BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS032A04

Length=561
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006365462.1|  PREDICTED: protein transport protein SEC23-like    219   5e-63   Solanum tuberosum [potatoes]
ref|XP_004239847.1|  PREDICTED: protein transport protein SEC23-like    219   5e-63   Solanum lycopersicum
ref|XP_009799069.1|  PREDICTED: protein transport protein SEC23-like    215   8e-62   Nicotiana sylvestris
ref|XP_009622558.1|  PREDICTED: protein transport protein SEC23-like    215   9e-62   Nicotiana tomentosiformis
ref|XP_006358773.1|  PREDICTED: protein transport protein SEC23-like    211   3e-60   Solanum tuberosum [potatoes]
ref|XP_004247906.1|  PREDICTED: protein transport protein SEC23-like    209   2e-59   Solanum lycopersicum
emb|CDP15130.1|  unnamed protein product                                201   1e-56   Coffea canephora [robusta coffee]
gb|KDO52832.1|  hypothetical protein CISIN_1g0042381mg                  193   8e-56   Citrus sinensis [apfelsine]
ref|XP_009378161.1|  PREDICTED: protein transport protein SEC23-like    194   2e-54   Pyrus x bretschneideri [bai li]
gb|EPS74608.1|  hypothetical protein M569_00146                         186   3e-54   Genlisea aurea
ref|XP_009373604.1|  PREDICTED: protein transport protein SEC23-like    194   3e-54   Pyrus x bretschneideri [bai li]
gb|KDP32574.1|  hypothetical protein JCGZ_13124                         194   4e-54   Jatropha curcas
ref|XP_002516399.1|  protein transport protein sec23, putative          193   6e-54   Ricinus communis
ref|XP_008337484.1|  PREDICTED: protein transport protein SEC23         193   7e-54   
ref|XP_006421049.1|  hypothetical protein CICLE_v10004373mg             193   7e-54   Citrus clementina [clementine]
ref|XP_003601725.1|  Protein transport protein Sec23                    191   2e-53   
ref|XP_008222792.1|  PREDICTED: protein transport protein SEC23         191   2e-53   Prunus mume [ume]
ref|XP_007221956.1|  hypothetical protein PRUPE_ppa001742mg             191   2e-53   Prunus persica
ref|XP_003601724.1|  Protein transport protein Sec23                    191   2e-53   Medicago truncatula
ref|XP_006492989.1|  PREDICTED: protein transport protein SEC23-like    191   4e-53   Citrus sinensis [apfelsine]
ref|XP_009349001.1|  PREDICTED: protein transport protein SEC23-like    191   4e-53   Pyrus x bretschneideri [bai li]
ref|XP_010028115.1|  PREDICTED: protein transport protein SEC23-like    191   4e-53   Eucalyptus grandis [rose gum]
gb|EYU38948.1|  hypothetical protein MIMGU_mgv1a001629mg                191   5e-53   Erythranthe guttata [common monkey flower]
ref|XP_003552491.1|  PREDICTED: protein transport protein SEC23-l...    190   6e-53   Glycine max [soybeans]
ref|XP_011084141.1|  PREDICTED: protein transport protein SEC23-like    190   6e-53   Sesamum indicum [beniseed]
ref|XP_007034166.1|  Sec23/Sec24 protein transport family protein       190   6e-53   Theobroma cacao [chocolate]
ref|XP_010270294.1|  PREDICTED: protein transport protein SEC23-like    190   7e-53   Nelumbo nucifera [Indian lotus]
ref|XP_004502262.1|  PREDICTED: protein transport protein SEC23-l...    190   8e-53   Cicer arietinum [garbanzo]
ref|XP_010650390.1|  PREDICTED: protein transport protein SEC23-like    190   9e-53   Vitis vinifera
ref|XP_010097955.1|  Protein transport protein SEC23                    189   1e-52   Morus notabilis
ref|XP_007153808.1|  hypothetical protein PHAVU_003G066300g             189   1e-52   Phaseolus vulgaris [French bean]
ref|XP_004296961.1|  PREDICTED: protein transport protein SEC23-like    189   2e-52   Fragaria vesca subsp. vesca
ref|XP_007163794.1|  hypothetical protein PHAVU_001G264700g             188   3e-52   Phaseolus vulgaris [French bean]
ref|XP_004172995.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    181   5e-52   
ref|XP_010683601.1|  PREDICTED: protein transport protein SEC23-like    187   8e-52   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB37898.1|  hypothetical protein B456_006G225300                    187   1e-51   Gossypium raimondii
gb|KJB37899.1|  hypothetical protein B456_006G225300                    186   1e-51   Gossypium raimondii
gb|KHF97532.1|  Protein transport SEC23                                 186   2e-51   Gossypium arboreum [tree cotton]
ref|XP_003538532.1|  PREDICTED: protein transport protein SEC23-l...    186   2e-51   Glycine max [soybeans]
gb|KJB71965.1|  hypothetical protein B456_011G150700                    186   3e-51   Gossypium raimondii
ref|XP_010269071.1|  PREDICTED: protein transport protein SEC23-like    186   3e-51   Nelumbo nucifera [Indian lotus]
gb|KHG15352.1|  Protein transport SEC23                                 185   3e-51   Gossypium arboreum [tree cotton]
ref|XP_011045698.1|  PREDICTED: protein transport protein SEC23-like    184   7e-51   Populus euphratica
gb|EPS72601.1|  hypothetical protein M569_02145                         184   1e-50   Genlisea aurea
ref|XP_008439044.1|  PREDICTED: protein transport protein SEC23         184   1e-50   Cucumis melo [Oriental melon]
ref|XP_006370915.1|  transport family protein                           183   2e-50   
ref|XP_011046336.1|  PREDICTED: protein transport protein SEC23-like    183   2e-50   Populus euphratica
gb|KGN57237.1|  hypothetical protein Csa_3G172420                       182   5e-50   Cucumis sativus [cucumbers]
ref|XP_004147649.1|  PREDICTED: protein transport protein SEC23-like    182   5e-50   
ref|XP_010466720.1|  PREDICTED: protein transport protein SEC23-like    182   7e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010532717.1|  PREDICTED: protein transport protein SEC23-l...    181   7e-50   Tarenaya hassleriana [spider flower]
ref|XP_002300208.1|  transport family protein                           181   8e-50   Populus trichocarpa [western balsam poplar]
ref|XP_010532714.1|  PREDICTED: protein transport protein SEC23-l...    181   1e-49   Tarenaya hassleriana [spider flower]
emb|CDY12738.1|  BnaC04g29030D                                          181   2e-49   Brassica napus [oilseed rape]
gb|KHG04907.1|  Protein transport SEC23                                 181   2e-49   Gossypium arboreum [tree cotton]
gb|KHG16267.1|  Protein transport Sec23A                                181   2e-49   Gossypium arboreum [tree cotton]
gb|KFK39665.1|  hypothetical protein AALP_AA3G273400                    181   2e-49   Arabis alpina [alpine rockcress]
ref|XP_010512680.1|  PREDICTED: protein transport protein SEC23-l...    181   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_002892293.1|  hypothetical protein ARALYDRAFT_470552             180   2e-49   
gb|KJB28028.1|  hypothetical protein B456_005G022700                    179   2e-49   Gossypium raimondii
ref|NP_974544.1|  sec23/sec24-like transport protein                    179   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010527425.1|  PREDICTED: protein transport protein SEC23-l...    179   4e-49   Tarenaya hassleriana [spider flower]
gb|KJB30033.1|  hypothetical protein B456_005G128200                    177   4e-49   Gossypium raimondii
ref|XP_010527422.1|  PREDICTED: protein transport protein SEC23-l...    179   5e-49   Tarenaya hassleriana [spider flower]
ref|XP_010485034.1|  PREDICTED: protein transport protein SEC23-like    178   1e-48   Camelina sativa [gold-of-pleasure]
gb|KJB28027.1|  hypothetical protein B456_005G022700                    178   1e-48   Gossypium raimondii
gb|KFK42891.1|  hypothetical protein AALP_AA1G052100                    178   1e-48   Arabis alpina [alpine rockcress]
emb|CDX90271.1|  BnaA08g17130D                                          178   1e-48   
ref|NP_563741.1|  sec23/sec24-like transport protein                    178   2e-48   Arabidopsis thaliana [mouse-ear cress]
gb|AAL08282.1|  At1g05520/T25N20_16                                     178   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006418018.1|  hypothetical protein EUTSA_v10006857mg             178   2e-48   Eutrema salsugineum [saltwater cress]
gb|AAF79733.1|AC005106_14  T25N20.17                                    178   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|NP_849541.2|  sec23/sec24-like transport protein                    177   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193152.2|  sec23/sec24-like transport protein                    177   2e-48   Arabidopsis thaliana [mouse-ear cress]
gb|AAM10394.1|  AT4g14160/dl3120w                                       177   2e-48   Arabidopsis thaliana [mouse-ear cress]
emb|CAB10195.1|  transport protein                                      177   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010522277.1|  PREDICTED: protein transport protein SEC23         177   2e-48   Tarenaya hassleriana [spider flower]
gb|KJB30034.1|  hypothetical protein B456_005G128200                    176   4e-48   Gossypium raimondii
ref|XP_002885585.1|  hypothetical protein ARALYDRAFT_479878             177   4e-48   
emb|CDY12077.1|  BnaC03g59930D                                          176   4e-48   Brassica napus [oilseed rape]
gb|KJB30032.1|  hypothetical protein B456_005G128200                    176   5e-48   Gossypium raimondii
ref|XP_006414783.1|  hypothetical protein EUTSA_v10024465mg             176   5e-48   Eutrema salsugineum [saltwater cress]
gb|KFK22996.1|  hypothetical protein AALP_AAs50735U000600               176   8e-48   Arabis alpina [alpine rockcress]
ref|XP_010457640.1|  PREDICTED: protein transport protein SEC23-l...    175   2e-47   
ref|XP_010475248.1|  PREDICTED: protein transport protein SEC23-like    174   3e-47   Camelina sativa [gold-of-pleasure]
emb|CDY01197.1|  BnaA04g06220D                                          174   4e-47   
ref|XP_006283156.1|  hypothetical protein CARUB_v10004186mg             174   5e-47   Capsella rubella
ref|XP_009111051.1|  PREDICTED: protein transport protein SEC23         173   6e-47   Brassica rapa
emb|CDX86574.1|  BnaC08g01290D                                          173   6e-47   
ref|NP_189008.1|  Sec23/Sec24 protein transport family protein          172   1e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870333.1|  hypothetical protein ARALYDRAFT_493493             172   1e-46   
ref|NP_001189956.1|  Sec23/Sec24 protein transport family protein       172   1e-46   Arabidopsis thaliana [mouse-ear cress]
emb|CBI39378.3|  unnamed protein product                                172   2e-46   Vitis vinifera
ref|XP_009139544.1|  PREDICTED: protein transport protein SEC23-like    172   3e-46   Brassica rapa
ref|XP_006297004.1|  hypothetical protein CARUB_v10012995mg             171   3e-46   Capsella rubella
ref|XP_008785319.1|  PREDICTED: protein transport protein SEC23-like    171   3e-46   Phoenix dactylifera
ref|XP_006297005.1|  hypothetical protein CARUB_v10012995mg             171   4e-46   
ref|XP_010934373.1|  PREDICTED: protein transport protein SEC23-l...    169   9e-46   
ref|XP_009419583.1|  PREDICTED: protein transport protein SEC23-like    170   1e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009420223.1|  PREDICTED: protein transport protein SEC23-like    168   6e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010934372.1|  PREDICTED: protein transport protein SEC23-l...    167   9e-45   Elaeis guineensis
ref|XP_010908065.1|  PREDICTED: protein transport protein SEC23-l...    167   1e-44   
ref|XP_010908064.1|  PREDICTED: protein transport protein SEC23-l...    167   1e-44   Elaeis guineensis
ref|XP_006303716.1|  hypothetical protein CARUB_v10011838mg             163   3e-43   Capsella rubella
ref|XP_006827919.1|  hypothetical protein AMTR_s00008p00163370          160   2e-42   Amborella trichopoda
ref|XP_009414536.1|  PREDICTED: protein transport protein SEC23-like    160   5e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008791501.1|  PREDICTED: protein transport protein SEC23-like    160   7e-42   Phoenix dactylifera
ref|XP_010440522.1|  PREDICTED: protein transport protein SEC23-like    157   5e-41   Camelina sativa [gold-of-pleasure]
ref|XP_009417946.1|  PREDICTED: protein transport protein SEC23-like    154   1e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010435181.1|  PREDICTED: protein transport protein SEC23-like    152   4e-39   Camelina sativa [gold-of-pleasure]
ref|XP_003059046.1|  predicted protein                                  151   9e-39   Micromonas pusilla CCMP1545
gb|KJB72954.1|  hypothetical protein B456_011G205900                    149   2e-38   Gossypium raimondii
gb|KJB72955.1|  hypothetical protein B456_011G205900                    149   2e-38   Gossypium raimondii
gb|KJB72956.1|  hypothetical protein B456_011G205900                    149   3e-38   Gossypium raimondii
gb|KJB72952.1|  hypothetical protein B456_011G205900                    149   3e-38   Gossypium raimondii
ref|XP_007011443.1|  Sec23/Sec24 protein transport family protein...    149   5e-38   Theobroma cacao [chocolate]
gb|KDP24898.1|  hypothetical protein JCGZ_24276                         150   5e-38   Jatropha curcas
ref|XP_002508348.1|  predicted protein                                  149   7e-38   Micromonas commoda
ref|XP_010255698.1|  PREDICTED: protein transport protein SEC23-like    148   7e-38   Nelumbo nucifera [Indian lotus]
gb|EAZ07329.1|  hypothetical protein OsI_29578                          144   8e-38   Oryza sativa Indica Group [Indian rice]
gb|KJB78641.1|  hypothetical protein B456_013G010400                    146   9e-38   Gossypium raimondii
ref|XP_010939455.1|  PREDICTED: protein transport protein SEC23 i...    147   9e-38   
ref|XP_002526529.1|  protein transport protein sec23, putative          148   1e-37   Ricinus communis
ref|XP_009387153.1|  PREDICTED: protein transport protein SEC23         148   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003577593.1|  PREDICTED: protein transport protein SEC23-like    148   1e-37   Brachypodium distachyon [annual false brome]
ref|XP_008797249.1|  PREDICTED: protein transport protein sec23 i...    147   1e-37   
ref|XP_010939452.1|  PREDICTED: protein transport protein SEC23 i...    147   2e-37   Elaeis guineensis
ref|XP_007011442.1|  Sec23/Sec24 protein transport family protein...    148   2e-37   
ref|XP_008797246.1|  PREDICTED: protein transport protein SEC23 i...    147   2e-37   Phoenix dactylifera
ref|XP_002444510.1|  hypothetical protein SORBIDRAFT_07g023060          147   2e-37   Sorghum bicolor [broomcorn]
ref|XP_010450096.1|  PREDICTED: protein transport protein SEC23-like    147   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_001762459.1|  predicted protein                                  147   3e-37   
ref|XP_008375693.1|  PREDICTED: protein transport protein SEC23-like    144   4e-37   
gb|KJB78640.1|  hypothetical protein B456_013G010400                    145   4e-37   Gossypium raimondii
ref|XP_001774792.1|  predicted protein                                  146   4e-37   
ref|XP_010097714.1|  Protein transport protein SEC23                    146   4e-37   
ref|XP_008344490.1|  PREDICTED: protein transport protein SEC23-like    141   4e-37   
gb|KJB78639.1|  hypothetical protein B456_013G010400                    145   5e-37   Gossypium raimondii
gb|KJB78634.1|  hypothetical protein B456_013G010400                    146   5e-37   Gossypium raimondii
gb|KJB78638.1|  hypothetical protein B456_013G010400                    145   6e-37   Gossypium raimondii
gb|KJB78636.1|  hypothetical protein B456_013G010400                    145   6e-37   Gossypium raimondii
ref|XP_004973675.1|  PREDICTED: protein transport protein SEC23-l...    145   8e-37   Setaria italica
gb|EMS65767.1|  Protein transport protein SEC23                         143   1e-36   Triticum urartu
emb|CAN81541.1|  hypothetical protein VITISV_008772                     141   1e-36   Vitis vinifera
ref|XP_004973674.1|  PREDICTED: protein transport protein SEC23-l...    145   1e-36   Setaria italica
ref|XP_007220245.1|  hypothetical protein PRUPE_ppa001813mg             144   2e-36   Prunus persica
ref|XP_009361354.1|  PREDICTED: protein transport protein SEC23-like    144   2e-36   Pyrus x bretschneideri [bai li]
ref|NP_001062030.1|  Os08g0474700                                       144   2e-36   
ref|XP_008232223.1|  PREDICTED: protein transport protein SEC23         144   3e-36   Prunus mume [ume]
ref|XP_010278786.1|  PREDICTED: protein transport protein SEC23-l...    144   3e-36   
ref|XP_010278782.1|  PREDICTED: protein transport protein SEC23-l...    144   3e-36   Nelumbo nucifera [Indian lotus]
ref|XP_008460075.1|  PREDICTED: protein transport protein SEC23         144   3e-36   Cucumis melo [Oriental melon]
ref|XP_010278787.1|  PREDICTED: protein transport protein SEC23-l...    144   3e-36   Nelumbo nucifera [Indian lotus]
ref|XP_004145019.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    144   3e-36   
ref|XP_010278785.1|  PREDICTED: protein transport protein SEC23-l...    144   4e-36   Nelumbo nucifera [Indian lotus]
ref|XP_004160683.1|  PREDICTED: protein transport protein SEC23-like    144   4e-36   
ref|XP_010278781.1|  PREDICTED: protein transport protein SEC23-l...    144   4e-36   
ref|XP_004153079.1|  PREDICTED: protein transport protein SEC23-like    144   4e-36   
ref|XP_004964627.1|  PREDICTED: protein transport protein SEC23-l...    143   5e-36   
ref|XP_011024746.1|  PREDICTED: protein transport protein SEC23-l...    143   7e-36   Populus euphratica
ref|XP_011024747.1|  PREDICTED: protein transport protein SEC23-l...    143   8e-36   Populus euphratica
gb|KHG07260.1|  Protein transport SEC23                                 142   8e-36   Gossypium arboreum [tree cotton]
ref|XP_002460346.1|  hypothetical protein SORBIDRAFT_02g026780          142   8e-36   Sorghum bicolor [broomcorn]
gb|AAX96396.1|  At1g05520/T25N20_16                                     143   9e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004307298.1|  PREDICTED: protein transport protein SEC23         142   9e-36   Fragaria vesca subsp. vesca
gb|EAY80788.1|  hypothetical protein OsI_35968                          143   9e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_006659495.1|  PREDICTED: protein transport protein SEC23-like    142   1e-35   Oryza brachyantha
ref|XP_003578242.1|  PREDICTED: protein transport protein SEC23-like    142   2e-35   Brachypodium distachyon [annual false brome]
gb|EMT27989.1|  Protein transport protein sec-23                        142   2e-35   
ref|XP_010052697.1|  PREDICTED: protein transport protein SEC23         142   2e-35   Eucalyptus grandis [rose gum]
gb|EEE67142.1|  hypothetical protein OsJ_24197                          142   2e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009376310.1|  PREDICTED: protein transport protein SEC23-like    141   2e-35   Pyrus x bretschneideri [bai li]
ref|XP_011010741.1|  PREDICTED: protein transport protein SEC23-like    141   2e-35   Populus euphratica
emb|CBI38071.3|  unnamed protein product                                142   2e-35   Vitis vinifera
ref|XP_002265101.1|  PREDICTED: protein transport protein SEC23         141   2e-35   Vitis vinifera
ref|XP_008344985.1|  PREDICTED: protein transport protein SEC23         141   2e-35   
ref|XP_001702936.1|  COP-II coat subunit                                141   3e-35   Chlamydomonas reinhardtii
ref|XP_002320574.1|  transport family protein                           141   4e-35   
ref|XP_006375610.1|  hypothetical protein POPTR_0014s17660g             140   4e-35   Populus trichocarpa [western balsam poplar]
gb|KDO85352.1|  hypothetical protein CISIN_1g004199mg                   138   4e-35   Citrus sinensis [apfelsine]
gb|EEC82002.1|  hypothetical protein OsI_25948                          140   5e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_003626854.1|  Protein transport protein SEC23                    140   8e-35   Medicago truncatula
gb|KDO85351.1|  hypothetical protein CISIN_1g004199mg                   138   8e-35   Citrus sinensis [apfelsine]
dbj|BAJ93511.1|  predicted protein                                      138   9e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA40251.1|  TPA: hypothetical protein ZEAMMB73_365624              139   1e-34   
ref|XP_002946892.1|  hypothetical protein VOLCADRAFT_103128             140   1e-34   Volvox carteri f. nagariensis
ref|XP_002461253.1|  hypothetical protein SORBIDRAFT_02g043632          132   1e-34   
ref|XP_008668489.1|  PREDICTED: uncharacterized protein LOC100384...    140   1e-34   
ref|XP_006445524.1|  hypothetical protein CICLE_v10019144mg             138   2e-34   
gb|KDO85350.1|  hypothetical protein CISIN_1g004199mg                   138   2e-34   Citrus sinensis [apfelsine]
ref|XP_005843379.1|  hypothetical protein CHLNCDRAFT_141205             136   3e-34   Chlorella variabilis
gb|EMS46122.1|  Protein transport protein SEC23                         138   3e-34   Triticum urartu
ref|XP_006464334.1|  PREDICTED: protein transport protein SEC23-like    138   4e-34   Citrus sinensis [apfelsine]
gb|KDO85349.1|  hypothetical protein CISIN_1g004199mg                   138   4e-34   Citrus sinensis [apfelsine]
gb|EMT03462.1|  Protein transport protein SEC23                         137   6e-34   
dbj|BAJ85358.1|  predicted protein                                      137   8e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK01218.1|  predicted protein                                      137   8e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010691934.1|  PREDICTED: protein transport protein SEC23         136   1e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004510207.1|  PREDICTED: protein transport protein SEC23-like    135   3e-33   Cicer arietinum [garbanzo]
ref|XP_006854134.1|  hypothetical protein AMTR_s00048p00165750          135   6e-33   Amborella trichopoda
ref|XP_010235206.1|  PREDICTED: protein transport protein SEC23-l...    134   7e-33   
ref|XP_003574621.1|  PREDICTED: protein transport protein SEC23-l...    134   9e-33   Brachypodium distachyon [annual false brome]
ref|XP_002966180.1|  hypothetical protein SELMODRAFT_168140             134   1e-32   Selaginella moellendorffii
ref|XP_002982254.1|  hypothetical protein SELMODRAFT_155031             134   1e-32   Selaginella moellendorffii
emb|CCO26910.1|  Protein transport protein SEC23                        124   2e-32   Rhizoctonia solani AG-1 IB
ref|XP_002102257.1|  GD19805                                            124   3e-32   
ref|XP_003521007.1|  PREDICTED: protein transport protein SEC23-like    132   3e-32   Glycine max [soybeans]
ref|XP_009629158.1|  PREDICTED: protein transport protein SEC23         132   4e-32   Nicotiana tomentosiformis
gb|KDP40275.1|  hypothetical protein JCGZ_02273                         132   4e-32   Jatropha curcas
ref|XP_009800228.1|  PREDICTED: protein transport protein SEC23         132   4e-32   Nicotiana sylvestris
ref|XP_002986965.1|  hypothetical protein SELMODRAFT_124893             132   7e-32   
ref|XP_002977937.1|  hypothetical protein SELMODRAFT_107900             132   7e-32   
ref|XP_001774442.1|  predicted protein                                  132   7e-32   
ref|XP_004229519.1|  PREDICTED: protein transport protein SEC23         131   8e-32   Solanum lycopersicum
dbj|BAM19569.1|  protein transport protein sec23                        123   2e-31   Papilio xuthus [Chinese swallowtail]
gb|KIJ06392.1|  hypothetical protein PAXINDRAFT_103385                  122   2e-31   Paxillus involutus ATCC 200175
ref|XP_006354587.1|  PREDICTED: protein transport protein SEC23-like    130   2e-31   Solanum tuberosum [potatoes]
ref|XP_780042.1|  PREDICTED: protein transport protein Sec23A iso...    130   2e-31   Strongylocentrotus purpuratus [purple urchin]
emb|CCA74741.1|  probable SEC23-component of COPII coat of ER-gol...    130   2e-31   Serendipita indica DSM 11827
ref|XP_007660591.1|  PREDICTED: protein transport protein Sec23A-...    120   3e-31   
ref|XP_010495646.1|  PREDICTED: protein transport protein SEC23-like    127   3e-31   Camelina sativa [gold-of-pleasure]
ref|XP_008042194.1|  copii coat protein                                 129   4e-31   Trametes versicolor FP-101664 SS1
gb|KIM24219.1|  hypothetical protein M408DRAFT_331867                   129   4e-31   Serendipita vermifera MAFF 305830
gb|ABQ12917.1|  Sec23 (S. cerevisiae) homolog B                         121   4e-31   Bos taurus [bovine]
gb|KHN32738.1|  Protein transport protein SEC23                         129   5e-31   Glycine soja [wild soybean]
ref|XP_008482918.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    128   6e-31   
ref|XP_011279270.1|  PREDICTED: protein transport protein Sec23B-...    121   6e-31   
ref|XP_002517022.1|  protein transport protein sec23, putative          129   7e-31   Ricinus communis
ref|XP_011030584.1|  PREDICTED: protein transport protein sec23-1       129   1e-30   Populus euphratica
ref|XP_010481838.1|  PREDICTED: protein transport protein SEC23-like    128   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010274198.1|  PREDICTED: protein transport protein Sec23A        128   1e-30   Nelumbo nucifera [Indian lotus]
ref|XP_002385801.1|  hypothetical protein MPER_16204                    120   1e-30   
ref|XP_011091114.1|  PREDICTED: protein transport protein SEC23         128   1e-30   Sesamum indicum [beniseed]
ref|XP_002315735.1|  transport family protein                           128   1e-30   
ref|XP_002489340.1|  hypothetical protein SORBIDRAFT_0010s021250        128   1e-30   Sorghum bicolor [broomcorn]
ref|XP_007301896.1|  hypothetical protein STEHIDRAFT_166914             128   2e-30   Stereum hirsutum FP-91666 SS1
ref|XP_007134267.1|  hypothetical protein PHAVU_010G032700g             128   2e-30   Phaseolus vulgaris [French bean]
ref|XP_010149983.1|  PREDICTED: protein transport protein Sec23A-...    122   2e-30   Eurypyga helias
ref|XP_006280033.1|  hypothetical protein CARUB_v10025910mg             128   2e-30   Capsella rubella
ref|XP_010441998.1|  PREDICTED: protein transport protein SEC23-like    128   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_011410444.1|  PREDICTED: protein transport protein Sec23A-...    127   2e-30   Amphimedon queenslandica
ref|XP_007004395.1|  hypothetical protein TREMEDRAFT_71580              127   2e-30   Tremella mesenterica DSM 1558
ref|XP_004979229.1|  PREDICTED: protein transport protein SEC23-like    127   2e-30   Setaria italica
ref|XP_001751286.1|  predicted protein                                  127   2e-30   
ref|XP_003547758.1|  PREDICTED: protein transport protein SEC23-like    127   2e-30   Glycine max [soybeans]
dbj|BAB08946.1|  protein transport protein SEC23                        127   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002863641.1|  hypothetical protein ARALYDRAFT_494637             127   2e-30   
gb|KDE07582.1|  protein transporter SEC23                               127   2e-30   Microbotryum lychnidis-dioicae p1A1 Lamole
gb|KDN53244.1|  hypothetical protein K437DRAFT_253260                   127   2e-30   Tilletiaria anomala UBC 951
ref|NP_568626.1|  sec23/sec24-like transport protein                    127   2e-30   Arabidopsis thaliana [mouse-ear cress]
gb|EFX88498.1|  hypothetical protein DAPPUDRAFT_190968                  127   2e-30   Daphnia pulex
gb|EKC99299.1|  protein transport protein SEC23                         127   2e-30   Trichosporon asahii var. asahii CBS 8904
ref|XP_010087764.1|  Protein transport protein Sec23A                   127   2e-30   
ref|XP_004923361.1|  PREDICTED: protein transport protein Sec23A-...    127   3e-30   
gb|KDN50157.1|  LOW QUALITY PROTEIN: hypothetical protein RSAG8_0...    126   3e-30   Rhizoctonia solani AG-8 WAC10335
gb|EPX71940.1|  GTPase activating protein Sec23a                        127   3e-30   Schizosaccharomyces octosporus yFS286
gb|ERL83427.1|  hypothetical protein D910_00401                         127   3e-30   Dendroctonus ponderosae
ref|XP_007384113.1|  protein transporter SEC23                          127   3e-30   Punctularia strigosozonata HHB-11173 SS5
gb|EPY49891.1|  GTPase activating protein Sec23a                        127   3e-30   Schizosaccharomyces cryophilus OY26
ref|XP_007370480.1|  hypothetical protein DICSQDRAFT_183604             127   3e-30   Dichomitus squalens LYAD-421 SS1
ref|XP_004923360.1|  PREDICTED: protein transport protein Sec23A-...    127   3e-30   Bombyx mori [silk moth]
gb|EGI70064.1|  Protein transport protein Sec23A                        127   3e-30   Acromyrmex echinatior
gb|EMD35658.1|  copii coat protein                                      127   3e-30   Gelatoporia subvermispora B
emb|CAB81549.1|  putative Sec23 protein                                 127   3e-30   Drosophila melanogaster
ref|XP_002311659.1|  hypothetical protein POPTR_0008s16120g             127   3e-30   
ref|XP_008224182.1|  PREDICTED: protein transport protein SEC23         127   3e-30   Prunus mume [ume]
ref|XP_006403208.1|  hypothetical protein EUTSA_v10003153mg             127   4e-30   Eutrema salsugineum [saltwater cress]
ref|XP_006356052.1|  PREDICTED: protein transport protein SEC23-like    127   4e-30   Solanum tuberosum [potatoes]
gb|EJT48333.1|  protein transport protein SEC23                         127   4e-30   Trichosporon asahii var. asahii CBS 2479
gb|KIJ06501.1|  hypothetical protein PAXINDRAFT_91896                   122   4e-30   Paxillus involutus ATCC 200175
ref|XP_004234029.1|  PREDICTED: protein transport protein SEC23         127   4e-30   Solanum lycopersicum
dbj|BAE33090.1|  unnamed protein product                                122   4e-30   Mus musculus [mouse]
ref|XP_008477629.1|  PREDICTED: protein transport protein Sec23A-...    126   5e-30   
gb|ENN77775.1|  hypothetical protein YQE_05747                          126   5e-30   Dendroctonus ponderosae
gb|AEE62753.1|  unknown                                                 126   5e-30   Dendroctonus ponderosae
ref|XP_009101771.1|  PREDICTED: protein transport protein SEC23         126   5e-30   Brassica rapa
emb|CDI52493.1|  probable SEC23-component of COPII coat of ER-gol...    126   6e-30   Melanopsichium pennsylvanicum 4
ref|NP_730978.1|  Sec23 ortholog, isoform A                             126   6e-30   Drosophila melanogaster
emb|CAN67335.1|  hypothetical protein VITISV_024487                     126   6e-30   Vitis vinifera
ref|NP_001246933.1|  Sec23 ortholog, isoform F                          126   6e-30   
ref|NP_001246932.1|  Sec23 ortholog, isoform E                          126   6e-30   
ref|XP_010531432.1|  PREDICTED: protein transport protein SEC23         126   6e-30   
gb|AAN71374.1|  RE35250p                                                126   6e-30   
emb|CEL57741.1|  Protein transport protein SEC23 OS=Ustilago mayd...    127   6e-30   
ref|XP_002098055.1|  GE10151                                            126   6e-30   
ref|XP_001978970.1|  GG12978                                            126   6e-30   
ref|XP_006957323.1|  copii coat protein                                 126   6e-30   
ref|XP_009268230.1|  Protein transport protein SEC23                    127   7e-30   
gb|EPS96173.1|  hypothetical protein FOMPIDRAFT_1167779                 126   7e-30   
ref|XP_009549822.1|  hypothetical protein HETIRDRAFT_435796             126   7e-30   
ref|XP_002284161.1|  PREDICTED: protein transport protein SEC23         126   7e-30   
gb|KIO19135.1|  hypothetical protein M407DRAFT_246276                   126   7e-30   
ref|XP_010278158.1|  PREDICTED: protein transport protein SEC23-like    126   7e-30   
gb|KDQ13407.1|  hypothetical protein BOTBODRAFT_33712                   126   8e-30   
emb|CCM06023.1|  predicted protein                                      126   8e-30   
ref|XP_001998913.1|  GI23366                                            126   8e-30   
gb|EUC66788.1|  protein transporter Sec23                               126   9e-30   
ref|XP_010024035.1|  PREDICTED: protein transport protein Sec23A        126   9e-30   
gb|EDL95155.1|  SEC23B (S. cerevisiae) (predicted), isoform CRA_b       123   9e-30   
ref|XP_007404362.1|  hypothetical protein MELLADRAFT_41731              125   9e-30   
ref|XP_011029889.1|  PREDICTED: protein transport protein sec23-1...    125   1e-29   
emb|CDX94717.1|  BnaC07g17260D                                          125   1e-29   
gb|KEP48063.1|  protein transporter Sec23                               126   1e-29   
ref|XP_003321108.2|  protein transporter SEC23                          125   1e-29   
emb|CDY22339.1|  BnaA06g36610D                                          125   1e-29   
gb|EHJ75116.1|  putative protein transport protein sec23                123   1e-29   
gb|EDL28470.1|  SEC23B (S. cerevisiae), isoform CRA_b                   123   1e-29   
ref|XP_007392773.1|  hypothetical protein PHACADRAFT_251062             125   1e-29   
emb|CCF53565.1|  probable SEC23-component of COPII coat of ER-gol...    125   1e-29   
gb|EPX72404.1|  GTPase activating protein Sec23b                        125   1e-29   
gb|KDQ58302.1|  hypothetical protein JAAARDRAFT_34105                   125   1e-29   
ref|XP_002431175.1|  protein transport protein Sec23A, putative         125   1e-29   
gb|KIP01777.1|  hypothetical protein PHLGIDRAFT_96685                   125   1e-29   
ref|XP_003746313.1|  PREDICTED: protein transport protein Sec23A        125   1e-29   
ref|XP_007225252.1|  hypothetical protein PRUPE_ppa001670mg             125   1e-29   
ref|XP_011387617.1|  putative GTPase-activating protein SEC23           125   1e-29   
dbj|GAC96354.1|  potential SEC23-like GTPase-activating protein         125   1e-29   
emb|CDH54362.1|  protein transporter sec23                              121   1e-29   
ref|XP_008312513.1|  PREDICTED: protein transport protein Sec23A        125   1e-29   
dbj|GAK63456.1|  copii coat protein                                     125   1e-29   
gb|EST07588.1|  vesicle coat complex COPII, subunit SEC23               125   1e-29   
emb|CBQ71835.1|  probable SEC23-component of COPII coat of ER-gol...    125   1e-29   
gb|EMS18549.1|  protein transport protein SEC23                         125   1e-29   
ref|XP_003736491.1|  GA26597, isoform B                                 125   2e-29   
ref|XP_002013896.1|  GL24389                                            125   2e-29   
ref|XP_007869503.1|  copii coat protein                                 125   2e-29   
emb|CDR44779.1|  RHTO0S10e00320g1_1                                     125   2e-29   
ref|XP_002070766.1|  GK12234                                            125   2e-29   
ref|XP_002056184.1|  GJ10360                                            125   2e-29   
ref|XP_001990177.1|  GH18375                                            125   2e-29   
gb|ADN34158.1|  transport protein sec23                                 125   2e-29   
gb|ETS62844.1|  hypothetical protein PaG_02599                          125   2e-29   
ref|XP_011064305.1|  PREDICTED: protein transport protein Sec23A        125   2e-29   
ref|XP_001953052.1|  GF17577                                            125   2e-29   
ref|XP_002137352.1|  GA26597, isoform A                                 125   2e-29   
ref|XP_011093425.1|  PREDICTED: protein transport protein SEC23 i...    124   2e-29   
ref|XP_005186964.1|  PREDICTED: protein transport protein Sec23A ...    125   2e-29   
gb|EYU42283.1|  hypothetical protein MIMGU_mgv1a001723mg                124   2e-29   
ref|XP_009026518.1|  hypothetical protein HELRODRAFT_185982             124   2e-29   
gb|KFK31705.1|  hypothetical protein AALP_AA6G148300                    124   2e-29   
ref|XP_005186963.1|  PREDICTED: protein transport protein Sec23A ...    125   2e-29   
ref|XP_007879432.1|  hypothetical protein PFL1_03722                    124   2e-29   
ref|XP_008465182.1|  PREDICTED: protein transport protein SEC23         124   2e-29   
ref|XP_004840935.1|  PREDICTED: protein transport protein Sec23B ...    124   2e-29   
ref|XP_004909922.1|  PREDICTED: protein transport protein Sec23B        124   2e-29   
ref|XP_003427585.1|  PREDICTED: protein transport protein Sec23A ...    124   2e-29   
ref|XP_008211672.1|  PREDICTED: protein transport protein Sec23A ...    124   2e-29   
gb|EHB18824.1|  Protein transport protein Sec23B                        124   2e-29   
ref|XP_004150433.1|  PREDICTED: protein transport protein SEC23-like    124   3e-29   
ref|XP_005072663.1|  PREDICTED: protein transport protein Sec23B        124   3e-29   
ref|XP_004164421.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    124   3e-29   
ref|XP_010632467.1|  PREDICTED: protein transport protein Sec23B        124   3e-29   
gb|KIL64158.1|  hypothetical protein M378DRAFT_24750                    124   3e-29   
ref|XP_003363993.1|  PREDICTED: protein transport protein Sec23B        124   3e-29   
ref|XP_008538699.1|  PREDICTED: protein transport protein Sec23B        124   3e-29   
ref|NP_001006179.1|  protein transport protein Sec23A                   124   3e-29   
ref|XP_005634787.1|  PREDICTED: protein transport protein Sec23B ...    124   3e-29   
ref|XP_003203805.1|  PREDICTED: protein transport protein Sec23B        124   3e-29   
ref|XP_005380990.1|  PREDICTED: protein transport protein Sec23B        124   3e-29   
ref|XP_010081860.1|  PREDICTED: protein transport protein Sec23A        122   3e-29   
ref|XP_002173747.1|  GTPase activating protein Sec23a                   124   3e-29   
gb|KIM86120.1|  hypothetical protein PILCRDRAFT_816653                  124   3e-29   
ref|XP_002620173.1|  protein transporter SEC23                          124   3e-29   
gb|EJU02357.1|  hypothetical protein DACRYDRAFT_22029                   124   3e-29   
ref|XP_005634786.1|  PREDICTED: protein transport protein Sec23B ...    124   3e-29   
gb|EEQ86379.1|  protein transporter sec23                               124   4e-29   
ref|XP_008549259.1|  PREDICTED: protein transport protein Sec23A ...    124   4e-29   
ref|XP_006838861.1|  hypothetical protein AMTR_s00002p00266230          124   4e-29   
gb|KFV01574.1|  Protein transport protein Sec23A                        122   4e-29   
ref|XP_005095981.1|  PREDICTED: protein transport protein Sec23A-...    124   4e-29   
ref|XP_008549258.1|  PREDICTED: protein transport protein Sec23A ...    124   4e-29   
ref|XP_006616915.1|  PREDICTED: protein transport protein Sec23A-...    124   4e-29   
ref|XP_006616914.1|  PREDICTED: protein transport protein Sec23A-...    124   4e-29   
ref|XP_392515.2|  PREDICTED: protein transport protein Sec23A-lik...    124   4e-29   
ref|XP_006567440.1|  PREDICTED: protein transport protein Sec23A-...    124   4e-29   
ref|XP_001765516.1|  predicted protein                                  124   4e-29   
ref|XP_007771283.1|  copii coat protein                                 124   4e-29   
ref|XP_004614465.1|  PREDICTED: protein transport protein Sec23B ...    124   4e-29   
ref|XP_005095979.1|  PREDICTED: protein transport protein Sec23A-...    124   4e-29   
gb|EPY54023.1|  GTPase activating protein Sec23b                        124   4e-29   
ref|XP_003933212.1|  PREDICTED: protein transport protein Sec23B        124   4e-29   
ref|XP_011416353.1|  PREDICTED: protein transport protein Sec23A-...    124   4e-29   
ref|XP_011214742.1|  PREDICTED: protein transport protein Sec23A ...    124   4e-29   
emb|CDJ94460.1|  Zinc finger and Sec23 Sec24 trunk region domain ...    117   4e-29   
ref|XP_005320492.1|  PREDICTED: protein transport protein Sec23B ...    124   4e-29   
ref|XP_008678116.1|  PREDICTED: protein transport protein SEC23-like    124   4e-29   
ref|XP_004614464.1|  PREDICTED: protein transport protein Sec23B ...    124   4e-29   
ref|XP_011416351.1|  PREDICTED: protein transport protein Sec23A-...    124   5e-29   
ref|XP_011177751.1|  PREDICTED: protein transport protein Sec23A ...    124   5e-29   
emb|CBY41352.1|  unnamed protein product                                124   5e-29   
ref|XP_011214740.1|  PREDICTED: protein transport protein Sec23A ...    124   5e-29   
ref|XP_008589236.1|  PREDICTED: protein transport protein Sec23A        121   5e-29   
ref|XP_011177750.1|  PREDICTED: protein transport protein Sec23A ...    124   5e-29   
ref|XP_010589816.1|  PREDICTED: protein transport protein Sec23B ...    123   5e-29   
gb|EKC40209.1|  transport protein Sec23A                                124   5e-29   
gb|EYC37691.1|  hypothetical protein Y032_0772g2231                     117   5e-29   
ref|XP_003962841.1|  PREDICTED: protein transport protein Sec23A-...    124   5e-29   
ref|XP_004531028.1|  PREDICTED: protein transport protein Sec23A-...    124   5e-29   
ref|XP_008583587.1|  PREDICTED: protein transport protein Sec23B ...    124   5e-29   
gb|EYC37693.1|  hypothetical protein Y032_0772g2231                     117   5e-29   
ref|XP_011416350.1|  PREDICTED: protein transport protein Sec23A-...    124   5e-29   
gb|KIO08685.1|  hypothetical protein M404DRAFT_996932                   124   5e-29   
gb|KIK68656.1|  hypothetical protein GYMLUDRAFT_36135                   123   5e-29   
dbj|BAG61217.1|  unnamed protein product                                123   5e-29   
ref|XP_006463484.1|  copii coat protein                                 123   5e-29   
ref|XP_004531027.1|  PREDICTED: protein transport protein Sec23A-...    124   5e-29   
ref|XP_005320491.1|  PREDICTED: protein transport protein Sec23B ...    123   5e-29   
dbj|BAG58980.1|  unnamed protein product                                123   5e-29   
ref|XP_009435084.1|  PREDICTED: protein transport protein Sec23B ...    123   5e-29   
gb|AAH95404.1|  Sec23 homolog B (S. cerevisiae)                         123   5e-29   
emb|CAA65775.1|  Sec23 protein                                          123   5e-29   
emb|CDQ97079.1|  unnamed protein product                                119   6e-29   
gb|AAH05404.1|  SEC23B protein                                          123   6e-29   
ref|NP_001126773.1|  protein transport protein Sec23B                   123   6e-29   
gb|KIH68912.1|  Sec23/Sec24 zinc finger                                 117   6e-29   
ref|NP_001166217.1|  protein transport protein Sec23B isoform 2         123   6e-29   
ref|NP_116780.1|  protein transport protein Sec23B isoform 1            123   6e-29   
ref|XP_007515183.1|  predicted protein                                  124   6e-29   
ref|NP_001267323.1|  protein transport protein Sec23B                   123   6e-29   
ref|XP_003484429.1|  PREDICTED: protein transport protein Sec23A-...    123   6e-29   
ref|XP_009214879.1|  PREDICTED: protein transport protein Sec23B        123   6e-29   
ref|XP_005568308.1|  PREDICTED: protein transport protein Sec23B ...    123   6e-29   
gb|EDL28469.1|  SEC23B (S. cerevisiae), isoform CRA_a                   123   6e-29   
ref|XP_007959355.1|  PREDICTED: protein transport protein Sec23B        123   6e-29   
ref|XP_002747524.1|  PREDICTED: protein transport protein Sec23B        123   6e-29   
ref|XP_002808009.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    123   6e-29   
ref|NP_001274570.1|  Sec23 homolog B                                    123   6e-29   
ref|XP_007525648.1|  PREDICTED: protein transport protein Sec23B ...    123   6e-29   
ref|XP_003268276.2|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    123   6e-29   
ref|XP_010809545.1|  PREDICTED: protein transport protein Sec23B ...    123   7e-29   
ref|XP_007891559.1|  PREDICTED: protein transport protein Sec23A        123   7e-29   
ref|XP_004376602.1|  PREDICTED: protein transport protein Sec23A        120   7e-29   
ref|XP_010589815.1|  PREDICTED: protein transport protein Sec23B ...    123   7e-29   
ref|XP_002710997.1|  PREDICTED: protein transport protein Sec23B        123   7e-29   
ref|XP_007525637.1|  PREDICTED: protein transport protein Sec23B ...    123   7e-29   
ref|XP_010754153.1|  PREDICTED: protein transport protein Sec23A        123   7e-29   
ref|XP_004404205.1|  PREDICTED: protein transport protein Sec23B ...    123   7e-29   
gb|KIY53247.1|  hypothetical protein FISHEDRAFT_69101                   123   7e-29   
ref|XP_007896517.1|  PREDICTED: protein transport protein Sec23B        123   7e-29   
ref|XP_008838451.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    123   7e-29   
ref|XP_004404204.1|  PREDICTED: protein transport protein Sec23B ...    123   7e-29   
ref|XP_006163699.1|  PREDICTED: protein transport protein Sec23B ...    123   7e-29   
gb|KJA25434.1|  hypothetical protein HYPSUDRAFT_134756                  123   7e-29   
dbj|BAE26887.1|  unnamed protein product                                123   7e-29   
ref|XP_010368152.1|  PREDICTED: protein transport protein Sec23B        123   7e-29   
ref|XP_007332071.1|  hypothetical protein AGABI1DRAFT_115330            123   7e-29   
gb|KII87913.1|  hypothetical protein PLICRDRAFT_111718                  123   7e-29   
ref|XP_006730832.1|  PREDICTED: protein transport protein Sec23B ...    123   7e-29   
ref|XP_004754209.1|  PREDICTED: protein transport protein Sec23B ...    123   7e-29   
ref|NP_001264164.1|  protein transport protein Sec23B                   123   7e-29   
gb|KIJ62122.1|  hypothetical protein HYDPIDRAFT_95130                   123   7e-29   
ref|XP_006984533.1|  PREDICTED: protein transport protein Sec23B        123   8e-29   
gb|KIK93986.1|  hypothetical protein PAXRUDRAFT_33778                   123   8e-29   
ref|NP_062761.2|  protein transport protein Sec23B isoform 1            123   8e-29   
ref|XP_003983861.1|  PREDICTED: protein transport protein Sec23B        123   8e-29   
ref|XP_009396065.1|  PREDICTED: protein transport protein sec23-1       123   8e-29   
dbj|BAE39773.1|  unnamed protein product                                123   8e-29   
ref|XP_005152100.1|  PREDICTED: protein transport protein Sec23A-...    123   8e-29   
gb|AAH05464.1|  SEC23B (S. cerevisiae)                                  123   8e-29   
ref|XP_004014345.1|  PREDICTED: protein transport protein Sec23B ...    123   8e-29   
ref|XP_004472430.1|  PREDICTED: protein transport protein Sec23B        123   8e-29   
dbj|BAE34488.1|  unnamed protein product                                123   8e-29   
ref|XP_006182896.1|  PREDICTED: protein transport protein Sec23B ...    123   8e-29   
ref|XP_004687202.1|  PREDICTED: protein transport protein Sec23B        123   8e-29   
gb|KIK40341.1|  hypothetical protein CY34DRAFT_765799                   123   8e-29   
gb|KHN81848.1|  Protein transport protein Sec23B                        117   8e-29   
ref|NP_001254761.1|  Sec23 homolog B                                    123   8e-29   
ref|XP_009373957.1|  PREDICTED: protein transport protein SEC23-l...    123   8e-29   
ref|XP_006163701.1|  PREDICTED: protein transport protein Sec23B ...    123   8e-29   
ref|XP_005889080.1|  PREDICTED: protein transport protein Sec23B ...    123   8e-29   
ref|XP_007648538.1|  PREDICTED: protein transport protein Sec23B ...    123   8e-29   
ref|XP_006824846.1|  PREDICTED: protein transport protein Sec23A        123   8e-29   
ref|XP_010834629.1|  PREDICTED: protein transport protein Sec23B        123   8e-29   
dbj|BAN20484.1|  protein transport protein sec23                        123   8e-29   
gb|AAF08301.1|  SEC23B protein                                          123   8e-29   
ref|XP_006182895.1|  PREDICTED: protein transport protein Sec23B ...    123   8e-29   
dbj|BAE42552.1|  unnamed protein product                                123   8e-29   
ref|NP_001029798.1|  protein transport protein Sec23B                   123   9e-29   
ref|XP_005688133.1|  PREDICTED: protein transport protein Sec23B ...    123   9e-29   
ref|XP_001374135.1|  PREDICTED: protein transport protein Sec23B ...    123   9e-29   
ref|XP_005989219.1|  PREDICTED: protein transport protein Sec23A        123   9e-29   
ref|XP_009373956.1|  PREDICTED: protein transport protein SEC23-l...    123   9e-29   
ref|XP_011416352.1|  PREDICTED: protein transport protein Sec23A-...    123   9e-29   
ref|XP_003027779.1|  hypothetical protein SCHCODRAFT_79176              123   9e-29   
ref|XP_011306630.1|  PREDICTED: protein transport protein Sec23A ...    123   9e-29   
gb|EYC37692.1|  hypothetical protein Y032_0772g2231                     117   9e-29   
ref|XP_004014344.1|  PREDICTED: protein transport protein Sec23B ...    123   9e-29   
gb|ERE70495.1|  protein transport protein Sec23B isoform 2              123   9e-29   
ref|XP_005957402.1|  PREDICTED: protein transport protein Sec23B ...    123   9e-29   
ref|XP_007191960.1|  PREDICTED: protein transport protein Sec23B ...    122   9e-29   
ref|XP_004433770.1|  PREDICTED: protein transport protein Sec23B ...    123   9e-29   
ref|XP_011306629.1|  PREDICTED: protein transport protein Sec23A ...    123   9e-29   
ref|XP_008708256.1|  PREDICTED: protein transport protein Sec23B        123   9e-29   
emb|CDH54361.1|  protein transporter sec23                              123   9e-29   
ref|XP_006077306.1|  PREDICTED: protein transport protein Sec23B ...    123   9e-29   
ref|XP_003707642.1|  PREDICTED: protein transport protein Sec23A ...    123   1e-28   
ref|XP_006921617.1|  PREDICTED: protein transport protein Sec23B ...    123   1e-28   
emb|CDS13951.1|  Putative Protein transporter SEC23                     122   1e-28   
ref|XP_003707641.1|  PREDICTED: protein transport protein Sec23A ...    122   1e-28   
ref|XP_006206235.1|  PREDICTED: protein transport protein Sec23B ...    122   1e-28   



>ref|XP_006365462.1| PREDICTED: protein transport protein SEC23-like [Solanum tuberosum]
Length=784

 Score =   219 bits (557),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +2

Query  209  SSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK  388
            ++E++Q D EGIDGVRMTWNAWPRTKVE+SKCVIPIA+SIHLIRP  +L T+PY PLRCK
Sbjct  2    ATEMAQPDAEGIDGVRMTWNAWPRTKVEASKCVIPIASSIHLIRPHTDLPTLPYVPLRCK  61

Query  389  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            TCTAVLNPFARVD+QALIWICPFCFQRN FP  YS +SETNVP ELYPQFTTIQYTL
Sbjct  62   TCTAVLNPFARVDFQALIWICPFCFQRNHFPQHYSGISETNVPGELYPQFTTIQYTL  118



>ref|XP_004239847.1| PREDICTED: protein transport protein SEC23-like [Solanum lycopersicum]
Length=784

 Score =   219 bits (557),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +2

Query  209  SSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK  388
            ++E++Q D EGIDGVRMTWNAWPRTKVE+SKCVIPIA+SIHLIRP  +L T+PY PLRCK
Sbjct  2    ATEMAQPDAEGIDGVRMTWNAWPRTKVEASKCVIPIASSIHLIRPHTDLPTLPYVPLRCK  61

Query  389  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            TCTAVLNPFARVD+QALIWICPFCFQRN FP  YS +SETNVP ELYPQFTTIQYTL
Sbjct  62   TCTAVLNPFARVDFQALIWICPFCFQRNHFPQHYSGISETNVPGELYPQFTTIQYTL  118



>ref|XP_009799069.1| PREDICTED: protein transport protein SEC23-like [Nicotiana sylvestris]
Length=770

 Score =   215 bits (547),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +2

Query  209  SSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK  388
            ++E++Q D EGIDGVRMTWNAWPRTKVESSKCVIPIA SIHLIRP  +L T+ Y PL+CK
Sbjct  2    ATEMAQPDAEGIDGVRMTWNAWPRTKVESSKCVIPIATSIHLIRPHTDLPTLSYPPLKCK  61

Query  389  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            TC++VLNPFARVD+QALIWICPFCFQRN FPH YS ++ETNVPAELYPQFTTIQYTL
Sbjct  62   TCSSVLNPFARVDFQALIWICPFCFQRNHFPHHYSGINETNVPAELYPQFTTIQYTL  118



>ref|XP_009622558.1| PREDICTED: protein transport protein SEC23-like [Nicotiana tomentosiformis]
Length=774

 Score =   215 bits (547),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +2

Query  209  SSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK  388
            ++E++Q D EGIDGVRMTWNAWPRTKVESSKCVIPIA SIHLIRP  +L T+ Y PL+CK
Sbjct  2    ATEMAQPDAEGIDGVRMTWNAWPRTKVESSKCVIPIATSIHLIRPHTDLPTLSYPPLKCK  61

Query  389  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            TC++VLNPFARVD+QALIWICPFCFQRN FPH YS ++ETNVPAELYPQFTTIQYTL
Sbjct  62   TCSSVLNPFARVDFQALIWICPFCFQRNHFPHHYSGINETNVPAELYPQFTTIQYTL  118



>ref|XP_006358773.1| PREDICTED: protein transport protein SEC23-like [Solanum tuberosum]
Length=764

 Score =   211 bits (536),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +2

Query  209  SSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK  388
            ++E++QTD EGIDGVRMTWN+WPRTKVE+SKC+IPIA+SI L+RP P+L T+PYAPLRCK
Sbjct  2    ATEMAQTDPEGIDGVRMTWNSWPRTKVEASKCIIPIASSIQLLRPFPDLPTLPYAPLRCK  61

Query  389  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            TC+++LNPF RVD+QALIWICPFCFQRN FP  YS +SETNVPAELYPQFTTIQY +
Sbjct  62   TCSSILNPFCRVDFQALIWICPFCFQRNHFPQHYSGISETNVPAELYPQFTTIQYAI  118



>ref|XP_004247906.1| PREDICTED: protein transport protein SEC23-like [Solanum lycopersicum]
Length=766

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +2

Query  209  SSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK  388
            ++E++QT+ EGIDGVRMTWN+WPRTKVE+SKC+IPIA+SI L+RP P+L T+PYAPLRCK
Sbjct  2    ATEMAQTEPEGIDGVRMTWNSWPRTKVEASKCIIPIASSIQLLRPFPDLPTLPYAPLRCK  61

Query  389  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            TC+++LNPF RVD+QALIWICPFCFQRN FP  YS +SETNVPAELYPQFTTIQY +
Sbjct  62   TCSSILNPFCRVDFQALIWICPFCFQRNHFPQHYSGISETNVPAELYPQFTTIQYAI  118



>emb|CDP15130.1| unnamed protein product [Coffea canephora]
Length=784

 Score =   201 bits (511),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +2

Query  209  SSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK  388
            ++E++Q D EGIDGVRMTWN WPRTKVE SKCVIP+AASI  IR  P+++T+PY PL+CK
Sbjct  2    ATEMAQMDPEGIDGVRMTWNVWPRTKVELSKCVIPLAASISPIRSHPDVLTLPYPPLKCK  61

Query  389  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            TCTAVLNPF RVD+Q L+WICPFCF RN FP  Y+A+SETN+PAELYPQFTTIQYTL
Sbjct  62   TCTAVLNPFCRVDFQGLVWICPFCFSRNHFPQHYNAISETNMPAELYPQFTTIQYTL  118



>gb|KDO52832.1| hypothetical protein CISIN_1g0042381mg, partial [Citrus sinensis]
Length=412

 Score =   193 bits (490),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P++ T+PYAPLRCKT
Sbjct  2    SEMASTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAASISPIRSHPDIPTLPYAPLRCKT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            CTA LN FARVD+ A IWICPFC+QRN FP  Y+A+SETN+P ELYPQ+TT++YTL
Sbjct  62   CTAALNAFARVDFTAKIWICPFCYQRNHFPPHYAAISETNLPCELYPQYTTVEYTL  117



>ref|XP_009378161.1| PREDICTED: protein transport protein SEC23-like [Pyrus x bretschneideri]
Length=773

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR  P++ T+PYAPLRCKT
Sbjct  2    SEMANTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAACISPIRSHPDIPTLPYAPLRCKT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+AVLNPFARVD+ A IWICPFC+QRN FP  Y+A+SETN+P ELYPQ+TT+QY L
Sbjct  62   CSAVLNPFARVDFTAKIWICPFCYQRNHFPPHYAAISETNLPGELYPQYTTLQYAL  117



>gb|EPS74608.1| hypothetical protein M569_00146, partial [Genlisea aurea]
Length=323

 Score =   186 bits (473),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  197  SLMASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAP  376
            S MA+ E++QT+ EGIDGVRMTW  WPRTKVE+SKCVIPIAASI  IRP  +L  +PY P
Sbjct  1    SSMAAPELAQTEPEGIDGVRMTWFNWPRTKVEASKCVIPIAASIQPIRPHVDLKILPYPP  60

Query  377  LRCKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYT  556
            LRCK C+AVLNPF RVD+ A IWICPFCFQRN FP  YS++S+TN+PAELYP FT+I+++
Sbjct  61   LRCKACSAVLNPFCRVDFTACIWICPFCFQRNHFPQHYSSMSQTNLPAELYPNFTSIEFS  120

Query  557  L  559
            +
Sbjct  121  I  121



>ref|XP_009373604.1| PREDICTED: protein transport protein SEC23-like [Pyrus x bretschneideri]
Length=773

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR  P++ T+PYAPLRCKT
Sbjct  2    SEMANTDAEGIDGVRMTWNVWPRTKVEASKCVIPLAACISPIRSHPDIPTLPYAPLRCKT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+A LNPFARVD+ A IWICPFC+QRN FP  Y+A+SETN+P ELYPQ+TT+QY L
Sbjct  62   CSAALNPFARVDFTAKIWICPFCYQRNHFPPHYAAISETNLPGELYPQYTTLQYAL  117



>gb|KDP32574.1| hypothetical protein JCGZ_13124 [Jatropha curcas]
Length=778

 Score =   194 bits (492),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P++ T+PY+PLRCKT
Sbjct  2    SEMANTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAASISPIRHHPDIPTLPYSPLRCKT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+AVLN FARVD+ A IWICPFCFQRN FP  Y+ +SETN+PAELYPQ+TT+Q+TL
Sbjct  62   CSAVLNSFARVDFTAKIWICPFCFQRNHFPPHYAMISETNLPAELYPQYTTVQFTL  117



>ref|XP_002516399.1| protein transport protein sec23, putative [Ricinus communis]
 gb|EEF46016.1| protein transport protein sec23, putative [Ricinus communis]
Length=782

 Score =   193 bits (491),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SEI+ TD EGIDGVRM+WN WPRTKVE+SKCVIP+AASI  IR  P++ T+PY+PLRCKT
Sbjct  2    SEIANTDPEGIDGVRMSWNVWPRTKVEASKCVIPLAASISPIRHHPDIPTLPYSPLRCKT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+++LN FARVD+ A IWICPFCFQRN FP  YS +SETN+PAELYPQ+TT+QYTL
Sbjct  62   CSSILNCFARVDFTAKIWICPFCFQRNHFPPHYSMISETNLPAELYPQYTTVQYTL  117



>ref|XP_008337484.1| PREDICTED: protein transport protein SEC23 [Malus domestica]
Length=773

 Score =   193 bits (490),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR  P++ T+PYAPLRCKT
Sbjct  2    SEMANTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAACISPIRSHPDIPTLPYAPLRCKT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+A LNPFARVD+ A IWICPFC+QRN FP  Y+A+SETN+P ELYPQ+TT+QY L
Sbjct  62   CSAALNPFARVDFTAKIWICPFCYQRNHFPPHYAAISETNLPGELYPQYTTLQYAL  117



>ref|XP_006421049.1| hypothetical protein CICLE_v10004373mg [Citrus clementina]
 gb|ESR34289.1| hypothetical protein CICLE_v10004373mg [Citrus clementina]
Length=774

 Score =   193 bits (490),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P++ T+PYAPLRCKT
Sbjct  2    SEMASTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAASISPIRSHPDIPTLPYAPLRCKT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            CTA LN FARVD+ A IWICPFC+QRN FP  Y+A+SETN+P ELYPQ+TT++YTL
Sbjct  62   CTAALNAFARVDFTAKIWICPFCYQRNHFPPHYAAISETNLPCELYPQYTTVEYTL  117



>ref|XP_003601725.1| Protein transport protein Sec23 [Medicago truncatula]
 gb|AES71976.1| protein transporter Sec23-like protein [Medicago truncatula]
Length=702

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++ TD EGIDGVRMTWN WPR+KVESSKCVIP+AA+I LIR  P++ ++PYAPLRCKT
Sbjct  2    SEMANTDPEGIDGVRMTWNVWPRSKVESSKCVIPLAATISLIRSHPDIPSLPYAPLRCKT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            CT++LNP++RVD+ A IWICPFC+QRN FP  Y+A+SETN+P ELYPQ+TT++Y +
Sbjct  62   CTSILNPYSRVDFTAKIWICPFCYQRNHFPPHYNAISETNLPGELYPQYTTVEYHI  117



>ref|XP_008222792.1| PREDICTED: protein transport protein SEC23 [Prunus mume]
 ref|XP_008222793.1| PREDICTED: protein transport protein SEC23 [Prunus mume]
Length=772

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR  P++ T+PYAPLRCKT
Sbjct  2    SEMANTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAACISPIRAHPDIPTLPYAPLRCKT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+A LNPF+RVD+ A IWICPFC+QRN FP  Y+A+SETN+P ELYPQ+TT+QY L
Sbjct  62   CSAALNPFSRVDFTAKIWICPFCYQRNHFPPHYAAISETNLPGELYPQYTTLQYAL  117



>ref|XP_007221956.1| hypothetical protein PRUPE_ppa001742mg [Prunus persica]
 ref|XP_007221957.1| hypothetical protein PRUPE_ppa001742mg [Prunus persica]
 gb|EMJ23155.1| hypothetical protein PRUPE_ppa001742mg [Prunus persica]
 gb|EMJ23156.1| hypothetical protein PRUPE_ppa001742mg [Prunus persica]
Length=772

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR  P++ T+PYAPLRCKT
Sbjct  2    SEMANTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAACISPIRAHPDIPTLPYAPLRCKT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+A LNPF+RVD+ A IWICPFC+QRN FP  Y+A+SETN+P ELYPQ+TT+QY L
Sbjct  62   CSAALNPFSRVDFTAKIWICPFCYQRNHFPPHYAAISETNLPGELYPQYTTLQYAL  117



>ref|XP_003601724.1| Protein transport protein Sec23 [Medicago truncatula]
 gb|AES71975.1| protein transporter Sec23-like protein [Medicago truncatula]
Length=771

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++ TD EGIDGVRMTWN WPR+KVESSKCVIP+AA+I LIR  P++ ++PYAPLRCKT
Sbjct  2    SEMANTDPEGIDGVRMTWNVWPRSKVESSKCVIPLAATISLIRSHPDIPSLPYAPLRCKT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            CT++LNP++RVD+ A IWICPFC+QRN FP  Y+A+SETN+P ELYPQ+TT++Y +
Sbjct  62   CTSILNPYSRVDFTAKIWICPFCYQRNHFPPHYNAISETNLPGELYPQYTTVEYHI  117



>ref|XP_006492989.1| PREDICTED: protein transport protein SEC23-like [Citrus sinensis]
Length=774

 Score =   191 bits (485),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P++ T+PYAPLRCKT
Sbjct  2    SEMASTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAASISPIRSHPDIPTLPYAPLRCKT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            CTA LN FARVD+ A IWICPFC+QRN FP  Y+A+SETN+P ELYPQ+TT++Y L
Sbjct  62   CTAALNAFARVDFTAKIWICPFCYQRNHFPPHYAAISETNLPCELYPQYTTVEYIL  117



>ref|XP_009349001.1| PREDICTED: protein transport protein SEC23-like [Pyrus x bretschneideri]
Length=770

 Score =   191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +2

Query  218  ISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCT  397
            ++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR  P++ T+PYAPLRCKTC+
Sbjct  1    MANTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAACISPIRSHPDIPTLPYAPLRCKTCS  60

Query  398  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            AVLNPFARVD+ A IWICPFC+QRN FP  Y+A+SETN+P ELYPQ+TT+QY L
Sbjct  61   AVLNPFARVDFTAKIWICPFCYQRNHFPPHYAAISETNLPGELYPQYTTLQYAL  114



>ref|XP_010028115.1| PREDICTED: protein transport protein SEC23-like [Eucalyptus grandis]
 gb|KCW54774.1| hypothetical protein EUGRSUZ_I00719 [Eucalyptus grandis]
Length=777

 Score =   191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +2

Query  209  SSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK  388
            SSE+S  D EG+DGVRM+WN WPRTKVE+SKCVIP+AA I  +RP P++ T+PYAPLRCK
Sbjct  2    SSEMSSVDPEGMDGVRMSWNVWPRTKVEASKCVIPLAACIAPLRPHPDIPTLPYAPLRCK  61

Query  389  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            TC+AVLNP+ARVD+ A IWICPFC+QRN FP  Y+A+S+TN+P ELY Q+TTIQY+L
Sbjct  62   TCSAVLNPYARVDFTAKIWICPFCYQRNHFPPHYAAISDTNLPGELYSQYTTIQYSL  118



>gb|EYU38948.1| hypothetical protein MIMGU_mgv1a001629mg [Erythranthe guttata]
Length=782

 Score =   191 bits (484),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +2

Query  203  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  382
            MA+ E++QTD EGI+GVRMTW  WPR+KVE+SKCVIPIAASI  IRP  +L  +PYAPLR
Sbjct  1    MAAPELAQTDPEGIEGVRMTWLNWPRSKVEASKCVIPIAASIQPIRPHVDLQILPYAPLR  60

Query  383  CKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            CKTC++VLNPF RVD+ ALIWICPFCFQRN FP  YS++S+TN+PAELYP F +I+Y++
Sbjct  61   CKTCSSVLNPFCRVDFTALIWICPFCFQRNHFPQHYSSISQTNMPAELYPNFPSIEYSI  119



>ref|XP_003552491.1| PREDICTED: protein transport protein SEC23-like isoform 1 [Glycine 
max]
Length=766

 Score =   190 bits (483),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++  D EG+DGVRMTWN WPRTKVESSKCVIP+AA++ LIRP P++  +PYAPLRCKT
Sbjct  2    SEMASPDPEGLDGVRMTWNVWPRTKVESSKCVIPLAATVALIRPHPDIPRLPYAPLRCKT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C++ LNPF+RVD+ A IWICPFC+QRN FP  Y A+SETN+P ELYPQ+TT++Y L
Sbjct  62   CSSALNPFSRVDFTAKIWICPFCYQRNHFPPHYHAISETNLPGELYPQYTTVEYIL  117



>ref|XP_011084141.1| PREDICTED: protein transport protein SEC23-like [Sesamum indicum]
Length=782

 Score =   190 bits (483),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +2

Query  203  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  382
            MA+ E++QTD EGI+GVRMTW  WPR+KVE+SKCVIPIAASI  IRP  +L  +PY PLR
Sbjct  1    MAAPELAQTDPEGIEGVRMTWLNWPRSKVEASKCVIPIAASIQPIRPHVDLQILPYPPLR  60

Query  383  CKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            CKTC+AVLNPF RVD+ ALIWICPFCFQRN FP  YS++S+TNVPAELYP F +I+Y++
Sbjct  61   CKTCSAVLNPFCRVDFTALIWICPFCFQRNHFPQHYSSISQTNVPAELYPNFPSIEYSI  119



>ref|XP_007034166.1| Sec23/Sec24 protein transport family protein [Theobroma cacao]
 gb|EOY05092.1| Sec23/Sec24 protein transport family protein [Theobroma cacao]
Length=772

 Score =   190 bits (483),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++ TD EG+D VRMTWN WPRTKVE+SKCVIP+AASI  IRP P++ T+PYAPLRCKT
Sbjct  2    SEMANTDPEGVDAVRMTWNVWPRTKVEASKCVIPLAASIAPIRPNPDIPTLPYAPLRCKT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+A LN FARVD+ A IWICPFC+QRN FP  Y+ +SETN+P ELYPQ+TT+QYTL
Sbjct  62   CSAALNAFARVDFTAKIWICPFCYQRNHFPPHYAMISETNLPCELYPQYTTVQYTL  117



>ref|XP_010270294.1| PREDICTED: protein transport protein SEC23-like [Nelumbo nucifera]
Length=769

 Score =   190 bits (482),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++ +D EGIDGVRMTWNAWPRTKVE+SKCVIP+AA+I  IRP P++ T+PY PLRCKT
Sbjct  2    SEMAASDPEGIDGVRMTWNAWPRTKVEASKCVIPLAAAISPIRPHPDIPTLPYLPLRCKT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C  VLNP+ RVD+ A IWICPFCFQRN FP  YS +SETNVPAELYPQ+TT++Y +
Sbjct  62   CACVLNPYCRVDFTAKIWICPFCFQRNHFPPHYSMISETNVPAELYPQYTTVEYVV  117



>ref|XP_004502262.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Cicer 
arietinum]
 ref|XP_004502263.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Cicer 
arietinum]
Length=762

 Score =   190 bits (482),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SEI+ TD EG+DGVRMTWN WPR+KVE+SKCVIP+A ++++IRP P++  +PYAPLRCKT
Sbjct  2    SEIASTDPEGVDGVRMTWNVWPRSKVEASKCVIPLAVTLYVIRPHPDIPRLPYAPLRCKT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+A LNPFARVD+ A IWICPFC+QRN FP  Y+A+SET++P ELYPQ+TT++Y +
Sbjct  62   CSAALNPFARVDFTAKIWICPFCYQRNHFPPHYNAISETHLPGELYPQYTTVEYAI  117



>ref|XP_010650390.1| PREDICTED: protein transport protein SEC23-like [Vitis vinifera]
Length=771

 Score =   190 bits (482),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D EGIDGVRMTWN WPRTKVE+SKCVIPIAAS+  IR  P++ T+PYAPLRCKTC ++LN
Sbjct  7    DQEGIDGVRMTWNVWPRTKVEASKCVIPIAASVSPIRSHPDIPTLPYAPLRCKTCISLLN  66

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            PF RVD+ A IWICPFCFQRN FPH YS +SE+N+P ELYPQ+TT++Y+L
Sbjct  67   PFCRVDFAAKIWICPFCFQRNHFPHHYSMISESNLPGELYPQYTTVEYSL  116



>ref|XP_010097955.1| Protein transport protein SEC23 [Morus notabilis]
 gb|EXB73685.1| Protein transport protein SEC23 [Morus notabilis]
Length=775

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            +E++ TD +GIDGVRMTWNAWPRTKVE+SKCVIP+AA I  IRP PE+ T+ Y PLRCKT
Sbjct  2    TEMASTDIDGIDGVRMTWNAWPRTKVEASKCVIPLAAVISPIRPHPEIATLDYYPLRCKT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYT  556
            C A+LNPF RVD+ A+IWICPFCFQRN FP QY  +S+TN+P EL+P +TTIQY+
Sbjct  62   CAAILNPFCRVDFTAMIWICPFCFQRNHFPPQYVGISDTNLPGELFPSYTTIQYS  116



>ref|XP_007153808.1| hypothetical protein PHAVU_003G066300g [Phaseolus vulgaris]
 gb|ESW25802.1| hypothetical protein PHAVU_003G066300g [Phaseolus vulgaris]
Length=767

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELV-TVPYAPLRCK  388
            SE++QTD EG+DGVRMTWN WPRTKVE+SKCVIP+AA+I L+RP P +  T+PYAPLRCK
Sbjct  2    SEMAQTDPEGVDGVRMTWNLWPRTKVEASKCVIPLAATIALLRPHPGIPPTLPYAPLRCK  61

Query  389  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            TC+++LNPF+RVD+ A IWICPFC+ RN FP  Y+ +SETN+PAELYPQ+TT QY L
Sbjct  62   TCSSILNPFSRVDFAAKIWICPFCYNRNHFPPHYAQISETNLPAELYPQYTTFQYQL  118



>ref|XP_004296961.1| PREDICTED: protein transport protein SEC23-like [Fragaria vesca 
subsp. vesca]
Length=770

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR   ++ T+PYAPLRCKT
Sbjct  2    SEMANTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAACIAPIRFHTDIPTLPYAPLRCKT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+AVLNPF+RVD+ A IWICPFC+QRN FP  YS +SETN+P ELYPQ+TT+QY+L
Sbjct  62   CSAVLNPFSRVDFTAKIWICPFCYQRNHFPPHYSLISETNLPGELYPQYTTVQYSL  117



>ref|XP_007163794.1| hypothetical protein PHAVU_001G264700g [Phaseolus vulgaris]
 gb|ESW35788.1| hypothetical protein PHAVU_001G264700g [Phaseolus vulgaris]
Length=768

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++  D EG+DGVRMTWN WPRTKVESSKCVIP+AA++ LIRP P++  + YAPLRCKT
Sbjct  2    SEMASPDPEGVDGVRMTWNVWPRTKVESSKCVIPLAATVALIRPHPDIPRLQYAPLRCKT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C++ LNPFARVD+ A IWICPFC+QRN FP  Y+A+SETN P ELYPQ+TT++Y L
Sbjct  62   CSSALNPFARVDFTAKIWICPFCYQRNHFPPHYNAISETNFPGELYPQYTTVEYIL  117



>ref|XP_004172995.1| PREDICTED: LOW QUALITY PROTEIN: protein transport protein SEC23-like 
[Cucumis sativus]
Length=332

 Score =   181 bits (458),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++  D EGIDGVRM+WN WPRTKVE+SKCV+P+AASI  IR  PE+ T+PYAPLRCK+
Sbjct  2    SEMANADPEGIDGVRMSWNVWPRTKVEASKCVVPLAASIAPIRHHPEIPTLPYAPLRCKS  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            C+AVLNPF+RVD+ A IWICPFC+QR  FP  Y+ +SET++P ELYPQ+TT+QY
Sbjct  62   CSAVLNPFSRVDFTAKIWICPFCYQRCHFPPHYAMISETHLPGELYPQYTTVQY  115



>ref|XP_010683601.1| PREDICTED: protein transport protein SEC23-like [Beta vulgaris 
subsp. vulgaris]
Length=791

 Score =   187 bits (475),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D EGIDGVRMTWNAWPRTKVE+SKCVIPIAA+I  IR  PE+ T+PYAPLRCKTC A LN
Sbjct  16   DPEGIDGVRMTWNAWPRTKVEASKCVIPIAATISPIRANPEIPTLPYAPLRCKTCVAALN  75

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            P+ RVD+ A IWICPFCFQRN FP  YS +SE NVPAELYPQ+TT+ Y+L
Sbjct  76   PYCRVDFTAKIWICPFCFQRNHFPPHYSGISENNVPAELYPQYTTLAYSL  125



>gb|KJB37898.1| hypothetical protein B456_006G225300 [Gossypium raimondii]
Length=770

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++ TD EGID VRMTWN WPRTKVE+SKCVIP+AA+I  IRP P++ T+PYAPLRC+T
Sbjct  2    SEMANTDPEGIDAVRMTWNVWPRTKVEASKCVIPLAATIAPIRPHPDIPTLPYAPLRCRT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+A LN FARVD  A IWICPFC+QRN FP  Y+ +SETN+P ELYPQ+TT+QYTL
Sbjct  62   CSAALNAFARVDLVAKIWICPFCYQRNHFPPHYAMISETNLPCELYPQYTTVQYTL  117



>gb|KJB37899.1| hypothetical protein B456_006G225300 [Gossypium raimondii]
Length=727

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++ TD EGID VRMTWN WPRTKVE+SKCVIP+AA+I  IRP P++ T+PYAPLRC+T
Sbjct  2    SEMANTDPEGIDAVRMTWNVWPRTKVEASKCVIPLAATIAPIRPHPDIPTLPYAPLRCRT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+A LN FARVD  A IWICPFC+QRN FP  Y+ +SETN+P ELYPQ+TT+QYTL
Sbjct  62   CSAALNAFARVDLVAKIWICPFCYQRNHFPPHYAMISETNLPCELYPQYTTVQYTL  117



>gb|KHF97532.1| Protein transport SEC23 [Gossypium arboreum]
Length=759

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++ TD EGID VRMTWN WPRTKVE+SKCVIP+AA+I  IRP P++ T+PYAPLRC+ 
Sbjct  2    SEMANTDPEGIDAVRMTWNVWPRTKVEASKCVIPLAATIAPIRPHPDIPTLPYAPLRCRM  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+A LN FARVD+ A IWICPFC+QRN FP  Y+ +SETN+P ELYPQ+TT+QYTL
Sbjct  62   CSAALNAFARVDFVAKIWICPFCYQRNHFPPHYAMISETNLPCELYPQYTTVQYTL  117



>ref|XP_003538532.1| PREDICTED: protein transport protein SEC23-like isoform 1 [Glycine 
max]
Length=767

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++  D EG+DGVRMTWN WPRTKVESSKCVIP+AA++ LIRP P++  + YAPLRCKT
Sbjct  2    SEMASPDPEGLDGVRMTWNVWPRTKVESSKCVIPLAATVALIRPHPDIPRLQYAPLRCKT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C++ LNPF+RVD+ A IWICPFC+QRN FP  Y A+SETN P ELYPQ+TT++Y L
Sbjct  62   CSSALNPFSRVDFTAKIWICPFCYQRNHFPPHYHAISETNFPGELYPQYTTVEYLL  117



>gb|KJB71965.1| hypothetical protein B456_011G150700 [Gossypium raimondii]
Length=771

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++  D EGID VRMTWN WPRTKVE+SKCVIP+AASI  IRP  ++  +PYAPLRCKT
Sbjct  2    SEMANMDPEGIDAVRMTWNVWPRTKVEASKCVIPLAASIAPIRPHTDIPMLPYAPLRCKT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+AVLN FARVD+ A IWICPFC+QRN FP  Y+ +SETN+P ELYPQ+TT+QY L
Sbjct  62   CSAVLNAFARVDFMAKIWICPFCYQRNHFPPHYAMISETNLPGELYPQYTTVQYAL  117



>ref|XP_010269071.1| PREDICTED: protein transport protein SEC23-like [Nelumbo nucifera]
Length=770

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++ +D EGIDGVRMTWN WPRTKVE+SKCVIPIAA+I  IR  P++  +PY PLRCKT
Sbjct  2    SEMAASDPEGIDGVRMTWNVWPRTKVEASKCVIPIAAAITPIRSHPDIPPLPYLPLRCKT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C  VLNP+ RVD+ A IWICPFCFQRN FP  YS +SE+NVPAELYPQ+TT++YT+
Sbjct  62   CAGVLNPYCRVDFNAKIWICPFCFQRNHFPPHYSMISESNVPAELYPQYTTVEYTV  117



>gb|KHG15352.1| Protein transport SEC23 [Gossypium arboreum]
Length=771

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++  D EGID +RMTWN WPRTKVE+SKCVIP+AASI  IRP  ++  +PYAPLRCKT
Sbjct  2    SEMANMDPEGIDAIRMTWNVWPRTKVEASKCVIPLAASIAPIRPHTDIPMLPYAPLRCKT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+AVLN FARVD+ A IWICPFC+QRN FP  Y+ +SETN+P ELYPQ+TT+QY L
Sbjct  62   CSAVLNAFARVDFMAKIWICPFCYQRNHFPPHYAMISETNLPGELYPQYTTVQYAL  117



>ref|XP_011045698.1| PREDICTED: protein transport protein SEC23-like [Populus euphratica]
Length=775

 Score =   184 bits (468),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SEI  TD EGID VRMTWN WPRTKVE+SKCVIP+AASI  IRP  E+ T+PY PLRCKT
Sbjct  2    SEIPNTDPEGIDSVRMTWNNWPRTKVEASKCVIPLAASISPIRPHSEIPTLPYPPLRCKT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            CT+++N F+RVD+ A IWICPFC+QRN FP  YS +SETN+PAELY Q+TTI+YTL
Sbjct  62   CTSIMNCFSRVDFTAKIWICPFCYQRNHFPPHYSMISETNLPAELYTQYTTIEYTL  117



>gb|EPS72601.1| hypothetical protein M569_02145 [Genlisea aurea]
Length=773

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +2

Query  203  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  382
            MA+ E++Q++ EGI+GVRMTW  WPRTKVE+SKCVIPIAASI  IR   +L  +PY PLR
Sbjct  1    MAAPELAQSEQEGIEGVRMTWYNWPRTKVEASKCVIPIAASIQPIRSHVDLQILPYPPLR  60

Query  383  CKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            CKTC+AVLNPF RVD+ AL+WICPFC+QRN FP  YS++S+TN+PAELYP F +I+Y++
Sbjct  61   CKTCSAVLNPFCRVDFTALVWICPFCYQRNHFPQHYSSISQTNIPAELYPNFPSIEYSI  119



>ref|XP_008439044.1| PREDICTED: protein transport protein SEC23 [Cucumis melo]
Length=775

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++  D EGIDGVRM+WN WPRTKVE+SKCV+P+AASI  IR  PE+ T+PYAPLRCK+
Sbjct  2    SEMANADPEGIDGVRMSWNVWPRTKVEASKCVVPLAASIAPIRHHPEIPTLPYAPLRCKS  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+AVLNPF+RVD+ A IWICPFC+QR  FP  Y+ +SET++P ELYPQ+TT+QY L
Sbjct  62   CSAVLNPFSRVDFTAKIWICPFCYQRCHFPPHYAMISETHLPGELYPQYTTVQYAL  117



>ref|XP_006370915.1| transport family protein [Populus trichocarpa]
 gb|ERP48712.1| transport family protein [Populus trichocarpa]
Length=777

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SEI   D EGID VRMTWN WPRTKVE+SKCVIP+AASI  IR  PE+ T+PY PLRCKT
Sbjct  2    SEIPNADPEGIDSVRMTWNNWPRTKVEASKCVIPLAASISPIRSNPEIPTLPYLPLRCKT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            CT+++N F+RVD+ A IWICPFCFQRN FP  YS +SETN+PAELY Q+TTI+YT+
Sbjct  62   CTSIMNCFSRVDFTAKIWICPFCFQRNHFPPHYSMISETNLPAELYSQYTTIEYTI  117



>ref|XP_011046336.1| PREDICTED: protein transport protein SEC23-like [Populus euphratica]
Length=777

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SEI   D EGID VRMTWN WPRTKVE+SKCVIP+AASI  IR  PE+ T+PY PLRCKT
Sbjct  2    SEIPNADPEGIDSVRMTWNNWPRTKVEASKCVIPLAASISPIRSNPEIPTLPYLPLRCKT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            CT+++N F+RVD+ A IWICPFCFQRN FP  YS +SETN+PAELY Q+TTI+YT+
Sbjct  62   CTSIMNCFSRVDFTAKIWICPFCFQRNHFPPNYSMISETNLPAELYSQYTTIEYTI  117



>gb|KGN57237.1| hypothetical protein Csa_3G172420 [Cucumis sativus]
Length=775

 Score =   182 bits (462),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++  D EGIDGVRM+WN WPRTKVE+SKCV+P+AASI  IR  PE+ T+PYAPLRCK+
Sbjct  2    SEMANADPEGIDGVRMSWNVWPRTKVEASKCVVPLAASIAPIRHHPEIPTLPYAPLRCKS  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            C+AVLNPF+RVD+ A IWICPFC+QR  FP  Y+ +SET++P ELYPQ+TT+QY
Sbjct  62   CSAVLNPFSRVDFTAKIWICPFCYQRCHFPPHYAMISETHLPGELYPQYTTVQY  115



>ref|XP_004147649.1| PREDICTED: protein transport protein SEC23-like [Cucumis sativus]
Length=776

 Score =   182 bits (462),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++  D EGIDGVRM+WN WPRTKVE+SKCV+P+AASI  IR  PE+ T+PYAPLRCK+
Sbjct  2    SEMANADPEGIDGVRMSWNVWPRTKVEASKCVVPLAASIAPIRHHPEIPTLPYAPLRCKS  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            C+AVLNPF+RVD+ A IWICPFC+QR  FP  Y+ +SET++P ELYPQ+TT+QY
Sbjct  62   CSAVLNPFSRVDFTAKIWICPFCYQRCHFPPHYAMISETHLPGELYPQYTTVQY  115



>ref|XP_010466720.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=770

 Score =   182 bits (461),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            +E + TD EGIDGVRMTWN WPR+K E+SKCVIP+AASI  IR  P++ T+PYAPLRC+T
Sbjct  2    AETANTDLEGIDGVRMTWNVWPRSKAEASKCVIPLAASISPIRRHPDIPTLPYAPLRCRT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+A LN +A+VD+ A +WICPFCFQRN FP  Y  +SETN+P ELYPQ+TT++YTL
Sbjct  62   CSAALNAYAQVDFTAKLWICPFCFQRNHFPPHYHVISETNLPGELYPQYTTLEYTL  117



>ref|XP_010532717.1| PREDICTED: protein transport protein SEC23-like isoform X4 [Tarenaya 
hassleriana]
Length=613

 Score =   181 bits (458),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            +E++  D +GIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR  P++ ++PYAPLRC+T
Sbjct  2    AEMANPDLDGIDGVRMTWNVWPRTKVEASKCVIPLAACISPIRRHPDIPSLPYAPLRCRT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+A LN FARVD+ A IWICPFC+QRN FP  Y  +SETN+P ELYPQ+TT++YTL
Sbjct  62   CSAALNAFARVDFTAKIWICPFCYQRNHFPPHYHMISETNLPGELYPQYTTVEYTL  117



>ref|XP_002300208.1| transport family protein [Populus trichocarpa]
 gb|EEE85013.1| transport family protein [Populus trichocarpa]
Length=775

 Score =   181 bits (460),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SEI  TD EGID VRMTWN WPRTKVE+SKCVIP+AASI  IRP  E+ T+ Y PLRCKT
Sbjct  2    SEIPNTDPEGIDSVRMTWNNWPRTKVEASKCVIPLAASISPIRPHSEIPTLTYPPLRCKT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            CT+++N F+RVD+ A IWICPFC+QRN FP  YS +SETN+PAELY Q+TTI+YTL
Sbjct  62   CTSIMNCFSRVDFTAKIWICPFCYQRNHFPPHYSMISETNLPAELYSQYTTIEYTL  117



>ref|XP_010532714.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010532715.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010532716.1| PREDICTED: protein transport protein SEC23-like isoform X3 [Tarenaya 
hassleriana]
Length=778

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            +E++  D +GIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR  P++ ++PYAPLRC+T
Sbjct  2    AEMANPDLDGIDGVRMTWNVWPRTKVEASKCVIPLAACISPIRRHPDIPSLPYAPLRCRT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+A LN FARVD+ A IWICPFC+QRN FP  Y  +SETN+P ELYPQ+TT++YTL
Sbjct  62   CSAALNAFARVDFTAKIWICPFCYQRNHFPPHYHMISETNLPGELYPQYTTVEYTL  117



>emb|CDY12738.1| BnaC04g29030D [Brassica napus]
Length=736

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            +E++  D EG+DGVRMTWN WPRTKVE+SKCVIP+AASI  IR   E+ ++PYAPL+C+T
Sbjct  2    AEMANMDPEGMDGVRMTWNVWPRTKVEASKCVIPLAASISPIRRHSEIPSLPYAPLKCRT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C AVLN FARVD+ A IWICPFCFQRN FP  Y  +SETN+P ELYPQ+TT++Y L
Sbjct  62   CVAVLNAFARVDFAAKIWICPFCFQRNPFPPHYHMISETNLPGELYPQYTTVEYAL  117



>gb|KHG04907.1| Protein transport SEC23 [Gossypium arboreum]
Length=842

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +2

Query  218  ISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCT  397
            ++ +D EG+DGVRMTWN WPRTK+E+SKCVIP+AASI  IRP  ++ T+PYAPLRC+TC+
Sbjct  1    MANSDPEGVDGVRMTWNVWPRTKLEASKCVIPLAASIAPIRPHSDIPTLPYAPLRCRTCS  60

Query  398  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            AVLN ++RVD+ A IWICPFC+QRN FP  Y+ +SETN+P ELYPQ+TT+QYTL
Sbjct  61   AVLNVYSRVDFLAKIWICPFCYQRNQFPPHYAMISETNLPCELYPQYTTVQYTL  114



>gb|KHG16267.1| Protein transport Sec23A [Gossypium arboreum]
Length=772

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++ TD EGID VRMTWN WPRTKVE+S CVIP+A SI  IR  P++ T+PYAPLRCK+
Sbjct  2    SEMANTDPEGIDAVRMTWNVWPRTKVEASACVIPLAVSIAPIRSHPDIPTLPYAPLRCKS  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C++ LN FARVD+ A IWICPFC+QRN FP  Y+ +SETN+P ELYPQ+TT+QY+L
Sbjct  62   CSSALNAFARVDFTAKIWICPFCYQRNHFPPHYAMISETNLPCELYPQYTTVQYSL  117



>gb|KFK39665.1| hypothetical protein AALP_AA3G273400 [Arabis alpina]
Length=773

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            +E + TD EGIDGVRMTWN WPR+K+E+SKCVIP+AA I  IR   ++ T+PYAPL+C+T
Sbjct  2    AETANTDQEGIDGVRMTWNVWPRSKIEASKCVIPLAACISPIRRHSDIPTLPYAPLKCRT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            CTA LNP+A+VD+   IWICPFCFQRN FP  Y  +SETN+P ELYPQ+TT++YTL
Sbjct  62   CTAALNPYAQVDFNVKIWICPFCFQRNQFPPHYHVISETNLPGELYPQYTTVEYTL  117



>ref|XP_010512680.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Camelina 
sativa]
 ref|XP_010512688.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Camelina 
sativa]
Length=769

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            +E + TD EGIDGVRMTWN WPR+KVE+SKCVIP+AASI  IR   ++ T+PYAPLRC+T
Sbjct  2    AETANTDLEGIDGVRMTWNVWPRSKVEASKCVIPLAASISPIRRHSDIPTLPYAPLRCRT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+A LN +A+VD+ A +WICPFCFQRN FP  Y  +SETN+P ELYPQ+TT++YTL
Sbjct  62   CSAALNAYAQVDFTAKLWICPFCFQRNHFPPHYHVISETNLPGELYPQYTTVEYTL  117



>ref|XP_002892293.1| hypothetical protein ARALYDRAFT_470552 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68552.1| hypothetical protein ARALYDRAFT_470552 [Arabidopsis lyrata subsp. 
lyrata]
Length=780

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  218  ISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCT  397
            ++  D EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR   ++ +V YAPLRC+TC+
Sbjct  1    MASMDPEGIDGVRMTWNVWPRTKVEASKCVIPVAACISPIRYHRDIPSVDYAPLRCRTCS  60

Query  398  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            A LNPFARVD  A IWICP CFQRN FPH Y A+S+TNVP ELYPQ+TT++YTL
Sbjct  61   AALNPFARVDTHAKIWICPICFQRNHFPHHYHAISDTNVPCELYPQYTTVEYTL  114



>gb|KJB28028.1| hypothetical protein B456_005G022700 [Gossypium raimondii]
Length=549

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++ TD EGID VRMTWN WPRTKVE+S CVIP+A SI  IR  P++ T+PY+PLRCK+
Sbjct  2    SEMANTDPEGIDAVRMTWNVWPRTKVEASACVIPLAVSIAPIRSHPDIPTLPYSPLRCKS  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C++ LN FARVD+ A IWICPFC+QRN FP  Y+ +S+TN+P ELYPQ+TT+QY+L
Sbjct  62   CSSALNAFARVDFTAKIWICPFCYQRNHFPPHYAMISDTNLPCELYPQYTTVQYSL  117



>ref|NP_974544.1| sec23/sec24-like transport protein [Arabidopsis thaliana]
 gb|AEE83386.1| sec23/sec24-like transport protein [Arabidopsis thaliana]
Length=620

 Score =   179 bits (455),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 74/122 (61%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +2

Query  194  SSLMASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYA  373
            + +   +++ + D EGIDGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P ++ +PYA
Sbjct  2    AEMADKAKVEEMDWEGIDGVRMTWNLWPRTKVEASKCVIPLAASISPIRRHPLILDLPYA  61

Query  374  PLRCKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PL CKTC A+LN FARVD+ A+ W+CPFC+ RN FP  Y ++SE N+P ELYPQ+TT++Y
Sbjct  62   PLDCKTCKALLNAFARVDFAAMNWVCPFCYHRNHFPSHYHSISEINLPGELYPQYTTVEY  121

Query  554  TL  559
            TL
Sbjct  122  TL  123



>ref|XP_010527425.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Tarenaya 
hassleriana]
Length=624

 Score =   179 bits (453),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            +E++  D EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR  P++ ++PYAPLRC+T
Sbjct  2    AEMANPDLEGIDGVRMTWNVWPRTKVEASKCVIPLAACISPIRRHPDIPSLPYAPLRCRT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+A LN FARVD+ A IWICPFC+QRN FP  Y  +S+TN+P ELYPQ+TT++Y L
Sbjct  62   CSAALNAFARVDFTAKIWICPFCYQRNHFPPHYHMISDTNLPGELYPQYTTVEYAL  117



>gb|KJB30033.1| hypothetical protein B456_005G128200 [Gossypium raimondii]
Length=494

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +2

Query  218  ISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCT  397
            ++ +D EG+DGVRMTWN WPRTK+E+SKCVIP+AASI  I P  ++ T+PYAPLRC+TC+
Sbjct  1    MANSDPEGVDGVRMTWNVWPRTKLEASKCVIPLAASIAPIPPHSDIPTLPYAPLRCRTCS  60

Query  398  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            A LN ++RVD+ A IWICPFC+QRN FP  Y+ +SETN+P ELYPQ+TT+QYTL
Sbjct  61   AALNAYSRVDFLAKIWICPFCYQRNQFPPHYAMISETNLPCELYPQYTTVQYTL  114



>ref|XP_010527422.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010527423.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010527424.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Tarenaya 
hassleriana]
Length=776

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            +E++  D EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR  P++ ++PYAPLRC+T
Sbjct  2    AEMANPDLEGIDGVRMTWNVWPRTKVEASKCVIPLAACISPIRRHPDIPSLPYAPLRCRT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+A LN FARVD+ A IWICPFC+QRN FP  Y  +S+TN+P ELYPQ+TT++Y L
Sbjct  62   CSAALNAFARVDFTAKIWICPFCYQRNHFPPHYHMISDTNLPGELYPQYTTVEYAL  117



>ref|XP_010485034.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=780

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++  D EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR   ++ +V YAPLRC++
Sbjct  2    SEMATMDPEGIDGVRMTWNVWPRTKVEASKCVIPVAACISPIRYHRDIQSVGYAPLRCRS  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            CTA LNPFARVD+ A IWICP CFQRN FP  Y  +SETN+P ELYPQ+TT++YTL
Sbjct  62   CTAALNPFARVDFSAKIWICPICFQRNHFPPHYHVMSETNLPCELYPQYTTVEYTL  117



>gb|KJB28027.1| hypothetical protein B456_005G022700 [Gossypium raimondii]
Length=772

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++ TD EGID VRMTWN WPRTKVE+S CVIP+A SI  IR  P++ T+PY+PLRCK+
Sbjct  2    SEMANTDPEGIDAVRMTWNVWPRTKVEASACVIPLAVSIAPIRSHPDIPTLPYSPLRCKS  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C++ LN FARVD+ A IWICPFC+QRN FP  Y+ +S+TN+P ELYPQ+TT+QY+L
Sbjct  62   CSSALNAFARVDFTAKIWICPFCYQRNHFPPHYAMISDTNLPCELYPQYTTVQYSL  117



>gb|KFK42891.1| hypothetical protein AALP_AA1G052100 [Arabis alpina]
Length=777

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++  D EGIDGVRMTWN WPR KVE+SKCVIP+AA I  IR   ++ +VPYAPLRC+T
Sbjct  2    SEMATMDPEGIDGVRMTWNVWPRNKVEASKCVIPVAACISPIRYHRDIQSVPYAPLRCRT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            CTA LNPF+RVD+ A +WICP C+QRN FP  Y  +SETN+P ELYPQ+TT++YTL
Sbjct  62   CTAALNPFSRVDFSAKLWICPICYQRNHFPPHYHVISETNLPCELYPQYTTVEYTL  117



>emb|CDX90271.1| BnaA08g17130D [Brassica napus]
Length=738

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            +E++  D EG+DGVRMTWN WPRTKVE+SKCV+P+AASI  IR   ++ ++PYAPL+C+T
Sbjct  2    AEMANMDPEGMDGVRMTWNVWPRTKVEASKCVVPLAASISPIRRHSDIPSLPYAPLKCRT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C AVLN FARVD+ A IWICPFCFQRN FP  Y  +SETN+P ELYPQ+TT++Y +
Sbjct  62   CVAVLNAFARVDFAAKIWICPFCFQRNPFPPHYHMISETNLPGELYPQYTTVEYAI  117



>ref|NP_563741.1| sec23/sec24-like transport protein [Arabidopsis thaliana]
 gb|AAN72246.1| At1g05520/T25N20_16 [Arabidopsis thaliana]
 gb|AEE27848.1| sec23/sec24-like transport protein [Arabidopsis thaliana]
Length=783

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++  D EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR   ++ +V YAPLRC+ 
Sbjct  2    SEMASMDPEGIDGVRMTWNVWPRTKVEASKCVIPVAACISPIRYHRDIPSVEYAPLRCRI  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            CTA LNPFARVD+ A IWICP CFQRN FP  Y  +SETNVP ELYPQ+TT++YTL
Sbjct  62   CTAALNPFARVDFLAKIWICPICFQRNHFPPHYHVMSETNVPCELYPQYTTVEYTL  117



>gb|AAL08282.1| At1g05520/T25N20_16 [Arabidopsis thaliana]
Length=783

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++  D EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR   ++ +V YAPLRC+ 
Sbjct  2    SEMASMDPEGIDGVRMTWNVWPRTKVEASKCVIPVAACISPIRYHRDIPSVEYAPLRCRI  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            CTA LNPFARVD+ A IWICP CFQRN FP  Y  +SETNVP ELYPQ+TT++YTL
Sbjct  62   CTAALNPFARVDFLAKIWICPICFQRNHFPPHYHVMSETNVPCELYPQYTTVEYTL  117



>ref|XP_006418018.1| hypothetical protein EUTSA_v10006857mg [Eutrema salsugineum]
 gb|ESQ36371.1| hypothetical protein EUTSA_v10006857mg [Eutrema salsugineum]
Length=780

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++  D EGIDGVRMTWN WPR KVE+SKCVIP+AA I  IR   ++ +VPYAPLRC+T
Sbjct  2    SEMASMDPEGIDGVRMTWNVWPRNKVEASKCVIPVAACISPIRYHRDIQSVPYAPLRCRT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+A LNPFARVD+ A IWICP CFQRN FP  Y  +SETN+P ELYPQ TT++YT+
Sbjct  62   CSAALNPFARVDFTAKIWICPICFQRNHFPPHYHGISETNLPCELYPQCTTVEYTM  117



>gb|AAF79733.1|AC005106_14 T25N20.17 [Arabidopsis thaliana]
Length=811

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++  D EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR   ++ +V YAPLRC+ 
Sbjct  2    SEMASMDPEGIDGVRMTWNVWPRTKVEASKCVIPVAACISPIRYHRDIPSVEYAPLRCRI  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            CTA LNPFARVD+ A IWICP CFQRN FP  Y  +SETNVP ELYPQ+TT++YTL
Sbjct  62   CTAALNPFARVDFLAKIWICPICFQRNHFPPHYHVMSETNVPCELYPQYTTVEYTL  117



>ref|NP_849541.2| sec23/sec24-like transport protein [Arabidopsis thaliana]
 gb|AEE83385.1| sec23/sec24-like transport protein [Arabidopsis thaliana]
Length=773

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +2

Query  194  SSLMASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYA  373
            + +   +++ + D EGIDGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P ++ +PYA
Sbjct  2    AEMADKAKVEEMDWEGIDGVRMTWNLWPRTKVEASKCVIPLAASISPIRRHPLILDLPYA  61

Query  374  PLRCKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PL CKTC A+LN FARVD+ A+ W+CPFC+ RN FP  Y ++SE N+P ELYPQ+TT++Y
Sbjct  62   PLDCKTCKALLNAFARVDFAAMNWVCPFCYHRNHFPSHYHSISEINLPGELYPQYTTVEY  121

Query  554  TL  559
            TL
Sbjct  122  TL  123



>ref|NP_193152.2| sec23/sec24-like transport protein [Arabidopsis thaliana]
 gb|AAL67087.1| putative transport protein [Arabidopsis thaliana]
 gb|AAM67461.1| putative transport protein [Arabidopsis thaliana]
 gb|AEE83387.1| sec23/sec24-like transport protein [Arabidopsis thaliana]
Length=772

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +2

Query  194  SSLMASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYA  373
            + +   +++ + D EGIDGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P ++ +PYA
Sbjct  2    AEMADKAKVEEMDWEGIDGVRMTWNLWPRTKVEASKCVIPLAASISPIRRHPLILDLPYA  61

Query  374  PLRCKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PL CKTC A+LN FARVD+ A+ W+CPFC+ RN FP  Y ++SE N+P ELYPQ+TT++Y
Sbjct  62   PLDCKTCKALLNAFARVDFAAMNWVCPFCYHRNHFPSHYHSISEINLPGELYPQYTTVEY  121

Query  554  TL  559
            TL
Sbjct  122  TL  123



>gb|AAM10394.1| AT4g14160/dl3120w [Arabidopsis thaliana]
Length=772

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +2

Query  194  SSLMASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYA  373
            + +   +++ + D EGIDGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P ++ +PYA
Sbjct  2    AEMADKAKVEEMDWEGIDGVRMTWNLWPRTKVEASKCVIPLAASISPIRRHPLILDLPYA  61

Query  374  PLRCKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PL CKTC A+LN FARVD+ A+ W+CPFC+ RN FP  Y ++SE N+P ELYPQ+TT++Y
Sbjct  62   PLDCKTCKALLNAFARVDFAAMNWVCPFCYHRNHFPSHYHSISEINLPGELYPQYTTVEY  121

Query  554  TL  559
            TL
Sbjct  122  TL  123



>emb|CAB10195.1| transport protein [Arabidopsis thaliana]
 emb|CAB78458.1| transport protein [Arabidopsis thaliana]
Length=769

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            +++ + D EGIDGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P ++ +PYAPL CKT
Sbjct  5    AKVEEMDWEGIDGVRMTWNLWPRTKVEASKCVIPLAASISPIRRHPLILDLPYAPLDCKT  64

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C A+LN FARVD+ A+ W+CPFC+ RN FP  Y ++SE N+P ELYPQ+TT++YTL
Sbjct  65   CKALLNAFARVDFAAMNWVCPFCYHRNHFPSHYHSISEINLPGELYPQYTTVEYTL  120



>ref|XP_010522277.1| PREDICTED: protein transport protein SEC23 [Tarenaya hassleriana]
 ref|XP_010522278.1| PREDICTED: protein transport protein SEC23 [Tarenaya hassleriana]
 ref|XP_010522279.1| PREDICTED: protein transport protein SEC23 [Tarenaya hassleriana]
 ref|XP_010522280.1| PREDICTED: protein transport protein SEC23 [Tarenaya hassleriana]
 ref|XP_010522281.1| PREDICTED: protein transport protein SEC23 [Tarenaya hassleriana]
 ref|XP_010522282.1| PREDICTED: protein transport protein SEC23 [Tarenaya hassleriana]
Length=780

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++  D EGIDGVRMTWN WPRTKVE+SKCV+PIAA I  IR   E+ TVPYAPLRC+T
Sbjct  2    SEMATMDPEGIDGVRMTWNFWPRTKVEASKCVVPIAACISPIRYHREIPTVPYAPLRCRT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+A LN F RVD+   IWICPFCFQRN FP  Y  +SETN+P ELYPQ+TT++YT+
Sbjct  62   CSAALNAFCRVDFTVKIWICPFCFQRNHFPPHYHMISETNLPCELYPQYTTVEYTI  117



>gb|KJB30034.1| hypothetical protein B456_005G128200 [Gossypium raimondii]
Length=644

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +2

Query  218  ISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCT  397
            ++ +D EG+DGVRMTWN WPRTK+E+SKCVIP+AASI  I P  ++ T+PYAPLRC+TC+
Sbjct  1    MANSDPEGVDGVRMTWNVWPRTKLEASKCVIPLAASIAPIPPHSDIPTLPYAPLRCRTCS  60

Query  398  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            A LN ++RVD+ A IWICPFC+QRN FP  Y+ +SETN+P ELYPQ+TT+QYTL
Sbjct  61   AALNAYSRVDFLAKIWICPFCYQRNQFPPHYAMISETNLPCELYPQYTTVQYTL  114



>ref|XP_002885585.1| hypothetical protein ARALYDRAFT_479878 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61844.1| hypothetical protein ARALYDRAFT_479878 [Arabidopsis lyrata subsp. 
lyrata]
Length=769

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            +E + TD EGIDGVRMTWN WPR+KVE+SKCVIP+AA I  IR   ++ T+PYAPLRC+T
Sbjct  2    AETANTDLEGIDGVRMTWNVWPRSKVEASKCVIPLAACISPIRRHSDIPTLPYAPLRCRT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+A LN +A+VD+ A +WICPFC+QRN FP  Y  +SETN+P ELYPQ+TT++YTL
Sbjct  62   CSAALNAYAQVDFTAKLWICPFCYQRNHFPPHYHVISETNLPGELYPQYTTVEYTL  117



>emb|CDY12077.1| BnaC03g59930D [Brassica napus]
Length=737

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            +E++  D EG+DGVRMTWN WPRTKVE+SKCV+P+AASI  IR   ++ ++PYAPL+C+T
Sbjct  2    AEMANMDPEGMDGVRMTWNVWPRTKVEASKCVVPLAASISPIRRHSDIPSLPYAPLKCRT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C AVLN FARVD+ A IWICPFCFQRN FP  Y  +S+TN+P ELYPQ+TT++Y +
Sbjct  62   CVAVLNAFARVDFAAKIWICPFCFQRNPFPPHYHMISDTNLPGELYPQYTTVEYAI  117



>gb|KJB30032.1| hypothetical protein B456_005G128200 [Gossypium raimondii]
Length=769

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +2

Query  218  ISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCT  397
            ++ +D EG+DGVRMTWN WPRTK+E+SKCVIP+AASI  I P  ++ T+PYAPLRC+TC+
Sbjct  1    MANSDPEGVDGVRMTWNVWPRTKLEASKCVIPLAASIAPIPPHSDIPTLPYAPLRCRTCS  60

Query  398  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            A LN ++RVD+ A IWICPFC+QRN FP  Y+ +SETN+P ELYPQ+TT+QYTL
Sbjct  61   AALNAYSRVDFLAKIWICPFCYQRNQFPPHYAMISETNLPCELYPQYTTVQYTL  114



>ref|XP_006414783.1| hypothetical protein EUTSA_v10024465mg [Eutrema salsugineum]
 gb|ESQ56236.1| hypothetical protein EUTSA_v10024465mg [Eutrema salsugineum]
Length=780

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            +E++  D EG+DGVRMTWN WPRTKVE+SKCVIP+AASI  IR   ++ ++PYAPL+C+T
Sbjct  2    AEMATMDPEGMDGVRMTWNVWPRTKVEASKCVIPLAASISPIRRHSDIPSLPYAPLKCRT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C A LN FARVD+ A IWICPFC+QRN FP  Y  +SE N+P ELYPQ+TT++YTL
Sbjct  62   CEAALNAFARVDFTAKIWICPFCYQRNHFPPHYHMISENNLPGELYPQYTTVEYTL  117



>gb|KFK22996.1| hypothetical protein AALP_AAs50735U000600 [Arabis alpina]
Length=775

 Score =   176 bits (446),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            +E+  TD EGIDGVRMTWN WPRTKVE+SKCVIP+A SI  IR   ++ ++PYAPL C+T
Sbjct  2    AEMVNTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAVSISPIRRHSDIPSLPYAPLLCRT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C A LN FARVD+Q+ IWICPFC+QR++FP  Y  +SE+N+P ELYPQ+TT++YTL
Sbjct  62   CNAALNSFARVDFQSKIWICPFCYQRSNFPPHYHMISESNLPGELYPQYTTVEYTL  117



>ref|XP_010457640.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Camelina 
sativa]
 ref|XP_010457641.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Camelina 
sativa]
Length=780

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++  D EGIDGVRM WN WPRTKVE+SKCVIP+AA I  IR   ++ +V YAPLRC++
Sbjct  2    SEMATMDPEGIDGVRMPWNFWPRTKVEASKCVIPVAACISPIRYHRDIQSVGYAPLRCRS  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            CTA LNPFARVD+ A IWICP CFQRN FP  Y  +SETN+P ELYPQ+TT++YTL
Sbjct  62   CTAALNPFARVDFSAKIWICPICFQRNHFPPHYHVMSETNLPCELYPQYTTVEYTL  117



>ref|XP_010475248.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=780

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++  D EGIDGVRM WN WPR KVE+SKCVIP+AA I  IR   ++ +V YAPLRC++
Sbjct  2    SEMATMDPEGIDGVRMPWNVWPRNKVEASKCVIPVAACISPIRYHRDIQSVGYAPLRCRS  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            CTA LNPFARVD+ A IWICP CFQRN FP  Y  +SETN+P ELYPQ+TT++YTL
Sbjct  62   CTAALNPFARVDFSAKIWICPICFQRNHFPPHYHVMSETNLPCELYPQYTTVEYTL  117



>emb|CDY01197.1| BnaA04g06220D [Brassica napus]
Length=762

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  218  ISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCT  397
            +++ D EG+DGVRMTWN WPRTKVE+SKCVIP+AASI  IR   ++ ++PYAPL+C+TC 
Sbjct  1    MAEMDPEGMDGVRMTWNVWPRTKVEASKCVIPLAASISPIRRHSDIPSLPYAPLKCRTCV  60

Query  398  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            +VLN FARVD+ A IWICPFCFQRN FP  Y  +S+TN+P ELYPQ++T++Y L
Sbjct  61   SVLNAFARVDFAAKIWICPFCFQRNPFPPHYHMISDTNLPGELYPQYSTVEYAL  114



>ref|XP_006283156.1| hypothetical protein CARUB_v10004186mg [Capsella rubella]
 gb|EOA16054.1| hypothetical protein CARUB_v10004186mg [Capsella rubella]
Length=781

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            ++++  D EG+DGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P+++ + YAPL+C+T
Sbjct  2    ADMAYVDPEGMDGVRMTWNFWPRTKVEASKCVIPLAASISPIRRHPDILNLDYAPLQCRT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+AVLN FARVD+ A IWICPFC+QRN+FP  Y ++SETN+P ELY  +TT++YT+
Sbjct  62   CSAVLNCFARVDFIAKIWICPFCYQRNTFPTHYHSISETNLPGELYQHYTTVEYTI  117



>ref|XP_009111051.1| PREDICTED: protein transport protein SEC23 [Brassica rapa]
 emb|CDY15544.1| BnaA08g28280D [Brassica napus]
Length=767

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            +E+   D EGID VRMTWN WPR KVE+SKCV+P+AA I  IR   ++ +VPYAPLRC+T
Sbjct  2    AEMESLDPEGIDSVRMTWNVWPRNKVEASKCVVPVAACISPIRYHRDIQSVPYAPLRCRT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+A LNPFARVD+ A IWICP CFQRN FP  Y  +SETN+P ELYPQ+TT++Y++
Sbjct  62   CSAALNPFARVDFSAKIWICPICFQRNHFPPHYHVISETNLPCELYPQYTTVEYSM  117



>emb|CDX86574.1| BnaC08g01290D [Brassica napus]
Length=767

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            +E+   D EGID VRMTWN WPR KVE+SKCV+P+AA I  IR   ++ +VPYAPLRC+T
Sbjct  2    AEMESLDPEGIDSVRMTWNVWPRNKVEASKCVVPVAACISPIRYHRDIQSVPYAPLRCRT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+A LNPFARVD+ A IWICP CFQRN FP  Y  +SETN+P ELYPQ+TT++Y++
Sbjct  62   CSAALNPFARVDFSAKIWICPICFQRNHFPPHYHVISETNLPCELYPQYTTVEYSM  117



>ref|NP_189008.1| Sec23/Sec24 protein transport family protein [Arabidopsis thaliana]
 dbj|BAB02785.1| protein transport protein Sec23 [Arabidopsis thaliana]
 gb|AAO22730.1| putative transport protein [Arabidopsis thaliana]
 gb|AAO50656.1| putative transport protein [Arabidopsis thaliana]
 gb|AEE76796.1| Sec23/Sec24 protein transport family protein [Arabidopsis thaliana]
Length=765

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            +E + TD EGIDGVRMTWN WP +K E+SKCVIP+AA I  IR   ++ T+PYAPLRC+T
Sbjct  2    AETANTDLEGIDGVRMTWNVWPHSKAEASKCVIPLAACISPIRRHADIPTLPYAPLRCRT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+A LN +A+VD+ A +WICPFC+QRN FP  Y  +SETN+P ELYPQ+TT++YTL
Sbjct  62   CSAALNAYAQVDFTAKLWICPFCYQRNHFPPHYHVISETNLPGELYPQYTTVEYTL  117



>ref|XP_002870333.1| hypothetical protein ARALYDRAFT_493493 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46592.1| hypothetical protein ARALYDRAFT_493493 [Arabidopsis lyrata subsp. 
lyrata]
Length=763

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +2

Query  236  EGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLNPF  415
            EG+DGVRMTWN WPRTKVE+SKCVIP+AASI  IR   ++  +PYAPL+C+TC AVLN F
Sbjct  6    EGMDGVRMTWNLWPRTKVEASKCVIPLAASISPIRRHSDIPDLPYAPLKCRTCVAVLNAF  65

Query  416  ARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            ARVD+ A IWICPFC QRN FP  Y ++SE N+P ELYPQ+TT++YTL
Sbjct  66   ARVDFNAKIWICPFCHQRNHFPVHYHSISEINLPGELYPQYTTVEYTL  113



>ref|NP_001189956.1| Sec23/Sec24 protein transport family protein [Arabidopsis thaliana]
 gb|AEE76797.1| Sec23/Sec24 protein transport family protein [Arabidopsis thaliana]
Length=791

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            +E + TD EGIDGVRMTWN WP +K E+SKCVIP+AA I  IR   ++ T+PYAPLRC+T
Sbjct  2    AETANTDLEGIDGVRMTWNVWPHSKAEASKCVIPLAACISPIRRHADIPTLPYAPLRCRT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+A LN +A+VD+ A +WICPFC+QRN FP  Y  +SETN+P ELYPQ+TT++YTL
Sbjct  62   CSAALNAYAQVDFTAKLWICPFCYQRNHFPPHYHVISETNLPGELYPQYTTVEYTL  117



>emb|CBI39378.3| unnamed protein product [Vitis vinifera]
Length=707

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +2

Query  257  MTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLNPFARVDYQA  436
            MTWN WPRTKVE+SKCVIPIAAS+  IR  P++ T+PYAPLRCKTC ++LNPF RVD+ A
Sbjct  1    MTWNVWPRTKVEASKCVIPIAASVSPIRSHPDIPTLPYAPLRCKTCISLLNPFCRVDFAA  60

Query  437  LIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
             IWICPFCFQRN FPH YS +SE+N+P ELYPQ+TT++Y+L
Sbjct  61   KIWICPFCFQRNHFPHHYSMISESNLPGELYPQYTTVEYSL  101



>ref|XP_009139544.1| PREDICTED: protein transport protein SEC23-like [Brassica rapa]
Length=772

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  218  ISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCT  397
            +++ D EG+DGVRMTWN WPRTKVE+SKCVIP+AASI  IR   ++ ++PYAPL+C+TC 
Sbjct  1    MAEMDPEGMDGVRMTWNVWPRTKVEASKCVIPLAASISPIRRHSDIPSLPYAPLKCRTCV  60

Query  398  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            +VL  FARVD+ A IWICPFCFQRN FP  Y  +S+TN+P ELYPQ++T++Y L
Sbjct  61   SVLTAFARVDFAAKIWICPFCFQRNPFPPHYHMISDTNLPGELYPQYSTVEYAL  114



>ref|XP_006297004.1| hypothetical protein CARUB_v10012995mg [Capsella rubella]
 gb|EOA29902.1| hypothetical protein CARUB_v10012995mg [Capsella rubella]
Length=782

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            +E + TD EGIDGVRMTWN WP +KVESSK VIP+AA I  IR   ++ T+PYAPLRC+T
Sbjct  2    AETAITDLEGIDGVRMTWNVWPHSKVESSKLVIPLAACISPIRRHSDIPTLPYAPLRCRT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+A LN +A+VD+ A +WICPFCFQRN FP  Y  +SETN+P ELYPQ+TT++YTL
Sbjct  62   CSAALNAYAQVDFTAKLWICPFCFQRNHFPPHYHVMSETNLPGELYPQYTTVEYTL  117



>ref|XP_008785319.1| PREDICTED: protein transport protein SEC23-like [Phoenix dactylifera]
 ref|XP_008785320.1| PREDICTED: protein transport protein SEC23-like [Phoenix dactylifera]
 ref|XP_008785321.1| PREDICTED: protein transport protein SEC23-like [Phoenix dactylifera]
Length=785

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 89/109 (82%), Gaps = 1/109 (1%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVL  406
            D +G DGVRMTWNAWPR+KVE+SKCVIP+AASI  IR  P L+ +PYAPLRCK  C AVL
Sbjct  17   DPDGPDGVRMTWNAWPRSKVEASKCVIPVAASIAPIRASPSLLVLPYAPLRCKPPCAAVL  76

Query  407  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            NPFARVD+ A IWICP CF RN FP  Y+A+SETNVP ELYPQ TT++Y
Sbjct  77   NPFARVDFAAKIWICPLCFSRNHFPPHYAAISETNVPGELYPQCTTVEY  125



>ref|XP_006297005.1| hypothetical protein CARUB_v10012995mg [Capsella rubella]
 gb|EOA29903.1| hypothetical protein CARUB_v10012995mg [Capsella rubella]
Length=812

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            +E + TD EGIDGVRMTWN WP +KVESSK VIP+AA I  IR   ++ T+PYAPLRC+T
Sbjct  2    AETAITDLEGIDGVRMTWNVWPHSKVESSKLVIPLAACISPIRRHSDIPTLPYAPLRCRT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+A LN +A+VD+ A +WICPFCFQRN FP  Y  +SETN+P ELYPQ+TT++YTL
Sbjct  62   CSAALNAYAQVDFTAKLWICPFCFQRNHFPPHYHVMSETNLPGELYPQYTTVEYTL  117



>ref|XP_010934373.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Elaeis 
guineensis]
Length=540

 Score =   169 bits (427),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 86/104 (83%), Gaps = 1/104 (1%)
 Frame = +2

Query  245  DGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVLNPFAR  421
            DGVRMTWNAWPR+KVE+SKCVIP+AASI  IR  P L+ +PYAPLRCK  C AVLNPFAR
Sbjct  19   DGVRMTWNAWPRSKVEASKCVIPVAASIAPIRASPSLLVLPYAPLRCKPPCAAVLNPFAR  78

Query  422  VDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            VD+ A IWICP CF RN FP  Y+A+SETNVP ELYPQ TT++Y
Sbjct  79   VDFAAKIWICPLCFSRNQFPPHYAAMSETNVPGELYPQCTTVEY  122



>ref|XP_009419583.1| PREDICTED: protein transport protein SEC23-like [Musa acuminata 
subsp. malaccensis]
Length=783

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 91/118 (77%), Gaps = 1/118 (1%)
 Frame = +2

Query  203  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  382
             +    S TD +G DGVRMTWN+WPR+KVE+SKC++P+AAS+  IR  P LV +PYAPLR
Sbjct  7    FSGGGASSTDPDGPDGVRMTWNSWPRSKVEASKCIVPVAASVTPIRASPSLVVLPYAPLR  66

Query  383  CK-TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            CK  C AVLNPFARVD+ A IWICP CF RN FP  Y+ +SETNVP ELYP+ TT++Y
Sbjct  67   CKPPCAAVLNPFARVDFAAKIWICPLCFSRNHFPPHYAGISETNVPGELYPECTTVEY  124



>ref|XP_009420223.1| PREDICTED: protein transport protein SEC23-like [Musa acuminata 
subsp. malaccensis]
Length=783

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 88/109 (81%), Gaps = 1/109 (1%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVL  406
            D +G DGVRMTWN+WPR+KVE+SKCV+P+AAS+  IR  P LV +PY+PLRCK  C AVL
Sbjct  17   DPDGPDGVRMTWNSWPRSKVEASKCVVPVAASVAPIRSSPSLVVLPYSPLRCKPPCAAVL  76

Query  407  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            NPFARVD+ A IWICPFCF RN FP  Y+ +SE NVP ELYPQ TT++Y
Sbjct  77   NPFARVDFAAKIWICPFCFSRNHFPPHYAGISEANVPGELYPQCTTVEY  125



>ref|XP_010934372.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Elaeis 
guineensis]
Length=782

 Score =   167 bits (424),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 86/104 (83%), Gaps = 1/104 (1%)
 Frame = +2

Query  245  DGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVLNPFAR  421
            DGVRMTWNAWPR+KVE+SKCVIP+AASI  IR  P L+ +PYAPLRCK  C AVLNPFAR
Sbjct  19   DGVRMTWNAWPRSKVEASKCVIPVAASIAPIRASPSLLVLPYAPLRCKPPCAAVLNPFAR  78

Query  422  VDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            VD+ A IWICP CF RN FP  Y+A+SETNVP ELYPQ TT++Y
Sbjct  79   VDFAAKIWICPLCFSRNQFPPHYAAMSETNVPGELYPQCTTVEY  122



>ref|XP_010908065.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Elaeis 
guineensis]
Length=754

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 88/109 (81%), Gaps = 1/109 (1%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVL  406
            D +G DGVRMTWNAWPR+KVE+SKCVIP+AA I  IR  P L+ +PYAPLRCK  C AVL
Sbjct  17   DPDGPDGVRMTWNAWPRSKVEASKCVIPVAACIAPIRASPSLLVLPYAPLRCKPPCAAVL  76

Query  407  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            NPF+RVD+ A IWICP CF RN FP  Y+A+SETNVP ELYPQ TT++Y
Sbjct  77   NPFSRVDFAAKIWICPICFSRNHFPPHYAAISETNVPGELYPQCTTVEY  125



>ref|XP_010908064.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Elaeis 
guineensis]
Length=790

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 88/109 (81%), Gaps = 1/109 (1%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVL  406
            D +G DGVRMTWNAWPR+KVE+SKCVIP+AA I  IR  P L+ +PYAPLRCK  C AVL
Sbjct  17   DPDGPDGVRMTWNAWPRSKVEASKCVIPVAACIAPIRASPSLLVLPYAPLRCKPPCAAVL  76

Query  407  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            NPF+RVD+ A IWICP CF RN FP  Y+A+SETNVP ELYPQ TT++Y
Sbjct  77   NPFSRVDFAAKIWICPICFSRNHFPPHYAAISETNVPGELYPQCTTVEY  125



>ref|XP_006303716.1| hypothetical protein CARUB_v10011838mg [Capsella rubella]
 gb|EOA36614.1| hypothetical protein CARUB_v10011838mg [Capsella rubella]
Length=780

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            SE++  D EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR   ++    YAPLRC+T
Sbjct  2    SEVASIDPEGIDGVRMTWNVWPRTKVEASKCVIPVAACISPIRYHRDIQFNNYAPLRCRT  61

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            CTA LNP+ RVD+ A IWICP CFQRN FP  Y  +SETN+  ELY Q +T++YTL
Sbjct  62   CTAALNPYVRVDFSAKIWICPICFQRNHFPPHYHVMSETNLACELYQQCSTVEYTL  117



>ref|XP_006827919.1| hypothetical protein AMTR_s00008p00163370 [Amborella trichopoda]
 gb|ERM95335.1| hypothetical protein AMTR_s00008p00163370 [Amborella trichopoda]
Length=762

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E ++GVRM+WN WPRTKV++SKCV+P+A  +  IR  PEL  +PY PLRCK+C+ VLN
Sbjct  6    EMEAVEGVRMSWNVWPRTKVDASKCVVPLATVVSPIRSLPELPVLPYPPLRCKSCSCVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            P  RVDY A IW+CPFCFQR  FP  Y  +SETNVPAEL+PQ++ I+Y+L
Sbjct  66   PHCRVDYAARIWVCPFCFQRTHFPIHYEGISETNVPAELFPQYSVIEYSL  115



>ref|XP_009414536.1| PREDICTED: protein transport protein SEC23-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009414537.1| PREDICTED: protein transport protein SEC23-like [Musa acuminata 
subsp. malaccensis]
Length=785

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 87/110 (79%), Gaps = 1/110 (1%)
 Frame = +2

Query  227  TDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAV  403
            +D +G DGVRM+WN WPR+K+E+SKCVIP+AASI  IR  P ++ +PY PLRCK  C+AV
Sbjct  13   SDPDGPDGVRMSWNNWPRSKIEASKCVIPVAASITPIRASPSVLVLPYQPLRCKPPCSAV  72

Query  404  LNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            L+PFARVD+ A IWICP CF RN FP  Y+ +SE NVP ELYPQ TT++Y
Sbjct  73   LSPFARVDFAAKIWICPLCFSRNHFPPHYAGISEANVPGELYPQCTTVEY  122



>ref|XP_008791501.1| PREDICTED: protein transport protein SEC23-like [Phoenix dactylifera]
Length=791

 Score =   160 bits (404),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 83/102 (81%), Gaps = 1/102 (1%)
 Frame = +2

Query  251  VRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVLNPFARVD  427
            VRMTWNAWPR+KVE+SKCVIP+AA I  IR  P L+ +PYAPLRCK  C AVLNPFARVD
Sbjct  24   VRMTWNAWPRSKVEASKCVIPVAACIAPIRASPSLLVLPYAPLRCKPPCAAVLNPFARVD  83

Query  428  YQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            + A IWICP CF RN FP  Y+A+SETNVP ELYPQ TT++Y
Sbjct  84   FAARIWICPICFSRNHFPPHYAAISETNVPGELYPQCTTVEY  125



>ref|XP_010440522.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=779

 Score =   157 bits (398),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 90/116 (78%), Gaps = 1/116 (1%)
 Frame = +2

Query  212  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  391
            ++++  D EG+DGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P+++ + YAPL C+ 
Sbjct  2    ADMASMDPEGMDGVRMTWNVWPRTKVEASKCVIPLAASISPIRRHPDILNLDYAPLHCR-  60

Query  392  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            C+AVLN FA VDY+A IW CPFC   N+FP  Y ++++ N+P ELYPQ TT++Y +
Sbjct  61   CSAVLNAFASVDYRARIWKCPFCLHTNTFPTHYHSITQDNLPGELYPQCTTVEYAV  116



>ref|XP_009417946.1| PREDICTED: protein transport protein SEC23-like [Musa acuminata 
subsp. malaccensis]
Length=786

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 82/102 (80%), Gaps = 1/102 (1%)
 Frame = +2

Query  251  VRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVLNPFARVD  427
            VRMTWN WPR+K+E+SKCV+P+AASI  IR  P L+ +PY PLRCK  C+AVLNPFARVD
Sbjct  22   VRMTWNNWPRSKLEASKCVVPVAASIAPIRASPSLLVLPYNPLRCKPPCSAVLNPFARVD  81

Query  428  YQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            + A IWICPFCF RN FP  Y+A+SE  VP ELYPQ TT++Y
Sbjct  82   FAAKIWICPFCFSRNHFPPHYAAISEAVVPGELYPQCTTVEY  123



>ref|XP_010435181.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=776

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 85/114 (75%), Gaps = 1/114 (1%)
 Frame = +2

Query  218  ISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCT  397
            ++  D EG+DGVRMTWN WPRTKVE+SKCVIP+AASI  IR   +++ + YAPLRC+ C+
Sbjct  1    MASMDPEGMDGVRMTWNVWPRTKVEASKCVIPLAASISPIRRHHDILNLDYAPLRCR-CS  59

Query  398  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            AVLN FA VDY A IW C FC   N FP  Y +++  N+P ELYPQ TT++YT+
Sbjct  60   AVLNAFATVDYDARIWKCHFCLHTNHFPTHYRSITRDNLPGELYPQCTTVEYTV  113



>ref|XP_003059046.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57501.1| predicted protein [Micromonas pusilla CCMP1545]
Length=809

 Score =   151 bits (382),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +2

Query  236  EGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLNPF  415
            E +DGVR++WN WP +K E++KCV+P+ A +   +P P++  VPY P+RCK C A LNP+
Sbjct  10   EAVDGVRLSWNVWPNSKAEAAKCVVPLGAVVTPRKPLPDMPVVPYDPVRCKGCAACLNPY  69

Query  416  ARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            ARVD+   +WICPFC+ RN FP  Y+++SETN+PAEL+P +TTI+Y L
Sbjct  70   ARVDFNGKLWICPFCYARNHFPPHYASISETNLPAELFPTYTTIEYAL  117



>gb|KJB72954.1| hypothetical protein B456_011G205900 [Gossypium raimondii]
Length=692

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + EG DGVRM WN  P TK E+S CV+P++A    I+P P +  +PYAPLRC+ C +VLN
Sbjct  6    ELEGQDGVRMAWNVIPGTKQEASNCVVPVSAVYTPIKPFPNMPVLPYAPLRCRNCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISDENLPAELFPQYTTIEY  113



>gb|KJB72955.1| hypothetical protein B456_011G205900 [Gossypium raimondii]
Length=681

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + EG DGVRM WN  P TK E+S CV+P++A    I+P P +  +PYAPLRC+ C +VLN
Sbjct  6    ELEGQDGVRMAWNVIPGTKQEASNCVVPVSAVYTPIKPFPNMPVLPYAPLRCRNCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISDENLPAELFPQYTTIEY  113



>gb|KJB72956.1| hypothetical protein B456_011G205900 [Gossypium raimondii]
Length=735

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + EG DGVRM WN  P TK E+S CV+P++A    I+P P +  +PYAPLRC+ C +VLN
Sbjct  6    ELEGQDGVRMAWNVIPGTKQEASNCVVPVSAVYTPIKPFPNMPVLPYAPLRCRNCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISDENLPAELFPQYTTIEY  113



>gb|KJB72952.1| hypothetical protein B456_011G205900 [Gossypium raimondii]
 gb|KJB72953.1| hypothetical protein B456_011G205900 [Gossypium raimondii]
Length=761

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + EG DGVRM WN  P TK E+S CV+P++A    I+P P +  +PYAPLRC+ C +VLN
Sbjct  6    ELEGQDGVRMAWNVIPGTKQEASNCVVPVSAVYTPIKPFPNMPVLPYAPLRCRNCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISDENLPAELFPQYTTIEY  113



>ref|XP_007011443.1| Sec23/Sec24 protein transport family protein isoform 2 [Theobroma 
cacao]
 gb|EOY20253.1| Sec23/Sec24 protein transport family protein isoform 2 [Theobroma 
cacao]
Length=761

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + EG DGVRM WN  P TK E+S CV+P++A    I+P P +  +PYAPLRC+ C +VLN
Sbjct  6    ELEGQDGVRMAWNVVPGTKQEASNCVVPVSAIYTPIKPFPNMPVLPYAPLRCRNCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISDENLPAELFPQYTTIEY  113



>gb|KDP24898.1| hypothetical protein JCGZ_24276 [Jatropha curcas]
Length=1052

 Score =   150 bits (379),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DGVRM WN  P TK E+S CV+P++A    I+P P +  +PYAPLRC+TC +VLN
Sbjct  6    DLEAQDGVRMPWNVLPGTKQEASNCVVPVSAMYTPIKPFPNMPILPYAPLRCRTCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISDDNLPAELFPQYTTIEY  113



>ref|XP_002508348.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69606.1| predicted protein [Micromonas sp. RCC299]
Length=808

 Score =   149 bits (375),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +2

Query  236  EGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLNPF  415
            E +DGVR++WN WP +++E+ KCV+P  A +   +  PE+  VPY P+RCK C A LNP+
Sbjct  46   EAVDGVRLSWNVWPNSRMEAQKCVVPFGALVTPRKVLPEMPVVPYDPVRCKGCAACLNPY  105

Query  416  ARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            ARVD+ A +WICPFC+ RN FP  Y+++SETN+PAEL+P +TTI+Y L
Sbjct  106  ARVDFNAKLWICPFCYTRNHFPQHYASISETNLPAELFPTYTTIEYQL  153



>ref|XP_010255698.1| PREDICTED: protein transport protein SEC23-like [Nelumbo nucifera]
 ref|XP_010255700.1| PREDICTED: protein transport protein SEC23-like [Nelumbo nucifera]
Length=764

 Score =   148 bits (374),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DG+RM WN +P TK E++ CV+P++A    ++P P    +PY+PLRC+TC +VLN
Sbjct  6    DLEAQDGIRMPWNVFPGTKQEAANCVVPVSAIYTPLKPFPNXPVLPYSPLRCRTCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VDY A IWICPFCFQRN FP  Y+++SE N+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDYMAKIWICPFCFQRNHFPPHYASISEDNLPAELFPQYTTIEY  113



>gb|EAZ07329.1| hypothetical protein OsI_29578 [Oryza sativa Indica Group]
Length=367

 Score =   144 bits (364),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DG+RM WN  P TK +++ CV+P++A    +RP P +  +PY PLRC+ C ++LN
Sbjct  6    DLELQDGIRMPWNVIPGTKQDAANCVVPVSAIYTPLRPNPAIPVLPYGPLRCRMCRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF  VDY A IW+CPFCFQRN FP  YS++SE+N+PAEL+PQ+TT+++
Sbjct  66   PFCVVDYVAKIWVCPFCFQRNHFPQHYSSISESNLPAELFPQYTTVEF  113



>gb|KJB78641.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
 gb|KJB78642.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
Length=510

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E  DGVRMTWN  P TK E+  CV+P++A    I+P P ++ +PYAPLRC+ C++VLN
Sbjct  6    ELEAQDGVRMTWNVVPGTKEEAGNCVVPVSAIYTPIKPFPNMLVLPYAPLRCRNCSSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF  +D+ A IWICPFCF R+ FP  Y++VSE N+PAEL+PQ+TTI+Y
Sbjct  66   PFCVMDFAAKIWICPFCFHRSHFPAHYASVSEENLPAELFPQYTTIEY  113



>ref|XP_010939455.1| PREDICTED: protein transport protein SEC23 isoform X2 [Elaeis 
guineensis]
Length=683

 Score =   147 bits (371),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DGVRMTWN +P TK ++  CVIP AA    ++P P    +PYAPLRC+ C ++LN
Sbjct  6    DLESQDGVRMTWNIFPGTKQDAVGCVIPTAAMYTPLKPIPNTPVLPYAPLRCRMCRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VDY A IWICPFCFQRN FP  YS++SE N+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDYIAKIWICPFCFQRNHFPPHYSSISEDNLPAELFPQYTTIEY  113



>ref|XP_002526529.1| protein transport protein sec23, putative [Ricinus communis]
 gb|EEF35920.1| protein transport protein sec23, putative [Ricinus communis]
Length=761

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DGVRM WN  P +K E+S CV+P++A    I+P P +  +PYAPLRC+TC +VLN
Sbjct  6    DLEAQDGVRMPWNVLPGSKQEASNCVVPVSAIYTPIKPFPNMPVLPYAPLRCRTCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VD+ A IWICPFCFQRN FP  Y ++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYGSISDDNLPAELFPQYTTIEY  113



>ref|XP_009387153.1| PREDICTED: protein transport protein SEC23 [Musa acuminata subsp. 
malaccensis]
Length=763

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DGVRMTWN  P TK E+  CVIP+AA    ++P P++  +PY+PLRC+ C ++LN
Sbjct  6    DLETQDGVRMTWNMLPGTKQEALGCVIPVAAIYTPLKPIPDMPVLPYSPLRCRICRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VDY A IW+CPFCFQRN FP  Y ++SE N+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDYVAKIWVCPFCFQRNHFPQHYLSISEDNLPAELFPQYTTIEY  113



>ref|XP_003577593.1| PREDICTED: protein transport protein SEC23-like [Brachypodium 
distachyon]
Length=787

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 86/108 (80%), Gaps = 3/108 (3%)
 Frame = +2

Query  239  GIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVT--VPYAPLRCKT-CTAVLN  409
            G D VR+TWNAWPR+KVE+S+CV+P+AA+I  +R    L +  +PYAPLRCK  C+A+LN
Sbjct  16   GPDAVRLTWNAWPRSKVEASRCVVPLAAAISPVRCPESLASPPLPYAPLRCKPPCSALLN  75

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PFARVDY A IWICP CF RN FP  Y+ +SE+NVPAEL+PQ +T++Y
Sbjct  76   PFARVDYAAKIWICPLCFSRNHFPPHYAGISESNVPAELFPQCSTVEY  123



>ref|XP_008797249.1| PREDICTED: protein transport protein sec23 isoform X2 [Phoenix 
dactylifera]
Length=709

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DGVRMTWN +P TK ++  CVIP AA    ++P P    +PYAPLRC+ C ++LN
Sbjct  6    DLESQDGVRMTWNIFPGTKQDAVGCVIPTAAIYTPLKPIPNTPVLPYAPLRCRMCRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VDY A IWICPFCFQRN FP  YS++SE N+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDYIAKIWICPFCFQRNHFPPHYSSISEDNLPAELFPQYTTIEY  113



>ref|XP_010939452.1| PREDICTED: protein transport protein SEC23 isoform X1 [Elaeis 
guineensis]
 ref|XP_010939453.1| PREDICTED: protein transport protein SEC23 isoform X1 [Elaeis 
guineensis]
 ref|XP_010939454.1| PREDICTED: protein transport protein SEC23 isoform X1 [Elaeis 
guineensis]
Length=763

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DGVRMTWN +P TK ++  CVIP AA    ++P P    +PYAPLRC+ C ++LN
Sbjct  6    DLESQDGVRMTWNIFPGTKQDAVGCVIPTAAMYTPLKPIPNTPVLPYAPLRCRMCRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VDY A IWICPFCFQRN FP  YS++SE N+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDYIAKIWICPFCFQRNHFPPHYSSISEDNLPAELFPQYTTIEY  113



>ref|XP_007011442.1| Sec23/Sec24 protein transport family protein isoform 1 [Theobroma 
cacao]
 gb|EOY20252.1| Sec23/Sec24 protein transport family protein isoform 1 [Theobroma 
cacao]
Length=998

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + EG DGVRM WN  P TK E+S CV+P++A    I+P P +  +PYAPLRC+ C +VLN
Sbjct  6    ELEGQDGVRMAWNVVPGTKQEASNCVVPVSAIYTPIKPFPNMPVLPYAPLRCRNCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISDENLPAELFPQYTTIEY  113



>ref|XP_008797246.1| PREDICTED: protein transport protein SEC23 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008797247.1| PREDICTED: protein transport protein SEC23 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008797248.1| PREDICTED: protein transport protein SEC23 isoform X1 [Phoenix 
dactylifera]
Length=763

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DGVRMTWN +P TK ++  CVIP AA    ++P P    +PYAPLRC+ C ++LN
Sbjct  6    DLESQDGVRMTWNIFPGTKQDAVGCVIPTAAIYTPLKPIPNTPVLPYAPLRCRMCRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VDY A IWICPFCFQRN FP  YS++SE N+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDYIAKIWICPFCFQRNHFPPHYSSISEDNLPAELFPQYTTIEY  113



>ref|XP_002444510.1| hypothetical protein SORBIDRAFT_07g023060 [Sorghum bicolor]
 gb|EES14005.1| hypothetical protein SORBIDRAFT_07g023060 [Sorghum bicolor]
Length=763

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DG+RMTWN  P TK +++ CV+P++A    ++P P +  +PYAPLRC+ C ++LN
Sbjct  6    DLETQDGIRMTWNVIPGTKQDATNCVVPVSAIYTPLKPNPSIPVLPYAPLRCRMCRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VD+ A IW+CPFCFQRN FP  Y+++SE N+PAEL+PQ+TT++Y
Sbjct  66   PFSVVDFVAKIWVCPFCFQRNHFPQHYNSISENNLPAELFPQYTTVEY  113



>ref|XP_010450096.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=784

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 87/122 (71%), Gaps = 9/122 (7%)
 Frame = +2

Query  218  ISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCT  397
            ++  D EG+DGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P+++ + YAPL C+ C+
Sbjct  1    MASMDPEGMDGVRMTWNVWPRTKVEASKCVIPLAASISPIRRHPDILNLDYAPLHCR-CS  59

Query  398  AVLNPFARVDYQAL--------IWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            AVLN FA VD+ A         IW CPFC   N FP  Y ++S+ N+P ELYPQ TT++Y
Sbjct  60   AVLNAFATVDFSASHSASASAKIWKCPFCLHPNHFPTHYHSISQDNLPGELYPQCTTVEY  119

Query  554  TL  559
            T+
Sbjct  120  TV  121



>ref|XP_001762459.1| predicted protein [Physcomitrella patens]
 gb|EDQ72582.1| predicted protein [Physcomitrella patens]
Length=774

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 82/112 (73%), Gaps = 4/112 (4%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAA---SIHLIRPQPELVTV-PYAPLRCKTCT  397
            D E ++G+RM+WN WP TK+++SKC IP+AA    +H   P    V V  YAPLRC+ C 
Sbjct  6    DAEAMNGIRMSWNVWPSTKLDASKCHIPLAALYTPLHGAGPHSNPVAVLNYAPLRCRACR  65

Query  398  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
             VLNPF  VDYQA IWICPFC QRNSFPH YS++S+ NVP E++PQ TT++Y
Sbjct  66   GVLNPFCAVDYQAKIWICPFCHQRNSFPHHYSSISDQNVPGEIWPQCTTVEY  117



>ref|XP_008375693.1| PREDICTED: protein transport protein SEC23-like [Malus domestica]
Length=521

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DGVRM WN  P TK ES+  V+P++A    I+P P +  +PYAPLRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQESTNSVVPVSAIYTPIKPFPSMPVLPYAPLRCRTCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VDY A IWICPFCF RN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSTVDYAAKIWICPFCFTRNHFPPHYASISDENLPAELFPQYTTIEY  113



>gb|KJB78640.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
Length=687

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E  DGVRMTWN  P TK E+  CV+P++A    I+P P ++ +PYAPLRC+ C++VLN
Sbjct  6    ELEAQDGVRMTWNVVPGTKEEAGNCVVPVSAIYTPIKPFPNMLVLPYAPLRCRNCSSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF  +D+ A IWICPFCF R+ FP  Y++VSE N+PAEL+PQ+TTI+Y
Sbjct  66   PFCVMDFAAKIWICPFCFHRSHFPAHYASVSEENLPAELFPQYTTIEY  113



>ref|XP_001774792.1| predicted protein [Physcomitrella patens]
 gb|EDQ60463.1| predicted protein [Physcomitrella patens]
Length=772

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 84/112 (75%), Gaps = 4/112 (4%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAA---SIHLIRPQPELVT-VPYAPLRCKTCT  397
            + E ++G+RM+WN WP TK+++SKC IP+AA    +H   P    VT + YAPLRC+ C 
Sbjct  6    EAEAMNGIRMSWNVWPSTKLDASKCHIPLAALYTPLHGAGPHSNPVTKLNYAPLRCRACR  65

Query  398  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            +VLNPF  VDYQA IWICPFC QRNSFPH Y+++SE NVP EL+PQ TT++Y
Sbjct  66   SVLNPFCSVDYQAKIWICPFCHQRNSFPHHYASISEQNVPGELWPQCTTVEY  117



>ref|XP_010097714.1| Protein transport protein SEC23 [Morus notabilis]
 gb|EXB70669.1| Protein transport protein SEC23 [Morus notabilis]
Length=756

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DGVRM WN  P TK E++ CV+P++A    I+P P +  VPY PLRC+TC ++LN
Sbjct  6    DLEAQDGVRMPWNVLPGTKQEATSCVVPVSAIYTPIKPLPNIPVVPYGPLRCRTCRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VD+ A IWICPFCFQRN FP  Y+ +S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDFVAKIWICPFCFQRNHFPPGYATISDDNLPAELFPQYTTIEY  113



>ref|XP_008344490.1| PREDICTED: protein transport protein SEC23-like [Malus domestica]
Length=305

 Score =   141 bits (355),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DGVRM WN  P TK ES+  V+P++A    I+P P +  +PYA LRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQESTNSVVPVSAIYTPIKPFPSMPVLPYAALRCRTCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VDY A IWICPFCF RN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSTVDYAAKIWICPFCFTRNHFPPHYASISDENLPAELFPQYTTIEY  113



>gb|KJB78639.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
Length=716

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E  DGVRMTWN  P TK E+  CV+P++A    I+P P ++ +PYAPLRC+ C++VLN
Sbjct  6    ELEAQDGVRMTWNVVPGTKEEAGNCVVPVSAIYTPIKPFPNMLVLPYAPLRCRNCSSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF  +D+ A IWICPFCF R+ FP  Y++VSE N+PAEL+PQ+TTI+Y
Sbjct  66   PFCVMDFAAKIWICPFCFHRSHFPAHYASVSEENLPAELFPQYTTIEY  113



>gb|KJB78634.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
 gb|KJB78635.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
 gb|KJB78637.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
Length=757

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E  DGVRMTWN  P TK E+  CV+P++A    I+P P ++ +PYAPLRC+ C++VLN
Sbjct  6    ELEAQDGVRMTWNVVPGTKEEAGNCVVPVSAIYTPIKPFPNMLVLPYAPLRCRNCSSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF  +D+ A IWICPFCF R+ FP  Y++VSE N+PAEL+PQ+TTI+Y
Sbjct  66   PFCVMDFAAKIWICPFCFHRSHFPAHYASVSEENLPAELFPQYTTIEY  113



>gb|KJB78638.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
Length=745

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E  DGVRMTWN  P TK E+  CV+P++A    I+P P ++ +PYAPLRC+ C++VLN
Sbjct  6    ELEAQDGVRMTWNVVPGTKEEAGNCVVPVSAIYTPIKPFPNMLVLPYAPLRCRNCSSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF  +D+ A IWICPFCF R+ FP  Y++VSE N+PAEL+PQ+TTI+Y
Sbjct  66   PFCVMDFAAKIWICPFCFHRSHFPAHYASVSEENLPAELFPQYTTIEY  113



>gb|KJB78636.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
Length=726

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E  DGVRMTWN  P TK E+  CV+P++A    I+P P ++ +PYAPLRC+ C++VLN
Sbjct  6    ELEAQDGVRMTWNVVPGTKEEAGNCVVPVSAIYTPIKPFPNMLVLPYAPLRCRNCSSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF  +D+ A IWICPFCF R+ FP  Y++VSE N+PAEL+PQ+TTI+Y
Sbjct  66   PFCVMDFAAKIWICPFCFHRSHFPAHYASVSEENLPAELFPQYTTIEY  113



>ref|XP_004973675.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Setaria 
italica]
Length=709

 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DG+RM WN  P TK ++  CV+P++A    ++P P +  +PYAPLRC+ C ++LN
Sbjct  6    DLEAQDGIRMAWNVIPGTKQDAINCVVPVSAIFTPLKPNPTIPVLPYAPLRCRMCRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VD+ A IW+CPFCFQRN FP  Y  +SE N+PAEL+PQFTT++Y
Sbjct  66   PFSVVDFVAKIWVCPFCFQRNHFPQHYYTISENNLPAELFPQFTTVEY  113



>gb|EMS65767.1| Protein transport protein SEC23 [Triticum urartu]
Length=589

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E +DG+RM WN  P TK ++  CV+P++A    ++  P++  VPYAPLRC+ C ++LN
Sbjct  6    ELEALDGIRMPWNVIPGTKEDAVSCVVPVSAIYTPLKSIPDMPVVPYAPLRCRMCRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+RVDY A IW+C FCFQRN FP  YS++SE N+P EL+PQ+TTI+Y
Sbjct  66   PFSRVDYSAKIWLCTFCFQRNQFPQHYSSISENNLPPELFPQYTTIEY  113



>emb|CAN81541.1| hypothetical protein VITISV_008772 [Vitis vinifera]
Length=372

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E  DGVRM WN  P TK ES++ +IP+AA    ++P P +  +PY PLRC+TC +VLN
Sbjct  6    ELEAQDGVRMPWNVIPGTKQESAQSIIPVAAIYTPLKPFPSMPVLPYTPLRCRTCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PFA VD+ A +WICPFCFQRN FP  YS++S+ N+PAEL+P +TT++Y
Sbjct  66   PFAIVDFSAKLWICPFCFQRNHFPAHYSSISDLNLPAELFPNYTTLEY  113



>ref|XP_004973674.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Setaria 
italica]
Length=763

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DG+RM WN  P TK ++  CV+P++A    ++P P +  +PYAPLRC+ C ++LN
Sbjct  6    DLEAQDGIRMAWNVIPGTKQDAINCVVPVSAIFTPLKPNPTIPVLPYAPLRCRMCRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VD+ A IW+CPFCFQRN FP  Y  +SE N+PAEL+PQFTT++Y
Sbjct  66   PFSVVDFVAKIWVCPFCFQRNHFPQHYYTISENNLPAELFPQFTTVEY  113



>ref|XP_007220245.1| hypothetical protein PRUPE_ppa001813mg [Prunus persica]
 gb|EMJ21444.1| hypothetical protein PRUPE_ppa001813mg [Prunus persica]
Length=761

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DGVRM WN  P TK ES+  V+P++A    I+P P +  +PYAPLRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQESTNSVVPVSAIYTPIKPFPSMPVLPYAPLRCRTCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VDY A IWICPFCF RN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSTVDYAAKIWICPFCFTRNHFPPHYASISDENLPAELFPQYTTIEY  113



>ref|XP_009361354.1| PREDICTED: protein transport protein SEC23-like [Pyrus x bretschneideri]
Length=761

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DGVRM WN  P TK ES+  V+P++A    I+P P +  +PYAPLRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQESTNSVVPVSAIYTPIKPFPSMPVLPYAPLRCRTCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VDY A IWICPFCF RN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSTVDYAAKIWICPFCFTRNHFPPHYASISDENLPAELFPQYTTIEY  113



>ref|NP_001062030.1| Os08g0474700 [Oryza sativa Japonica Group]
 dbj|BAD09341.1| putative SEC23 [Oryza sativa Japonica Group]
 dbj|BAF23944.1| Os08g0474700 [Oryza sativa Japonica Group]
Length=763

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DG+RM WN  P TK +++ CV+P++A    +RP P +  +PY PLRC+ C ++LN
Sbjct  6    DLELQDGIRMPWNVIPGTKQDAANCVVPVSAIYTPLRPNPAIPVLPYGPLRCRMCRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF  VDY A IW+CPFCFQRN FP  YS++SE+N+PAEL+PQ+TT+++
Sbjct  66   PFCVVDYVAKIWVCPFCFQRNHFPQHYSSISESNLPAELFPQYTTVEF  113



>ref|XP_008232223.1| PREDICTED: protein transport protein SEC23 [Prunus mume]
 ref|XP_008232224.1| PREDICTED: protein transport protein SEC23 [Prunus mume]
Length=761

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DGVRM WN  P TK ES+  V+P++A    I+P P +  +PYAPLRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQESTNSVVPVSAIYTPIKPFPAMPVLPYAPLRCRTCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VDY A IWICPFCF RN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSTVDYAAKIWICPFCFTRNHFPPHYASISDENLPAELFPQYTTIEY  113



>ref|XP_010278786.1| PREDICTED: protein transport protein SEC23-like isoform X4 [Nelumbo 
nucifera]
Length=742

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DG+RM WN +P TK E++ CV+P++A    ++P P +  +PY+PLRC+TC +VLN
Sbjct  6    DLEAHDGIRMPWNVFPGTKQEAASCVVPVSAIYTPLKPFPNMPVLPYSPLRCRTCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VDY   IWICPFCFQRN FP  Y+++S+ N+P +L+PQ+TTI+Y
Sbjct  66   PFSTVDYMGQIWICPFCFQRNHFPPHYASISQDNLPPDLFPQYTTIEY  113



>ref|XP_010278782.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010278783.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010278784.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Nelumbo 
nucifera]
Length=766

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DG+RM WN +P TK E++ CV+P++A    ++P P +  +PY+PLRC+TC +VLN
Sbjct  6    DLEAHDGIRMPWNVFPGTKQEAASCVVPVSAIYTPLKPFPNMPVLPYSPLRCRTCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VDY   IWICPFCFQRN FP  Y+++S+ N+P +L+PQ+TTI+Y
Sbjct  66   PFSTVDYMGQIWICPFCFQRNHFPPHYASISQDNLPPDLFPQYTTIEY  113



>ref|XP_008460075.1| PREDICTED: protein transport protein SEC23 [Cucumis melo]
Length=761

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DGVRM WN  P TK E+S C++P++A    I+  P +  +PY+PLRC+TC ++LN
Sbjct  6    DLEAQDGVRMPWNVVPGTKQEASNCIVPVSALYTPIKAFPNMPVLPYSPLRCRTCRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISDDNLPAELFPQYTTIEY  113



>ref|XP_010278787.1| PREDICTED: protein transport protein SEC23-like isoform X5 [Nelumbo 
nucifera]
Length=734

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DG+RM WN +P TK E++ CV+P++A    ++P P +  +PY+PLRC+TC +VLN
Sbjct  6    DLEAHDGIRMPWNVFPGTKQEAASCVVPVSAIYTPLKPFPNMPVLPYSPLRCRTCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VDY   IWICPFCFQRN FP  Y+++S+ N+P +L+PQ+TTI+Y
Sbjct  66   PFSTVDYMGQIWICPFCFQRNHFPPHYASISQDNLPPDLFPQYTTIEY  113



>ref|XP_004145019.1| PREDICTED: LOW QUALITY PROTEIN: protein transport protein SEC23-like 
[Cucumis sativus]
Length=769

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DGVRM WN  P TK E+S C++P++A    I+  P +  +PY+PLRC+TC ++LN
Sbjct  6    DLEAQDGVRMPWNVVPGTKQEASNCIVPVSALYTPIKAFPNMPVLPYSPLRCRTCRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISDDNLPAELFPQYTTIEY  113



>ref|XP_010278785.1| PREDICTED: protein transport protein SEC23-like isoform X3 [Nelumbo 
nucifera]
Length=746

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DG+RM WN +P TK E++ CV+P++A    ++P P +  +PY+PLRC+TC +VLN
Sbjct  6    DLEAHDGIRMPWNVFPGTKQEAASCVVPVSAIYTPLKPFPNMPVLPYSPLRCRTCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VDY   IWICPFCFQRN FP  Y+++S+ N+P +L+PQ+TTI+Y
Sbjct  66   PFSTVDYMGQIWICPFCFQRNHFPPHYASISQDNLPPDLFPQYTTIEY  113



>ref|XP_004160683.1| PREDICTED: protein transport protein SEC23-like [Cucumis sativus]
Length=761

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DGVRM WN  P TK E+S C++P++A    I+  P +  +PY+PLRC+TC ++LN
Sbjct  6    DLEAQDGVRMPWNVVPGTKQEASNCIVPVSALYTPIKAFPNMPVLPYSPLRCRTCRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISDDNLPAELFPQYTTIEY  113



>ref|XP_010278781.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Nelumbo 
nucifera]
Length=780

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DG+RM WN +P TK E++ CV+P++A    ++P P +  +PY+PLRC+TC +VLN
Sbjct  6    DLEAHDGIRMPWNVFPGTKQEAASCVVPVSAIYTPLKPFPNMPVLPYSPLRCRTCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VDY   IWICPFCFQRN FP  Y+++S+ N+P +L+PQ+TTI+Y
Sbjct  66   PFSTVDYMGQIWICPFCFQRNHFPPHYASISQDNLPPDLFPQYTTIEY  113



>ref|XP_004153079.1| PREDICTED: protein transport protein SEC23-like [Cucumis sativus]
 gb|KGN46272.1| hypothetical protein Csa_6G078680 [Cucumis sativus]
Length=761

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DGVRM WN  P TK E+S C++P++A    I+  P +  +PY+PLRC+TC ++LN
Sbjct  6    DLEAQDGVRMPWNVVPGTKQEASNCIVPVSALYTPIKAFPNMPVLPYSPLRCRTCRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISDDNLPAELFPQYTTIEY  113



>ref|XP_004964627.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Setaria 
italica]
 ref|XP_004964628.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Setaria 
italica]
 ref|XP_004964629.1| PREDICTED: protein transport protein SEC23-like isoform X3 [Setaria 
italica]
 ref|XP_004964630.1| PREDICTED: protein transport protein SEC23-like isoform X4 [Setaria 
italica]
 ref|XP_004964631.1| PREDICTED: protein transport protein SEC23-like isoform X5 [Setaria 
italica]
 ref|XP_004964632.1| PREDICTED: protein transport protein SEC23-like isoform X6 [Setaria 
italica]
Length=762

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DG+RM WN  P TK E+  CVIP++A    ++  P++  +PY+PLRC+ C +VLN
Sbjct  6    DLEAQDGIRMPWNVIPGTKQEALNCVIPVSAIYTPLKSIPDIPVLPYSPLRCRMCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VDY A IW+CPFCFQRN FP  YS +SE N+PAEL+PQ+TT++Y
Sbjct  66   PFSIVDYVAKIWVCPFCFQRNQFPQHYSLISENNLPAELFPQYTTVEY  113



>ref|XP_011024746.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Populus 
euphratica]
Length=766

 Score =   143 bits (360),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E  DGVRM WN  P TK ESS CV+P++A    I+P P +  +PY+PLRC+ C +VLN
Sbjct  6    ELEAQDGVRMPWNVLPGTKQESSNCVVPVSAIYTPIKPFPNMPVLPYSPLRCRNCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF  VD+ A +WICPFCFQRN FP  Y+A+S+ N+PAEL+ Q+TTI+Y
Sbjct  66   PFCTVDFSAKLWICPFCFQRNQFPPHYTAISDDNLPAELFSQYTTIEY  113



>ref|XP_011024747.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Populus 
euphratica]
Length=765

 Score =   143 bits (360),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E  DGVRM WN  P TK ESS CV+P++A    I+P P +  +PY+PLRC+ C +VLN
Sbjct  6    ELEAQDGVRMPWNVLPGTKQESSNCVVPVSAIYTPIKPFPNMPVLPYSPLRCRNCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF  VD+ A +WICPFCFQRN FP  Y+A+S+ N+PAEL+ Q+TTI+Y
Sbjct  66   PFCTVDFSAKLWICPFCFQRNQFPPHYTAISDDNLPAELFSQYTTIEY  113



>gb|KHG07260.1| Protein transport SEC23 [Gossypium arboreum]
Length=761

 Score =   142 bits (359),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E  DGVRMTWN  P TK E+  CV+P++A    I+P P ++ + YAPLRC+ C++VLN
Sbjct  6    ELEAQDGVRMTWNVVPGTKEEAGNCVVPVSAIYTPIKPFPNMLVLTYAPLRCRNCSSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF  +D+ A IWICPFCF R+ FP  Y++VSE N+PAEL+PQ+TTI+Y
Sbjct  66   PFCVMDFAAKIWICPFCFHRSHFPAHYASVSEENLPAELFPQYTTIEY  113



>ref|XP_002460346.1| hypothetical protein SORBIDRAFT_02g026780 [Sorghum bicolor]
 gb|EER96867.1| hypothetical protein SORBIDRAFT_02g026780 [Sorghum bicolor]
Length=762

 Score =   142 bits (359),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DG+RM WN  P TK E+  CVIP++A    ++  P++  +PY+PLRC+ C ++LN
Sbjct  6    DLEVQDGIRMPWNVIPGTKQETVNCVIPVSAIYTPLKSIPDIPVLPYSPLRCRMCRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VDY A IW+CPFCFQRN FP  YS++SE N+PAEL+PQ+TT++Y
Sbjct  66   PFSIVDYVAKIWVCPFCFQRNQFPQHYSSISENNLPAELFPQYTTVEY  113



>gb|AAX96396.1| At1g05520/T25N20_16 [Oryza sativa Japonica Group]
 gb|ABA93126.1| Sec23/Sec24 trunk domain containing protein, expressed [Oryza 
sativa Japonica Group]
 gb|EEE52049.1| hypothetical protein OsJ_33782 [Oryza sativa Japonica Group]
Length=793

 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 84/104 (81%), Gaps = 3/104 (3%)
 Frame = +2

Query  251  VRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVT--VPYAPLRCKT-CTAVLNPFAR  421
            VR+TWNAWPR+KVE+S+CV+P+AA+I  +R    L +  +PY PLRCK  C+A+LNPFAR
Sbjct  21   VRLTWNAWPRSKVEASRCVVPLAAAISPVRSPESLASPPLPYPPLRCKPPCSALLNPFAR  80

Query  422  VDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            VD+ A IWICP CF RN FP  Y+A+SE+NVPAEL+PQ +T++Y
Sbjct  81   VDFAAKIWICPLCFSRNHFPPHYAAISESNVPAELFPQCSTVEY  124



>ref|XP_004307298.1| PREDICTED: protein transport protein SEC23 [Fragaria vesca subsp. 
vesca]
Length=761

 Score =   142 bits (359),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DGVRM WN  P TK ES+  VIP++A    I+P P +  +PY+PLRC+TC AVLN
Sbjct  6    DLETQDGVRMPWNVIPGTKQESTNSVIPVSAIYTPIKPFPTMPLLPYSPLRCRTCRAVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VDY A IWICPFCF RN FP  Y+++++ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSTVDYAAKIWICPFCFTRNHFPPHYASITDDNLPAELFPQYTTIEY  113



>gb|EAY80788.1| hypothetical protein OsI_35968 [Oryza sativa Indica Group]
Length=793

 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 84/104 (81%), Gaps = 3/104 (3%)
 Frame = +2

Query  251  VRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVT--VPYAPLRCKT-CTAVLNPFAR  421
            VR+TWNAWPR+KVE+S+CV+P+AA+I  +R    L +  +PY PLRCK  C+A+LNPFAR
Sbjct  21   VRLTWNAWPRSKVEASRCVVPLAAAISPVRSPESLASPPLPYPPLRCKPPCSALLNPFAR  80

Query  422  VDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            VD+ A IWICP CF RN FP  Y+A+SE+NVPAEL+PQ +T++Y
Sbjct  81   VDFAAKIWICPLCFSRNHFPPHYAAISESNVPAELFPQCSTVEY  124



>ref|XP_006659495.1| PREDICTED: protein transport protein SEC23-like [Oryza brachyantha]
Length=763

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E  DG+RM WN  P TK +++ CV+P++A    ++P P +  +PY PLRC+ C ++LN
Sbjct  6    ELEAQDGIRMPWNVIPGTKQDAANCVVPVSAIYTPLKPNPVIPVLPYGPLRCRMCRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF  VDY A IW+CPFCFQRN FP  YS++SE+N+PAEL+PQ+TT+++
Sbjct  66   PFCVVDYVAKIWVCPFCFQRNHFPQHYSSISESNLPAELFPQYTTVEF  113



>ref|XP_003578242.1| PREDICTED: protein transport protein SEC23-like [Brachypodium 
distachyon]
Length=762

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E +DG+RM WN  P T+ +++ CV+P++A    ++  P +  VPY+PLRC+ C ++LN
Sbjct  6    DLEALDGIRMPWNVIPGTREDAASCVVPVSAIYTPLKSIPNVPVVPYSPLRCRMCRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VDY A IW+CPFCFQRN FP  YS++SE N+P EL+PQ TTI+Y
Sbjct  66   PFSMVDYDAKIWLCPFCFQRNHFPQHYSSISENNLPPELFPQHTTIEY  113



>gb|EMT27989.1| Protein transport protein sec-23 [Aegilops tauschii]
Length=932

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E +DG+RM WN  P T+ ++  CV+P++A    ++  P++  VPYAPLRC+ C ++LN
Sbjct  162  ELEALDGIRMPWNVIPGTREDAVSCVVPVSAIYTPLKSIPDMPVVPYAPLRCRMCRSILN  221

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+RVDY A IW+C FCFQRN FP  YS++SE N+P EL+PQ+TTI+Y
Sbjct  222  PFSRVDYNAKIWLCTFCFQRNQFPQHYSSISENNLPPELFPQYTTIEY  269



>ref|XP_010052697.1| PREDICTED: protein transport protein SEC23 [Eucalyptus grandis]
 gb|KCW76763.1| hypothetical protein EUGRSUZ_D01124 [Eucalyptus grandis]
Length=762

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DGVRM WN  P T+ E++ CV+P++A    +RP P +  +PY+PLRC+ C +VLN
Sbjct  6    DLEAQDGVRMPWNVVPGTRQEAAGCVVPVSAVYTPLRPFPSMPVLPYSPLRCRNCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VD+ A IWICP CFQRN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDFAAKIWICPLCFQRNHFPPHYASISDDNLPAELFPQYTTIEY  113



>gb|EEE67142.1| hypothetical protein OsJ_24197 [Oryza sativa Japonica Group]
Length=768

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DG+RM WN  P T+ ++  CV+PI+A    ++  P++  +PY+PLRC+ C ++LN
Sbjct  6    DLEAQDGIRMPWNVIPGTREDALSCVVPISAIYTPLKQVPDIPVLPYSPLRCRMCRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VDY A IW+CPFCFQRN FP  YS++SE+N+PAEL+PQ+TT++Y
Sbjct  66   PFSIVDYVAKIWVCPFCFQRNHFPQHYSSISESNLPAELFPQYTTVEY  113



>ref|XP_009376310.1| PREDICTED: protein transport protein SEC23-like [Pyrus x bretschneideri]
Length=761

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DGVRM WN  P TK ES+  V+P++A    I+P P +  +PYA LRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQESTNSVVPVSAIYTPIKPFPSMPVLPYAALRCRTCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VDY A IWICPFCF RN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSTVDYAAKIWICPFCFTRNHFPPHYASISDENLPAELFPQYTTIEY  113



>ref|XP_011010741.1| PREDICTED: protein transport protein SEC23-like [Populus euphratica]
Length=765

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E  DGVRM WN  P TK ESS CV+P++A    I+P P +  +PY+PLRC++C ++LN
Sbjct  6    ELEAQDGVRMPWNVLPGTKQESSNCVVPVSAIYTPIKPFPNMPVLPYSPLRCRSCRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF  VD+ A IWICPFCFQRN FP  Y+++S+ N+PAEL+ Q+TTI++
Sbjct  66   PFCTVDFSAKIWICPFCFQRNQFPPHYASISDDNLPAELFSQYTTIEF  113



>emb|CBI38071.3| unnamed protein product [Vitis vinifera]
Length=800

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E  DGVRM WN  P TK ES++ +IP+AA    ++P P +  +PY PLRC+TC +VLN
Sbjct  6    ELEAQDGVRMPWNVIPGTKQESAQSIIPVAAIYTPLKPFPSMPVLPYTPLRCRTCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PFA VD+ A +WICPFCFQRN FP  YS++S+ N+PAEL+P +TT++Y
Sbjct  66   PFAIVDFSAKLWICPFCFQRNHFPAHYSSISDLNLPAELFPNYTTLEY  113



>ref|XP_002265101.1| PREDICTED: protein transport protein SEC23 [Vitis vinifera]
Length=761

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E  DGVRM WN  P TK ES++ +IP+AA    ++P P +  +PY PLRC+TC +VLN
Sbjct  6    ELEAQDGVRMPWNVIPGTKQESAQSIIPVAAIYTPLKPFPSMPVLPYTPLRCRTCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PFA VD+ A +WICPFCFQRN FP  YS++S+ N+PAEL+P +TT++Y
Sbjct  66   PFAIVDFSAKLWICPFCFQRNHFPAHYSSISDLNLPAELFPNYTTLEY  113



>ref|XP_008344985.1| PREDICTED: protein transport protein SEC23 [Malus domestica]
Length=761

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DGVRM WN  P TK ES+  V+P++A    I+P P +  +PYA LRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQESTNSVVPVSAIYTPIKPFPSMPVLPYAALRCRTCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VDY A IWICPFCF RN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSTVDYAAKIWICPFCFTRNHFPPHYASISDENLPAELFPQYTTIEY  113



>ref|XP_001702936.1| COP-II coat subunit [Chlamydomonas reinhardtii]
 gb|EDO96789.1| COP-II coat subunit [Chlamydomonas reinhardtii]
Length=762

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +2

Query  236  EGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLNPF  415
            E IDGVR+TWN WP +K+E++KCVIP A+     +  P +  +PY P+ CK C A+LNP+
Sbjct  7    EDIDGVRLTWNIWPNSKLEATKCVIPFASIYTPNKRLPTMPVLPYEPIPCKQCNAILNPY  66

Query  416  ARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            ARVD+ + +WICPFC  RN FP  Y  +S+TN+PAELYP + TI+YTL
Sbjct  67   ARVDFYSKVWICPFCHSRNHFPAHYQGISDTNMPAELYPNYCTIEYTL  114



>ref|XP_002320574.1| transport family protein [Populus trichocarpa]
 gb|EEE98889.1| transport family protein [Populus trichocarpa]
Length=773

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E  DGVRM WN  P TK ESS CV+P++A    I+P P +  +PY+PLRC+ C ++LN
Sbjct  6    ELEAQDGVRMPWNVLPGTKQESSNCVVPVSAIYTPIKPFPNMPVLPYSPLRCRACRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF  VD+ A IWICPFCFQRN FP  Y+++S+ N+PAEL+ Q+TTI++
Sbjct  66   PFCTVDFSAKIWICPFCFQRNQFPPHYASISDDNLPAELFSQYTTIEF  113



>ref|XP_006375610.1| hypothetical protein POPTR_0014s17660g [Populus trichocarpa]
 gb|ERP53407.1| hypothetical protein POPTR_0014s17660g [Populus trichocarpa]
Length=765

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E  DGVRM WN  P TK ESS CV+P++A    I+P P +  +PY+PLRC+ C ++LN
Sbjct  6    ELEAQDGVRMPWNVLPGTKQESSNCVVPVSAIYTPIKPFPNMPVLPYSPLRCRACRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF  VD+ A IWICPFCFQRN FP  Y+++S+ N+PAEL+ Q+TTI++
Sbjct  66   PFCTVDFSAKIWICPFCFQRNQFPPHYASISDDNLPAELFSQYTTIEF  113



>gb|KDO85352.1| hypothetical protein CISIN_1g004199mg [Citrus sinensis]
Length=470

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 82/112 (73%), Gaps = 4/112 (4%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQP----ELVTVPYAPLRCKTCT  397
            D E  DGVRM WN  P TK E+S CV+P++A    I+  P     +  +PYAPLRC+TC 
Sbjct  6    DLEAQDGVRMPWNVIPGTKQEASNCVVPVSAIYTPIKAFPVNNNSMPILPYAPLRCRTCR  65

Query  398  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            ++LNPF+ VD+ A IWICPFCFQRN FP  Y+++++ N+PAEL+PQ+TTI+Y
Sbjct  66   SILNPFSIVDFAAKIWICPFCFQRNHFPPHYASITDDNLPAELFPQYTTIEY  117



>gb|EEC82002.1| hypothetical protein OsI_25948 [Oryza sativa Indica Group]
Length=768

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DG+RM WN  P T+ ++  CV+PI+A    ++  P++  +PY+PLRC+ C ++LN
Sbjct  6    DLEAQDGIRMPWNVIPGTREDALSCVVPISAIYTPLKQVPDIPVLPYSPLRCRMCRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VDY A IW+CPFCFQRN FP  YS++SE+N+PAEL+PQ+TT++Y
Sbjct  66   PFSIVDYVAKIWVCPFCFQRNHFPQLYSSISESNLPAELFPQYTTVEY  113



>ref|XP_003626854.1| Protein transport protein SEC23 [Medicago truncatula]
 gb|AET01330.1| protein transporter Sec23-like protein [Medicago truncatula]
Length=763

 Score =   140 bits (352),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DGVRM WN  P TK ES   V+P+AA    I+  P +  +PY+PLRC+TC ++LN
Sbjct  7    DLETQDGVRMPWNVIPGTKQESVNVVVPVAAIYTPIKHFPTMPILPYSPLRCRTCRSILN  66

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF  VD+ A IWICPFCFQRN FP+ Y+++SE N+PAEL+PQ+TT++Y
Sbjct  67   PFCIVDFAAKIWICPFCFQRNHFPNHYASISEDNMPAELFPQYTTVEY  114



>gb|KDO85351.1| hypothetical protein CISIN_1g004199mg [Citrus sinensis]
Length=561

 Score =   138 bits (347),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 82/112 (73%), Gaps = 4/112 (4%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQP----ELVTVPYAPLRCKTCT  397
            D E  DGVRM WN  P TK E+S CV+P++A    I+  P     +  +PYAPLRC+TC 
Sbjct  6    DLEAQDGVRMPWNVIPGTKQEASNCVVPVSAIYTPIKAFPVNNNSMPILPYAPLRCRTCR  65

Query  398  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            ++LNPF+ VD+ A IWICPFCFQRN FP  Y+++++ N+PAEL+PQ+TTI+Y
Sbjct  66   SILNPFSIVDFAAKIWICPFCFQRNHFPPHYASITDDNLPAELFPQYTTIEY  117



>dbj|BAJ93511.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=614

 Score =   138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E  DGVRMTWN  P TK +++ CV+P++A    + P P +  +PYAPLRC+ C A+LN
Sbjct  6    ELEARDGVRMTWNVIPGTKQDAASCVVPVSAMYTPLNPNPAIPVLPYAPLRCRICRAILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+  D+ + +W+CPFCFQRN FP QYS VS++N+P ELYP+  T++Y
Sbjct  66   PFSVADFNSKMWLCPFCFQRNHFPQQYSTVSQSNLPTELYPECCTVEY  113



>tpg|DAA40251.1| TPA: hypothetical protein ZEAMMB73_365624 [Zea mays]
Length=724

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DG+RM WN  P TK E+  CVIP++A    ++P  ++  +PY+PLRC+ C ++LN
Sbjct  6    DLELQDGIRMPWNVIPGTKQETVNCVIPVSAIYTPLKPISDIPVLPYSPLRCRMCRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VDY A IW+C FCFQRN FP  YS++SE N+PAEL+PQ+TT++Y
Sbjct  66   PFSIVDYVAKIWVCSFCFQRNQFPQHYSSISENNLPAELFPQYTTVEY  113



>ref|XP_002946892.1| hypothetical protein VOLCADRAFT_103128 [Volvox carteri f. nagariensis]
 gb|EFJ52118.1| hypothetical protein VOLCADRAFT_103128 [Volvox carteri f. nagariensis]
Length=764

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +2

Query  236  EGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLNPF  415
            E IDGVR+TWN WP +K+E++KCVIP A+     +  P +  +PY P+ CK C+A+LNP+
Sbjct  7    EDIDGVRLTWNIWPNSKLEATKCVIPFASVYTPNKRLPTMPVLPYEPIPCKQCSAILNPY  66

Query  416  ARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            ARVD+ + +WICPFC  RN FP  Y  +S+T++PAELYP + TI+YTL
Sbjct  67   ARVDFYSKVWICPFCHSRNHFPAHYQGISDTSMPAELYPNYCTIEYTL  114



>ref|XP_002461253.1| hypothetical protein SORBIDRAFT_02g043632 [Sorghum bicolor]
 gb|EER97774.1| hypothetical protein SORBIDRAFT_02g043632 [Sorghum bicolor]
Length=219

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DG+RMTWN  P TK +++ CV+P++     ++P   +  +PYAPL C+ C ++LN
Sbjct  6    DLETQDGIRMTWNVIPGTKQDATNCVVPVSVIYTPLKPNLSIPVLPYAPLSCRMCRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VD+ A IW+C FCFQRN FP  Y+++ E N+PAEL+PQ+TT++Y
Sbjct  66   PFSVVDFVAKIWVCSFCFQRNHFPQHYNSILENNLPAELFPQYTTVEY  113



>ref|XP_008668489.1| PREDICTED: uncharacterized protein LOC100384491 isoform X1 [Zea 
mays]
Length=895

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 93/135 (69%), Gaps = 6/135 (4%)
 Frame = +2

Query  161  FVCI----YLYYIARSSLMASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASI  328
            F+C+     L  + +++++  SE    D E  DG+RM WN  P TK E+  CVIP++A  
Sbjct  114  FLCLTCGSLLQLLYKAAVLKMSEF--LDLELQDGIRMPWNVIPGTKQETVNCVIPVSAIY  171

Query  329  HLIRPQPELVTVPYAPLRCKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSET  508
              ++P  ++  +PY+PLRC+ C ++LNPF+ VDY A IW+C FCFQRN FP  YS++SE 
Sbjct  172  TPLKPISDIPVLPYSPLRCRMCRSILNPFSIVDYVAKIWVCSFCFQRNQFPQHYSSISEN  231

Query  509  NVPAELYPQFTTIQY  553
            N+PAEL+PQ+TT++Y
Sbjct  232  NLPAELFPQYTTVEY  246



>ref|XP_006445524.1| hypothetical protein CICLE_v10019144mg [Citrus clementina]
 gb|ESR58764.1| hypothetical protein CICLE_v10019144mg [Citrus clementina]
Length=683

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 82/112 (73%), Gaps = 4/112 (4%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQP----ELVTVPYAPLRCKTCT  397
            D E  DGVRM WN  P TK E+S CV+P++A    I+  P     +  +PYAPLRC+TC 
Sbjct  6    DLEAQDGVRMPWNVIPGTKQEASNCVVPVSAIYTPIKAFPVNNNSMPILPYAPLRCRTCR  65

Query  398  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            ++LNPF+ VD+ A IWICPFCFQRN FP  Y+++++ N+PAEL+PQ+TTI+Y
Sbjct  66   SILNPFSIVDFAAKIWICPFCFQRNHFPPHYASITDDNLPAELFPQYTTIEY  117



>gb|KDO85350.1| hypothetical protein CISIN_1g004199mg [Citrus sinensis]
Length=701

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 82/112 (73%), Gaps = 4/112 (4%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQP----ELVTVPYAPLRCKTCT  397
            D E  DGVRM WN  P TK E+S CV+P++A    I+  P     +  +PYAPLRC+TC 
Sbjct  6    DLEAQDGVRMPWNVIPGTKQEASNCVVPVSAIYTPIKAFPVNNNSMPILPYAPLRCRTCR  65

Query  398  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            ++LNPF+ VD+ A IWICPFCFQRN FP  Y+++++ N+PAEL+PQ+TTI+Y
Sbjct  66   SILNPFSIVDFAAKIWICPFCFQRNHFPPHYASITDDNLPAELFPQYTTIEY  117



>ref|XP_005843379.1| hypothetical protein CHLNCDRAFT_141205 [Chlorella variabilis]
 gb|EFN51277.1| hypothetical protein CHLNCDRAFT_141205 [Chlorella variabilis]
Length=466

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 82/120 (68%), Gaps = 2/120 (2%)
 Frame = +2

Query  200  LMASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPL  379
            +M  +E ++   E IDGVRMTWN WP +++E++KCVIP        R   +L  V Y P+
Sbjct  1    MMLQAEFAEL--EEIDGVRMTWNVWPHSRLEAAKCVIPFCTLYSPARQTSQLQVVEYDPV  58

Query  380  RCKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
             CKTC +VLNP+A VD+ A IW CPFC  RN FP  Y+ +SE +VPAEL+PQ+ TI+Y+L
Sbjct  59   TCKTCGSVLNPYASVDFAAKIWTCPFCHTRNHFPPHYAGISEASVPAELFPQYCTIEYSL  118



>gb|EMS46122.1| Protein transport protein SEC23 [Triticum urartu]
Length=720

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E  DGVRMTWN  P TK +++ CV+P++A    + P P +  +PYAPLRC+ C ++LN
Sbjct  6    ELEARDGVRMTWNVIPGTKQDAASCVVPVSAMYTPLNPNPAIPVLPYAPLRCRICRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+  D+ + +W+CPFCFQRN FP QYSAVS++N+P ELYP+  T++Y
Sbjct  66   PFSVADFGSKMWLCPFCFQRNHFPQQYSAVSQSNLPTELYPECCTVEY  113



>ref|XP_006464334.1| PREDICTED: protein transport protein SEC23-like [Citrus sinensis]
 gb|KDO85348.1| hypothetical protein CISIN_1g004199mg [Citrus sinensis]
Length=769

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 82/112 (73%), Gaps = 4/112 (4%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQP----ELVTVPYAPLRCKTCT  397
            D E  DGVRM WN  P TK E+S CV+P++A    I+  P     +  +PYAPLRC+TC 
Sbjct  6    DLEAQDGVRMPWNVIPGTKQEASNCVVPVSAIYTPIKAFPVNNNSMPILPYAPLRCRTCR  65

Query  398  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            ++LNPF+ VD+ A IWICPFCFQRN FP  Y+++++ N+PAEL+PQ+TTI+Y
Sbjct  66   SILNPFSIVDFAAKIWICPFCFQRNHFPPHYASITDDNLPAELFPQYTTIEY  117



>gb|KDO85349.1| hypothetical protein CISIN_1g004199mg [Citrus sinensis]
Length=762

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 82/112 (73%), Gaps = 4/112 (4%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQP----ELVTVPYAPLRCKTCT  397
            D E  DGVRM WN  P TK E+S CV+P++A    I+  P     +  +PYAPLRC+TC 
Sbjct  6    DLEAQDGVRMPWNVIPGTKQEASNCVVPVSAIYTPIKAFPVNNNSMPILPYAPLRCRTCR  65

Query  398  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            ++LNPF+ VD+ A IWICPFCFQRN FP  Y+++++ N+PAEL+PQ+TTI+Y
Sbjct  66   SILNPFSIVDFAAKIWICPFCFQRNHFPPHYASITDDNLPAELFPQYTTIEY  117



>gb|EMT03462.1| Protein transport protein SEC23 [Aegilops tauschii]
Length=829

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E  DGVRMTWN  P TK +++ CV+P++A    + P P +  +PYAPLRC+ C ++LN
Sbjct  6    ELEARDGVRMTWNVIPGTKQDAASCVVPVSAIYTPLNPNPAIPVLPYAPLRCRICRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+  D+ + +W+CPFCFQRN FP QYSAVS++N+P ELYP+  T++Y
Sbjct  66   PFSVADFGSKMWLCPFCFQRNHFPQQYSAVSQSNLPTELYPECCTVEY  113



>dbj|BAJ85358.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=782

 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 80/104 (77%), Gaps = 3/104 (3%)
 Frame = +2

Query  251  VRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVT--VPYAPLRCKT-CTAVLNPFAR  421
            VR TWNAWPR+KVE+S+CV+P+AA+I  +R    L +  +PY PLRCK  C+A+LNPFAR
Sbjct  20   VRFTWNAWPRSKVEASRCVVPLAAAISPVRSPESLASPPLPYPPLRCKPPCSALLNPFAR  79

Query  422  VDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            VD+ A IWICP CF RN FP  Y+ +SE NVPAEL+ Q +T++Y
Sbjct  80   VDFAAKIWICPLCFSRNHFPPHYAGISENNVPAELFTQCSTVEY  123



>dbj|BAK01218.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=782

 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 80/104 (77%), Gaps = 3/104 (3%)
 Frame = +2

Query  251  VRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVT--VPYAPLRCKT-CTAVLNPFAR  421
            VR TWNAWPR+KVE+S+CV+P+AA+I  +R    L +  +PY PLRCK  C+A+LNPFAR
Sbjct  20   VRFTWNAWPRSKVEASRCVVPLAAAISPVRSPESLASPPLPYPPLRCKPPCSALLNPFAR  79

Query  422  VDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            VD+ A IWICP CF RN FP  Y+ +SE NVPAEL+ Q +T++Y
Sbjct  80   VDFAAKIWICPLCFSRNHFPPHYAGISENNVPAELFTQCSTVEY  123



>ref|XP_010691934.1| PREDICTED: protein transport protein SEC23 [Beta vulgaris subsp. 
vulgaris]
Length=769

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DGVRM WN  P TK ESS  VIP++     I+  P L  +PY+PLRC++C ++LN
Sbjct  6    DLETQDGVRMPWNVIPGTKQESSNSVIPVSLLYTPIKSFPNLPILPYSPLRCRSCRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ +D+   +WICPFCF RN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSVIDFAGKVWICPFCFNRNHFPQHYASISDDNLPAELFPQYTTIEY  113



>ref|XP_004510207.1| PREDICTED: protein transport protein SEC23-like [Cicer arietinum]
Length=762

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DGVRM WN  P TK ES   V+P+AA    I+  P +  +PY+PLRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQESLNVVVPVAAIYTPIKHFPSMPLLPYSPLRCRTCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF  VD+ A IWICP CFQRN FP  Y+++S+ N+PAEL+PQ+TT++Y
Sbjct  66   PFCIVDFAAKIWICPICFQRNHFPPHYASISDENLPAELFPQYTTVEY  113



>ref|XP_006854134.1| hypothetical protein AMTR_s00048p00165750 [Amborella trichopoda]
 gb|ERN15601.1| hypothetical protein AMTR_s00048p00165750 [Amborella trichopoda]
Length=762

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E  DG+RM WN WP TK E+S CVIP +A    + P P L  +PY PLRC+TC ++LN
Sbjct  6    ELEAQDGIRMPWNVWPGTKPEASACVIPTSAIYTPLNPNPNLPLLPYQPLRCRTCRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PFA VD+QA IW CPFC+QRN FP  Y+++++TN+PAEL+PQ+TT++Y
Sbjct  66   PFAIVDFQAKIWACPFCYQRNHFPPHYASITDTNLPAELFPQYTTVEY  113



>ref|XP_010235206.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Brachypodium 
distachyon]
Length=722

 Score =   134 bits (337),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E  DG+RMTWN  P TK +++ CV+P++A    + P P +  +PYAPLRC+ C ++LN
Sbjct  6    ELEAQDGIRMTWNVIPGTKQDAASCVVPVSALYTPLYPNPAIPVLPYAPLRCRICRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
             F+ VD+ + IW CPFCFQRN FP  YS VS +N+P ELYPQ TT++Y
Sbjct  66   SFSVVDFDSKIWQCPFCFQRNHFPQHYSTVSASNLPTELYPQCTTVEY  113



>ref|XP_003574621.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Brachypodium 
distachyon]
Length=763

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E  DG+RMTWN  P TK +++ CV+P++A    + P P +  +PYAPLRC+ C ++LN
Sbjct  6    ELEAQDGIRMTWNVIPGTKQDAASCVVPVSALYTPLYPNPAIPVLPYAPLRCRICRSILN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
             F+ VD+ + IW CPFCFQRN FP  YS VS +N+P ELYPQ TT++Y
Sbjct  66   SFSVVDFDSKIWQCPFCFQRNHFPQHYSTVSASNLPTELYPQCTTVEY  113



>ref|XP_002966180.1| hypothetical protein SELMODRAFT_168140 [Selaginella moellendorffii]
 gb|EFJ32207.1| hypothetical protein SELMODRAFT_168140 [Selaginella moellendorffii]
Length=756

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 79/110 (72%), Gaps = 3/110 (3%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRP--QPELVTVPYAPLRCKTCTAV  403
            + E  DG+RM+WN WP ++VE ++CV+P AA I  ++P  QPE V + Y PLRC+TC A+
Sbjct  6    EIEAADGIRMSWNVWPSSRVEMARCVVPPAAVISPLQPLAQPEAV-LQYPPLRCRTCRAI  64

Query  404  LNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            LNPF  VD+   IW+CPF F RN FP  YS +SE+ +P ELY QFTTI+Y
Sbjct  65   LNPFCSVDFAGKIWVCPFDFSRNQFPPHYSELSESYLPGELYQQFTTIEY  114



>ref|XP_002982254.1| hypothetical protein SELMODRAFT_155031 [Selaginella moellendorffii]
 gb|EFJ16499.1| hypothetical protein SELMODRAFT_155031 [Selaginella moellendorffii]
Length=756

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 79/110 (72%), Gaps = 3/110 (3%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRP--QPELVTVPYAPLRCKTCTAV  403
            + E  DG+RM+WN WP ++VE ++CV+P AA I  ++P  QPE V + Y PLRC+TC A+
Sbjct  6    EIEAADGIRMSWNVWPSSRVEMARCVVPPAAVISPLQPLAQPEAV-LQYPPLRCRTCRAI  64

Query  404  LNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            LNPF  VD+   IW+CPF F RN FP  YS +SE+ +P ELY QFTTI+Y
Sbjct  65   LNPFCSVDFAGKIWVCPFDFSRNQFPPHYSELSESYLPGELYQQFTTIEY  114



>emb|CCO26910.1| Protein transport protein SEC23 [Rhizoctonia solani AG-1 IB]
Length=151

 Score =   124 bits (312),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 80/111 (72%), Gaps = 1/111 (1%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVL  406
            D E  DGVR++WN WP +++E+++ V+PIAA    ++ + +L  V Y P+ CK  C A+L
Sbjct  5    DVEERDGVRLSWNVWPSSRIEATRTVVPIAALYTPLKQREDLPPVLYEPVTCKPPCRAIL  64

Query  407  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            NP+ ++D +  +WICPFC QRN+FP  Y  +S TN+PAEL P++TTI+YTL
Sbjct  65   NPYCQIDVRGKLWICPFCLQRNAFPPHYKDISNTNLPAELLPKYTTIEYTL  115



>ref|XP_002102257.1| GD19805 [Drosophila simulans]
 gb|EDX11760.1| GD19805 [Drosophila simulans]
Length=156

 Score =   124 bits (312),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 82/121 (68%), Gaps = 2/121 (2%)
 Frame = +2

Query  203  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  382
            M + E      E  DGVR+TWN WP +++E+S+ V+P+A     ++ +P+L  + Y P+ 
Sbjct  1    MTTYEEFIQQNEDRDGVRLTWNVWPSSRIEASRLVVPLACLYQPLKERPDLPPIQYEPVL  60

Query  383  C--KTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYT  556
            C    C A+LNP  +VDY+A +W+C FCFQRN FP QY+A+SE + PAEL P F+TI+YT
Sbjct  61   CTRSNCRAILNPLCQVDYRAKLWVCNFCFQRNPFPPQYAAISEQHQPAELIPGFSTIEYT  120

Query  557  L  559
            +
Sbjct  121  I  121



>ref|XP_003521007.1| PREDICTED: protein transport protein SEC23-like [Glycine max]
Length=767

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DGVRM WN  P TK ++   V+PI+A    I+  P +  + Y+PLRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQDAQNAVVPISAVYTPIKHFPSMPVLNYSPLRCRTCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYT  556
            PF  VD+ A IWICPFCFQRN FP  YS++S+ ++PAEL+PQ+TT++Y 
Sbjct  66   PFCIVDFAAKIWICPFCFQRNHFPPHYSSISDDSLPAELFPQYTTVEYN  114



>ref|XP_009629158.1| PREDICTED: protein transport protein SEC23 [Nicotiana tomentosiformis]
Length=764

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 80/109 (73%), Gaps = 1/109 (1%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E  D VRM WN  P +K E+++CVIP++A    ++P P   T+PYAPLRC+ C +VLN
Sbjct  6    ELETQDAVRMPWNVLPGSKSEAAQCVIPVSAIYTPLKPFPNTPTLPYAPLRCRNCRSVLN  65

Query  410  PFARVDYQAL-IWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VD+ +  IWIC FC QRN FP  Y ++SETN+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDFSSTKIWICCFCLQRNHFPQNYQSISETNMPAELFPQYTTIEY  114



>gb|KDP40275.1| hypothetical protein JCGZ_02273 [Jatropha curcas]
Length=787

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E I+G+R +WNAWP TK E +  VIP+      +    EL  +PY PL C  C AVLN
Sbjct  5    ELEAIEGLRWSWNAWPTTKNEVTSLVIPLGIMCTPLMQSLELPILPYEPLTCTRCGAVLN  64

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            P+ARVDYQ+ IW CPFC+Q+N+FP  YS + ETN+PAEL+P ++T++Y L
Sbjct  65   PYARVDYQSRIWSCPFCYQKNTFPISYSGIGETNLPAELFPTYSTVEYKL  114



>ref|XP_009800228.1| PREDICTED: protein transport protein SEC23 [Nicotiana sylvestris]
Length=764

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 80/109 (73%), Gaps = 1/109 (1%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E  D VRM WN  P +K E+++CVIP++A    ++P P   T+PYAPLRC+ C +VLN
Sbjct  6    ELETQDAVRMPWNVLPGSKSEAAQCVIPVSAIYTPLKPFPNTPTLPYAPLRCRNCRSVLN  65

Query  410  PFARVDYQAL-IWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VD+ +  IWIC FC QRN FP  Y ++SETN+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDFSSTKIWICCFCLQRNHFPQNYQSISETNMPAELFPQYTTIEY  114



>ref|XP_002986965.1| hypothetical protein SELMODRAFT_124893 [Selaginella moellendorffii]
 gb|EFJ12047.1| hypothetical protein SELMODRAFT_124893 [Selaginella moellendorffii]
Length=763

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 79/111 (71%), Gaps = 1/111 (1%)
 Frame = +2

Query  227  TDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVL  406
             + E  +G+R  WNAWP +++++++ V+P     +++ P P+L  +PY P+RCK C AVL
Sbjct  4    NEIEATEGLRWVWNAWPTSRIDAARMVVPFGIMANVLMPLPDLPVLPYQPVRCK-CQAVL  62

Query  407  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            NP+  VDY A IW CPFC QRN FP  Y+ VSE+N+PAELYP ++T++Y +
Sbjct  63   NPYCNVDYTARIWGCPFCLQRNYFPGNYAGVSESNLPAELYPTYSTVEYVI  113



>ref|XP_002977937.1| hypothetical protein SELMODRAFT_107900 [Selaginella moellendorffii]
 gb|EFJ21275.1| hypothetical protein SELMODRAFT_107900 [Selaginella moellendorffii]
Length=763

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 79/111 (71%), Gaps = 1/111 (1%)
 Frame = +2

Query  227  TDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVL  406
             + E  +G+R  WNAWP +++++++ V+P     +++ P P+L  +PY P+RCK C AVL
Sbjct  4    NEIEATEGLRWVWNAWPTSRIDAARMVVPFGIMANVLMPLPDLPVLPYQPVRCK-CQAVL  62

Query  407  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            NP+  VDY A IW CPFC QRN FP  Y+ VSE+N+PAELYP ++T++Y +
Sbjct  63   NPYCNVDYTARIWGCPFCLQRNYFPGNYAGVSESNLPAELYPTYSTVEYVI  113



>ref|XP_001774442.1| predicted protein [Physcomitrella patens]
 gb|EDQ60805.1| predicted protein [Physcomitrella patens]
Length=779

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 77/117 (66%), Gaps = 7/117 (6%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQ-------PELVTVPYAPLRCK  388
            + E   GVRM WNAWP T++E++KC +P AA +  +          P +  +PY PLRCK
Sbjct  7    EVEAATGVRMPWNAWPNTQIEAAKCAVPFAAVVTPLHHGGGADSTAPPVNVLPYPPLRCK  66

Query  389  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            TC AVLNPF RVD+ A IWICPFC+QR  FP  Y+++S  N P ELYPQ  +++Y +
Sbjct  67   TCRAVLNPFCRVDFDAKIWICPFCYQRCHFPSHYASISLNNQPGELYPQCASVEYKM  123



>ref|XP_004229519.1| PREDICTED: protein transport protein SEC23 [Solanum lycopersicum]
Length=764

 Score =   131 bits (330),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 81/109 (74%), Gaps = 1/109 (1%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E  D VRM WN  P +K E+++CVIP++A    ++P P+  T+PYAPLRC+ C +VLN
Sbjct  6    ELETQDAVRMPWNVLPGSKSEAAQCVIPVSAIYTPLKPFPDTPTLPYAPLRCRNCRSVLN  65

Query  410  PFARVDYQAL-IWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VD+ +  IWIC FC QRN FP  Y ++SETN+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDFSSTKIWICCFCLQRNHFPPSYQSISETNMPAELFPQYTTIEY  114



>dbj|BAM19569.1| protein transport protein sec23, partial [Papilio xuthus]
Length=190

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 81/121 (67%), Gaps = 2/121 (2%)
 Frame = +2

Query  203  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  382
            MA+ E      E  DG+R TWN WP + +E++  V+P+A     ++ +P+L  + Y P+ 
Sbjct  1    MATYEEFIQQNEDRDGIRFTWNVWPSSXIETTXLVVPLACLYQPLKERPDLPPIQYEPVL  60

Query  383  C--KTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYT  556
            C   TC A+LNP  +VDY+A +W+C FCFQRN FP QY+A+SE + PAEL P F+TI+YT
Sbjct  61   CTRNTCRAILNPMCQVDYRAKLWVCNFCFQRNPFPPQYAAISEQHQPAELIPNFSTIEYT  120

Query  557  L  559
            +
Sbjct  121  I  121



>gb|KIJ06392.1| hypothetical protein PAXINDRAFT_103385, partial [Paxillus involutus 
ATCC 200175]
Length=137

 Score =   122 bits (305),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 79/111 (71%), Gaps = 1/111 (1%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVL  406
            D E  DGVR++WN WP +++E+++ V+PI+A    +R + +L  V Y P+ CK  C A+L
Sbjct  6    DVEERDGVRLSWNVWPSSRIEATRTVVPISALYTPLRQREDLPPVLYEPVTCKPPCRAIL  65

Query  407  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            NP+ ++D +  +WICPFC  RN+FP  Y  +S TN+PAEL P++TTI+YTL
Sbjct  66   NPYCQIDIRGKLWICPFCLSRNAFPPHYKDISNTNLPAELLPKYTTIEYTL  116



>ref|XP_006354587.1| PREDICTED: protein transport protein SEC23-like [Solanum tuberosum]
Length=764

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 80/109 (73%), Gaps = 1/109 (1%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E  D VRM WN  P +K E+++CVIP++A    ++P P   T+PYAPLRC+ C +VLN
Sbjct  6    ELETQDAVRMPWNVLPGSKSEAAQCVIPVSAIYTPLKPFPNTPTLPYAPLRCRNCRSVLN  65

Query  410  PFARVDYQAL-IWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            PF+ VD+ +  IWIC FC QRN FP  Y ++SETN+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDFSSTKIWICCFCLQRNHFPPSYQSISETNMPAELFPQYTTIEY  114



>ref|XP_780042.1| PREDICTED: protein transport protein Sec23A isoform 1 [Strongylocentrotus 
purpuratus]
Length=764

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 86/121 (71%), Gaps = 3/121 (2%)
 Frame = +2

Query  203  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  382
            MA+ E  + + E  DGVR +WN WP +++E+++ V+P++A    ++ +P+L  + Y P+ 
Sbjct  1    MANYEFIRQNEE-RDGVRFSWNVWPSSRLEATRMVVPLSALYTPLKERPDLPPIQYDPVL  59

Query  383  CK--TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYT  556
            C   TC AVLNPF +VDY+A +W C FCFQRN FP+QY  +SE + PAEL PQFTTI+YT
Sbjct  60   CSRSTCRAVLNPFCQVDYRAKLWNCNFCFQRNQFPNQYRGISEQHQPAELIPQFTTIEYT  119

Query  557  L  559
            L
Sbjct  120  L  120



>emb|CCA74741.1| probable SEC23-component of COPII coat of ER-golgi vesicles [Piriformospora 
indica DSM 11827]
Length=766

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 82/111 (74%), Gaps = 1/111 (1%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVL  406
            D E  DG+R++WNAWP +++E+++ V+PIAA    ++ + +L  V Y P+ CK  C AVL
Sbjct  5    DVEERDGLRLSWNAWPSSRIEATRTVVPIAALYTPLKQREDLPPVLYEPVTCKPPCRAVL  64

Query  407  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            NP+ ++D +A +WICPFC  RNSFP  Y  +S+ N+PAELYP++TTI+YTL
Sbjct  65   NPYCQIDVRAKLWICPFCLTRNSFPAHYKDISQANLPAELYPKYTTIEYTL  115



>ref|XP_007660591.1| PREDICTED: protein transport protein Sec23A-like, partial [Ornithorhynchus 
anatinus]
Length=126

 Score =   120 bits (302),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 77/112 (69%), Gaps = 2/112 (2%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK--TCTAV  403
              E  DGVR +WN WP +++E+++ V+P+A  +  ++ +P+L  V Y P+ C   TC AV
Sbjct  14   QNEERDGVRFSWNVWPSSRLEATRLVVPLACLLTPLKERPDLPPVQYEPVLCSRPTCKAV  73

Query  404  LNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            LNP  +VDY+A +W C FCFQRN FP  Y+ +SE N PAEL PQF+TI+Y +
Sbjct  74   LNPLCQVDYRAKLWACNFCFQRNQFPPAYAGISEVNQPAELMPQFSTIEYIV  125



>ref|XP_010495646.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=489

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 75/108 (69%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E I+G+R +WN+WP TK +    V+P++     +    EL T+PY PL C  C AVLN
Sbjct  5    ELEAIEGLRWSWNSWPTTKSDCESLVVPLSIMYTPLMHFSELPTIPYDPLICSRCGAVLN  64

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            P+ARVDYQ+ IW CPFCF +N FP  YS ++ETN+PAEL+P ++ ++Y
Sbjct  65   PYARVDYQSRIWSCPFCFHKNHFPRSYSGITETNLPAELFPTYSAVEY  112



>ref|XP_008042194.1| copii coat protein [Trametes versicolor FP-101664 SS1]
 gb|EIW54810.1| copii coat protein [Trametes versicolor FP-101664 SS1]
Length=763

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 81/111 (73%), Gaps = 1/111 (1%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVL  406
            D E  DGVR++WN WP +++E+++ V+PI+A    ++P+ +L  + Y P+ CK  C AVL
Sbjct  5    DVEERDGVRLSWNVWPSSRIEATRTVVPISALYAPLKPREDLPEILYEPVTCKPPCRAVL  64

Query  407  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            NP+ ++D +  +WICPFC QRN+FP  Y  +S TN+P+EL P+FTTI+YTL
Sbjct  65   NPYCQIDIRGKLWICPFCLQRNAFPPHYKDISNTNLPSELLPKFTTIEYTL  115



>gb|KIM24219.1| hypothetical protein M408DRAFT_331867 [Serendipita vermifera 
MAFF 305830]
Length=771

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 81/111 (73%), Gaps = 1/111 (1%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVL  406
            D E  DG+R++WNAWP T++E+++ V+PI+A    ++ + +L  V Y P+ CK  C AVL
Sbjct  5    DVEERDGLRLSWNAWPATRIEATRTVVPISALYSPLKQREDLPPVLYDPVTCKPPCRAVL  64

Query  407  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            NP+ ++D +  +WICPFC  RNSFP  Y  +S TN+PAELYP++TTI+YTL
Sbjct  65   NPYCQIDVRGKLWICPFCLTRNSFPAHYKDISSTNMPAELYPKYTTIEYTL  115



>gb|ABQ12917.1| Sec23 (S. cerevisiae) homolog B [Bos taurus]
Length=140

 Score =   121 bits (303),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 77/112 (69%), Gaps = 2/112 (2%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK--TCTAV  403
              E  DGVR +WN WP +++E+++ V+P+A  +  ++ +P+L  V Y P+ C   TC A+
Sbjct  10   QNEERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLKERPDLPPVQYEPVLCSRPTCKAI  69

Query  404  LNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            LNP  +VDY+A +W C FCFQRN FP  Y+ +SE N PAEL PQF+TI+Y +
Sbjct  70   LNPLCQVDYRAKLWACNFCFQRNQFPPAYAGISEVNQPAELMPQFSTIEYVI  121



>gb|KHN32738.1| Protein transport protein SEC23 [Glycine soja]
Length=765

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 77/109 (71%), Gaps = 0/109 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DGVRM WN  P TK ++   V+PI+A    I+    +  + Y+PLRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQDAQNAVVPISAVYTPIKHFTSMPLLNYSPLRCRTCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYT  556
            PF  VD+ A IWICPFCFQRN FP  YS++S+ ++PAEL+PQ+TT++Y 
Sbjct  66   PFCIVDFAAKIWICPFCFQRNHFPPHYSSISDDSLPAELFPQYTTVEYN  114



>ref|XP_008482918.1| PREDICTED: LOW QUALITY PROTEIN: protein transport protein Sec23B 
[Diaphorina citri]
Length=604

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 80/111 (72%), Gaps = 2/111 (2%)
 Frame = +2

Query  233  TEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRC--KTCTAVL  406
             E  DG+R TWN WP +K+E+S+ V+P+      ++ +P+L  + Y PL C    C A+L
Sbjct  11   NEERDGIRCTWNVWPSSKLEASRLVMPVGCLYQPLKEKPDLPPLQYEPLLCMRNQCRAIL  70

Query  407  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            NP  +VDY++ +W+C FCFQRN+FP QY+A++E + PAEL+PQFTTI+YT+
Sbjct  71   NPLCQVDYKSKLWVCNFCFQRNAFPPQYAAITEQHQPAELHPQFTTIEYTI  121



>ref|XP_011279270.1| PREDICTED: protein transport protein Sec23B-like [Felis catus]
Length=164

 Score =   121 bits (303),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 77/111 (69%), Gaps = 2/111 (2%)
 Frame = +2

Query  233  TEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK--TCTAVL  406
             E  DGVR +WN WP +++E+++ V+P+A  +  ++ +P+L  V Y P+ C   TC A+L
Sbjct  11   NEERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLKERPDLPPVQYEPVLCSRPTCKAIL  70

Query  407  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            NP  +VDY+A +W C FCFQRN FP  Y+ +SE N PAEL PQF+TI+Y +
Sbjct  71   NPLCQVDYRAKLWACNFCFQRNQFPPAYTGISEVNQPAELMPQFSTIEYVI  121



>ref|XP_002517022.1| protein transport protein sec23, putative [Ricinus communis]
 gb|EEF45185.1| protein transport protein sec23, putative [Ricinus communis]
Length=782

 Score =   129 bits (323),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E I+G+R +WN+WP  K E+S   IP++     +    EL  +PY PL C  C A+LN
Sbjct  5    ELESIEGLRWSWNSWPTRKNEASSLTIPLSIMCTPLMQSSELPILPYEPLTCTRCFAILN  64

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            P+ARVDYQ+ IW+CPFC+Q+N+FP  YS + ETN+PAEL+P ++T++Y  
Sbjct  65   PYARVDYQSRIWVCPFCYQKNTFPISYSGIGETNLPAELFPTYSTVEYKF  114



>ref|XP_011030584.1| PREDICTED: protein transport protein sec23-1 [Populus euphratica]
Length=794

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 76/110 (69%), Gaps = 0/110 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E I+G+R +WNAWP TK + S  +IP++     +    EL  +PY PL C  C AVLN
Sbjct  5    ELEAIEGLRWSWNAWPTTKKQVSTLIIPLSIMCTPLMQSTELPILPYDPLICTRCAAVLN  64

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            P+ARVDYQ+ IW+CPFC+ RN FP  Y  + ETN+PAEL+P ++T++Y +
Sbjct  65   PYARVDYQSRIWVCPFCYNRNPFPSSYLGIGETNLPAELFPTYSTVEYKI  114



>ref|XP_010481838.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=788

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 76/109 (70%), Gaps = 0/109 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E I+G+R +WN+WP TK +    V+P++     +    EL T+PY PL C  C AVLN
Sbjct  5    ELEAIEGLRWSWNSWPTTKSDCEFLVVPLSIMYTPLMQFSELPTIPYDPLICSRCGAVLN  64

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYT  556
            P+ARVDYQ+ IW CPFCF +N FP  YS ++ETN+PAEL+P ++ ++YT
Sbjct  65   PYARVDYQSRIWSCPFCFHKNHFPRSYSGITETNLPAELFPTYSAVEYT  113



>ref|XP_010274198.1| PREDICTED: protein transport protein Sec23A [Nelumbo nucifera]
Length=792

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E I+G+R +WN+WP +K E+S  VIP++     +    EL  +PY PL C  C AVLN
Sbjct  5    ELEAIEGLRWSWNSWPASKSEASSLVIPLSVMCTPLMEFTELPLLPYDPLVCSRCGAVLN  64

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            P+ARVDYQ+ +W+CPFC+Q+N FP  Y+ + E N+PAEL+P ++T++Y
Sbjct  65   PYARVDYQSRLWVCPFCYQKNPFPRSYAGIGENNLPAELFPTYSTVEY  112



>ref|XP_002385801.1| hypothetical protein MPER_16204 [Moniliophthora perniciosa FA553]
 gb|EEB86731.1| hypothetical protein MPER_16204 [Moniliophthora perniciosa FA553]
Length=167

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 79/111 (71%), Gaps = 1/111 (1%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVL  406
            D E  DGVR++WN WP +++E+++ V+PI+A    ++ + +L  V Y P+ CK  C A+L
Sbjct  6    DVEERDGVRLSWNVWPSSRIEATRTVVPISALYTPLKVRDDLPPVLYEPVACKPPCRAIL  65

Query  407  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            NP+ ++D +  +WICPFC  RN+FP  Y  +S TN+PAEL P++TTI+YTL
Sbjct  66   NPYCQIDIRGKLWICPFCISRNAFPPHYKDISNTNLPAELLPKYTTIEYTL  116



>ref|XP_011091114.1| PREDICTED: protein transport protein SEC23 [Sesamum indicum]
Length=788

 Score =   128 bits (322),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 79/111 (71%), Gaps = 0/111 (0%)
 Frame = +2

Query  227  TDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVL  406
            ++ EGI+G+R +W++WP +K E +  V+P++     + P  EL  +PY PL C  C AVL
Sbjct  4    SELEGIEGLRWSWHSWPISKPEVASLVVPLSIMCTPLTPFSELPILPYEPLNCSQCAAVL  63

Query  407  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            NP++RVDY + IW+C FC+++N FP  Y+ ++E N+PAEL+P ++T++Y L
Sbjct  64   NPYSRVDYVSKIWVCSFCYRKNPFPRSYAHINENNIPAELFPTYSTVEYHL  114



>ref|XP_002315735.1| transport family protein [Populus trichocarpa]
 gb|EEF01906.1| transport family protein [Populus trichocarpa]
Length=753

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 76/110 (69%), Gaps = 0/110 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E I+G+R +WNAWP TK + S  +IP++     +    EL  +PY PL C  C AVLN
Sbjct  5    ELEAIEGLRWSWNAWPTTKNQVSTLIIPLSIMCTPLMQSTELPILPYDPLICTRCAAVLN  64

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            P+ARVDYQ+ IW+CPFC+ RN FP  Y  + ETN+PAEL+P ++T++Y +
Sbjct  65   PYARVDYQSRIWVCPFCYNRNHFPISYLGIGETNLPAELFPTYSTVEYKI  114



>ref|XP_002489340.1| hypothetical protein SORBIDRAFT_0010s021250 [Sorghum bicolor]
 gb|EES20133.1| hypothetical protein SORBIDRAFT_0010s021250 [Sorghum bicolor]
Length=793

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 82/110 (75%), Gaps = 5/110 (5%)
 Frame = +2

Query  239  GIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIR----PQPELVTVPYAPLRCKT-CTAV  403
            G D VR+TWN WPR+KVE+S+CV+P+AA+I   R           +PY PLRCK  C+A+
Sbjct  20   GPDAVRLTWNTWPRSKVEASRCVVPLAATISPARVPDPSAASPPPLPYPPLRCKPPCSAL  79

Query  404  LNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            LNPFARVD+ A IWICP CF RN FP  Y+A+SE+NVPAEL+PQ +T++Y
Sbjct  80   LNPFARVDFAAKIWICPLCFSRNHFPPHYAAISESNVPAELFPQCSTVEY  129



>ref|XP_007301896.1| hypothetical protein STEHIDRAFT_166914 [Stereum hirsutum FP-91666 
SS1]
 gb|EIM88967.1| hypothetical protein STEHIDRAFT_166914 [Stereum hirsutum FP-91666 
SS1]
Length=765

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 80/111 (72%), Gaps = 1/111 (1%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVL  406
            D E  DGVR++WN WP +++E+++ V+PIAA    ++ + +L  V Y P+ CK  C AVL
Sbjct  6    DVEDRDGVRLSWNVWPSSRIEANRTVVPIAALYTPLKQRDDLPPVLYEPVTCKPPCRAVL  65

Query  407  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            NP+ ++D +  +WICPFC QRN+FP  Y  +S TN+PAEL P++TTI+YTL
Sbjct  66   NPYCQIDIRGKLWICPFCLQRNAFPPHYKDISNTNLPAELLPKYTTIEYTL  116



>ref|XP_007134267.1| hypothetical protein PHAVU_010G032700g [Phaseolus vulgaris]
 gb|ESW06261.1| hypothetical protein PHAVU_010G032700g [Phaseolus vulgaris]
Length=764

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 76/109 (70%), Gaps = 0/109 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DGVRM WN  P TK ++   V+P++     I+  P +  + Y PLRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQDALNAVVPVSVVYTPIKHFPSMPVLNYTPLRCRTCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYT  556
            PF  VD+ A IWICPFCFQRN FP  Y+++S+ ++PAEL+PQ+TT++Y 
Sbjct  66   PFCIVDFAAKIWICPFCFQRNHFPPHYASISDESLPAELFPQYTTVEYN  114



>ref|XP_010149983.1| PREDICTED: protein transport protein Sec23A-like, partial [Eurypyga 
helias]
Length=227

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 78/112 (70%), Gaps = 2/112 (2%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK--TCTAV  403
            + E  DGVR +WN WP +++E+++ V+P+AA    ++ +P+L  + Y P+ C   TC AV
Sbjct  10   ENEDRDGVRFSWNVWPSSRLEATRMVVPVAALFTPLKERPDLPPIQYEPVLCSRTTCRAV  69

Query  404  LNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            LNP  +VDY+A +W C FC+QRN FP  Y+ +SE N PAEL PQF++I+Y +
Sbjct  70   LNPLCQVDYRAKLWACNFCYQRNQFPPTYAGISEMNQPAELLPQFSSIEYVV  121



>ref|XP_006280033.1| hypothetical protein CARUB_v10025910mg [Capsella rubella]
 ref|XP_006280034.1| hypothetical protein CARUB_v10025910mg [Capsella rubella]
 gb|EOA12931.1| hypothetical protein CARUB_v10025910mg [Capsella rubella]
 gb|EOA12932.1| hypothetical protein CARUB_v10025910mg [Capsella rubella]
Length=791

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 75/108 (69%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E I+G+R +WN+WP TK +    V+P++     +    EL T+PY PL C  C AVLN
Sbjct  5    ELEAIEGLRWSWNSWPTTKSDCESLVVPLSIMYTPLMQFSELPTIPYDPLICSRCGAVLN  64

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            P+ARVDYQ+ IW CPFCF +N FP  YS ++ETN+PAEL+P ++ ++Y
Sbjct  65   PYARVDYQSRIWSCPFCFHKNHFPRSYSGITETNLPAELFPTYSAVEY  112



>ref|XP_010441998.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=792

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 75/108 (69%), Gaps = 0/108 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E I+G+R +WN+WP TK +    V+P++     +    EL T+PY PL C  C AVLN
Sbjct  5    ELEAIEGLRWSWNSWPTTKSDCESLVVPLSIMYTPLMHFSELPTIPYDPLICSRCGAVLN  64

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  553
            P+ARVDYQ+ IW CPFCF +N FP  YS ++ETN+PAEL+P ++ ++Y
Sbjct  65   PYARVDYQSRIWSCPFCFHKNHFPRSYSGITETNLPAELFPTYSAVEY  112



>ref|XP_011410444.1| PREDICTED: protein transport protein Sec23A-like [Amphimedon 
queenslandica]
Length=715

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 78/111 (70%), Gaps = 2/111 (2%)
 Frame = +2

Query  233  TEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK--TCTAVL  406
             E  DGVR+TWN WP T++E++K V+P+AA I  ++ +PEL    Y P+ C    C AVL
Sbjct  11   NEDRDGVRLTWNVWPSTRIEAAKLVVPMAAMITPLKERPELPPAQYEPVLCGRSQCRAVL  70

Query  407  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            NP  +VDY++  WIC FC+QRN+FP  Y+A+SE+N PAEL   F+TI+Y L
Sbjct  71   NPLCQVDYRSKSWICNFCYQRNTFPQHYAAISESNQPAELISHFSTIEYHL  121



>ref|XP_007004395.1| hypothetical protein TREMEDRAFT_71580 [Tremella mesenterica DSM 
1558]
 gb|EIW70298.1| hypothetical protein TREMEDRAFT_71580 [Tremella mesenterica DSM 
1558]
Length=762

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 81/111 (73%), Gaps = 1/111 (1%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK-TCTAVL  406
            D E  DG+R++WNAWP +++E+++ V+PI+A    ++ + +L  V Y P+ CK +C A+L
Sbjct  8    DVEDRDGIRLSWNAWPSSRIEATRTVVPISALYTPLKEREDLPPVLYEPVTCKASCKAIL  67

Query  407  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            NPF ++D +  +WICPFC QRN FP  Y  ++ TN+PAEL P++TTI+YTL
Sbjct  68   NPFCQIDVRGKLWICPFCLQRNPFPPHYKDITTTNLPAELLPKYTTIEYTL  118



>ref|XP_004979229.1| PREDICTED: protein transport protein SEC23-like [Setaria italica]
Length=791

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 82/108 (76%), Gaps = 5/108 (5%)
 Frame = +2

Query  251  VRMTWNAWPRTKVESSKCVIPIAASIHLIR----PQPELVTVPYAPLRCKT-CTAVLNPF  415
            VR+TWNAWPR+KVE+S+CV+P+AA++   R           +PY PLRCK  C+A+LNPF
Sbjct  23   VRLTWNAWPRSKVEASRCVVPLAATVSPARVPDPSAAAPPPLPYPPLRCKPPCSALLNPF  82

Query  416  ARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            ARVD+ A IWICP CF RN FP  Y+A+SE+NVPAEL+PQ +T++Y +
Sbjct  83   ARVDFAAKIWICPLCFSRNHFPPHYAAISESNVPAELFPQCSTVEYIV  130



>ref|XP_001751286.1| predicted protein [Physcomitrella patens]
 gb|EDQ83603.1| predicted protein [Physcomitrella patens]
Length=757

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 76/117 (65%), Gaps = 7/117 (6%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIR-------PQPELVTVPYAPLRCK  388
            + E   GVRM WN WP TK+E++KC +P AA +  +          P +  +PY PLRC+
Sbjct  7    EVEAATGVRMPWNVWPNTKIEAAKCTVPFAAVVTPLHHGEGASDAAPPVNLLPYPPLRCR  66

Query  389  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            TC AVLNPF RVD+ A +WIC FC+QR  FP  Y+++S TN P ELYPQ  +++Y L
Sbjct  67   TCQAVLNPFCRVDFDAKMWICLFCYQRCYFPQHYASISLTNQPGELYPQCASVEYKL  123



>ref|XP_003547758.1| PREDICTED: protein transport protein SEC23-like [Glycine max]
Length=765

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 77/109 (71%), Gaps = 0/109 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DGVRM WN  P TK ++   V+P++A    I+    +  + Y+PLRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQDAQNAVVPVSAVYTPIKHFTSMPLLNYSPLRCRTCRSVLN  65

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYT  556
            PF  VD+ A IWICPFCFQRN FP  Y+++S+ ++PAEL+PQ+TT++Y 
Sbjct  66   PFCIVDFAAKIWICPFCFQRNHFPPHYASISDDSLPAELFPQYTTVEYN  114



>dbj|BAB08946.1| protein transport protein SEC23 [Arabidopsis thaliana]
Length=736

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 76/109 (70%), Gaps = 0/109 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E I+G+R +WN+WP TK +    V+P++     +    EL T+PY PL C  C AVLN
Sbjct  5    ELEAIEGLRWSWNSWPTTKSDCESLVVPLSIMYTPLMHFSELPTIPYDPLICSRCGAVLN  64

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYT  556
            P+ARVDYQ+ IW CPFCF +N FP  YS ++ETN+PAEL+P ++ ++Y+
Sbjct  65   PYARVDYQSRIWSCPFCFHKNLFPRSYSGITETNLPAELFPTYSAVEYS  113



>ref|XP_002863641.1| hypothetical protein ARALYDRAFT_494637 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39900.1| hypothetical protein ARALYDRAFT_494637 [Arabidopsis lyrata subsp. 
lyrata]
Length=793

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 76/109 (70%), Gaps = 0/109 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E I+G+R +WN+WP TK +    V+P++     +    EL T+PY PL C  C AVLN
Sbjct  5    ELEAIEGLRWSWNSWPTTKSDCESLVVPLSIMYTPLMQFSELPTIPYDPLICSRCGAVLN  64

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYT  556
            P+ARVDYQ+ IW CPFCF +N FP  YS ++ETN+PAEL+P ++ ++Y+
Sbjct  65   PYARVDYQSRIWSCPFCFHKNLFPRSYSGITETNLPAELFPTYSAVEYS  113



>gb|KDE07582.1| protein transporter SEC23 [Microbotryum violaceum p1A1 Lamole]
Length=809

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            D E  DGVR++WN +  +++ES++ V+PIAA    ++ + +L  V Y P+ CKTC A+LN
Sbjct  54   DVEDRDGVRLSWNVFAGSRIESTRTVVPIAALYTPLKERADLPPVLYEPVTCKTCRAILN  113

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            P+ ++D +  +WICPFC QRN+FP  Y  +S  N+PAEL P++TTI+YTL
Sbjct  114  PYCQIDVRGKLWICPFCLQRNAFPPHYKDISSNNLPAELLPKYTTIEYTL  163



>gb|KDN53244.1| hypothetical protein K437DRAFT_253260 [Tilletiaria anomala UBC 
951]
Length=768

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 79/111 (71%), Gaps = 1/111 (1%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVL  406
            D E  DGVR++WN WP TKVE+++ V+P+AA    ++ + +L  V Y P+ CK  C AVL
Sbjct  5    DVEDRDGVRLSWNVWPSTKVEATRTVVPVAALYTPLKEREDLPPVMYEPVVCKEPCRAVL  64

Query  407  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  559
            NP+ ++D +  +WICPFC  RN+FP  Y  +S TN+PAEL P++TTI+YTL
Sbjct  65   NPYCQIDVRGKLWICPFCLSRNAFPPHYRDISNTNLPAELLPKYTTIEYTL  115



>ref|NP_568626.1| sec23/sec24-like transport protein [Arabidopsis thaliana]
 gb|AAO29951.1| Unknown protein [Arabidopsis thaliana]
 gb|AAQ56793.1| At5g43670 [Arabidopsis thaliana]
 gb|AED94993.1| sec23/sec24-like transport protein [Arabidopsis thaliana]
Length=794

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 76/109 (70%), Gaps = 0/109 (0%)
 Frame = +2

Query  230  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  409
            + E I+G+R +WN+WP TK +    V+P++     +    EL T+PY PL C  C AVLN
Sbjct  5    ELEAIEGLRWSWNSWPTTKSDCESLVVPLSIMYTPLMHFSELPTIPYDPLICSRCGAVLN  64

Query  410  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYT  556
            P+ARVDYQ+ IW CPFCF +N FP  YS ++ETN+PAEL+P ++ ++Y+
Sbjct  65   PYARVDYQSRIWSCPFCFHKNLFPRSYSGITETNLPAELFPTYSAVEYS  113



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880