BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS032E06

Length=535
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009623191.1|  PREDICTED: ER membrane protein complex subun...    251   2e-74   Nicotiana tomentosiformis
ref|XP_011094459.1|  PREDICTED: ER membrane protein complex subun...    243   3e-71   Sesamum indicum [beniseed]
ref|XP_009597396.1|  PREDICTED: ER membrane protein complex subun...    241   9e-71   Nicotiana tomentosiformis
ref|XP_006366781.1|  PREDICTED: ER membrane protein complex subun...    240   3e-70   Solanum tuberosum [potatoes]
ref|XP_008220058.1|  PREDICTED: ER membrane protein complex subun...    238   1e-69   Prunus mume [ume]
ref|XP_007012093.1|  Catalytics isoform 2                               236   3e-69   
ref|XP_007012092.1|  Catalytics isoform 1                               236   4e-69   
ref|XP_009785843.1|  PREDICTED: ER membrane protein complex subun...    236   6e-69   Nicotiana sylvestris
ref|XP_009759124.1|  PREDICTED: ER membrane protein complex subun...    235   1e-68   Nicotiana sylvestris
ref|XP_007227052.1|  hypothetical protein PRUPE_ppa000842mg             235   1e-68   
gb|KDO79765.1|  hypothetical protein CISIN_1g002016mg                   232   4e-68   Citrus sinensis [apfelsine]
gb|KDO79766.1|  hypothetical protein CISIN_1g002016mg                   232   4e-68   Citrus sinensis [apfelsine]
gb|KDO79764.1|  hypothetical protein CISIN_1g002016mg                   233   5e-68   Citrus sinensis [apfelsine]
ref|XP_002284012.1|  PREDICTED: ER membrane protein complex subun...    232   1e-67   Vitis vinifera
ref|XP_006450658.1|  hypothetical protein CICLE_v10007348mg             232   1e-67   Citrus clementina [clementine]
gb|EYU41569.1|  hypothetical protein MIMGU_mgv1a000799mg                230   5e-67   Erythranthe guttata [common monkey flower]
gb|KDP34198.1|  hypothetical protein JCGZ_07769                         228   3e-66   Jatropha curcas
gb|KJB82870.1|  hypothetical protein B456_013G218700                    227   8e-66   Gossypium raimondii
ref|XP_010325953.1|  PREDICTED: ER membrane protein complex subun...    226   3e-65   Solanum lycopersicum
ref|XP_002516556.1|  catalytic, putative                                224   6e-65   
gb|KHG26099.1|  Uncharacterized protein F383_09262                      223   3e-64   Gossypium arboreum [tree cotton]
emb|CDP15321.1|  unnamed protein product                                223   3e-64   Coffea canephora [robusta coffee]
ref|XP_010254044.1|  PREDICTED: ER membrane protein complex subun...    221   9e-64   Nelumbo nucifera [Indian lotus]
ref|XP_010254043.1|  PREDICTED: ER membrane protein complex subun...    221   9e-64   Nelumbo nucifera [Indian lotus]
gb|KJB27314.1|  hypothetical protein B456_004G290400                    220   4e-63   Gossypium raimondii
gb|KHG26100.1|  Uncharacterized protein F383_09262                      205   8e-63   Gossypium arboreum [tree cotton]
gb|KFK25418.1|  hypothetical protein AALP_AA8G112000                    217   2e-62   Arabis alpina [alpine rockcress]
gb|EPS59522.1|  hypothetical protein M569_15283                         216   6e-62   Genlisea aurea
ref|XP_008378089.1|  PREDICTED: ER membrane protein complex subun...    216   8e-62   
gb|KJB65684.1|  hypothetical protein B456_010G108200                    214   1e-61   Gossypium raimondii
gb|KHG18967.1|  Uncharacterized protein F383_07420                      215   2e-61   Gossypium arboreum [tree cotton]
gb|KJB65683.1|  hypothetical protein B456_010G108200                    215   2e-61   Gossypium raimondii
gb|KJB65682.1|  hypothetical protein B456_010G108200                    215   2e-61   Gossypium raimondii
ref|XP_010925904.1|  PREDICTED: ER membrane protein complex subun...    214   2e-61   Elaeis guineensis
gb|KJB65685.1|  hypothetical protein B456_010G108200                    215   2e-61   Gossypium raimondii
ref|XP_010049094.1|  PREDICTED: ER membrane protein complex subun...    213   6e-61   Eucalyptus grandis [rose gum]
ref|XP_009346082.1|  PREDICTED: ER membrane protein complex subun...    213   8e-61   Pyrus x bretschneideri [bai li]
ref|XP_010100254.1|  hypothetical protein L484_007251                   213   8e-61   
emb|CDY67992.1|  BnaCnng57230D                                          206   2e-60   Brassica napus [oilseed rape]
ref|XP_008802826.1|  PREDICTED: ER membrane protein complex subun...    212   2e-60   Phoenix dactylifera
ref|XP_008393881.1|  PREDICTED: ER membrane protein complex subun...    210   8e-60   
ref|XP_010049093.1|  PREDICTED: ER membrane protein complex subun...    208   4e-59   Eucalyptus grandis [rose gum]
ref|XP_004291191.2|  PREDICTED: ER membrane protein complex subun...    207   1e-58   Fragaria vesca subsp. vesca
ref|XP_010541259.1|  PREDICTED: ER membrane protein complex subun...    206   3e-58   Tarenaya hassleriana [spider flower]
ref|XP_009121935.1|  PREDICTED: ER membrane protein complex subun...    204   1e-57   Brassica rapa
ref|XP_009125814.1|  PREDICTED: LOW QUALITY PROTEIN: ER membrane ...    204   1e-57   Brassica rapa
ref|XP_009367894.1|  PREDICTED: ER membrane protein complex subun...    204   2e-57   Pyrus x bretschneideri [bai li]
ref|XP_006399663.1|  hypothetical protein EUTSA_v10012570mg             204   2e-57   Eutrema salsugineum [saltwater cress]
ref|XP_009395509.1|  PREDICTED: ER membrane protein complex subun...    204   3e-57   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX69747.1|  BnaA10g20960D                                          205   5e-57   
ref|XP_011026615.1|  PREDICTED: ER membrane protein complex subun...    202   9e-57   Populus euphratica
ref|XP_010491889.1|  PREDICTED: ER membrane protein complex subun...    201   3e-56   Camelina sativa [gold-of-pleasure]
ref|XP_002873520.1|  hypothetical protein ARALYDRAFT_487993             200   5e-56   
ref|XP_006287000.1|  hypothetical protein CARUB_v10000146mg             200   5e-56   Capsella rubella
ref|XP_010453205.1|  PREDICTED: ER membrane protein complex subun...    199   8e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010668174.1|  PREDICTED: ER membrane protein complex subun...    198   3e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_196717.3|  PQQ_DH domain-containing protein                      198   3e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010419729.1|  PREDICTED: ER membrane protein complex subun...    197   3e-55   Camelina sativa [gold-of-pleasure]
ref|XP_002324236.2|  hypothetical protein POPTR_0018s00550g             197   4e-55   
ref|XP_003522701.1|  PREDICTED: ER membrane protein complex subun...    197   7e-55   Glycine max [soybeans]
gb|KHN10213.1|  Hypothetical protein glysoja_017817                     197   8e-55   Glycine soja [wild soybean]
emb|CDX91208.1|  BnaC02g03890D                                          196   1e-54   
ref|XP_011019630.1|  PREDICTED: ER membrane protein complex subun...    196   1e-54   Populus euphratica
ref|XP_006382057.1|  hypothetical protein POPTR_0006s25700g             195   2e-54   
ref|XP_002308610.1|  hypothetical protein POPTR_0006s25700g             195   3e-54   
emb|CDX85707.1|  BnaA02g01060D                                          194   4e-54   
ref|XP_003526482.1|  PREDICTED: ER membrane protein complex subun...    190   1e-52   Glycine max [soybeans]
gb|KHN18187.1|  Hypothetical protein glysoja_025077                     190   2e-52   Glycine soja [wild soybean]
ref|XP_008445027.1|  PREDICTED: ER membrane protein complex subun...    190   3e-52   Cucumis melo [Oriental melon]
ref|XP_004164260.1|  PREDICTED: ER membrane protein complex subun...    189   6e-52   
ref|XP_004150284.1|  PREDICTED: ER membrane protein complex subun...    189   7e-52   Cucumis sativus [cucumbers]
emb|CAB87716.1|  putative protein                                       188   1e-51   Arabidopsis thaliana [mouse-ear cress]
gb|KEH36041.1|  ER membrane protein complex subunit-like protein        187   2e-51   Medicago truncatula
ref|XP_003636448.1|  hypothetical protein MTR_041s0018                  187   2e-51   
ref|XP_009396281.1|  PREDICTED: ER membrane protein complex subun...    184   2e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004501175.1|  PREDICTED: ER membrane protein complex subun...    184   2e-50   Cicer arietinum [garbanzo]
ref|XP_007137196.1|  hypothetical protein PHAVU_009G1078000g            181   1e-49   Phaseolus vulgaris [French bean]
ref|XP_006833394.1|  hypothetical protein AMTR_s00109p00121860          171   2e-45   Amborella trichopoda
gb|KHG08509.1|  Uncharacterized protein F383_13837                      154   1e-39   Gossypium arboreum [tree cotton]
ref|XP_006654166.1|  PREDICTED: ER membrane protein complex subun...    150   2e-38   Oryza brachyantha
gb|EMS55546.1|  hypothetical protein TRIUR3_31633                       149   4e-38   Triticum urartu
dbj|BAJ90673.1|  predicted protein                                      149   6e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT32849.1|  hypothetical protein F775_31297                         149   7e-38   
gb|EEE62894.1|  hypothetical protein OsJ_17698                          147   4e-37   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054975.1|  Os05g0230600                                       147   4e-37   
ref|XP_004960655.1|  PREDICTED: ER membrane protein complex subun...    146   8e-37   Setaria italica
ref|XP_008648064.1|  PREDICTED: uncharacterized protein LOC100381...    144   3e-36   
gb|AFW82067.1|  hypothetical protein ZEAMMB73_676127                    144   3e-36   
gb|EEC78801.1|  hypothetical protein OsI_19058                          144   3e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_002439481.1|  hypothetical protein SORBIDRAFT_09g007880          144   3e-36   Sorghum bicolor [broomcorn]
ref|XP_008656322.1|  PREDICTED: ER membrane protein complex subun...    144   5e-36   
ref|XP_003568721.1|  PREDICTED: ER membrane protein complex subun...    140   7e-35   Brachypodium distachyon [annual false brome]
ref|XP_003636402.1|  hypothetical protein MTR_040s0031                  109   5e-24   
gb|KEH36029.1|  ER membrane protein complex subunit-like protein        105   1e-22   Medicago truncatula
ref|XP_002962821.1|  hypothetical protein SELMODRAFT_165412           83.6    4e-15   
ref|XP_002965963.1|  hypothetical protein SELMODRAFT_84520            82.8    7e-15   
emb|CDX70404.1|  BnaC03g04880D                                        77.0    1e-14   
ref|XP_001765108.1|  predicted protein                                81.3    2e-14   
gb|AFK49518.1|  unknown                                               48.5    5e-05   Lotus japonicus
ref|XP_002731135.2|  PREDICTED: ER membrane protein complex subun...  50.8    2e-04   Saccoglossus kowalevskii



>ref|XP_009623191.1| PREDICTED: ER membrane protein complex subunit 1-like [Nicotiana 
tomentosiformis]
Length=983

 Score =   251 bits (641),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 149/178 (84%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D ID IDI++GKYVITLSSG S LRAWNLPDGQMVWESFL G  PSRS+LL P+NLK D+
Sbjct  84   DTIDAIDISMGKYVITLSSGGSILRAWNLPDGQMVWESFLRGLKPSRSLLLTPTNLKADK  143

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D++IL+Y +GYLH +SS DG+++WK +L+++G+DIQH++HP+G++ +YA+G++  SQF A
Sbjct  144  DNVILVYGNGYLHYLSSIDGDILWKMDLSHKGVDIQHLIHPEGSETIYAIGVSDLSQFEA  203

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y INAR  ELLKH SM FPGGFSGDISLV S+K V LDS+GSILVSI F +G I FQQ
Sbjct  204  YIINARSDELLKHSSMSFPGGFSGDISLVASDKAVVLDSSGSILVSISFIEGEIKFQQ  261



>ref|XP_011094459.1| PREDICTED: ER membrane protein complex subunit 1 [Sesamum indicum]
Length=982

 Score =   243 bits (619),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 146/178 (82%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D ID ID+ALGKYVITLSSG S LRAWNLPDGQMVWES L GS+PS+ +LL+P+NLKVD+
Sbjct  86   DAIDQIDVALGKYVITLSSGGSVLRAWNLPDGQMVWESTLIGSTPSKPLLLIPTNLKVDK  145

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D++I +Y +G++HAV+S DGEVIWKKELA+EG+D+Q +++PDG++ +YAVGL   S F  
Sbjct  146  DNMIFVYGNGFIHAVASIDGEVIWKKELASEGIDVQQLIYPDGSEIIYAVGLLGFSGFDV  205

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            +++N + GELLKH +M+FP GFSGD+S VT +  VALDST  +LV I F+DG I+F Q
Sbjct  206  FQLNVKSGELLKHNNMLFPAGFSGDLSFVTDDTAVALDSTRKVLVVICFQDGKISFHQ  263



>ref|XP_009597396.1| PREDICTED: ER membrane protein complex subunit 1-like [Nicotiana 
tomentosiformis]
Length=982

 Score =   241 bits (615),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 145/178 (81%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DVID IDIALGKYV+TLSSG S LRAWNLPDGQMVWESFL GS+PSRS+LL P+N   D+
Sbjct  84   DVIDEIDIALGKYVVTLSSGGSILRAWNLPDGQMVWESFLLGSNPSRSLLLTPANFGADK  143

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D++IL+Y SGYLHAVSS DG+++WKK+LA +G+D+ H+VH + +  +YA+G+   SQF A
Sbjct  144  DNVILVYGSGYLHAVSSIDGDILWKKDLAQKGIDVHHLVHLEESGMLYALGVGDRSQFEA  203

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y IN   GELLKH SM FPGGFSGD+SL TS+K VALDS+GSILV+I F  G I FQ+
Sbjct  204  YVINVGNGELLKHSSMEFPGGFSGDLSLSTSDKAVALDSSGSILVTISFVGGEIKFQE  261



>ref|XP_006366781.1| PREDICTED: ER membrane protein complex subunit 1-like [Solanum 
tuberosum]
Length=982

 Score =   240 bits (612),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 142/178 (80%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DVID IDIALGKYV+TLSSG S LRAWNLPDGQMVWESFL GS PSRS+LL P+N   D+
Sbjct  84   DVIDEIDIALGKYVVTLSSGGSVLRAWNLPDGQMVWESFLLGSKPSRSLLLTPTNFGADK  143

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D++IL Y +G LHAVSS DG+++WKKELA  G+D+QH+VHP+ +D +YA+G+  +SQF A
Sbjct  144  DNVILAYGNGCLHAVSSIDGDILWKKELAENGIDVQHLVHPEESDTIYALGIGEASQFEA  203

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y +N R GELLKH S  FPGGFSGD+SL TS+K V LDS+ + LVS+ F  G I FQ+
Sbjct  204  YVLNVRNGELLKHSSKGFPGGFSGDLSLPTSDKAVVLDSSETSLVSVSFVGGEIKFQE  261



>ref|XP_008220058.1| PREDICTED: ER membrane protein complex subunit 1 [Prunus mume]
Length=988

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 142/178 (80%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSGS-TLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D+IDGIDIALGKYVITLSSG   LRAWNLPDGQMVWESFL GS  S+S+L VP+NLKVD+
Sbjct  89   DIIDGIDIALGKYVITLSSGGGILRAWNLPDGQMVWESFLEGSGASKSLLTVPTNLKVDK  148

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D+LIL++  G LHA+SS DGEV+WKKE+A E +++Q I+ P GTD +Y +G   SSQF A
Sbjct  149  DNLILVFGKGSLHAISSIDGEVLWKKEIAPESVEVQQIIQPLGTDIIYVLGFFGSSQFDA  208

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            YKINAR GELLKH S  F GGFSG+  +V+SE +V LDST + LV I F+DG IN+QQ
Sbjct  209  YKINARNGELLKHNSATFSGGFSGEALVVSSEILVTLDSTRTKLVIISFQDGEINYQQ  266



>ref|XP_007012093.1| Catalytics isoform 2 [Theobroma cacao]
 gb|EOY29712.1| Catalytics isoform 2 [Theobroma cacao]
Length=870

 Score =   236 bits (602),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 145/178 (81%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DVIDGIDIA+GKYVITLSSG S LRAWNLPDGQMVWES L G   S+S+LLV +NLKVD+
Sbjct  89   DVIDGIDIAIGKYVITLSSGGSILRAWNLPDGQMVWESSLQGPKHSKSLLLVLTNLKVDK  148

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D++++++++G LHAVSS DGEV+WKK+   E LD+Q ++ P G+D VY VG  +SSQF  
Sbjct  149  DNVVIVFTNGRLHAVSSIDGEVLWKKDFEAESLDVQQVIQPPGSDLVYVVGFAASSQFEM  208

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y+INAR GELLKHES  F GGF G++SLV+SE +VALDSTGSIL++I   +G I+FQQ
Sbjct  209  YQINARNGELLKHESAAFSGGFLGEVSLVSSETLVALDSTGSILLTISSHNGKISFQQ  266



>ref|XP_007012092.1| Catalytics isoform 1 [Theobroma cacao]
 gb|EOY29711.1| Catalytics isoform 1 [Theobroma cacao]
Length=988

 Score =   236 bits (603),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 145/178 (81%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DVIDGIDIA+GKYVITLSSG S LRAWNLPDGQMVWES L G   S+S+LLV +NLKVD+
Sbjct  89   DVIDGIDIAIGKYVITLSSGGSILRAWNLPDGQMVWESSLQGPKHSKSLLLVLTNLKVDK  148

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D++++++++G LHAVSS DGEV+WKK+   E LD+Q ++ P G+D VY VG  +SSQF  
Sbjct  149  DNVVIVFTNGRLHAVSSIDGEVLWKKDFEAESLDVQQVIQPPGSDLVYVVGFAASSQFEM  208

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y+INAR GELLKHES  F GGF G++SLV+SE +VALDSTGSIL++I   +G I+FQQ
Sbjct  209  YQINARNGELLKHESAAFSGGFLGEVSLVSSETLVALDSTGSILLTISSHNGKISFQQ  266



>ref|XP_009785843.1| PREDICTED: ER membrane protein complex subunit 1-like [Nicotiana 
sylvestris]
Length=981

 Score =   236 bits (602),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 142/178 (80%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DVID IDI LGKYV+TLSSG S LRAWNLPDGQMVWESFL GSSPSRS+LL P+N   D+
Sbjct  83   DVIDEIDITLGKYVVTLSSGGSILRAWNLPDGQMVWESFLLGSSPSRSLLLTPANFGADK  142

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D+ IL+Y +GYLHAVS  DG+++WKK+LA +G+++ H+VHP+ +  +YA+G+   SQF A
Sbjct  143  DNAILVYGNGYLHAVSCIDGDILWKKDLAQKGINVHHLVHPEESGMLYALGVGDRSQFEA  202

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y IN   G+LLKH S  FPGGFSGD+SL TS+K VALDS+GSILV+I F  G I FQ+
Sbjct  203  YVINVGNGKLLKHSSTEFPGGFSGDLSLSTSDKAVALDSSGSILVTISFVGGEIKFQE  260



>ref|XP_009759124.1| PREDICTED: ER membrane protein complex subunit 1-like [Nicotiana 
sylvestris]
Length=983

 Score =   235 bits (600),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 147/178 (83%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D ID IDI++GKYVITLSSG S LRAWNLPDGQMVWESFL GS PSRS+L  P+NLK D+
Sbjct  84   DTIDAIDISMGKYVITLSSGGSILRAWNLPDGQMVWESFLRGSKPSRSLLWTPTNLKADK  143

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D++IL+Y +G LH++SS DG+++WKK+L+++ +DIQH++HP+G++ +YA+G+   SQF A
Sbjct  144  DNVILVYGNGCLHSLSSIDGDILWKKDLSHKSIDIQHLIHPEGSETIYAIGVGDLSQFEA  203

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y IN R GELLKH SM FPGGFSGDISLV S+K V LDS+GS LVSI F +G I FQQ
Sbjct  204  YIINVRNGELLKHSSMSFPGGFSGDISLVASDKAVVLDSSGSSLVSISFTEGEIKFQQ  261



>ref|XP_007227052.1| hypothetical protein PRUPE_ppa000842mg [Prunus persica]
 gb|EMJ28251.1| hypothetical protein PRUPE_ppa000842mg [Prunus persica]
Length=983

 Score =   235 bits (599),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 141/178 (79%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSGS-TLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DVIDGIDIALGKYVITLSSG   LRAWNLPDGQMVWESFL GS  S+S+L VP+NLKVD+
Sbjct  84   DVIDGIDIALGKYVITLSSGGGILRAWNLPDGQMVWESFLEGSGASKSLLTVPTNLKVDK  143

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D+LIL++  G LHA+SS DGEV+WKKE+A E +++Q I+ P G+D +Y +G   SSQF A
Sbjct  144  DNLILVFGKGSLHAISSIDGEVLWKKEIAPESVEVQQIIQPLGSDIIYVLGFFGSSQFDA  203

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            YKINAR GELLKH S  F GGFS +  +V+SE +V LDST S LV I F+DG IN+QQ
Sbjct  204  YKINARNGELLKHNSATFSGGFSSEALVVSSEILVTLDSTRSKLVIISFQDGEINYQQ  261



>gb|KDO79765.1| hypothetical protein CISIN_1g002016mg [Citrus sinensis]
Length=794

 Score =   232 bits (592),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 141/178 (79%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DV+DGIDIALGKYVITLSS GSTLRAWNLPDGQMVWESFL GS  S+ +LLVP+NLKVD+
Sbjct  85   DVVDGIDIALGKYVITLSSDGSTLRAWNLPDGQMVWESFLRGSKHSKPLLLVPTNLKVDK  144

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            DSLIL+ S G LHAVSS DGE++W ++ A E +++Q ++  D +D +Y VG   SSQF A
Sbjct  145  DSLILVSSKGCLHAVSSIDGEILWTRDFAAESVEVQQVIQLDESDQIYVVGYAGSSQFHA  204

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y+INA  GELL HE+  F GGF GD++LV+S+ +V LD+T SILV++ FK+  I FQ+
Sbjct  205  YQINAMNGELLNHETAAFSGGFVGDVALVSSDTLVTLDTTRSILVTVSFKNRKIAFQE  262



>gb|KDO79766.1| hypothetical protein CISIN_1g002016mg [Citrus sinensis]
 gb|KDO79767.1| hypothetical protein CISIN_1g002016mg [Citrus sinensis]
Length=795

 Score =   232 bits (592),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 141/178 (79%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DV+DGIDIALGKYVITLSS GSTLRAWNLPDGQMVWESFL GS  S+ +LLVP+NLKVD+
Sbjct  85   DVVDGIDIALGKYVITLSSDGSTLRAWNLPDGQMVWESFLRGSKHSKPLLLVPTNLKVDK  144

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            DSLIL+ S G LHAVSS DGE++W ++ A E +++Q ++  D +D +Y VG   SSQF A
Sbjct  145  DSLILVSSKGCLHAVSSIDGEILWTRDFAAESVEVQQVIQLDESDQIYVVGYAGSSQFHA  204

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y+INA  GELL HE+  F GGF GD++LV+S+ +V LD+T SILV++ FK+  I FQ+
Sbjct  205  YQINAMNGELLNHETAAFSGGFVGDVALVSSDTLVTLDTTRSILVTVSFKNRKIAFQE  262



>gb|KDO79764.1| hypothetical protein CISIN_1g002016mg [Citrus sinensis]
Length=859

 Score =   233 bits (593),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 141/178 (79%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DV+DGIDIALGKYVITLSS GSTLRAWNLPDGQMVWESFL GS  S+ +LLVP+NLKVD+
Sbjct  85   DVVDGIDIALGKYVITLSSDGSTLRAWNLPDGQMVWESFLRGSKHSKPLLLVPTNLKVDK  144

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            DSLIL+ S G LHAVSS DGE++W ++ A E +++Q ++  D +D +Y VG   SSQF A
Sbjct  145  DSLILVSSKGCLHAVSSIDGEILWTRDFAAESVEVQQVIQLDESDQIYVVGYAGSSQFHA  204

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y+INA  GELL HE+  F GGF GD++LV+S+ +V LD+T SILV++ FK+  I FQ+
Sbjct  205  YQINAMNGELLNHETAAFSGGFVGDVALVSSDTLVTLDTTRSILVTVSFKNRKIAFQE  262



>ref|XP_002284012.1| PREDICTED: ER membrane protein complex subunit 1 [Vitis vinifera]
 emb|CBI20872.3| unnamed protein product [Vitis vinifera]
Length=987

 Score =   232 bits (592),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 140/178 (79%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D +D IDIALGKYVITLSS GS LRAWNLPDGQMVWESFL G  PS+S+L V +NLK+D+
Sbjct  87   DAVDEIDIALGKYVITLSSEGSILRAWNLPDGQMVWESFLQGPKPSKSLLSVSANLKIDK  146

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D++I ++  G LHAVSS DGEV+WKK+ A+E L++Q I+HP G+D +YAVG    SQ  A
Sbjct  147  DNVIFVFGKGCLHAVSSIDGEVLWKKDFADESLEVQQIIHPLGSDMIYAVGFVGLSQLDA  206

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y+IN R GE+LKH S  FPGGF G++SLV+S+ +VALD+T S L+SI F DG I+ QQ
Sbjct  207  YQINVRNGEVLKHRSAAFPGGFCGEVSLVSSDTLVALDATRSSLISISFLDGEISLQQ  264



>ref|XP_006450658.1| hypothetical protein CICLE_v10007348mg [Citrus clementina]
 ref|XP_006476068.1| PREDICTED: ER membrane protein complex subunit 1-like [Citrus 
sinensis]
 gb|ESR63898.1| hypothetical protein CICLE_v10007348mg [Citrus clementina]
 gb|KDO79763.1| hypothetical protein CISIN_1g002016mg [Citrus sinensis]
Length=981

 Score =   232 bits (592),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 141/178 (79%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DV+DGIDIALGKYVITLSS GSTLRAWNLPDGQMVWESFL GS  S+ +LLVP+NLKVD+
Sbjct  85   DVVDGIDIALGKYVITLSSDGSTLRAWNLPDGQMVWESFLRGSKHSKPLLLVPTNLKVDK  144

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            DSLIL+ S G LHAVSS DGE++W ++ A E +++Q ++  D +D +Y VG   SSQF A
Sbjct  145  DSLILVSSKGCLHAVSSIDGEILWTRDFAAESVEVQQVIQLDESDQIYVVGYAGSSQFHA  204

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y+INA  GELL HE+  F GGF GD++LV+S+ +V LD+T SILV++ FK+  I FQ+
Sbjct  205  YQINAMNGELLNHETAAFSGGFVGDVALVSSDTLVTLDTTRSILVTVSFKNRKIAFQE  262



>gb|EYU41569.1| hypothetical protein MIMGU_mgv1a000799mg [Erythranthe guttata]
Length=983

 Score =   230 bits (587),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 143/178 (80%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DVID IDIALGKYVITLSSG S +RAWNLPDGQMVWES L GS  SR +LL+P NLKVD+
Sbjct  84   DVIDQIDIALGKYVITLSSGGSVVRAWNLPDGQMVWESTLLGSKSSRPLLLIPKNLKVDK  143

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D +I +Y +G+++AV+S DGE IWKKELA+EG+D+Q ++ P+G+D +YAVGL  SS+F  
Sbjct  144  DDVIFVYGNGFIYAVASIDGEFIWKKELASEGIDVQQLILPEGSDTIYAVGLLGSSRFDV  203

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y+++ + GELLKH SM FP GFSGD+S V+    +A+D T ++LVS++F+DG I+F +
Sbjct  204  YQLDVKSGELLKHNSMFFPAGFSGDLSFVSEGMAMAVDFTETVLVSVLFRDGQISFHK  261



>gb|KDP34198.1| hypothetical protein JCGZ_07769 [Jatropha curcas]
Length=985

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 144/178 (81%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DVIDGIDIALGKYVITLSS GS LRAWNLPDGQMVWESFL G + S+S+LLVP++LKVD+
Sbjct  86   DVIDGIDIALGKYVITLSSEGSILRAWNLPDGQMVWESFLQGPNHSKSLLLVPASLKVDK  145

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D++IL++  G LHAVSS  GE++WKK+ + E  ++Q ++ P G+D V+ VG   S+QF  
Sbjct  146  DNVILVFGKGCLHAVSSVQGEILWKKDFSVESFEVQQVIQPLGSDVVHVVGFVGSTQFDV  205

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y++NA+ GELLKHES  F GGFSG++SLV+S+ +V LDS+ S L+++ F++G INFQ+
Sbjct  206  YQLNAKNGELLKHESAAFSGGFSGEVSLVSSDTLVVLDSSRSTLITVNFQNGDINFQK  263



>gb|KJB82870.1| hypothetical protein B456_013G218700 [Gossypium raimondii]
 gb|KJB82871.1| hypothetical protein B456_013G218700 [Gossypium raimondii]
 gb|KJB82872.1| hypothetical protein B456_013G218700 [Gossypium raimondii]
 gb|KJB82873.1| hypothetical protein B456_013G218700 [Gossypium raimondii]
Length=985

 Score =   227 bits (579),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 143/178 (80%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DVIDGIDIALGKYVITLSSG S LRAWNLPDGQMVWES L G   S+S+LLVP+NLK+++
Sbjct  86   DVIDGIDIALGKYVITLSSGGSILRAWNLPDGQMVWESSLRGPKHSKSLLLVPTNLKIEK  145

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D++++I+S+G L+AVS  DGEV+W+K+   E L++Q ++ P G++ +Y VG  SSS F  
Sbjct  146  DNIVIIFSNGRLNAVSCIDGEVLWEKDFEGESLEVQQVIQPPGSNLIYVVGFASSSLFEM  205

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y+INA  GELLKHES  F GGF G++S V SE VVALDSTG IL+++ F++G+I+FQQ
Sbjct  206  YQINALNGELLKHESAAFSGGFLGEVSPVFSETVVALDSTGLILLTVSFQNGMISFQQ  263



>ref|XP_010325953.1| PREDICTED: ER membrane protein complex subunit 1 [Solanum lycopersicum]
Length=982

 Score =   226 bits (575),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 140/178 (79%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DVID IDIALGKY++TLSSG S LRAWNLPDGQMVWESFL GS PSRS+L  P+N   D+
Sbjct  84   DVIDEIDIALGKYLVTLSSGGSVLRAWNLPDGQMVWESFLLGSKPSRSLLFTPTNFGADK  143

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D++IL Y +G LHAVSS DG+++WKKELA   +D+QH+VHP+ +D +YA+G+  +SQF A
Sbjct  144  DNVILAYGNGCLHAVSSIDGDILWKKELAENSIDVQHLVHPEESDTIYALGIGEASQFEA  203

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y IN R GELLKH S  F GGFSGD+SL TS+KVV LDS+ S LVSI F  G I FQ+
Sbjct  204  YVINVRNGELLKHSSKGFAGGFSGDLSLPTSDKVVVLDSSKSSLVSISFVGGEIKFQE  261



>ref|XP_002516556.1| catalytic, putative [Ricinus communis]
 gb|EEF45897.1| catalytic, putative [Ricinus communis]
Length=983

 Score =   224 bits (572),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 138/178 (78%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D IDGIDIA+GKYVITLSS G  LRAWNLPDGQMVWESFL G +PS+S+LLVP++ KVD+
Sbjct  84   DAIDGIDIAMGKYVITLSSEGGILRAWNLPDGQMVWESFLQGLNPSKSLLLVPASFKVDK  143

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D+ IL++  G L A+SS  GE+IWKK+ A E  ++Q ++ P  +D +Y VG   SSQF A
Sbjct  144  DNTILVFGKGCLSAISSIHGEIIWKKDFAAESFEVQQVIQPPSSDIIYVVGFVGSSQFDA  203

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y+INA+ GELLKHES    GGFSG++SLV++  +V LDSTGS L ++ F++G I+FQ+
Sbjct  204  YQINAKNGELLKHESAALSGGFSGEVSLVSTNTLVVLDSTGSALTAVSFQNGEISFQK  261



>gb|KHG26099.1| Uncharacterized protein F383_09262 [Gossypium arboreum]
Length=984

 Score =   223 bits (568),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 139/178 (78%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DVIDGIDI LGKYVITLSSG S LR+WNLPDGQMVWES L G   S+S LLVP+NLK D+
Sbjct  85   DVIDGIDIGLGKYVITLSSGGSILRSWNLPDGQMVWESSLQGPKHSKSFLLVPTNLKFDK  144

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D++++++S+G LHA+S  DGEV+WKK+   E  ++Q ++ P G+D ++ VG  + SQF  
Sbjct  145  DNVLVVFSNGRLHAISCIDGEVLWKKDFEAESFEVQQVILPPGSDLIHVVGFAAFSQFEM  204

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y+INA+ GELLKHES  F  GF G +SLV++E VVALDSTGSIL++I F+DG I+ QQ
Sbjct  205  YQINAKNGELLKHESASFSSGFLGQVSLVSTETVVALDSTGSILLTISFQDGKISSQQ  262



>emb|CDP15321.1| unnamed protein product [Coffea canephora]
Length=987

 Score =   223 bits (568),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 139/178 (78%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSGST-LRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D ++ +DIALGKYVITLSSG   LRAWNLPDGQM+WESFL GS+ SRSIL +P+NLKV +
Sbjct  88   DTVNELDIALGKYVITLSSGGKYLRAWNLPDGQMIWESFLPGSTASRSILSIPTNLKVGK  147

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D LIL Y SG L+AVSS DGEV+W K+LA+EG+D+Q ++H  G++ +YA+G   SS F  
Sbjct  148  DDLILAYGSGSLYAVSSIDGEVLWTKDLASEGIDVQQLIHRHGSNIIYALGFIGSSHFAT  207

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            ++INA+ GELLKH+ + F GGF GDIS + S+  VALDST S LVS+ F+DG I+ +Q
Sbjct  208  FEINAKNGELLKHDKVRFTGGFCGDISFLKSDTAVALDSTRSSLVSVRFRDGEISIEQ  265



>ref|XP_010254044.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Nelumbo 
nucifera]
Length=985

 Score =   221 bits (564),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 140/178 (79%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D +DGIDIALGKYVITLSS GS LRAWNLPDGQMVWE+FL GS+ S S+L + +N K+D+
Sbjct  86   DAVDGIDIALGKYVITLSSEGSILRAWNLPDGQMVWETFLRGSTSSNSLLSILTNFKMDK  145

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            ++++L++  G LHAVSS DGE IW+KELA E  +I+ I+    +D ++A+G   SS+FV 
Sbjct  146  ENMVLVFGGGCLHAVSSIDGETIWRKELATESFEIRQILQSPESDIIHALGFVGSSKFVT  205

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            YKI+A+ GELLKH S  FPGGF G++SLV+++ VVALD+T SILVSI F++G  +F Q
Sbjct  206  YKIDAKNGELLKHTSTAFPGGFPGELSLVSADTVVALDATRSILVSISFQNGETSFHQ  263



>ref|XP_010254043.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Nelumbo 
nucifera]
Length=989

 Score =   221 bits (564),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 140/178 (79%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D +DGIDIALGKYVITLSS GS LRAWNLPDGQMVWE+FL GS+ S S+L + +N K+D+
Sbjct  86   DAVDGIDIALGKYVITLSSEGSILRAWNLPDGQMVWETFLRGSTSSNSLLSILTNFKMDK  145

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            ++++L++  G LHAVSS DGE IW+KELA E  +I+ I+    +D ++A+G   SS+FV 
Sbjct  146  ENMVLVFGGGCLHAVSSIDGETIWRKELATESFEIRQILQSPESDIIHALGFVGSSKFVT  205

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            YKI+A+ GELLKH S  FPGGF G++SLV+++ VVALD+T SILVSI F++G  +F Q
Sbjct  206  YKIDAKNGELLKHTSTAFPGGFPGELSLVSADTVVALDATRSILVSISFQNGETSFHQ  263



>gb|KJB27314.1| hypothetical protein B456_004G290400 [Gossypium raimondii]
Length=982

 Score =   220 bits (560),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 140/178 (79%), Gaps = 2/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DV+DGIDIALGKYVITLSSG S LRAWNLPDGQMVWES L G   S+S+LL  +NL +++
Sbjct  84   DVVDGIDIALGKYVITLSSGGSILRAWNLPDGQMVWESSLHGPKHSKSLLLT-TNLIIEK  142

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D+ ++++S+G L+AVS  DGEV+WKK+   E L++Q ++ P G+D +Y VG  +SSQF  
Sbjct  143  DNSLIVFSNGRLNAVSCIDGEVLWKKDFEEESLEVQQVIQPPGSDFIYVVGFAASSQFET  202

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            YKINA+ GELLKHES  F G FSG++SLV+SE V ALDSTGSIL++I F +G I+ QQ
Sbjct  203  YKINAKNGELLKHESTAFSGRFSGEVSLVSSETVAALDSTGSILLTISFHNGKISSQQ  260



>gb|KHG26100.1| Uncharacterized protein F383_09262 [Gossypium arboreum]
Length=226

 Score =   205 bits (521),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 125/161 (78%), Gaps = 1/161 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DVIDGIDI LGKYVITLSSG S LR+WNLPDGQMVWES L G   S+S LLVP+NLK D+
Sbjct  56   DVIDGIDIGLGKYVITLSSGGSILRSWNLPDGQMVWESSLQGPKHSKSFLLVPTNLKFDK  115

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D++++++S+G LHA+S  DGEV+WKK+   E  ++Q ++ P G+D ++ VG  + SQF  
Sbjct  116  DNVLVVFSNGRLHAISCIDGEVLWKKDFEAESFEVQQVILPPGSDLIHVVGFAAFSQFEM  175

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTG  483
            Y+INA+ GELLKHES  F  GF G +SLV++E VVALDSTG
Sbjct  176  YQINAKNGELLKHESASFSSGFLGQVSLVSTETVVALDSTG  216



>gb|KFK25418.1| hypothetical protein AALP_AA8G112000 [Arabis alpina]
Length=982

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 139/179 (78%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    KDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVD  177
            KD IDG+DIALGKYVITLSS GSTLRAWNLPDGQMVWE+ L  +  S+S+L VP NLKVD
Sbjct  83   KDAIDGVDIALGKYVITLSSEGSTLRAWNLPDGQMVWETSLHNAQQSKSLLSVPINLKVD  142

Query  178  RDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFV  357
            +D  IL++  GYLHAVS+ DGEV+WKK+   EG ++Q ++ P G+  +Y +G  +S++ V
Sbjct  143  KDYPILVFGGGYLHAVSAVDGEVLWKKDFTAEGFEVQRVLQPPGSSIIYVLGFVNSAEAV  202

Query  358  AYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
             Y+I+++ GE+   +SM FPGGFSG IS V+++KVV LDST SILV+I F DG I+FQ+
Sbjct  203  VYQIDSKTGEVASQKSMEFPGGFSGGISSVSNDKVVVLDSTRSILVTISFLDGGISFQK  261



>gb|EPS59522.1| hypothetical protein M569_15283, partial [Genlisea aurea]
Length=908

 Score =   216 bits (550),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 139/179 (78%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    KDVIDGIDIALGKYVITLSSGST-LRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVD  177
            KD+ID IDIALGKYVITLS G T LRAW+LPDGQMVWES L GS PS+ ++L+P NL +D
Sbjct  8    KDIIDQIDIALGKYVITLSRGGTVLRAWSLPDGQMVWESTLLGSRPSKPLVLIPKNLNID  67

Query  178  RDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFV  357
            +D++I ++ +G++HAVSS DGEVIWKKELA++G +   +VHP G D +YA GL  SS+ V
Sbjct  68   KDNIIFVFGNGHIHAVSSIDGEVIWKKELASDGFEAHELVHPVGGDSIYAFGLIGSSEVV  127

Query  358  AYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
             Y++N + GELL + S++FPGGFSGD+S V+ +  V +D++G+ LV +  K+G ++F Q
Sbjct  128  FYRLNIKSGELLDNGSILFPGGFSGDLSFVSDDTAVVMDASGTNLVVVHLKNGQLSFHQ  186



>ref|XP_008378089.1| PREDICTED: ER membrane protein complex subunit 1-like [Malus 
domestica]
Length=985

 Score =   216 bits (550),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 134/178 (75%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D IDGIDIALGKYV+TL S GS LRAWNLPDGQMVWESFL GS  S+S+L VP++LKVD+
Sbjct  86   DAIDGIDIALGKYVVTLXSDGSILRAWNLPDGQMVWESFLEGSMSSKSLLSVPTSLKVDK  145

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
             +LIL++  G LHA+SS DGEV+W+K+ A E +++Q I+ P G D  Y +G   SSQF A
Sbjct  146  GNLILVFGKGSLHAISSIDGEVLWEKDFAAESVEVQQIIQPLGGDVAYVLGFVGSSQFDA  205

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y+ N R GELLKH S  F GGFSG+  LV+SE +V LDST S LV + F+DG I +QQ
Sbjct  206  YQXNVRNGELLKHSSAPFSGGFSGEALLVSSEILVTLDSTRSKLVIVSFQDGEIXYQQ  263



>gb|KJB65684.1| hypothetical protein B456_010G108200 [Gossypium raimondii]
Length=821

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 141/178 (79%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DVIDGIDI LGKYVITLSSG S LR+WNLPDGQMVWES L G   S+S LLVP+NLK D+
Sbjct  85   DVIDGIDIGLGKYVITLSSGGSILRSWNLPDGQMVWESSLQGPKHSKSFLLVPTNLKFDK  144

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D++++++S+G LHA+S  DGEV+WKK+   E  ++Q ++ P G+D +Y VG  +S QF  
Sbjct  145  DNVLVVFSNGRLHAISCIDGEVLWKKDFEAESFEVQQVIQPPGSDLIYVVGFAASYQFEM  204

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y+INA+ GELLKHES  F  GFSG++SLV++E VVALDSTGSIL++I F+DG I+ QQ
Sbjct  205  YQINAKNGELLKHESASFSSGFSGEVSLVSTETVVALDSTGSILLTISFQDGKISSQQ  262



>gb|KHG18967.1| Uncharacterized protein F383_07420 [Gossypium arboreum]
Length=982

 Score =   215 bits (548),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 139/178 (78%), Gaps = 2/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DV+DGIDIALGKYVITLSSG S LRAWNLPDGQMVWES L G   S+ +LL   NL +++
Sbjct  84   DVVDGIDIALGKYVITLSSGGSILRAWNLPDGQMVWESSLHGPKHSKPLLLT-RNLIIEK  142

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D++++++S+G L+AVS  DGEV+WKK+   E L++Q ++ P G+  +Y +G  +SSQF  
Sbjct  143  DNVLIVFSNGRLNAVSCIDGEVLWKKDFEEESLEVQQVIQPPGSGFIYVLGFAASSQFEM  202

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            YKINA+ GELLKHES  F G F+G++SLV+SE VVALDSTGSIL++I F +G I+ QQ
Sbjct  203  YKINAKNGELLKHESTAFSGRFTGEVSLVSSETVVALDSTGSILLTISFHNGKISSQQ  260



>gb|KJB65683.1| hypothetical protein B456_010G108200 [Gossypium raimondii]
Length=964

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 141/178 (79%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DVIDGIDI LGKYVITLSSG S LR+WNLPDGQMVWES L G   S+S LLVP+NLK D+
Sbjct  85   DVIDGIDIGLGKYVITLSSGGSILRSWNLPDGQMVWESSLQGPKHSKSFLLVPTNLKFDK  144

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D++++++S+G LHA+S  DGEV+WKK+   E  ++Q ++ P G+D +Y VG  +S QF  
Sbjct  145  DNVLVVFSNGRLHAISCIDGEVLWKKDFEAESFEVQQVIQPPGSDLIYVVGFAASYQFEM  204

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y+INA+ GELLKHES  F  GFSG++SLV++E VVALDSTGSIL++I F+DG I+ QQ
Sbjct  205  YQINAKNGELLKHESASFSSGFSGEVSLVSTETVVALDSTGSILLTISFQDGKISSQQ  262



>gb|KJB65682.1| hypothetical protein B456_010G108200 [Gossypium raimondii]
Length=984

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 141/178 (79%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DVIDGIDI LGKYVITLSSG S LR+WNLPDGQMVWES L G   S+S LLVP+NLK D+
Sbjct  85   DVIDGIDIGLGKYVITLSSGGSILRSWNLPDGQMVWESSLQGPKHSKSFLLVPTNLKFDK  144

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D++++++S+G LHA+S  DGEV+WKK+   E  ++Q ++ P G+D +Y VG  +S QF  
Sbjct  145  DNVLVVFSNGRLHAISCIDGEVLWKKDFEAESFEVQQVIQPPGSDLIYVVGFAASYQFEM  204

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y+INA+ GELLKHES  F  GFSG++SLV++E VVALDSTGSIL++I F+DG I+ QQ
Sbjct  205  YQINAKNGELLKHESASFSSGFSGEVSLVSTETVVALDSTGSILLTISFQDGKISSQQ  262



>ref|XP_010925904.1| PREDICTED: ER membrane protein complex subunit 1 [Elaeis guineensis]
Length=983

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 138/178 (78%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D +D IDIALGKY ITLSS GS LRAWNLPDGQM+WES L GS+PS+S+L VP+N  + +
Sbjct  84   DHVDQIDIALGKYFITLSSEGSILRAWNLPDGQMMWESALYGSTPSKSLLFVPANTNLGK  143

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            ++ IL++S G+LHAVSS DGE+IWKKE A + L+I+ +  P  +D +YAVG   SSQF  
Sbjct  144  ENRILVFSGGWLHAVSSIDGEIIWKKEFAIDRLEIKQVFQPLESDIIYAVGFVGSSQFSV  203

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y+++++ GE+LKH +  FP GF G++SLV+S+ +VALD+T S L+SI F+ G+INF Q
Sbjct  204  YQLSSKSGEVLKHNTASFPSGFCGEVSLVSSDMLVALDATRSALISISFQSGIINFHQ  261



>gb|KJB65685.1| hypothetical protein B456_010G108200 [Gossypium raimondii]
Length=1003

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 141/178 (79%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DVIDGIDI LGKYVITLSSG S LR+WNLPDGQMVWES L G   S+S LLVP+NLK D+
Sbjct  85   DVIDGIDIGLGKYVITLSSGGSILRSWNLPDGQMVWESSLQGPKHSKSFLLVPTNLKFDK  144

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D++++++S+G LHA+S  DGEV+WKK+   E  ++Q ++ P G+D +Y VG  +S QF  
Sbjct  145  DNVLVVFSNGRLHAISCIDGEVLWKKDFEAESFEVQQVIQPPGSDLIYVVGFAASYQFEM  204

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y+INA+ GELLKHES  F  GFSG++SLV++E VVALDSTGSIL++I F+DG I+ QQ
Sbjct  205  YQINAKNGELLKHESASFSSGFSGEVSLVSTETVVALDSTGSILLTISFQDGKISSQQ  262



>ref|XP_010049094.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Eucalyptus 
grandis]
 gb|KCW81549.1| hypothetical protein EUGRSUZ_C02905 [Eucalyptus grandis]
Length=984

 Score =   213 bits (543),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 138/178 (78%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D IDGIDIALGKYVITLSSG S LRAWNLPDGQ+VWES L GSSPS+ +L+VP++ +VDR
Sbjct  86   DAIDGIDIALGKYVITLSSGGSILRAWNLPDGQLVWESILKGSSPSKIMLIVPTSFRVDR  145

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            ++LI  ++ G LHAVSS DGE+IW+K+ A + L++Q ++     + V  +G   SSQF A
Sbjct  146  ENLIFAFAGGCLHAVSSIDGEIIWRKDFAAKSLEVQQVIQAPAEETVRVLGYVESSQFHA  205

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y+IN RKG+ +KH ++ FPGG S D  LV+ + +VALD+T S+L++I+F+DG INF++
Sbjct  206  YEINPRKGDEIKHVNVDFPGGLSADTVLVSDDVLVALDATRSVLLTILFQDGEINFRK  263



>ref|XP_009346082.1| PREDICTED: ER membrane protein complex subunit 1-like [Pyrus 
x bretschneideri]
Length=985

 Score =   213 bits (543),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 138/178 (78%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D IDGIDIALGKYV+TLSS GS LRAWNLPDGQMVWESFL GS  S+S+L VP++LKVD+
Sbjct  86   DAIDGIDIALGKYVVTLSSDGSILRAWNLPDGQMVWESFLEGSVSSKSLLSVPTSLKVDK  145

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
             +LIL++  G LHA+SS DGEV+W+K+ A E +++Q I+ P G+D  Y +G   SSQF A
Sbjct  146  GNLILVFGKGSLHAISSIDGEVLWEKDFAAESVEVQQIIQPLGSDVAYVLGFVGSSQFDA  205

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y+IN R GELLKH S  F GGFSG+  LV+SE +V LDST S LV + F+DG IN+QQ
Sbjct  206  YQINVRNGELLKHSSAPFSGGFSGEALLVSSEILVTLDSTRSKLVIVSFQDGEINYQQ  263



>ref|XP_010100254.1| hypothetical protein L484_007251 [Morus notabilis]
 gb|EXB82261.1| hypothetical protein L484_007251 [Morus notabilis]
Length=973

 Score =   213 bits (543),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 135/178 (76%), Gaps = 14/178 (8%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D +DGIDIALGKY ITLSS GS +RAWNLPDGQMVWESFL GS+PS+S+L VP+N+KVDR
Sbjct  87   DAVDGIDIALGKYAITLSSEGSIIRAWNLPDGQMVWESFLQGSNPSKSLLSVPTNVKVDR  146

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D+LIL++S G LHA+S  DGEV+WKK+ A E            +D +YA+G   SSQF A
Sbjct  147  DNLILVFSRGSLHAISGVDGEVVWKKDFAAE------------SDVIYAIGSVGSSQFDA  194

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y++NAR GELLK    VFPGGFSG++ LV+ + VVALD+  S LV+I F+DG I FQQ
Sbjct  195  YELNARNGELLKKHGAVFPGGFSGEMLLVSGDLVVALDANKSSLVTINFQDG-IKFQQ  251



>emb|CDY67992.1| BnaCnng57230D [Brassica napus]
Length=446

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 134/179 (75%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    KDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVD  177
            KD IDG+DIALGKYVITLSS GS LRAWNLPDGQMVWE+ L  +  S+S+L VP NLK D
Sbjct  85   KDAIDGVDIALGKYVITLSSEGSMLRAWNLPDGQMVWETSLHSAQHSKSLLSVPVNLKFD  144

Query  178  RDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFV  357
            +D  IL++  GYLHAVS  DGE++WKK+   EG ++Q ++ P  +  VY +G   SS+ +
Sbjct  145  KDYSILVFGGGYLHAVSPIDGELLWKKDFTAEGFEVQRVLQPLESSIVYVLGFLHSSEAI  204

Query  358  AYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
             Y+I+++ GE++  +S  FPG FSG+IS V+++KVV LDST SILV+I F DG I+FQ+
Sbjct  205  VYQIDSKSGEVVAEKSKAFPGRFSGEISAVSNDKVVVLDSTRSILVTISFVDGEISFQK  263



>ref|XP_008802826.1| PREDICTED: ER membrane protein complex subunit 1 [Phoenix dactylifera]
Length=985

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 136/178 (76%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D +D IDIALGKY ITLSS GS LRAWNLPDGQM+WES    S+PS+S+L VP+N+ + +
Sbjct  86   DHVDQIDIALGKYFITLSSEGSILRAWNLPDGQMMWESAFYASTPSKSLLYVPANINLGK  145

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            ++ IL++S G+LHAVSS DGE++WKKE A + L+I+ +  P  +D +YAVG   SSQF  
Sbjct  146  ENRILVFSGGWLHAVSSIDGEIVWKKEFAIDSLEIKQVFQPPESDIIYAVGFVGSSQFSV  205

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y+ +++ GE+LKH +  FPGGF G+ SLV+S+ +VALD+T S L++I F+ G+INF Q
Sbjct  206  YEFSSKSGEVLKHNTASFPGGFCGEASLVSSDMLVALDATRSALIAISFQSGIINFHQ  263



>ref|XP_008393881.1| PREDICTED: ER membrane protein complex subunit 1-like [Malus 
domestica]
Length=988

 Score =   210 bits (535),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 138/178 (78%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DVI GIDIALGKYV+TLSS GS LRAWNLPDGQMVWESFL GS  S+S+L VP++LK+D+
Sbjct  89   DVIGGIDIALGKYVVTLSSDGSILRAWNLPDGQMVWESFLEGSGSSKSLLSVPTSLKIDK  148

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            ++LIL++  G LHA+SS DGEV+W+K+ A E +++Q IV P G D  Y +G   SS F A
Sbjct  149  ENLILVFGKGSLHAISSIDGEVLWEKDFAVESVEVQQIVQPIGGDLAYVLGFVGSSHFDA  208

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y+IN R GELLKH S  F GGFSG+  LV+SE ++ LDSTGS LV + F+DG IN+QQ
Sbjct  209  YQINVRTGELLKHNSAPFSGGFSGEALLVSSEILLTLDSTGSKLVIVSFQDGEINYQQ  266



>ref|XP_010049093.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Eucalyptus 
grandis]
Length=986

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 138/180 (77%), Gaps = 3/180 (2%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D IDGIDIALGKYVITLSSG S LRAWNLPDGQ+VWES L GSSPS+ +L+VP++ +VDR
Sbjct  86   DAIDGIDIALGKYVITLSSGGSILRAWNLPDGQLVWESILKGSSPSKIMLIVPTSFRVDR  145

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANE--GLDIQHIVHPDGTDDVYAVGLTSSSQF  354
            ++LI  ++ G LHAVSS DGE+IW+K+ A +   L++Q ++     + V  +G   SSQF
Sbjct  146  ENLIFAFAGGCLHAVSSIDGEIIWRKDFAAKRFSLEVQQVIQAPAEETVRVLGYVESSQF  205

Query  355  VAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
             AY+IN RKG+ +KH ++ FPGG S D  LV+ + +VALD+T S+L++I+F+DG INF++
Sbjct  206  HAYEINPRKGDEIKHVNVDFPGGLSADTVLVSDDVLVALDATRSVLLTILFQDGEINFRK  265



>ref|XP_004291191.2| PREDICTED: ER membrane protein complex subunit 1 [Fragaria vesca 
subsp. vesca]
Length=988

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 132/178 (74%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DV+DGIDIA+GKYV+TLSS GS LRAWNLPDGQMVWESF+ GS  S+S+L VP+NL V++
Sbjct  89   DVVDGIDIAMGKYVVTLSSEGSILRAWNLPDGQMVWESFIDGSGASKSLLTVPTNLIVNK  148

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            +++IL+Y  G LHAVS  DG  +W K+ A E L++QHI+ P G+D +Y +G   SSQF A
Sbjct  149  ENVILVYGKGSLHAVSGIDGTPLWTKDFAAESLEVQHIIQPVGSDAIYVLGFVGSSQFDA  208

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y++N   GE+LKH S    GG+SG+  L +S  +V LD++ S LV I F+DG +N Q+
Sbjct  209  YQVNPENGEILKHNSAALSGGYSGEAILASSNILVTLDASRSKLVVISFQDGELNLQE  266



>ref|XP_010541259.1| PREDICTED: ER membrane protein complex subunit 1 [Tarenaya hassleriana]
Length=983

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 135/178 (76%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DVI+GIDIALGKYVITLSS GS LRAWNLPDGQMVWE+ L G   S+ +LLVP+NLKV R
Sbjct  86   DVINGIDIALGKYVITLSSEGSILRAWNLPDGQMVWETALHGVKHSKPLLLVPTNLKVGR  145

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D  IL++    L AVS  DGE++WKK+   +GL++Q ++ P G+  +Y +G + SSQ   
Sbjct  146  DYPILVFGGRSLQAVSGVDGEILWKKDFEPDGLEVQKVLQPSGSSMLYVLGFSDSSQVDV  205

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            ++I+A+ GE + H+SM+FPGGFSG++S V+S+K+  LDST S LV+I F DG I+FQQ
Sbjct  206  HQIDAKTGEAVTHKSMMFPGGFSGEVSSVSSDKLAVLDSTRSTLVTISFLDGDISFQQ  263



>ref|XP_009121935.1| PREDICTED: ER membrane protein complex subunit 1 [Brassica rapa]
Length=980

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 135/179 (75%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    KDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVD  177
            KD IDG+DIALGKYVITLSS GS +RAWNLPDGQMVWE+ L  +  S+S+L VP NLKVD
Sbjct  85   KDAIDGVDIALGKYVITLSSEGSMVRAWNLPDGQMVWETSLHSAQHSKSLLSVPVNLKVD  144

Query  178  RDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFV  357
            +D  IL++  GYLHAVS  DGEV+WKK+   EG ++Q ++ P  +  +Y +G   SS+ +
Sbjct  145  KDYPILVFGGGYLHAVSPIDGEVLWKKDFTAEGFEVQRVLQPLESSIIYVLGFLHSSEAI  204

Query  358  AYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
             Y+I+++ GE++  +S  FPGGFSG+++ V+++KVV LDST SILV+I F D  I+FQ+
Sbjct  205  VYQIDSKSGEVVAEKSKAFPGGFSGEVASVSNDKVVVLDSTRSILVTISFVDEEISFQK  263



>ref|XP_009125814.1| PREDICTED: LOW QUALITY PROTEIN: ER membrane protein complex subunit 
1-like [Brassica rapa]
Length=984

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 135/178 (76%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D IDG++IALGKYVITLSS GSTLRAWNLPDGQMVWE+ L  +  S+S+L VP NLKVD+
Sbjct  86   DAIDGVEIALGKYVITLSSQGSTLRAWNLPDGQMVWETSLHSAQISKSLLSVPINLKVDK  145

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D  IL +  GYLHAVS+ DGEV+ KK+   EG DIQ ++ P  +  +Y +G   SS+ V 
Sbjct  146  DYPILAFGGGYLHAVSAIDGEVLXKKDFTAEGYDIQRVLQPPESSIIYVLGFLHSSEAVV  205

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y+I+++ GE++  +SMVFP GFSG +S V+S+K+V LDST SILV+I F DG I+FQ+
Sbjct  206  YQIDSKTGEVVAEKSMVFPDGFSGAVSSVSSDKIVVLDSTRSILVTIGFLDGDISFQK  263



>ref|XP_009367894.1| PREDICTED: ER membrane protein complex subunit 1-like [Pyrus 
x bretschneideri]
Length=988

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 135/178 (76%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DVI GIDIALGKYVITLSS GS LRAWNLPDGQMVWESFL GS  S+S+L VP++LK+D+
Sbjct  89   DVIGGIDIALGKYVITLSSDGSILRAWNLPDGQMVWESFLEGSGSSKSLLSVPTSLKIDK  148

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            ++LIL++  G LHA+SS DG+V+W+K+ A E +++Q IV P G D  Y VG   SS F  
Sbjct  149  ENLILVFGKGSLHAISSIDGDVLWEKDFAVESVEVQQIVQPIGGDVAYVVGFVGSSHFDV  208

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y+IN R GELLKH S  F GGFSG+  LV+ E ++ LDST S LV + F+DG IN+QQ
Sbjct  209  YQINVRNGELLKHNSAPFSGGFSGEALLVSGEILLTLDSTRSKLVLVSFQDGEINYQQ  266



>ref|XP_006399663.1| hypothetical protein EUTSA_v10012570mg [Eutrema salsugineum]
 gb|ESQ41116.1| hypothetical protein EUTSA_v10012570mg [Eutrema salsugineum]
Length=984

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 139/178 (78%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D IDG+DIALGKYVITLSS GS LRAWNLPDGQMVWE+ L G+  S+S+L VP+NLKVD+
Sbjct  86   DAIDGVDIALGKYVITLSSEGSALRAWNLPDGQMVWETSLHGAQHSKSLLSVPTNLKVDK  145

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
               IL++  GYLHAVS+ DGEV+WKK+   EG ++Q ++ P G+  +Y +G  +SS+ V 
Sbjct  146  AYPILVFGGGYLHAVSAIDGEVLWKKDFTAEGFEVQRVLQPPGSSIIYVLGFVNSSEAVV  205

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y+I+++ GE++  ++M FP GFSG+IS V+S+KVV LDST SILV+I F DG I+FQ+
Sbjct  206  YQIDSKSGEVVAQKNMAFPAGFSGEISSVSSDKVVVLDSTRSILVTIGFLDGDISFQK  263



>ref|XP_009395509.1| PREDICTED: ER membrane protein complex subunit 1-like [Musa acuminata 
subsp. malaccensis]
Length=983

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 133/178 (75%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D ID +DI LGKYV+TLSSG S LRAWNLPDGQM+WES L  S+PS+S+L VP+N+ V +
Sbjct  85   DRIDQVDITLGKYVVTLSSGGSILRAWNLPDGQMIWESILQVSAPSKSLLHVPANMNVGK  144

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D+LIL++    +HA+SSTDG+++W+KEL+   L+IQ +  P  +D +YA+G   SS+FVA
Sbjct  145  DNLILVFGGSSIHALSSTDGQIVWRKELSTNSLEIQQVFQPHDSDIIYALGFIGSSEFVA  204

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y +N + GE+L+     F  GF G+ SL + + VVALD++ + LVSI F++G+INFQQ
Sbjct  205  YYVNYKTGEVLQQSKASFKSGFCGEASLASDDVVVALDASRTYLVSISFRNGVINFQQ  262



>emb|CDX69747.1| BnaA10g20960D [Brassica napus]
Length=1546

 Score =   205 bits (521),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 135/179 (75%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    KDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVD  177
            KD IDG+DIALGKYVITLSS GS +RAWNLPDGQMVWE+ L  +  S+S+L VP NLKVD
Sbjct  651  KDAIDGVDIALGKYVITLSSEGSMVRAWNLPDGQMVWETSLHSAQHSKSLLSVPVNLKVD  710

Query  178  RDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFV  357
            +D  IL++  GYLHAVS  DGEV+WKK+   EG ++Q ++ P  +  +Y +G   SS+ +
Sbjct  711  KDYPILVFGGGYLHAVSPIDGEVLWKKDFTAEGFEVQRVLQPLESSIIYVLGFLHSSEAI  770

Query  358  AYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
             Y+I+++ GE++  +S  FPGGFSG+++ V+++KVV LDST SILV+I F D  I+FQ+
Sbjct  771  VYQIDSKSGEVVAEKSKAFPGGFSGEVASVSNDKVVVLDSTRSILVTISFVDEEISFQK  829



>ref|XP_011026615.1| PREDICTED: ER membrane protein complex subunit 1 [Populus euphratica]
Length=985

 Score =   202 bits (514),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 130/178 (73%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D IDGIDIA+GKY+ITLSS GS LRAWNLPDGQM WESFL G S S+S L V ++ KVD+
Sbjct  86   DAIDGIDIAMGKYLITLSSEGSILRAWNLPDGQMWWESFLQGPSNSKSFLFVSTSTKVDK  145

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D+ IL++  G LHA+SS  GE++WK +   E  ++Q ++    ++ +Y VG    SQF  
Sbjct  146  DNTILVFGKGSLHAISSMHGEIVWKVDFPAESFEVQEVIQHHDSNTIYVVGFAGFSQFDV  205

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y+INA+ G+LLKH S  F GGFSG++SLV+  K+V LD+ GS L++I F++G I+FQ+
Sbjct  206  YQINAKNGQLLKHNSAAFDGGFSGEVSLVSKAKLVVLDAAGSTLLTISFQNGEISFQK  263



>ref|XP_010491889.1| PREDICTED: ER membrane protein complex subunit 1-like [Camelina 
sativa]
Length=978

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 138/179 (77%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    KDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVD  177
            KD IDG+ IALGKYVITLSS GSTLRAWNLPDGQMVWE+ L  +  S+S+L VP NLKVD
Sbjct  83   KDAIDGVGIALGKYVITLSSEGSTLRAWNLPDGQMVWETALHSAHHSKSLLSVPINLKVD  142

Query  178  RDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFV  357
            +D  I ++  GYLHAVS+ DGEV+W+K+   EG ++Q ++ P G+  +Y +G  + S+ V
Sbjct  143  KDYPITVFGGGYLHAVSALDGEVLWEKDFTAEGFEVQRVLQPLGSTVIYVLGFVNLSEAV  202

Query  358  AYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
             Y+I+++ GE+L  +SM FPGGFSG+IS V+S+KVV LDST SILV+I F DG I+FQ+
Sbjct  203  VYQIDSKSGEVLAQKSMAFPGGFSGEISSVSSDKVVVLDSTKSILVTIGFLDGDISFQK  261



>ref|XP_002873520.1| hypothetical protein ARALYDRAFT_487993 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49779.1| hypothetical protein ARALYDRAFT_487993 [Arabidopsis lyrata subsp. 
lyrata]
Length=982

 Score =   200 bits (508),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 139/179 (78%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    KDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVD  177
            KD IDG+ IALGKYVITLSS GS LRAWNLPDGQMVWE+ L  +  S+S+L VP NLKVD
Sbjct  83   KDAIDGVGIALGKYVITLSSEGSALRAWNLPDGQMVWETSLHTAQHSKSLLSVPINLKVD  142

Query  178  RDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFV  357
            +D  I+++  GYLHAVS+ DGEV+WKK+   EG ++Q ++ P G+  +Y +G  + S+ V
Sbjct  143  KDYPIIVFGGGYLHAVSAIDGEVLWKKDFTVEGFEVQRVLQPPGSSIIYVLGFINLSEAV  202

Query  358  AYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
             Y+I+++ GE++  +SMVFPGGFSG+IS V+S+KVV LDST SILV+I F DG ++FQ+
Sbjct  203  VYQIDSKSGEVVAQKSMVFPGGFSGEISSVSSDKVVVLDSTRSILVTIGFIDGGLSFQK  261



>ref|XP_006287000.1| hypothetical protein CARUB_v10000146mg [Capsella rubella]
 gb|EOA19898.1| hypothetical protein CARUB_v10000146mg [Capsella rubella]
Length=981

 Score =   200 bits (508),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 139/179 (78%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    KDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVD  177
            KD IDG+ IALGKYVITLSS GSTLRAWNLPDGQMVWE+ L  + PS+S+L VP NLKVD
Sbjct  83   KDAIDGVGIALGKYVITLSSEGSTLRAWNLPDGQMVWETSLHTAKPSKSLLSVPINLKVD  142

Query  178  RDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFV  357
            +D  I+++  GYLHAVS+ DGEV+W+K+   EG ++Q ++ P G+  +  +G  + S+ V
Sbjct  143  KDYPIIVFGGGYLHAVSAIDGEVLWEKDFTAEGFEVQRVLQPPGSSIISVLGFINLSEAV  202

Query  358  AYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
             Y+I+++ GE++  +S VFPGGFSG+IS V+S+KVV LDST SILV+I F DG I+FQ+
Sbjct  203  VYQIDSKSGEVVAQKSRVFPGGFSGEISSVSSDKVVVLDSTRSILVTIGFVDGDISFQK  261



>ref|XP_010453205.1| PREDICTED: ER membrane protein complex subunit 1-like [Camelina 
sativa]
Length=978

 Score =   199 bits (507),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 139/179 (78%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    KDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVD  177
            KD IDG+ IALGKYVITLSS GSTLRAWNLPDGQMVWE+ LS +  S+S+L VP NLKVD
Sbjct  83   KDAIDGVGIALGKYVITLSSEGSTLRAWNLPDGQMVWETALSSAHHSKSLLSVPINLKVD  142

Query  178  RDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFV  357
            +D  I ++  GYLHAVS+ DGEV+W+K+   EG ++Q ++ P G+  +Y +G  + S+ V
Sbjct  143  KDYPITVFGGGYLHAVSAIDGEVLWEKDFTAEGFEVQRVLQPLGSTVIYVLGFVNLSEAV  202

Query  358  AYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
             Y+I+++ GE++  +SMVFPGGFSG+IS V+S+KVV LDS  SILV+I F DG I+FQ+
Sbjct  203  VYQIDSKIGEVVAQKSMVFPGGFSGEISSVSSDKVVVLDSKKSILVTIGFIDGDISFQK  261



>ref|XP_010668174.1| PREDICTED: ER membrane protein complex subunit 1 [Beta vulgaris 
subsp. vulgaris]
Length=983

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 132/174 (76%), Gaps = 3/174 (2%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D ID IDIALGKYVITLSS GS +RAWNLPDGQMVWESFL+G  PS S LL   +LKV+R
Sbjct  86   DRIDHIDIALGKYVITLSSEGSIVRAWNLPDGQMVWESFLAGKKPSESSLLTVVDLKVER  145

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D++IL+YS+G+LHAVSS DG  +W  EL  E +++Q ++ P   D +YAVG + SS+  A
Sbjct  146  DNVILVYSNGFLHAVSSVDGASLWDMEL--ESVELQQLIKPVSGDVMYAVGFSGSSKLHA  203

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLI  522
            Y IN + GE+LK + + FPGGFSG+ISLV+SE +VALD+  ++LV I  KDG +
Sbjct  204  YGINIKTGEVLKQDVVDFPGGFSGEISLVSSETLVALDAQRTLLVIISLKDGKV  257



>ref|NP_196717.3| PQQ_DH domain-containing protein [Arabidopsis thaliana]
 gb|AED91695.1| PQQ_DH domain-containing protein [Arabidopsis thaliana]
Length=982

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 137/179 (77%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    KDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVD  177
            KD IDG+ IALGKYVITLSS GSTLRAWNLPDGQMVWE+ L  +  S+S+L VP NLKVD
Sbjct  83   KDAIDGVGIALGKYVITLSSEGSTLRAWNLPDGQMVWETSLHTAQHSKSLLSVPINLKVD  142

Query  178  RDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFV  357
            +D  I ++  GYLHAVS+ DGEV+WKK+   EG ++Q ++   G+  +Y +G   SS+ V
Sbjct  143  KDYPITVFGGGYLHAVSAIDGEVLWKKDFTAEGFEVQRVLQAPGSSIIYVLGFLHSSEAV  202

Query  358  AYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
             Y+I+++ GE++  +S VFPGGFSG+IS V+S+KVV LDST SILV+I F DG I+FQ+
Sbjct  203  VYQIDSKSGEVVAQKSTVFPGGFSGEISSVSSDKVVVLDSTRSILVTIGFIDGDISFQK  261



>ref|XP_010419729.1| PREDICTED: ER membrane protein complex subunit 1-like [Camelina 
sativa]
Length=978

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 138/179 (77%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    KDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVD  177
            KD IDG+ IALGKYVITLSS GSTLRAWNLPDGQMVWE+ L  +  S+S+L VP NLKVD
Sbjct  83   KDAIDGVGIALGKYVITLSSEGSTLRAWNLPDGQMVWETALHSAHHSKSLLSVPINLKVD  142

Query  178  RDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFV  357
            +D  I ++  GYLHAVS+ DGEV+W+K+   EG ++Q ++ P G+  +Y +G  + S+ V
Sbjct  143  KDYPITVFGGGYLHAVSALDGEVLWEKDFTAEGFEVQRVLQPLGSTVIYVLGFVNLSEAV  202

Query  358  AYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
             Y+I+++ GE++  +SMVFPGGFSG+IS V+S+KVV LDS  SILV+I F DG I+FQ+
Sbjct  203  VYQIDSKIGEVVAQKSMVFPGGFSGEISSVSSDKVVVLDSKKSILVTIGFIDGDISFQK  261



>ref|XP_002324236.2| hypothetical protein POPTR_0018s00550g [Populus trichocarpa]
 gb|EEF02801.2| hypothetical protein POPTR_0018s00550g [Populus trichocarpa]
Length=985

 Score =   197 bits (502),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 129/178 (72%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D IDGIDIA+GKY+ITLSS GS LRAWNLPDGQM WESFL G S S+S L V ++ KVD+
Sbjct  86   DAIDGIDIAMGKYLITLSSEGSILRAWNLPDGQMWWESFLQGPSDSKSFLFVSTSTKVDK  145

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D+ IL++  G LHA+SS  GE++WK +   E  ++Q ++    ++ +Y VG    S F  
Sbjct  146  DNTILVFGKGSLHAISSMHGEIVWKVDFPAESFEVQEVIQHHDSNTIYVVGFVGFSLFDV  205

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y+INA+ GELLKH+S  F GGFSG++SLV+  K+V LD+  S L++I F++G I+FQ+
Sbjct  206  YQINAKNGELLKHDSAAFDGGFSGEVSLVSKAKLVVLDAARSTLLTISFQNGEISFQK  263



>ref|XP_003522701.1| PREDICTED: ER membrane protein complex subunit 1-like [Glycine 
max]
Length=983

 Score =   197 bits (500),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 128/178 (72%), Gaps = 3/178 (2%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DV+DG+DIALGKYVITLSS GS LRAWNLPDGQMVWESFL GS  S+SIL +P NLK D+
Sbjct  86   DVVDGLDIALGKYVITLSSDGSILRAWNLPDGQMVWESFLQGSVASKSILYIPKNLKADK  145

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D LIL++  G LHAVSS DGEV+WKK+   E +++ HI+    TD++Y  G   SS+F  
Sbjct  146  DDLILVFGKGCLHAVSSIDGEVLWKKDFVGESIEVNHIIQ--STDEIYVAGFVGSSKFYV  203

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y +NA+ GELLK++    P    G++  V+ +K V LD T S +++I  K+G I+++Q
Sbjct  204  YGLNAKNGELLKNDHKALPCDTFGELLSVSGDKFVVLDKTRSKILTINIKNGEISYKQ  261



>gb|KHN10213.1| Hypothetical protein glysoja_017817 [Glycine soja]
Length=983

 Score =   197 bits (500),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 128/178 (72%), Gaps = 3/178 (2%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DV+DG+DIALGKYVITLSS GS LRAWNLPDGQMVWESFL GS  S+SIL +P NLK D+
Sbjct  86   DVVDGLDIALGKYVITLSSDGSILRAWNLPDGQMVWESFLQGSVASKSILYIPKNLKADK  145

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D LIL++  G LHAVSS DGEV+WKK+   E +++ HI+    TD++Y  G   SS+F  
Sbjct  146  DDLILVFGKGCLHAVSSIDGEVLWKKDFVGESIEVNHIIQ--STDEIYVAGFVGSSKFYV  203

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y +NA+ GELLK++    P    G++  V+ +K V LD T S +++I  K+G I+++Q
Sbjct  204  YGLNAKNGELLKNDHKALPCDTFGELLSVSGDKFVVLDKTRSKILTINIKNGEISYKQ  261



>emb|CDX91208.1| BnaC02g03890D [Brassica napus]
Length=997

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 138/193 (72%), Gaps = 16/193 (8%)
 Frame = +1

Query  4    DVIDGIDIALGK---------------YVITLSS-GSTLRAWNLPDGQMVWESFLSGSSP  135
            D IDG+DIALGK               YVITLSS GSTLRAWNLPDGQMVWE+ L  +  
Sbjct  84   DAIDGVDIALGKCRNHLHYMRCSTISGYVITLSSQGSTLRAWNLPDGQMVWETSLHSAQS  143

Query  136  SRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTD  315
            S+S+L VP NLKVD+D  IL++  GYLHAVS+ DGEV+WKK+   EG ++Q ++ P  + 
Sbjct  144  SKSLLSVPINLKVDKDYPILVFGGGYLHAVSAIDGEVLWKKDFTAEGFEVQRVLQPPESS  203

Query  316  DVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILV  495
             +Y +G   SS+ V Y+I+++ GE++  +SMVFPGGFSG IS V+S+KVV LDST SILV
Sbjct  204  IIYVLGFLHSSEAVVYQIDSKTGEVVAQKSMVFPGGFSGAISSVSSDKVVVLDSTRSILV  263

Query  496  SIIFKDGLINFQQ  534
            +I F DG INFQ+
Sbjct  264  TIGFLDGDINFQK  276



>ref|XP_011019630.1| PREDICTED: ER membrane protein complex subunit 1-like [Populus 
euphratica]
Length=985

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 131/179 (73%), Gaps = 3/179 (2%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D IDGIDIA+ KY ITLSSG S LRAWNLPDGQMVWESFL G   S+S L V ++ KVD+
Sbjct  86   DAIDGIDIAMTKYAITLSSGGSILRAWNLPDGQMVWESFLQGPIDSKSFLFVSASSKVDK  145

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIV-HPDGTDDVYAVGLTSSSQFV  357
            ++ IL++  G LHAVSS  GE++WK +  +E  ++Q ++ H DG + +Y VG   SSQF 
Sbjct  146  ENTILVFGKGSLHAVSSIHGEIVWKIDFPSECFEVQEVIQHYDG-NTIYVVGFVGSSQFD  204

Query  358  AYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
             Y+INA+ GELLKH+S  F GGFSG++SLV+  K+V LD+  S L++I F+ G I+FQ+
Sbjct  205  VYQINAKNGELLKHDSAAFDGGFSGEVSLVSRAKLVVLDAARSALLTISFQSGEISFQK  263



>ref|XP_006382057.1| hypothetical protein POPTR_0006s25700g [Populus trichocarpa]
 gb|ERP59854.1| hypothetical protein POPTR_0006s25700g [Populus trichocarpa]
Length=918

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 130/179 (73%), Gaps = 3/179 (2%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D IDGIDIA+ KY ITLSSG S LRAWNLPDGQMVWESFL G   S+S L V ++ KVD+
Sbjct  19   DAIDGIDIAMTKYAITLSSGGSILRAWNLPDGQMVWESFLQGPIDSKSFLFVSTSSKVDK  78

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIV-HPDGTDDVYAVGLTSSSQFV  357
            D+ IL++  G LHAVSS  GE++WK +  +E  ++Q ++ H DG + +Y VG   SSQF 
Sbjct  79   DNTILVFGKGSLHAVSSIHGEIVWKIDFPSESFEVQEVIQHHDG-NTIYVVGFVGSSQFD  137

Query  358  AYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
             Y+INA+ GELLKH+S    GGFSG++SLV+  K+V LD+  S L++I F+ G I+FQ+
Sbjct  138  VYQINAKNGELLKHDSAAVDGGFSGEVSLVSRAKLVVLDAARSTLLTISFQSGEISFQK  196



>ref|XP_002308610.1| hypothetical protein POPTR_0006s25700g [Populus trichocarpa]
 gb|EEE92133.1| hypothetical protein POPTR_0006s25700g [Populus trichocarpa]
Length=985

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 130/179 (73%), Gaps = 3/179 (2%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D IDGIDIA+ KY ITLSSG S LRAWNLPDGQMVWESFL G   S+S L V ++ KVD+
Sbjct  86   DAIDGIDIAMTKYAITLSSGGSILRAWNLPDGQMVWESFLQGPIDSKSFLFVSTSSKVDK  145

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIV-HPDGTDDVYAVGLTSSSQFV  357
            D+ IL++  G LHAVSS  GE++WK +  +E  ++Q ++ H DG + +Y VG   SSQF 
Sbjct  146  DNTILVFGKGSLHAVSSIHGEIVWKIDFPSESFEVQEVIQHHDG-NTIYVVGFVGSSQFD  204

Query  358  AYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
             Y+INA+ GELLKH+S    GGFSG++SLV+  K+V LD+  S L++I F+ G I+FQ+
Sbjct  205  VYQINAKNGELLKHDSAAVDGGFSGEVSLVSRAKLVVLDAARSTLLTISFQSGEISFQK  263



>emb|CDX85707.1| BnaA02g01060D [Brassica napus]
Length=942

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 133/194 (69%), Gaps = 16/194 (8%)
 Frame = +1

Query  1    KDVIDGIDIALGK---------------YVITLSS-GSTLRAWNLPDGQMVWESFLSGSS  132
            KD IDG+DIALGK               YVITLSS GS LRAWNLPDGQMVW++ L  + 
Sbjct  85   KDAIDGVDIALGKCRNHLHYMWCSSISGYVITLSSQGSMLRAWNLPDGQMVWKTSLHSAQ  144

Query  133  PSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGT  312
             S+S+L VP NLKVD+D  IL +  GYLHAVS+ DGEV+WKK+   EG ++Q I+ P  +
Sbjct  145  SSKSLLSVPINLKVDKDYPILAFGGGYLHAVSAIDGEVLWKKDFTAEGFEVQRILQPHES  204

Query  313  DDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSIL  492
              +Y +G   SS+ V Y+I+ R G+++  +SMV PGGFSG I  V+S+KVV LDST SIL
Sbjct  205  SIIYVLGFLHSSKAVVYQIDPRTGKVVAQKSMVVPGGFSGVILSVSSDKVVVLDSTRSIL  264

Query  493  VSIIFKDGLINFQQ  534
            V+I F DG I+F +
Sbjct  265  VTINFLDGDISFHK  278



>ref|XP_003526482.1| PREDICTED: ER membrane protein complex subunit 1-like [Glycine 
max]
Length=983

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 127/178 (71%), Gaps = 3/178 (2%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D++DG+DIALGKYVITLSS GS LRAWNLPDGQMVWESFL GS  S+SIL +P NLK D+
Sbjct  86   DIVDGLDIALGKYVITLSSDGSILRAWNLPDGQMVWESFLQGSVASKSILYIPKNLKADK  145

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D LIL++  G LHAVSS DGEV+WKK+   E +++ HI+    TD++Y  G   SS+F  
Sbjct  146  DDLILVFGKGCLHAVSSIDGEVLWKKDFVGESIEVNHIIQ--STDEIYVAGFVGSSKFYV  203

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y++NA+ GELL ++         G++  V+ +K V LD T S ++++  K+G I+++Q
Sbjct  204  YQLNAKNGELLNNDHKTLACDTFGELLSVSGDKFVVLDKTRSKILTLNIKNGGISYKQ  261



>gb|KHN18187.1| Hypothetical protein glysoja_025077 [Glycine soja]
Length=983

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 127/178 (71%), Gaps = 3/178 (2%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D++DG+DIALGKYVITLSS GS LRAWNLPDGQMVWESFL GS  S+SIL +P NLK D+
Sbjct  86   DIVDGLDIALGKYVITLSSDGSILRAWNLPDGQMVWESFLQGSVASKSILYIPKNLKADK  145

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D LIL++  G LHAVSS DGEV+WKK+   E +++ HI+    TD++Y  G   SS+F  
Sbjct  146  DDLILVFGKGCLHAVSSIDGEVLWKKDFVGESIEVNHIIQ--STDEIYVAGFVGSSKFYV  203

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y++NA+ GELL ++         G++  V+ +K V LD T S ++++  K+G I+++Q
Sbjct  204  YQLNAKNGELLNNDHKTLACDTFGELLSVSGDKFVVLDKTRSKILTLNIKNGGISYKQ  261



>ref|XP_008445027.1| PREDICTED: ER membrane protein complex subunit 1 [Cucumis melo]
Length=985

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 130/178 (73%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D IDGI+  LGKYV++LSS G+ LRAWNLPDGQM WESFL G+SPS+S+LLVP +LK ++
Sbjct  88   DPIDGIEFVLGKYVVSLSSEGNFLRAWNLPDGQMAWESFLQGTSPSKSLLLVPKSLKANQ  147

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            +++IL++S   LHAVSS DGEVIWK +L    ++IQ I+    +D +YAVG +S +Q   
Sbjct  148  ETVILVFSRSCLHAVSSLDGEVIWKIDLTENSVEIQKIIQLHDSDIIYAVGFSSPTQLDQ  207

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            ++IN + GELLKH++  F GGFSG++  V+ + +V +D+  S LV I FK+G I   Q
Sbjct  208  FQINVKSGELLKHQTATFSGGFSGELVSVSDDVLVTVDTARSNLVIINFKNGEIGILQ  265



>ref|XP_004164260.1| PREDICTED: ER membrane protein complex subunit 1-like [Cucumis 
sativus]
Length=985

 Score =   189 bits (479),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 129/178 (72%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D IDGI+  LGKYV++LSS G+ LRAWNLPDGQM WESFL G+SPS+S LLVP +LK ++
Sbjct  88   DPIDGIEFVLGKYVVSLSSEGNFLRAWNLPDGQMAWESFLQGTSPSKSFLLVPKSLKANQ  147

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            +++IL++S   LHAVSS DGEVIWK +L    ++IQ I+    ++ +YAVG +S +Q   
Sbjct  148  ETVILVFSRSCLHAVSSLDGEVIWKIDLTENSVEIQKIIQLPDSEFIYAVGFSSPTQLDQ  207

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            +KIN + GELLKH+   F GGFSG++  V+ + +V +D++ S LV I FK+G I   Q
Sbjct  208  FKINVKSGELLKHQKATFSGGFSGELVSVSDDVLVTVDTSRSNLVIINFKNGEIGILQ  265



>ref|XP_004150284.1| PREDICTED: ER membrane protein complex subunit 1-like [Cucumis 
sativus]
 gb|KGN62826.1| Catalytic [Cucumis sativus]
Length=985

 Score =   189 bits (479),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 129/174 (74%), Gaps = 1/174 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D IDGI+  LGKYV++LSS G+ LRAWNLPDGQM WESFL G+SPS+S LLVP +LK ++
Sbjct  88   DPIDGIEFVLGKYVVSLSSEGNFLRAWNLPDGQMAWESFLQGTSPSKSFLLVPKSLKANQ  147

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            +++IL++S   LHAVSS DGEVIWK +L    ++IQ I+    ++ +YAVG +S +Q   
Sbjct  148  ETVILVFSRSCLHAVSSLDGEVIWKIDLTENSVEIQKIIQLPDSEFIYAVGFSSPTQLDQ  207

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLI  522
            +KIN + GELLKH++  F GGFSG++  V+ + +V +D++ S LV I FK+G I
Sbjct  208  FKINVKSGELLKHQTATFSGGFSGELVSVSDDVLVTVDTSRSNLVIINFKNGEI  261



>emb|CAB87716.1| putative protein [Arabidopsis thaliana]
Length=955

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 134/179 (75%), Gaps = 5/179 (3%)
 Frame = +1

Query  1    KDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVD  177
            KD IDG+ IALGKYVITLSS GSTLRAWNLPDGQMVWE+ L  +  S+S+L VP    VD
Sbjct  60   KDAIDGVGIALGKYVITLSSEGSTLRAWNLPDGQMVWETSLHTAQHSKSLLSVP----VD  115

Query  178  RDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFV  357
            +D  I ++  GYLHAVS+ DGEV+WKK+   EG ++Q ++   G+  +Y +G   SS+ V
Sbjct  116  KDYPITVFGGGYLHAVSAIDGEVLWKKDFTAEGFEVQRVLQAPGSSIIYVLGFLHSSEAV  175

Query  358  AYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
             Y+I+++ GE++  +S VFPGGFSG+IS V+S+KVV LDST SILV+I F DG I+FQ+
Sbjct  176  VYQIDSKSGEVVAQKSTVFPGGFSGEISSVSSDKVVVLDSTRSILVTIGFIDGDISFQK  234



>gb|KEH36041.1| ER membrane protein complex subunit-like protein [Medicago truncatula]
Length=983

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 124/178 (70%), Gaps = 3/178 (2%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DV+DGIDIALGKYVITLSS GS LRAWNLPDGQMVWES L GS  S+SIL +P NLK D+
Sbjct  86   DVVDGIDIALGKYVITLSSDGSILRAWNLPDGQMVWESSLQGSKESKSILNIPKNLKADK  145

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D LIL++  G LHA+S  DGEV+W+K+ A+E +++ HI+     + +Y  G   SS+F  
Sbjct  146  DDLILVFGKGCLHAISGIDGEVLWRKDFASESIEVSHIIQ--SPEVIYVAGFVGSSKFYV  203

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y++NA+ GELLK+  +  P   SG+   V+ +K V LD   S +V+I   +G IN+ Q
Sbjct  204  YEVNAKSGELLKNNHVALPFATSGESLSVSGDKFVVLDDVRSKIVTIDINNGNINYNQ  261



>ref|XP_003636448.1| hypothetical protein MTR_041s0018 [Medicago truncatula]
Length=982

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 124/178 (70%), Gaps = 3/178 (2%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DV+DGIDIALGKYVITLSS GS LRAWNLPDGQMVWES L GS  S+SIL +P NLK D+
Sbjct  86   DVVDGIDIALGKYVITLSSDGSILRAWNLPDGQMVWESSLQGSKESKSILNIPKNLKADK  145

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D LIL++  G LHA+S  DGEV+W+K+ A+E +++ HI+     + +Y  G   SS+F  
Sbjct  146  DDLILVFGKGCLHAISGIDGEVLWRKDFASESIEVSHIIQ--SPEVIYVAGFVGSSKFYV  203

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y++NA+ GELLK+  +  P   SG+   V+ +K V LD   S +V+I   +G IN+ Q
Sbjct  204  YEVNAKSGELLKNNHVALPFATSGESLSVSGDKFVVLDDVRSKIVTIDINNGNINYNQ  261



>ref|XP_009396281.1| PREDICTED: ER membrane protein complex subunit 1-like [Musa acuminata 
subsp. malaccensis]
Length=997

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 127/178 (71%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D ID +DIALGKYV+TLSSG S LRAWNLPDGQM+WES L  S+ S+S L V +N+ V +
Sbjct  98   DHIDQVDIALGKYVVTLSSGGSILRAWNLPDGQMIWESTLPVSTLSKSSLYVLANMNVGK  157

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D+LIL++    +HA+SS DG+++W+KEL+ + L+IQ I  P  +D + AVG   SS+FV 
Sbjct  158  DNLILVFGGSSIHALSSMDGQIVWRKELSIDSLEIQQIFQPHDSDIINAVGFVGSSEFVV  217

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y+I+ R GE+++     F  GF G+ SLV    VVALD++ S LVSI FK+ +INF Q
Sbjct  218  YQISYRTGEVMQQSKASFESGFCGEASLVFDNLVVALDASKSSLVSISFKNEVINFHQ  275



>ref|XP_004501175.1| PREDICTED: ER membrane protein complex subunit 1-like [Cicer 
arietinum]
Length=981

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 122/178 (69%), Gaps = 3/178 (2%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DV+DG+DIALGKYVITLSSG S LRAWNLPDGQMVWES L GS  S+SIL VP NLK D+
Sbjct  84   DVVDGLDIALGKYVITLSSGGSILRAWNLPDGQMVWESSLQGSKESKSILNVPKNLKADK  143

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D LIL++  G LHA+S  DGEV+W+K+ A E +++  I+    T+ +Y  G   SS F  
Sbjct  144  DDLILVFGKGCLHAISGIDGEVLWRKDFAGESIEVTDIIQ--STEVIYVAGFVGSSNFNV  201

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y +NA  GE LK+  +V P   SG++  +  +K V LDS  S +V+I  K+G IN+ Q
Sbjct  202  YLLNAETGEFLKNNHLVLPFRTSGELLSIPGDKFVVLDSARSKIVTINIKNGDINYNQ  259



>ref|XP_007137196.1| hypothetical protein PHAVU_009G1078000g, partial [Phaseolus vulgaris]
 gb|ESW09190.1| hypothetical protein PHAVU_009G1078000g, partial [Phaseolus vulgaris]
Length=897

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 124/178 (70%), Gaps = 3/178 (2%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            DV+DG+DIALGKYVITLSS GS LRAWNLPDGQMVWE+ L GS  S+SIL +P NLK D+
Sbjct  86   DVVDGLDIALGKYVITLSSDGSLLRAWNLPDGQMVWETPLQGSKQSKSILYIPKNLKADK  145

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D LIL++  G L+AVS  DGEV+W+K+ A E +++  I+    TD +Y  G   SS+F  
Sbjct  146  DDLILVFGKGCLYAVSGIDGEVLWRKDFAGESIEVSRIIQ--STDKIYVAGFVGSSKFYV  203

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y +NA  GELLK++  + P    G++  V+ +K V LD   S +++I  K+G I+++Q
Sbjct  204  YGLNADTGELLKNDHTILPCDTFGELLSVSGDKFVVLDKMRSKILTINIKNGEISYKQ  261



>ref|XP_006833394.1| hypothetical protein AMTR_s00109p00121860 [Amborella trichopoda]
 gb|ERM98672.1| hypothetical protein AMTR_s00109p00121860 [Amborella trichopoda]
Length=976

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 122/178 (69%), Gaps = 9/178 (5%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D ++ IDIALGKYVITLSS GS LRAWNLPDGQM+WESFL GS PS+S+L V ++     
Sbjct  86   DAVNDIDIALGKYVITLSSSGSILRAWNLPDGQMMWESFLQGSGPSKSLLSVSAS-----  140

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
               IL++S G LHA+S  DG+V+W++EL+ E L++  I      + +YA GL  SSQ   
Sbjct  141  ---ILVFSGGCLHAISGIDGDVLWRRELSGESLEMHKIRQSPNGETIYAAGLVGSSQLAL  197

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y++N + G+++ H+  +F GGFSG++  ++   +VALD+T S +V+  F +G + F Q
Sbjct  198  YELNPKNGDIVNHKMALFSGGFSGEMLFLSDGTLVALDATRSTIVTASFNNGNLVFHQ  255



>gb|KHG08509.1| Uncharacterized protein F383_13837 [Gossypium arboreum]
Length=980

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 119/180 (66%), Gaps = 10/180 (6%)
 Frame = +1

Query  4    DVIDGIDIALGKY---VITLSSGSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKV  174
            DVIDGIDIALGK     I      ++ +    DG  +   F SGS      L + +NLK+
Sbjct  86   DVIDGIDIALGKCHYPFIRRKYFESMESSRWADGVGI---FSSGSKA----LKIITNLKI  138

Query  175  DRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQF  354
            ++D++++I+S+G L+AVS  DGEV+W+K+   E L +Q ++ P G++ +Y VG  SSS F
Sbjct  139  EKDNIVIIFSNGRLNAVSCIDGEVLWEKDFEGESLKVQQVIQPPGSNLIYVVGFVSSSLF  198

Query  355  VAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
              Y+INA  GELLKHES  F GGF G++S V SE VVALDSTG IL++I F++G I+F Q
Sbjct  199  EMYQINALNGELLKHESAAFSGGFLGEVSPVFSETVVALDSTGLILLTISFQNGKISFHQ  258



>ref|XP_006654166.1| PREDICTED: ER membrane protein complex subunit 1-like [Oryza 
brachyantha]
Length=985

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 118/178 (66%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D +D + ++LGKYV+TLSSG S LRAWNLPDGQM+WE+ L  +  S+S+L V SN KV +
Sbjct  88   DPVDQLSLSLGKYVVTLSSGGSILRAWNLPDGQMIWETNLQVAKSSKSLLHVLSNNKVAK  147

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D+L+ + +  +++AVSS DG + W KE + +GL+I+ +V     D +YAVGL+ SS+   
Sbjct  148  DNLVFVSAGQWIYAVSSIDGVISWGKEFSLDGLEIKQVVQSPENDIIYAVGLSGSSKLNL  207

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y++NA+ GE++KH    FP    G+  L +   +VALD T S L  I F    I++++
Sbjct  208  YQLNAKTGEIVKHIQESFPSAICGETILGSHNMLVALDETRSGLFLIEFNGERISYKK  265



>gb|EMS55546.1| hypothetical protein TRIUR3_31633 [Triticum urartu]
Length=885

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 116/176 (66%), Gaps = 1/176 (1%)
 Frame = +1

Query  10   IDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDRDS  186
            ID + ++ GKYV+TLSSG S LRAWNLPDGQM+WE+ +  S+ S+S+L V SN KV +D+
Sbjct  92   IDQLSLSAGKYVVTLSSGGSILRAWNLPDGQMIWETNIHTSTSSKSLLHVLSNSKVVKDN  151

Query  187  LILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVAYK  366
            L+L+ +  +++AVSS DG + W KE   +GL+I+ +V     D VY VG+  SS+   Y+
Sbjct  152  LVLVLAGQWIYAVSSIDGVISWGKEFTLDGLEIKQVVQSPDNDIVYVVGIAGSSKLAVYQ  211

Query  367  INARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            +NA+ GE++K      P G  G+I L +S  +VALD T S L  + FK   I++ +
Sbjct  212  LNAKTGEIVKDAQESLPDGLCGEILLGSSNVLVALDETRSALFIVDFKGESISYNK  267



>dbj|BAJ90673.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=989

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 116/176 (66%), Gaps = 1/176 (1%)
 Frame = +1

Query  10   IDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDRDS  186
            ID + ++ GKYV+TLSSG S LRAWNLPDGQMVWE+ +  SS S+S+L V SN KV +D+
Sbjct  92   IDQLSLSAGKYVVTLSSGGSILRAWNLPDGQMVWETNIQTSSASKSLLHVLSNSKVVQDN  151

Query  187  LILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVAYK  366
            L+L+ +  +++A+SS DG + W KE   +GL+I+ +V     D VY VG+  SS+   Y+
Sbjct  152  LVLVLAGQWIYAISSIDGLISWGKEFTLDGLEIKQVVQSPENDIVYVVGIAGSSKLAVYQ  211

Query  367  INARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            +NA+ GE++K      P G  G++ L +S  +VALD T S L  + FK   I++ +
Sbjct  212  LNAKTGEIVKDAQESLPDGLCGEMLLGSSNVLVALDETRSALFIVEFKGESISYNK  267



>gb|EMT32849.1| hypothetical protein F775_31297 [Aegilops tauschii]
Length=1139

 Score =   149 bits (377),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 116/176 (66%), Gaps = 1/176 (1%)
 Frame = +1

Query  10   IDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDRDS  186
            ID + ++ GKYV+TLSSG S LRAWNLPDGQM+WE+ +  S+ S+S+L V SN KV +D+
Sbjct  92   IDQLSLSAGKYVVTLSSGGSILRAWNLPDGQMIWETNIQTSTSSKSLLHVLSNSKVVKDN  151

Query  187  LILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVAYK  366
            L+L+ +  +++AVSS DG + W KE   +GL+I+ +V     D VY VG+  SS+   Y+
Sbjct  152  LVLVLAGQWIYAVSSIDGVISWGKEFTLDGLEIKQVVQSPENDIVYVVGIAGSSKLAVYQ  211

Query  367  INARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            +NA+ GE++K      P G  G+I L +S  +VALD T S L  + FK   I++ +
Sbjct  212  LNAKTGEIVKDAQESLPDGLCGEILLGSSNVLVALDETRSALFIVEFKGESISYNK  267



>gb|EEE62894.1| hypothetical protein OsJ_17698 [Oryza sativa Japonica Group]
Length=950

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 114/178 (64%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D +D + ++LGKYV+TLSSG S LRAWNLPDGQM+WE+ L  S  S+ +L V SN KV +
Sbjct  91   DPVDELSLSLGKYVVTLSSGGSILRAWNLPDGQMIWETNLQVSKSSKPLLHVLSNNKVAK  150

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D+L+ + +  +++AVSS DG + W KE + +GLD++ I+     D VYAVGL  SS+   
Sbjct  151  DNLVFVLAGRWIYAVSSIDGVISWGKEFSLDGLDLKQIIQSPENDIVYAVGLAGSSKLNL  210

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y++NA+ GE +KH    FP    G+  L +   +VALD T S L  I  K   I++ +
Sbjct  211  YQLNAKTGETVKHIQESFPIALCGETILGSHNVLVALDETRSDLFLIELKGESISYNK  268



>ref|NP_001054975.1| Os05g0230600 [Oryza sativa Japonica Group]
 gb|AAS98480.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAT93850.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16889.1| Os05g0230600 [Oryza sativa Japonica Group]
 dbj|BAG91928.1| unnamed protein product [Oryza sativa Japonica Group]
Length=989

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 114/178 (64%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D +D + ++LGKYV+TLSSG S LRAWNLPDGQM+WE+ L  S  S+ +L V SN KV +
Sbjct  91   DPVDELSLSLGKYVVTLSSGGSILRAWNLPDGQMIWETNLQVSKSSKPLLHVLSNNKVAK  150

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D+L+ + +  +++AVSS DG + W KE + +GLD++ I+     D VYAVGL  SS+   
Sbjct  151  DNLVFVLAGRWIYAVSSIDGVISWGKEFSLDGLDLKQIIQSPENDIVYAVGLAGSSKLNL  210

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y++NA+ GE +KH    FP    G+  L +   +VALD T S L  I  K   I++ +
Sbjct  211  YQLNAKTGETVKHIQESFPIALCGETILGSHNVLVALDETRSDLFLIELKGESISYNK  268



>ref|XP_004960655.1| PREDICTED: ER membrane protein complex subunit 1-like [Setaria 
italica]
Length=988

 Score =   146 bits (368),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 117/178 (66%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSGST-LRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D +D + ++LGKYV+TLSSG T LRAWNLPDGQM+WE+ L  S+ S   L V SN KV +
Sbjct  91   DPLDQLSLSLGKYVLTLSSGGTILRAWNLPDGQMIWETNLKTSTASNPQLHVMSNNKVAK  150

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D+L+L+ +  +++AVSS DG + W+KE + +GL+I+ ++     D VYA G+  SS+   
Sbjct  151  DNLVLVSAGRWIYAVSSIDGAISWEKEFSLDGLEIKQVLQSPENDIVYAFGIAGSSKLAL  210

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y+++A+ GE+LK      PG  SG+I L +   +VAL+   S L  I FK   I++++
Sbjct  211  YQLSAKTGEILKDVQESLPGELSGEIVLGSDNVLVALNKARSSLFLIEFKSERISYKK  268



>ref|XP_008648064.1| PREDICTED: uncharacterized protein LOC100381974 isoform X1 [Zea 
mays]
 gb|AFW77478.1| hypothetical protein ZEAMMB73_969683 [Zea mays]
Length=988

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 115/178 (65%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSGST-LRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D +D + ++LGKYV+TLS G T LRAWNLPDG M+WE+ L  S+ S   L V SN KV  
Sbjct  91   DPLDQLSLSLGKYVLTLSLGGTILRAWNLPDGHMIWETNLRISTASNPQLHVMSNNKVAN  150

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D+L+L+ +  +++AVSSTDG ++W+KE + +GL+I+ I+       VYA+GL  SS+   
Sbjct  151  DNLVLVSAGRWIYAVSSTDGAILWEKEFSLDGLEIKRILQSPENGIVYALGLAGSSKLAL  210

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y ++A+ GE+LK      PGG  G+  LV+   +VALD   S L+ I FK   I++ +
Sbjct  211  YHLSAKTGEILKDIQESLPGGLLGETVLVSDNVLVALDKARSSLLVIEFKGERISYNK  268



>gb|AFW82067.1| hypothetical protein ZEAMMB73_676127 [Zea mays]
Length=881

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 113/178 (63%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSGST-LRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D +D + ++LGKYV+TLSSG T LRAWNLPDG M+WE+ L  S+ S S L V SN K  R
Sbjct  91   DPLDQLGLSLGKYVLTLSSGGTILRAWNLPDGLMIWETNLRTSTASNSQLHVMSNNKAAR  150

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D+L+L+ +  +++AVSS DG + W+KE + + L+I+ I+     D VYA+GL  SS+   
Sbjct  151  DNLVLVSAGRWIYAVSSIDGAISWEKEFSLDDLEIKRILQSPENDVVYALGLAGSSKLAL  210

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y ++A+ GE+LK     FPGG  G   L +    VALD   S L+ I FK   I++ +
Sbjct  211  YHLSAKTGEILKDIQESFPGGLCGKTVLGSDNVFVALDKARSSLLLIEFKGERISYNK  268



>gb|EEC78801.1| hypothetical protein OsI_19058 [Oryza sativa Indica Group]
Length=1036

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 113/178 (63%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D +D + ++LGKYV+TLSSG S LRAWNLPDGQM+WE+ L  S  S+ +L V SN KV +
Sbjct  138  DPVDELSLSLGKYVVTLSSGGSILRAWNLPDGQMIWETNLQVSKSSKPLLHVLSNNKVAK  197

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D+L+ + +  +++AVSS DG + W KE + +GLD++ I+     D VYAVGL  S +   
Sbjct  198  DNLVFVLAGRWIYAVSSIDGVISWGKEFSLDGLDLKQIIQSPENDIVYAVGLAGSLKLNL  257

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y++NA+ GE +KH    FP    G+  L +   +VALD T S L  I  K   I++ +
Sbjct  258  YQLNAKTGETVKHIQESFPIALCGETILGSHNVLVALDETRSDLFLIELKGESISYNK  315



>ref|XP_002439481.1| hypothetical protein SORBIDRAFT_09g007880 [Sorghum bicolor]
 gb|EES17911.1| hypothetical protein SORBIDRAFT_09g007880 [Sorghum bicolor]
Length=989

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 115/178 (65%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSGST-LRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D +D + ++ GKYV+TLSSG T LRAWNLPDGQM+WE+ L  S+ S   L V SN KV +
Sbjct  91   DPLDQLSLSHGKYVLTLSSGGTILRAWNLPDGQMIWETNLRTSAASNPQLHVMSNNKVAK  150

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D+L+L+ +  +++AVSS DG + W+KE + +GL+I+ I+     D VYA+GL  SS+   
Sbjct  151  DNLVLVSAGRWIYAVSSIDGAISWEKEFSIDGLEIKGILQSPENDVVYALGLAGSSKLAL  210

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y ++A+ GE+LK      PGG  G+  L +   +VALD   S L+ I FK   I++ +
Sbjct  211  YHLSAKTGEILKDIQESLPGGLCGETVLGSDNVLVALDKARSSLLLIEFKAERISYNK  268



>ref|XP_008656322.1| PREDICTED: ER membrane protein complex subunit 1-like [Zea mays]
Length=989

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 113/178 (63%), Gaps = 1/178 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSGST-LRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D +D + ++LGKYV+TLSSG T LRAWNLPDG M+WE+ L  S+ S S L V SN K  R
Sbjct  91   DPLDQLGLSLGKYVLTLSSGGTILRAWNLPDGLMIWETNLRTSTASNSQLHVMSNNKAAR  150

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D+L+L+ +  +++AVSS DG + W+KE + + L+I+ I+     D VYA+GL  SS+   
Sbjct  151  DNLVLVSAGRWIYAVSSIDGAISWEKEFSLDDLEIKRILQSPENDVVYALGLAGSSKLAL  210

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  534
            Y ++A+ GE+LK     FPGG  G   L +    VALD   S L+ I FK   I++ +
Sbjct  211  YHLSAKTGEILKDIQESFPGGLCGKTVLGSDNVFVALDKARSSLLLIEFKGERISYNK  268



>ref|XP_003568721.1| PREDICTED: ER membrane protein complex subunit 1 [Brachypodium 
distachyon]
Length=989

 Score =   140 bits (354),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 112/170 (66%), Gaps = 1/170 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  180
            D ID + ++LGKYV+TLSSG S LRAWNLPDGQM+WE+ +  S+ S+S+L V S+ KV +
Sbjct  90   DPIDQLSLSLGKYVVTLSSGGSILRAWNLPDGQMIWETNIQTSTASKSLLHVLSSNKVAK  149

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  360
            D+L+L+ +   ++AVSS DG + W+K+   + L+I+ ++     D V  VG+  SS+   
Sbjct  150  DNLVLVSTGRSIYAVSSIDGVISWRKDFTLDDLEIKQVIQSPENDIVSVVGVAGSSKLAL  209

Query  361  YKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFK  510
            Y++NA+ GE++K      PGG  G+  L + + ++ALD T S +  I FK
Sbjct  210  YQLNAKSGEIVKDAQESLPGGLCGETVLGSHDVLIALDQTRSAIFVIEFK  259



>ref|XP_003636402.1| hypothetical protein MTR_040s0031 [Medicago truncatula]
Length=871

 Score =   109 bits (272),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 82/130 (63%), Gaps = 2/130 (2%)
 Frame = +1

Query  145  ILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVY  324
            IL++  NLK D+D LIL++  G LHA+S  DGEV+W+K+ A+E +++ HI+     + +Y
Sbjct  22   ILIIQKNLKADKDDLILVFGKGCLHAISGIDGEVLWRKDFASESIEVSHIIQ--SPEVIY  79

Query  325  AVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSII  504
              G   SS+F  Y++NA+ GELLK+  +  P   SG+   V+ +K V LD   S +V+I 
Sbjct  80   VAGFVGSSKFYVYEVNAKSGELLKNNHVALPFATSGESLSVSGDKFVVLDDVRSKIVTID  139

Query  505  FKDGLINFQQ  534
              +G IN+ Q
Sbjct  140  INNGNINYNQ  149



>gb|KEH36029.1| ER membrane protein complex subunit-like protein [Medicago truncatula]
Length=849

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 78/124 (63%), Gaps = 2/124 (2%)
 Frame = +1

Query  163  NLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTS  342
            NLK D+D LIL++  G LHA+S  DGEV+W+K+ A+E +++ HI+     + +Y  G   
Sbjct  6    NLKADKDDLILVFGKGCLHAISGIDGEVLWRKDFASESIEVSHIIQ--SPEVIYVAGFVG  63

Query  343  SSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLI  522
            SS+F  Y++NA+ GELLK+  +  P   SG+   V+ +K V LD   S +V+I   +G I
Sbjct  64   SSKFYVYEVNAKSGELLKNNHVALPFATSGESLSVSGDKFVVLDDVRSKIVTIDINNGNI  123

Query  523  NFQQ  534
            N+ Q
Sbjct  124  NYNQ  127



>ref|XP_002962821.1| hypothetical protein SELMODRAFT_165412 [Selaginella moellendorffii]
 gb|EFJ36284.1| hypothetical protein SELMODRAFT_165412 [Selaginella moellendorffii]
Length=942

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 92/167 (55%), Gaps = 16/167 (10%)
 Frame = +1

Query  10   IDGIDIALGKYVITLSSGSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDRDSL  189
            IDG+ +ALGKY ++LS G +LR+++LPDG ++WE+ L  S     + L+PS+        
Sbjct  72   IDGLQVALGKYAVSLSRGGSLRSFHLPDGSLIWETSLYTSPSPAQLFLLPSD-------D  124

Query  190  ILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVAYKI  369
            +L+   G ++ VSS DG ++W  +L +E    Q  +  +G  ++Y  G + SS    ++I
Sbjct  125  LLVLKQGIVYVVSSADGRLLWTSDLLDESRLAQTSLSFEG-KNIYVAGFSGSS-LALFRI  182

Query  370  NARKGEL--LKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSII  504
            +A  G    LK    + P  F     +++S    ALD+ G+I+  ++
Sbjct  183  DASTGAFTTLKTTEPLNPSSF-----VLSSGVFAALDTQGNIVTGLM  224



>ref|XP_002965963.1| hypothetical protein SELMODRAFT_84520 [Selaginella moellendorffii]
 gb|EFJ33383.1| hypothetical protein SELMODRAFT_84520 [Selaginella moellendorffii]
Length=942

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 91/167 (54%), Gaps = 16/167 (10%)
 Frame = +1

Query  10   IDGIDIALGKYVITLSSGSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDRDSL  189
            IDG+ +ALGKY ++LS G +LR+++LPDG ++WE+ L  S     + L+PS+        
Sbjct  72   IDGLQVALGKYAVSLSRGGSLRSFHLPDGSLIWETSLYTSPSPAQLFLLPSD-------D  124

Query  190  ILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVAYKI  369
            +L+   G ++ VSS DG ++W  +L +E    Q  +  +G  ++Y  G + SS    ++I
Sbjct  125  LLVLKQGIVYVVSSADGRLLWTADLLDESRLAQTSLSFEG-KNIYVAGFSGSS-IALFRI  182

Query  370  NARKGEL--LKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSII  504
            +A  G    LK    + P  F     +++S    ALD+ G I+  ++
Sbjct  183  DASTGAFTTLKTTEPLNPSSF-----VLSSGVFAALDTQGDIVTGLM  224



>emb|CDX70404.1| BnaC03g04880D [Brassica napus]
Length=121

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = +1

Query  1    KDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSIL-LVP  159
            KD IDG+DIAL KYVITLSS GS LRAWNLPDGQMVWE+ L  +  S+S+L LVP
Sbjct  59   KDAIDGVDIALEKYVITLSSQGSMLRAWNLPDGQMVWETSLHRAQHSKSLLFLVP  113



>ref|XP_001765108.1| predicted protein [Physcomitrella patens]
 gb|EDQ70103.1| predicted protein [Physcomitrella patens]
Length=998

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/166 (31%), Positives = 90/166 (54%), Gaps = 2/166 (1%)
 Frame = +1

Query  4    DVIDGIDIALGKYVITLSSGSTLRAWNLPDGQMVWESFLSG-SSPSRSILLVPSNLKVDR  180
            D ID ++I++GKYV+TLS G+T+RAW+LPDG ++WE+ +      +  ++ +P ++  D+
Sbjct  89   DNIDALEISMGKYVLTLSKGNTVRAWHLPDGALIWETRIQAFQGFNLGLIKLPVDIDGDK  148

Query  181  DSLILIYSSGYLHAVSSTDGEVIWKKELA-NEGLDIQHIVHPDGTDDVYAVGLTSSSQFV  357
             + + +YS   L A+S  DG  +W+ + A ++ + I+ +V        Y +G        
Sbjct  149  VNDLFVYSGSILTAISGADGATLWRVDAAGSKNIFIEKVVLAPEEGKAYGLGFFGIMGVA  208

Query  358  AYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILV  495
              +I+ + G+L   +S       S +   VTS+  VAL S    LV
Sbjct  209  LVEIDLKTGDLSDLKSAELSSMLSTEHLHVTSDYAVALQSDAESLV  254



>gb|AFK49518.1| unknown [Lotus japonicus]
Length=52

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = -3

Query  266  ASSFFQITSPSVLETACKYPLL*IRIKLSLSTFKFEGTNKIDLEGLEP  123
            A SFFQITSPSV ETA ++P     IK SLS  KF G   ID +  EP
Sbjct  5    AKSFFQITSPSVPETAWRHPFPKTMIKSSLSALKFFGMCNIDFDVFEP  52



>ref|XP_002731135.2| PREDICTED: ER membrane protein complex subunit 1-like, partial 
[Saccoglossus kowalevskii]
Length=954

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 88/172 (51%), Gaps = 25/172 (15%)
 Frame = +1

Query  40   YVITLS-SGSTLRAWNLPDGQMVWESFL----SGSSPSRSILLVPSNLKVDRDSLILIYS  204
            Y+IT+S +G  LR+W+   G +VWE       S S PS +       +   +D + ++ S
Sbjct  70   YLITVSGNGKILRSWDAGTGSLVWEEVAAVTESTSKPSHA-----QAVFAGQDMMAVLTS  124

Query  205  SG-YLHAVSSTDGEVIWKKELAN-EGLDIQHIVHPDGTDDVYAVGLTSSSQ--FVAYKIN  372
            S  Y+H++   DG  +W KEL N E ++ Q I H  G D +Y +GL  +S    V+Y++N
Sbjct  125  SNVYVHSLK--DGTSLWSKELPNSESVNYQWI-HCGG-DVIYVIGLVENSHISIVSYQLN  180

Query  373  ARKGELLKHESMVFPGGFSG----DISLVTSEKVVALDSTGSILVSIIFKDG  516
               GE     S+  P  ++        +V +  +V ++S  + L S++ K+G
Sbjct  181  -NDGEPNPQRSL--PAAWASVTGVSCIVVGNSNLVCVESLTNSLHSVVLKEG  229



Lambda      K        H        a         alpha
   0.316    0.135    0.385    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553975666000