE 
Sbjct  50   AGVKASSDWVMESMDKGTDSYGVTTGFGSTSHRRTKQGAALQKELIRFLNAGIFGNGAEA  109

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             H L HS T+AA+LVRINTLLQGY  I+FEILEAI   LN N+TP LPLRGTI++SGDL 
Sbjct  110  NHALPHSATRAAMLVRINTLLQGYSGIRFEILEAIAKFLNGNVTPCLPLRGTISSSGDLV  169

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI G++TGR NS+AVGP G+ L AEEAFR AG++ GFF L PKE LA+ NGTA GS 
Sbjct  170  PLSYIAGMLTGRANSRAVGPEGEILTAEEAFRLAGVDGGFFELQPKEGLALVNGTAVGSG  229

Query  541  LACMVLYEANI  573
            LA + LYEANI
Sbjct  230  LASIALYEANI  240



>emb|CDO99754.1| unnamed protein product [Coffea canephora]
Length=660

 Score =   278 bits (712),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYG+TTGFGATS RRTKQG ALQ+ELIR LNAG+FGNG E 
Sbjct  89   AGVKASSDWVMESMRKGTDSYGITTGFGATSHRRTKQGGALQEELIRFLNAGIFGNGTET  148

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+A++LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL 
Sbjct  149  CHTLPHSATRASMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLV  208

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP+G  ++A EAF  AGI++GFF L  KE LA+ NGTA GS 
Sbjct  209  PLSYIVGLLTGRPNSKAVGPDGKFVNATEAFSLAGIDTGFFELQAKEGLALVNGTAVGSA  268

Query  541  LACMVLYEANI  573
            LA MVL+EANI
Sbjct  269  LASMVLFEANI  279



>gb|AFU90757.1| phenylalanine ammonia-lyase [Epimedium sagittatum]
Length=716

 Score =   280 bits (716),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  88   AGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGVFGNGTES  147

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL  + T+AA+LVRINTLLQGY  I+FEI+EAIT  LN+NITP LPLRGTITASGDL 
Sbjct  148  THTLPQTATRAAMLVRINTLLQGYSGIRFEIMEAITKFLNNNITPCLPLRGTITASGDLV  207

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI G++TGR NSKAVGP G+AL A+EAF  AGIE+GFF L PKE LA+ NGTA GS 
Sbjct  208  PLSYIAGILTGRPNSKAVGPKGEALTAQEAFNLAGIETGFFELQPKEGLALVNGTAVGSG  267

Query  541  LACMVLYEANI  573
            LA MVL++ANI
Sbjct  268  LASMVLFDANI  278



>ref|XP_003521396.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Glycine max]
Length=716

 Score =   280 bits (715),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA+++WVM  M+NGT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E  
Sbjct  89   GVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTESS  148

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL H+ T+AA+LVRINTLLQGY  I+FEILEAIT LLN+N+TP LPLRGTITASGDL P
Sbjct  149  HTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNVTPCLPLRGTITASGDLVP  208

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKAVGP+G+ L+A+EAF  A I S FF L PKE LA+ NGTA GS L
Sbjct  209  LSYIAGLLTGRPNSKAVGPSGEVLNAKEAFELASINSEFFELQPKEGLALVNGTAVGSGL  268

Query  544  ACMVLYEANI  573
            A MVL+EANI
Sbjct  269  ASMVLFEANI  278



>dbj|BAO01110.1| phenylalanine ammonia-lyase [Vigna radiata]
Length=715

 Score =   280 bits (715),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA+++WVM  M+NGT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E C
Sbjct  88   GVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTESC  147

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL H+ T+AA+LVRINTLLQGY  I+FEILEAIT LLN+N+TP LPLRGTITASGDL P
Sbjct  148  HTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNVTPCLPLRGTITASGDLVP  207

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKAVGP+G+ L+A++AF+ A I S FF L PKE LA+ NGTA GS L
Sbjct  208  LSYIAGLLTGRPNSKAVGPSGELLNAKQAFQSANINSDFFELQPKEGLALVNGTAVGSGL  267

Query  544  ACMVLYEANI  573
            A +VL++ANI
Sbjct  268  ASIVLFDANI  277



>emb|CBI32748.3| unnamed protein product [Vitis vinifera]
Length=463

 Score =   273 bits (698),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = +1

Query  40   MDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*CHTLTHSLTKAAV  219
            M+ GT+SYGVTTGFGATS RRTK+G ALQKELIR LNAG+FGNG + CHTL HS T+AA+
Sbjct  1    MNKGTDSYGVTTGFGATSHRRTKEGGALQKELIRFLNAGIFGNGTDSCHTLPHSATRAAM  60

Query  220  LVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGPLSYIDGLITGRT  399
            LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGTITASGDL PLSYI GL+TGR 
Sbjct  61   LVRINTLLQGYSGIRFEILEAITKLLNHNITPSLPLRGTITASGDLVPLSYIAGLLTGRP  120

Query  400  NSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRLACMVLYEANI  573
            NSKAVGP G+ ++AEEAF+ AGIESGFF L PKE LA+ NGTA GS LA MVL+EAN+
Sbjct  121  NSKAVGPTGEVVNAEEAFKMAGIESGFFELQPKEGLALVNGTAVGSGLASMVLFEANV  178



>gb|ABF50788.1| phenylalanine ammonia-lyase [Isatis tinctoria]
Length=725

 Score =   280 bits (716),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK GAALQKELIR LNAG+FG+  E 
Sbjct  97   AGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGAALQKELIRFLNAGIFGSTKET  156

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA++VRINTLLQGY  I+FEILE +T+ LN+NITP LPLRGTITASGDL 
Sbjct  157  CHTLPHSATRAAMIVRINTLLQGYSGIRFEILETMTSFLNNNITPSLPLRGTITASGDLV  216

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA GPNG+AL+AEEAF+ AGI SGFF L PKE LA+ NGTA GS 
Sbjct  217  PLSYIAGLLTGRPNSKATGPNGEALNAEEAFKMAGITSGFFELQPKEGLALVNGTAVGSG  276

Query  541  LACMVLYEANI  573
            +A M L+E N+
Sbjct  277  MASMALFETNV  287



>ref|XP_006354339.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=722

 Score =   280 bits (715),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FGNG E 
Sbjct  94   AGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGVFGNGTES  153

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT L+N NITP LPLRGTITASGDL 
Sbjct  154  SHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNITPCLPLRGTITASGDLV  213

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+ L+AEEAF  AG+  GFF L PKE LA+ NGTA GS 
Sbjct  214  PLSYIAGLLTGRPNSKAVGPNGEKLNAEEAFCAAGVSGGFFELQPKEGLALVNGTAVGSG  273

Query  541  LACMVLYEANI  573
            +A MVL+++NI
Sbjct  274  MASMVLFDSNI  284



>gb|AJR20994.1| phenylalanine ammonia-lyase [Populus szechuanica]
Length=711

 Score =   279 bits (714),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 156/191 (82%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTKQG  LQKELIR LNAG+FGNG E 
Sbjct  83   AGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNGTES  142

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL  S T+AA+LVRINTLLQGY  I+FE+LEAIT LLNHNITP LPLRGTITASGDL 
Sbjct  143  SHTLPRSATRAAMLVRINTLLQGYSGIRFEMLEAITKLLNHNITPCLPLRGTITASGDLV  202

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+ L   EAF +AGI+ GFF L PKE LA+ NGTA GS 
Sbjct  203  PLSYIAGLLTGRPNSKAVGPNGEPLSPAEAFTQAGIDGGFFELQPKEGLALVNGTAVGSG  262

Query  541  LACMVLYEANI  573
            LA MVL+E N+
Sbjct  263  LASMVLFETNV  273



>gb|ABY89691.1| phenylalanine ammonialyase 2 protein [Brassica rapa subsp. oleifera]
Length=722

 Score =   280 bits (715),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FG+  E 
Sbjct  94   AGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGSTKET  153

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT+  N+NITP LPLRGTITASGDL 
Sbjct  154  SHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITSFFNNNITPSLPLRGTITASGDLV  213

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA GPNG+AL+AEEAF+ AG+ SGFF L PKE LA+ NGTA GS 
Sbjct  214  PLSYIAGLLTGRPNSKATGPNGEALNAEEAFKMAGVTSGFFDLQPKEGLALVNGTAVGSG  273

Query  541  LACMVLYEANI  573
            +A MVL+EAN+
Sbjct  274  MASMVLFEANV  284



>gb|ACC63889.1| phenylalanine ammonia-lyase [Populus trichocarpa]
Length=711

 Score =   279 bits (714),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 156/191 (82%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTKQG  LQKELIR LNAG+FGNG E 
Sbjct  83   AGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNGTES  142

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL  S T+AA+LVRINTLLQGY  I+FE+LEAIT LLNHNITP LPLRGTITASGDL 
Sbjct  143  SHTLPRSATRAAMLVRINTLLQGYSGIRFEMLEAITKLLNHNITPCLPLRGTITASGDLV  202

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+ L   EAF +AGI+ GFF L PKE LA+ NGTA GS 
Sbjct  203  PLSYIAGLLTGRPNSKAVGPNGEPLSPAEAFTQAGIDGGFFELQPKEGLALVNGTAVGSG  262

Query  541  LACMVLYEANI  573
            LA MVL+E N+
Sbjct  263  LASMVLFETNV  273



>ref|XP_002315308.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63891.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF01479.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   279 bits (713),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 156/191 (82%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTKQG  LQKELIR LNAG+FGNG E 
Sbjct  83   AGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNGTES  142

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL  S T+AA+LVRINTLLQGY  I+FE+LEAIT LLNHNITP LPLRGTITASGDL 
Sbjct  143  SHTLPRSATRAAMLVRINTLLQGYSGIRFEMLEAITKLLNHNITPCLPLRGTITASGDLV  202

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+ L   EAF +AGI+ GFF L PKE LA+ NGTA GS 
Sbjct  203  PLSYIAGLLTGRPNSKAVGPNGEPLSPAEAFTQAGIDGGFFELQPKEGLALVNGTAVGSG  262

Query  541  LACMVLYEANI  573
            LA MVL+E N+
Sbjct  263  LASMVLFETNV  273



>emb|CAL91170.1| phenylalanine ammonia-lyase 3 [Cynara cardunculus var. scolymus]
Length=264

 Score =   266 bits (680),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 150/180 (83%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIR-VLNAGLFGNGAE  177
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTKQG ALQKELIR  LNAG+FGNG+E
Sbjct  85   AGVKASSDWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRRFLNAGIFGNGSE  144

Query  178  *CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDL  357
             CHTL HS T+AA+LVRINTLLQGY  I+FEILEAIT  LN N+TP LPLRGTITASGDL
Sbjct  145  SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNTNVTPCLPLRGTITASGDL  204

Query  358  GPLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGS  537
             PLSYI GL+TGR NSKAVGPNG+ L+AE+AF  AG+  GFF L PKE LA+ NGTA GS
Sbjct  205  VPLSYIAGLLTGRPNSKAVGPNGEILNAEKAFSLAGVSGGFFELQPKEGLALVNGTAVGS  264



>ref|XP_006589419.1| PREDICTED: phenylalanine ammonia-lyase 2-like isoform X1 [Glycine 
max]
 ref|XP_006589420.1| PREDICTED: phenylalanine ammonia-lyase 2-like isoform X2 [Glycine 
max]
Length=717

 Score =   279 bits (714),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
            GVKA++DWVM  M  GT+SYGVTTGFGATS RRTKQG ALQ ELIR LNAG+FGNG E C
Sbjct  90   GVKASSDWVMDSMVKGTDSYGVTTGFGATSHRRTKQGGALQTELIRFLNAGIFGNGTESC  149

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            HTL HS T+AA+LVRINTLLQGY  I+FEI+EAIT  LNHNITP LPLRGTITASGDL P
Sbjct  150  HTLPHSATRAAMLVRINTLLQGYSGIRFEIMEAITKFLNHNITPCLPLRGTITASGDLVP  209

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSY+ GL+ GR NSK++GPNG  L+A+EAF+ AGI+ GFF L PKE LA+ NGTA GS L
Sbjct  210  LSYVAGLLIGRPNSKSIGPNGQVLNAKEAFQLAGIDGGFFELQPKEGLALVNGTAVGSGL  269

Query  544  ACMVLYEANI  573
            A  VL+EAN+
Sbjct  270  ASTVLFEANL  279



>ref|XP_002285277.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
 emb|CAN74850.1| hypothetical protein VITISV_000789 [Vitis vinifera]
Length=717

 Score =   279 bits (714),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGV+A+++WVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FG G E 
Sbjct  89   AGVQASSNWVMESMNQGTDSYGVTTGFGATSHRRTKQGNALQKELIRFLNAGIFGKGTES  148

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+AA+LVRINTLLQGY  I+FEILEA   LLN NI+P LPLRGTI+ASGDL 
Sbjct  149  CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEATVKLLNANISPCLPLRGTISASGDLV  208

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NS+AVGPNG++L+AEEAFR AGI+ GFF L PKE LA+ NGTA GS 
Sbjct  209  PLSYIAGLLTGRPNSRAVGPNGESLNAEEAFRLAGIDGGFFELQPKEGLALVNGTAVGSG  268

Query  541  LACMVLYEANI  573
            LA  VL+EANI
Sbjct  269  LASTVLFEANI  279



>gb|ACT53399.1| phenylalanine ammonia-lyase 2 [Ageratina adenophora]
Length=720

 Score =   279 bits (713),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGV A++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  92   AGVAASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTES  151

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT  LN+NITP LPLRGTITASG L 
Sbjct  152  SHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNNITPCLPLRGTITASGGLV  211

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP G+ L+AE AF RAG+E GFF L PKE LA+ NGTA GS 
Sbjct  212  PLSYIAGLLTGRPNSKAVGPTGEILNAETAFARAGVEGGFFELQPKEGLALVNGTAVGSG  271

Query  541  LACMVLYEANI  573
            +A MVL+EAN+
Sbjct  272  MASMVLFEANV  282



>emb|CAC81822.1| phenylalanine ammonia-lyase [Beta vulgaris]
Length=396

 Score =   270 bits (690),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = +1

Query  22   DWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*CHTLTHS  201
            +WVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E  HTL H+
Sbjct  1    EWVMERMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGVFGNGTESSHTLPHT  60

Query  202  LTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGPLSYIDG  381
             T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL PLSYI G
Sbjct  61   ATRAAMLVRINTLLQGYSGIRFEILEAITGLLNNNITPCLPLRGTITASGDLVPLSYIAG  120

Query  382  LITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRLACMVLY  561
            L+TGR NSKAVGPNG+ L+AE+AF+ A I SGFF L PKE LA+ NGTA GS +A +VL+
Sbjct  121  LLTGRPNSKAVGPNGEVLNAEQAFKAAQISSGFFELQPKEGLALVNGTAVGSGMASIVLF  180

Query  562  EANI  573
            E NI
Sbjct  181  ETNI  184



>ref|XP_009766905.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
 gb|ACJ66297.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
 gb|ACJ66298.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
Length=717

 Score =   279 bits (713),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FGNG E 
Sbjct  89   AGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGVFGNGTET  148

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAI  L+N NITP LPLRGTITASGDL 
Sbjct  149  SHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIAKLINSNITPCLPLRGTITASGDLV  208

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAV PNG+ L+AEEAFR AG+  GFF L PKE LA+ NGTA GS 
Sbjct  209  PLSYIAGLLTGRPNSKAVSPNGETLNAEEAFRVAGVNGGFFELQPKEGLALVNGTAVGSG  268

Query  541  LACMVLYEANI  573
            +A MVL+++NI
Sbjct  269  MASMVLFDSNI  279



>gb|KGN52973.1| hypothetical protein Csa_4G008760 [Cucumis sativus]
Length=438

 Score =   271 bits (694),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRT QG ALQKELIR LN+G+FGNG+E 
Sbjct  85   AGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQKELIRFLNSGIFGNGSES  144

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT LLNHN+TP LPLRGTITASGDL 
Sbjct  145  NHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNHNVTPCLPLRGTITASGDLV  204

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GPNG+ LDA+ AF +AGI+SGFF L PKE LA+ NGTA  S+
Sbjct  205  PLSYIAGLLTGRHNSKAIGPNGETLDAKAAFTQAGIDSGFFELQPKEGLALVNGTAVVSQ  264

Query  541  LACMVL  558
            +A  VL
Sbjct  265  VAKKVL  270



>gb|AEH02821.1| phenylalanine ammonia lyase [Chrysanthemum x morifolium]
Length=717

 Score =   279 bits (713),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FGNG E 
Sbjct  89   AGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGIFGNGTEA  148

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT  LN+N+TP LPLRGTITASGDL 
Sbjct  149  SHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNNVTPCLPLRGTITASGDLV  208

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP G+ L AE+AF +AG+E GFF L PKE LA+ NGTA GS 
Sbjct  209  PLSYIAGLLTGRPNSKAVGPTGEILTAEKAFAQAGVEGGFFELQPKEGLALVNGTAVGSG  268

Query  541  LACMVLYEANI  573
            +A MVL+EAN+
Sbjct  269  MASMVLFEANV  279



>ref|XP_006364022.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   279 bits (713),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FGNG E 
Sbjct  95   AGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGVFGNGTES  154

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT L+N NITP LPLRGT+TASGDL 
Sbjct  155  SHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNITPCLPLRGTVTASGDLV  214

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPN + L+AEEAFR AG+  GFF L PKE LA+ NGTA GS 
Sbjct  215  PLSYIAGLLTGRPNSKAVGPNREKLNAEEAFRVAGVTGGFFELQPKEGLALVNGTAVGSG  274

Query  541  LACMVLYEANI  573
            +A +VLY++NI
Sbjct  275  MASIVLYDSNI  285



>gb|ACZ51372.1| phenylalanine ammonia-lyase [Dianthus caryophyllus]
Length=706

 Score =   278 bits (712),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = +1

Query  7    VKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*CH  186
            VKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E  H
Sbjct  80   VKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGVFGNGTETSH  139

Query  187  TLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGPL  366
            TL H+ ++AA+LVRINTLLQGY  I++EILEAIT+LLNH++TP LPLRGTITASGDL PL
Sbjct  140  TLPHTASRAAMLVRINTLLQGYSGIRWEILEAITSLLNHDVTPCLPLRGTITASGDLVPL  199

Query  367  SYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRLA  546
            SYI GL+TGR N+KA GPNG+ L AEEAF+ A IES FF L PKE LAM NGTA GS +A
Sbjct  200  SYIAGLLTGRPNAKAAGPNGEILTAEEAFKAAKIESPFFELQPKEGLAMVNGTAVGSGMA  259

Query  547  CMVLYEANI  573
             +VLYEANI
Sbjct  260  SIVLYEANI  268



>sp|P45732.1|PALY_STYHU RecName: Full=Phenylalanine ammonia-lyase [Stylosanthes humilis]
 gb|AAA99500.1| phenylalanine ammonia lyase [Stylosanthes humilis]
Length=715

 Score =   278 bits (712),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+NGT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  87   AGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTET  146

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
              TL H+ T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL 
Sbjct  147  NCTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLV  206

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+ L+A+EAF+ AGI S FF L PKE LA+ NGT  GS 
Sbjct  207  PLSYIAGLLTGRPNSKAVGPNGETLNAKEAFQAAGIGSDFFELQPKEGLALVNGTPVGSG  266

Query  541  LACMVLYEANI  573
            LA +VL+EANI
Sbjct  267  LASVVLFEANI  277



>ref|XP_004246652.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X2 [Solanum 
lycopersicum]
Length=719

 Score =   278 bits (712),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFG TS RRT  G+ALQK+LIR LNAG+ GNG E 
Sbjct  94   AGVKASSDWVMDSMSKGTDSYGVTTGFGDTSHRRTTNGSALQKDLIRFLNAGVLGNGTES  153

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT L+N NITP LPLRGTITASGDL 
Sbjct  154  SHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNITPCLPLRGTITASGDLV  213

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+ L+AEEAFR AG+ SGFF L PKE LA+ NGTA GS 
Sbjct  214  PLSYIAGLLTGRPNSKAVGPNGEKLNAEEAFRVAGVTSGFFELQPKEGLALVNGTAVGSG  273

Query  541  LACMVLYEANI  573
            +A MVL+E+NI
Sbjct  274  MASMVLFESNI  284



>gb|AAN52280.1|AF480620_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=711

 Score =   278 bits (711),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 156/191 (82%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
             GVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG  LQKELIR LNAG+FGNG E 
Sbjct  83   VGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNGTES  142

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS ++AA+LVRINTLLQGY  I+FEILEAIT LLNHNITP LPLRGTITASGDL 
Sbjct  143  THTLPHSASRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLV  202

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GPNG+ L A EAF  AGI  GFF L PKE LA+ NGTA GS 
Sbjct  203  PLSYIAGLLTGRPNSKALGPNGEPLTAAEAFTLAGINGGFFELQPKEGLALVNGTAVGSG  262

Query  541  LACMVLYEANI  573
            LA MVL+E N+
Sbjct  263  LASMVLFETNV  273



>gb|AFP49806.1| phenylalanine ammonialyase 1 [Coffea arabica]
Length=717

 Score =   278 bits (712),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYG+TTGFGATS RRTKQG ALQ+ELIR LNAG+FGNG E 
Sbjct  89   AGVKASSDWVMESMRKGTDSYGITTGFGATSHRRTKQGGALQEELIRFLNAGIFGNGTET  148

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+A++LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL 
Sbjct  149  CHTLPHSATRASMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLV  208

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP+G  ++A EAF  AGI++GFF L  KE LA+ NGTA GS 
Sbjct  209  PLSYIVGLLTGRPNSKAVGPDGKFVNATEAFSLAGIDTGFFELQAKEGLALVNGTAVGSA  268

Query  541  LACMVLYEANI  573
            LA MVL+EANI
Sbjct  269  LASMVLFEANI  279



>gb|KJB73539.1| hypothetical protein B456_011G238400 [Gossypium raimondii]
Length=710

 Score =   278 bits (711),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
             VKA++DWVM GM+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FG G E C
Sbjct  83   AVKASSDWVMEGMNRGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGVFGQGTESC  142

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            H+L H+ T+AA+LVRINTLLQGY  I+FEILEAIT LLN NITP +PLRG+ITASGDL P
Sbjct  143  HSLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNVNITPCVPLRGSITASGDLVP  202

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKA+GPNG+ L+  EAF +AGI  GFF L PKE LAM NGTA GS L
Sbjct  203  LSYIAGLLTGRPNSKALGPNGETLNPTEAFSKAGINGGFFELQPKEGLAMVNGTAVGSGL  262

Query  544  ACMVLYEANI  573
            A +VL+EAN+
Sbjct  263  ASLVLFEANV  272



>ref|XP_010325983.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X3 [Solanum 
lycopersicum]
Length=718

 Score =   278 bits (712),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFG TS RRT  G+ALQK+LIR LNAG+ GNG E 
Sbjct  93   AGVKASSDWVMDSMSKGTDSYGVTTGFGDTSHRRTTNGSALQKDLIRFLNAGVLGNGTES  152

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT L+N NITP LPLRGTITASGDL 
Sbjct  153  SHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNITPCLPLRGTITASGDLV  212

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+ L+AEEAFR AG+ SGFF L PKE LA+ NGTA GS 
Sbjct  213  PLSYIAGLLTGRPNSKAVGPNGEKLNAEEAFRVAGVTSGFFELQPKEGLALVNGTAVGSG  272

Query  541  LACMVLYEANI  573
            +A MVL+E+NI
Sbjct  273  MASMVLFESNI  283



>gb|AEL21616.1| phenylalanine ammonia lyase 1 [Coffea arabica]
Length=717

 Score =   278 bits (712),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYG+TTGFGATS RRTKQG ALQ+ELIR LNAG+FGNG E 
Sbjct  89   AGVKASSDWVMESMRKGTDSYGITTGFGATSHRRTKQGGALQEELIRFLNAGIFGNGTET  148

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+A++LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL 
Sbjct  149  CHTLPHSATRASMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLV  208

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP+G  ++A EAF  AGI++GFF L  KE LA+ NGTA GS 
Sbjct  209  PLSYIVGLLTGRPNSKAVGPDGKFVNATEAFSLAGIDTGFFELQAKEGLALVNGTAVGSA  268

Query  541  LACMVLYEANI  573
            LA MVL+EANI
Sbjct  269  LASMVLFEANI  279



>gb|AAK84225.1|AF401636_1 phenylalanine ammonia-lyase [Rehmannia glutinosa]
Length=708

 Score =   278 bits (711),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 159/191 (83%), Gaps = 1/191 (1%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  81   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTES  140

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             H L HS T+AA+LVRINTLLQGY  I+FEILEA+T  LNHNITP LPLRGTITASGDL 
Sbjct  141  NHALPHSATRAAMLVRINTLLQGYSGIRFEILEALTKFLNHNITPCLPLRGTITASGDLV  200

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG+AL+A EAF  AG+ SGFF L PKE LA+ NGTA GS 
Sbjct  201  PLSYIAGLLTGRPNSKAVGPNGEALNAGEAFSLAGV-SGFFELQPKEGLALVNGTAVGSG  259

Query  541  LACMVLYEANI  573
            LA + LY+ANI
Sbjct  260  LASIALYDANI  270



>ref|XP_006436446.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
 ref|XP_006485648.1| PREDICTED: phenylalanine ammonia-lyase-like [Citrus sinensis]
 gb|ESR49686.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
Length=722

 Score =   278 bits (712),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 155/191 (81%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTKQG ALQKELIR LN+G+FGNG E 
Sbjct  92   AGVKASSDWVMDSMMKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNSGIFGNGTES  151

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVR+NTLLQGY  I+FEILE IT  LNHNITP LPLRGTITASGDL 
Sbjct  152  SHTLPHSATRAAMLVRVNTLLQGYSGIRFEILETITKFLNHNITPCLPLRGTITASGDLV  211

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG  L+  EAF  AG+ SGFF L PKE LA+ NGTA GS 
Sbjct  212  PLSYIAGLLTGRPNSKAVGPNGQVLNPTEAFNLAGVTSGFFELQPKEGLALVNGTAVGSG  271

Query  541  LACMVLYEANI  573
            LA  VL+EANI
Sbjct  272  LAATVLFEANI  282



>gb|AAN32866.1|AF460203_1 phenylalanine ammonia-lyase 1 [Coffea canephora]
 gb|AAZ04477.1| phenylalanine ammonia-lyase [Coffea canephora]
 gb|AEO92027.1| phenylalanine ammonia-lyase 1 [Coffea canephora]
Length=717

 Score =   278 bits (711),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYG+TTGFGATS RRTKQG ALQ+ELIR LNAG+FGNG E 
Sbjct  89   AGVKASSDWVMESMRKGTDSYGITTGFGATSHRRTKQGGALQEELIRFLNAGIFGNGTET  148

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CHTL HS T+A++LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL 
Sbjct  149  CHTLPHSATRASMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLV  208

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGP+G  ++A EAF  AGI++GFF L  KE LA+ NGTA GS 
Sbjct  209  PLSYIVGLLTGRPNSKAVGPDGKFVNATEAFSLAGIDTGFFELQAKEGLALVNGTAVGSA  268

Query  541  LACMVLYEANI  573
            LA MVL+EANI
Sbjct  269  LASMVLFEANI  279



>ref|XP_010515816.1| PREDICTED: phenylalanine ammonia-lyase 2 [Camelina sativa]
Length=718

 Score =   278 bits (711),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTK G ALQ ELIR LNAG+FGN  E 
Sbjct  90   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGTALQTELIRFLNAGIFGNTKET  149

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL  S T+AA+LVR+NTLLQGY  I+FEILEAIT+LLNHNI+P LPLRGTITASGDL 
Sbjct  150  SHTLPESATRAAMLVRVNTLLQGYSGIRFEILEAITSLLNHNISPSLPLRGTITASGDLV  209

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA GPNG++L A+EAF +AGI +GFF L PKE LA+ NGTA GS 
Sbjct  210  PLSYIAGLLTGRPNSKATGPNGESLTAKEAFEKAGISTGFFDLQPKEGLALVNGTAVGSG  269

Query  541  LACMVLYEANI  573
            +A MVL+EAN+
Sbjct  270  MASMVLFEANV  280



>gb|KDO46246.1| hypothetical protein CISIN_1g004955mg [Citrus sinensis]
Length=722

 Score =   278 bits (711),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 155/191 (81%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTKQG ALQKELIR LN+G+FGNG E 
Sbjct  92   AGVKASSDWVMDSMMKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNSGIFGNGTES  151

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVR+NTLLQGY  I+FEILE IT  LNHNITP LPLRGTITASGDL 
Sbjct  152  SHTLPHSATRAAMLVRVNTLLQGYSGIRFEILETITKFLNHNITPCLPLRGTITASGDLV  211

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKAVGPNG  L+  EAF  AG+ SGFF L PKE LA+ NGTA GS 
Sbjct  212  PLSYIAGLLTGRPNSKAVGPNGQVLNPTEAFNLAGVTSGFFELQPKEGLALVNGTAVGSG  271

Query  541  LACMVLYEANI  573
            LA  VL+EANI
Sbjct  272  LAATVLFEANI  282



>gb|KHG26972.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=710

 Score =   278 bits (710),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    GVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*C  183
             VKA++DWVM GM+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FG G E C
Sbjct  83   AVKASSDWVMEGMNRGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGVFGQGTESC  142

Query  184  HTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGP  363
            H+L H+ T+AA+LVRINTLLQGY  I+FEILEAIT LLN NITP +PLRG+ITASGDL P
Sbjct  143  HSLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNVNITPCVPLRGSITASGDLVP  202

Query  364  LSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRL  543
            LSYI GL+TGR NSKA+GPNG+ L+  EAF +AGI  GFF L PKE LAM NGTA GS L
Sbjct  203  LSYIAGLLTGRPNSKALGPNGETLNPTEAFSKAGINGGFFELQPKEGLAMVNGTAVGSGL  262

Query  544  ACMVLYEANI  573
            A +VL+EAN+
Sbjct  263  ASLVLFEANV  272



>sp|P45734.1|PALY_TRISU RecName: Full=Phenylalanine ammonia-lyase [Trifolium subterraneum]
 gb|AAA17993.1| phenylalanine ammonia-lyase [Trifolium subterraneum]
Length=725

 Score =   278 bits (711),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTKQG ALQKELIR LNAG+FGNG E 
Sbjct  97   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTES  156

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL H+ T+AA+LVRINTLLQGY  I+FEILEAIT LLN+NITP LPLRGTITASGDL 
Sbjct  157  NHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLV  216

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR+NSKA GP+G+ L+A+EAF+ AGI + FF L PKE LA+ NGTA GS 
Sbjct  217  PLSYIAGLLTGRSNSKAHGPSGEMLNAKEAFQLAGINAEFFELQPKEGLALVNGTAVGSG  276

Query  541  LACMVLYEANI  573
            LA +VL+EANI
Sbjct  277  LASIVLFEANI  287



>ref|XP_006424540.1| hypothetical protein CICLE_v10027912mg [Citrus clementina]
 gb|ESR37780.1| hypothetical protein CICLE_v10027912mg [Citrus clementina]
Length=714

 Score =   278 bits (710),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+NGT+SYGVTTGFGATS RRTKQGAALQKELIR LNAG+FG G E 
Sbjct  86   AGVKASSDWVMESMNNGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFGKGTES  145

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
            CH L H+ T+AA+LVRINTLLQGY  I+FEILEAIT  LN NITP LPLR +ITASGDL 
Sbjct  146  CHMLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKFLNRNITPCLPLRASITASGDLV  205

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            P SYI GL+TGR NS AVGPNG++L+A EAF +AGI+ GFF L PKE LA+ NGT  G+ 
Sbjct  206  PFSYIAGLLTGRPNSVAVGPNGESLNAAEAFSQAGIDGGFFELQPKEGLALVNGTGVGAG  265

Query  541  LACMVLYEANI  573
            LA +VL+EANI
Sbjct  266  LASIVLFEANI  276



>emb|CBI26457.3| unnamed protein product [Vitis vinifera]
Length=464

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 151/178 (85%), Gaps = 0/178 (0%)
 Frame = +1

Query  40   MDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*CHTLTHSLTKAAV  219
            M  G +SYGVTTGFGATS RRTKQG ALQKELIRVLNAG+FGNG E CHTL HS T+AA+
Sbjct  1    MKKGIDSYGVTTGFGATSHRRTKQGGALQKELIRVLNAGIFGNGRESCHTLPHSATRAAM  60

Query  220  LVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLGPLSYIDGLITGRT  399
            LVRIN+LLQGY  I+FEILEAIT LLNHNITP LPLRGT+TASGDL PLSYI GL+TGR 
Sbjct  61   LVRINSLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTVTASGDLVPLSYIAGLLTGRP  120

Query  400  NSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSRLACMVLYEANI  573
            NSKAVGP+G+ ++AEEAF+ AGIESGFF L PKE  A+ NGTA GS LA MVL+E N+
Sbjct  121  NSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGFALVNGTAVGSGLASMVLFETNV  178



>gb|ABN79671.2| phenylalanine ammonia-lyase [Rudbeckia hirta]
Length=720

 Score =   278 bits (710),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M+ GT+SYGVTTGFGATS RRTK G ALQKELIR LNAG+FGNG E 
Sbjct  92   AGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGIFGNGTES  151

Query  181  CHTLTHSLTKAAVLVRINTLLQGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGDLG  360
             HTL HS T+AA+LVRINTLLQGY  I+FEILEAIT  LN+NITP LPLRGTITASGDL 
Sbjct  152  SHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNNITPCLPLRGTITASGDLV  211

Query  361  PLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADGSR  540
            PLSYI GL+TGR NSKA+GP G+ L+AE AF +AG++ GFF L PKE LA+ NGTA GS 
Sbjct  212  PLSYIAGLLTGRPNSKAMGPTGEILNAETAFAQAGVKGGFFELQPKEGLALVNGTAVGSG  271

Query  541  LACMVLYEANI  573
            +A MVL+EAN+
Sbjct  272  MASMVLFEANV  282



>ref|XP_009116020.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 2 
[Brassica rapa]
Length=725

 Score =   278 bits (711),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 159/193 (82%), Gaps = 2/193 (1%)
 Frame = +1

Query  1    AGVKATNDWVMAGMDNGTNSYGVTTGFGATSDRRTKQGAALQKELIRVLNAGLFGNGAE*  180
            AGVKA++DWVM  M  GT+SYGVTTGFGATS RRTK G ALQ ELIR LNAG+FGN  E 
Sbjct  95   AGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGTALQTELIRFLNAGIFGNTKET  154

Query  181  CHTLTHSLTKAAVLVRINTLL--QGYFRIKFEILEAITTLLNHNITPWLPLRGTITASGD  354
            CHTL  S T+AA+LVR+NTLL  QGY  I+FEILEAIT+ LNHNI+P LPLRGTITASGD
Sbjct  155  CHTLPESATRAAMLVRVNTLLLLQGYSGIRFEILEAITSFLNHNISPSLPLRGTITASGD  214

Query  355  LGPLSYIDGLITGRTNSKAVGPNGDALDAEEAFRRAGIESGFF*LHPKERLAMANGTADG  534
            L PLSYI GL+TGR NSKA GPNG++L AEEAF++AGI SGFF L PKE LA+ NGTA G
Sbjct  215  LVPLSYIAGLLTGRPNSKATGPNGESLTAEEAFKQAGIASGFFDLQPKEGLALVNGTAVG  274

Query  535  SRLACMVLYEANI  573
            S +A MVL+EAN+
Sbjct  275  SGMASMVLFEANV  287



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 682974011750