BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS030G09

Length=508
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ADN92993.2|  lipoxygenase LOX1                                       300   6e-93   Ipomoea nil [qian niu]
ref|XP_009774053.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    201   6e-57   Nicotiana sylvestris
emb|CAA58859.1|  lipoxygenase                                           198   8e-56   Nicotiana tabacum [American tobacco]
emb|CDP15504.1|  unnamed protein product                                198   8e-56   Coffea canephora [robusta coffee]
ref|XP_009610900.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    198   1e-55   Nicotiana tomentosiformis
gb|AGL96414.1|  9-lipoxygenase                                          196   3e-55   Nicotiana benthamiana
ref|NP_001274916.1|  probable linoleate 9S-lipoxygenase 5               194   2e-54   Solanum tuberosum [potatoes]
ref|XP_004244890.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    193   4e-54   Solanum lycopersicum
gb|ACO57136.1|  lipoxygenase 1                                          192   7e-54   Capsicum annuum
ref|XP_010102744.1|  putative linoleate 9S-lipoxygenase 5               191   3e-53   
ref|XP_010659819.1|  PREDICTED: lipoxygenase isoform X1                 189   9e-53   
emb|CBI36801.3|  unnamed protein product                                189   1e-52   Vitis vinifera
ref|XP_006382594.1|  hypothetical protein POPTR_0005s03560g             189   2e-52   Populus trichocarpa [western balsam poplar]
ref|NP_001268178.1|  lipoxygenase                                       187   4e-52   Vitis vinifera
gb|AGU28274.1|  lipoxygenase 1                                          187   5e-52   Vitis vinifera
gb|KCW61797.1|  hypothetical protein EUGRSUZ_H04495                     182   6e-52   Eucalyptus grandis [rose gum]
ref|XP_010025193.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    187   9e-52   Eucalyptus grandis [rose gum]
ref|XP_009365900.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    187   9e-52   Pyrus x bretschneideri [bai li]
ref|XP_006382593.1|  hypothetical protein POPTR_0005s03550g             186   2e-51   
gb|AGI16377.1|  lipoxygenase                                            186   2e-51   Malus domestica [apple tree]
gb|AGI16382.1|  lipoxygenase                                            186   2e-51   Malus domestica [apple tree]
emb|CAD10740.1|  lipoxygenase                                           186   3e-51   Corylus avellana [European hazelnut]
ref|XP_008348093.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    185   3e-51   
sp|Q43190.1|LOX14_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    184   5e-51   Solanum tuberosum [potatoes]
emb|CCD74473.1|  lipoxygenase 1                                         179   6e-51   Arabidopsis halleri subsp. halleri
gb|KCW61796.1|  hypothetical protein EUGRSUZ_H04495                     182   7e-51   Eucalyptus grandis [rose gum]
ref|XP_011023610.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    184   8e-51   Populus euphratica
gb|AGI16378.1|  lipoxygenase                                            184   8e-51   Malus domestica [apple tree]
gb|AGI16380.1|  lipoxygenase                                            184   9e-51   Malus domestica [apple tree]
ref|XP_009597615.1|  PREDICTED: linoleate 9S-lipoxygenase 6             184   9e-51   Nicotiana tomentosiformis
ref|XP_010659859.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    183   2e-50   Vitis vinifera
gb|AAG00881.1|AC064840_12  lipoxygenase - partial coding sequence       177   2e-50   Arabidopsis thaliana [mouse-ear cress]
emb|CBI36802.3|  unnamed protein product                                183   2e-50   Vitis vinifera
ref|XP_010025196.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    182   3e-50   Eucalyptus grandis [rose gum]
emb|CDP20618.1|  unnamed protein product                                182   3e-50   Coffea canephora [robusta coffee]
ref|XP_011036799.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    182   4e-50   Populus euphratica
ref|NP_001234856.1|  linoleate 9S-lipoxygenase A                        182   4e-50   Solanum lycopersicum
sp|Q41238.1|LOX16_SOLTU  RecName: Full=Linoleate 9S-lipoxygenase ...    182   4e-50   Solanum tuberosum [potatoes]
gb|ABF19102.2|  9-lipoxygenase                                          182   4e-50   Capsicum annuum
gb|AGI16379.1|  lipoxygenase                                            182   5e-50   Malus domestica [apple tree]
gb|AGK82798.1|  lipoxygenase                                            182   6e-50   Malus domestica [apple tree]
gb|AEQ30071.1|  lipoxygenase                                            182   6e-50   Litchi chinensis [litchi]
gb|KHN16119.1|  Putative linoleate 9S-lipoxygenase 5                    181   7e-50   Glycine soja [wild soybean]
ref|XP_003536076.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    181   7e-50   Glycine max [soybeans]
ref|XP_009787604.1|  PREDICTED: linoleate 9S-lipoxygenase 6             181   1e-49   Nicotiana sylvestris
ref|XP_010025195.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    181   1e-49   Eucalyptus grandis [rose gum]
gb|ABW75772.2|  lipoxygenase                                            181   1e-49   Camellia sinensis [black tea]
ref|XP_007208098.1|  hypothetical protein PRUPE_ppa001293mg             181   1e-49   Prunus persica
ref|XP_004494612.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    181   1e-49   Cicer arietinum [garbanzo]
ref|XP_004302420.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    181   2e-49   Fragaria vesca subsp. vesca
ref|XP_010414944.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        181   2e-49   Camelina sativa [gold-of-pleasure]
gb|AFU51542.1|  lipoxygenase 3                                          180   2e-49   Capsicum annuum
emb|CAA64767.1|  lipoxygenase                                           176   2e-49   Solanum tuberosum [potatoes]
emb|CAB94852.1|  lipoxygenase                                           180   2e-49   Prunus dulcis [sweet almond]
gb|KDO56302.1|  hypothetical protein CISIN_1g002839mg                   180   3e-49   Citrus sinensis [apfelsine]
ref|XP_006433338.1|  hypothetical protein CICLE_v10000236mg             180   3e-49   Citrus clementina [clementine]
ref|XP_008246455.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    180   3e-49   Prunus mume [ume]
ref|XP_006344621.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    180   3e-49   Solanum tuberosum [potatoes]
gb|KHN03989.1|  Putative linoleate 9S-lipoxygenase 5                    179   4e-49   Glycine soja [wild soybean]
ref|XP_003521704.2|  PREDICTED: probable linoleate 9S-lipoxygenas...    179   4e-49   Glycine max [soybeans]
ref|XP_010553735.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        179   5e-49   Tarenaya hassleriana [spider flower]
gb|AAP83135.1|  lipoxygenase                                            179   5e-49   Nicotiana attenuata
gb|KCW44986.1|  hypothetical protein EUGRSUZ_L01433                     177   6e-49   Eucalyptus grandis [rose gum]
ref|XP_010511239.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        179   6e-49   Camelina sativa [gold-of-pleasure]
ref|XP_006392468.1|  hypothetical protein EUTSA_v10023267mg             179   6e-49   Eutrema salsugineum [saltwater cress]
ref|XP_007030817.1|  Lipoxygenase 1                                     179   7e-49   
ref|XP_010040715.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    177   8e-49   
gb|AAZ04411.1|  lipoxygenase                                            178   1e-48   Cynanchum gracillimum
gb|AAP83134.1|  lipoxygenase                                            178   1e-48   Nicotiana attenuata
ref|XP_009376659.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    178   1e-48   Pyrus x bretschneideri [bai li]
ref|XP_010480214.1|  PREDICTED: linoleate 9S-lipoxygenase 1             177   2e-48   Camelina sativa [gold-of-pleasure]
gb|AAO03558.1|  lipoxygenase 1                                          177   2e-48   Brassica napus [oilseed rape]
ref|XP_009119596.1|  PREDICTED: linoleate 9S-lipoxygenase 1             177   2e-48   Brassica rapa
gb|ACG56281.1|  lipoxygenase                                            177   2e-48   Olea europaea
ref|XP_006838255.1|  hypothetical protein AMTR_s00103p00053790          168   2e-48   
ref|NP_175900.1|  lipoxygenase 1                                        177   3e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010025194.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    177   3e-48   Eucalyptus grandis [rose gum]
ref|XP_007208096.1|  hypothetical protein PRUPE_ppa001287mg             177   4e-48   
ref|XP_007204937.1|  hypothetical protein PRUPE_ppa001311mg             177   4e-48   
gb|KDP23508.1|  hypothetical protein JCGZ_23341                         177   5e-48   Jatropha curcas
ref|XP_008246456.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    177   5e-48   Prunus mume [ume]
emb|CAD10779.2|  lipoxygenase                                           176   5e-48   Prunus dulcis [sweet almond]
ref|NP_001281030.1|  probable linoleate 9S-lipoxygenase 5               176   5e-48   Malus domestica [apple tree]
ref|XP_008246453.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    177   5e-48   
ref|NP_001281026.1|  probable linoleate 9S-lipoxygenase 5               177   6e-48   Malus domestica [apple tree]
emb|CDY43490.1|  BnaA01g21450D                                          177   7e-48   Brassica napus [oilseed rape]
ref|XP_007208102.1|  hypothetical protein PRUPE_ppa001216mg             176   9e-48   
ref|XP_009376660.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    176   9e-48   
ref|XP_010256003.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    176   1e-47   Nelumbo nucifera [Indian lotus]
ref|XP_009376681.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    176   1e-47   Pyrus x bretschneideri [bai li]
ref|XP_009376680.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    176   1e-47   Pyrus x bretschneideri [bai li]
ref|XP_008246451.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    176   2e-47   Prunus mume [ume]
ref|XP_008245950.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    176   2e-47   Prunus mume [ume]
ref|XP_008246452.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    175   2e-47   Prunus mume [ume]
gb|KFK35600.1|  hypothetical protein AALP_AA4G012300                    175   2e-47   Arabis alpina [alpine rockcress]
ref|XP_002891934.1|  hypothetical protein ARALYDRAFT_474776             175   2e-47   
ref|XP_006344622.1|  PREDICTED: linoleate 9S-lipoxygenase B-like        174   4e-47   Solanum tuberosum [potatoes]
sp|O22507.1|LOX17_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    174   4e-47   Solanum tuberosum [potatoes]
ref|NP_001275169.1|  probable linoleate 9S-lipoxygenase 8-like          174   4e-47   Solanum tuberosum [potatoes]
ref|XP_009376663.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    174   4e-47   Pyrus x bretschneideri [bai li]
ref|NP_001275357.1|  linoleate 9S-lipoxygenase 2                        174   4e-47   Solanum tuberosum [potatoes]
ref|XP_008340967.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    163   4e-47   
ref|XP_002512386.1|  lipoxygenase, putative                             174   4e-47   Ricinus communis
sp|P37831.1|LOX11_SOLTU  RecName: Full=Linoleate 9S-lipoxygenase ...    174   4e-47   Solanum tuberosum [potatoes]
ref|XP_006850111.1|  hypothetical protein AMTR_s00022p00225700          172   6e-47   
ref|XP_010549787.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        173   6e-47   Tarenaya hassleriana [spider flower]
ref|NP_001275351.1|  5-lipoxygenase                                     173   9e-47   Solanum tuberosum [potatoes]
ref|XP_007144726.1|  hypothetical protein PHAVU_007G179600g             172   1e-46   Phaseolus vulgaris [French bean]
sp|O22508.1|LOX18_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    172   2e-46   Solanum tuberosum [potatoes]
gb|KJB80989.1|  hypothetical protein B456_013G124500                    172   2e-46   Gossypium raimondii
sp|Q43189.1|LOX13_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    172   3e-46   Solanum tuberosum [potatoes]
ref|XP_006419897.1|  hypothetical protein CICLE_v10004281mg             170   3e-46   
gb|AGI16415.1|  lipoxygenase                                            172   3e-46   Malus domestica [apple tree]
gb|AGI16414.1|  lipoxygenase                                            172   3e-46   Malus domestica [apple tree]
ref|NP_001281022.1|  probable linoleate 9S-lipoxygenase 5               172   3e-46   Malus domestica [apple tree]
emb|CAA64764.1|  lipoxygenase                                           167   3e-46   Solanum tuberosum [potatoes]
gb|KDO74649.1|  hypothetical protein CISIN_1g002776mg                   170   3e-46   Citrus sinensis [apfelsine]
gb|KDO74650.1|  hypothetical protein CISIN_1g002776mg                   169   3e-46   Citrus sinensis [apfelsine]
ref|XP_006300394.1|  hypothetical protein CARUB_v10019783mg             171   3e-46   Capsella rubella
ref|XP_006419896.1|  hypothetical protein CICLE_v10004281mg             170   4e-46   
gb|AGI16416.1|  lipoxygenase                                            171   5e-46   Malus domestica [apple tree]
gb|AGN75068.1|  lipoxygenase 2                                          171   6e-46   Momordica charantia [balsam pear]
gb|KFK35599.1|  hypothetical protein AALP_AA4G012300                    171   7e-46   Arabis alpina [alpine rockcress]
gb|AAK50778.4|AF361893_1  bacterial-induced lipoxygenase                170   1e-45   Gossypium hirsutum [American cotton]
ref|XP_010324011.1|  PREDICTED: linoleate 9S-lipoxygenase B isofo...    170   1e-45   
ref|XP_008388961.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    170   1e-45   
ref|XP_006419898.1|  hypothetical protein CICLE_v10004281mg             170   1e-45   Citrus clementina [clementine]
gb|KDO74647.1|  hypothetical protein CISIN_1g002776mg                   170   2e-45   Citrus sinensis [apfelsine]
ref|XP_011023611.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    169   2e-45   Populus euphratica
emb|CAA64765.1|  lipoxygenase                                           169   2e-45   Solanum tuberosum [potatoes]
ref|XP_010108010.1|  Linoleate 9S-lipoxygenase 5                        169   2e-45   Morus notabilis
gb|AGI16413.1|  lipoxygenase                                            169   4e-45   Malus domestica [apple tree]
ref|NP_001234098.1|  lipoxygenase                                       168   6e-45   Solanum lycopersicum
ref|XP_011087404.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    168   7e-45   Sesamum indicum [beniseed]
ref|XP_002319015.2|  hypothetical protein POPTR_0013s02310g             168   7e-45   
ref|NP_001280815.1|  probable linoleate 9S-lipoxygenase 5               168   8e-45   Malus domestica [apple tree]
gb|KJB28315.1|  hypothetical protein B456_005G041900                    168   8e-45   Gossypium raimondii
ref|XP_008370477.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    168   1e-44   
ref|XP_004302419.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    167   1e-44   Fragaria vesca subsp. vesca
ref|XP_008359870.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    167   1e-44   
ref|XP_010323943.1|  PREDICTED: lipoxygenase isoform X1                 167   1e-44   
ref|XP_002311617.1|  lipoxygenase family protein                        167   1e-44   Populus trichocarpa [western balsam poplar]
gb|KDP40158.1|  hypothetical protein JCGZ_02156                         167   2e-44   Jatropha curcas
gb|ACU20079.1|  unknown                                                 156   2e-44   Glycine max [soybeans]
ref|XP_010024349.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    167   2e-44   Eucalyptus grandis [rose gum]
ref|XP_007208174.1|  hypothetical protein PRUPE_ppa001016mg             167   2e-44   Prunus persica
gb|ABV32552.1|  lipoxygenase                                            167   2e-44   Prunus persica
ref|XP_009407551.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    166   2e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011026284.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    166   3e-44   Populus euphratica
ref|XP_004139172.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    166   3e-44   Cucumis sativus [cucumbers]
ref|XP_004156417.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...    166   3e-44   
gb|KHG03761.1|  Linoleate 9S-lipoxygenase 5, chloroplastic -like ...    166   5e-44   Gossypium arboreum [tree cotton]
ref|NP_001234873.1|  linoleate 9S-lipoxygenase B                        165   5e-44   
gb|AAR90846.1|  lipoxygenase                                            153   5e-44   Capsicum annuum
gb|AAA74393.1|  lipoxygenase                                            165   5e-44   Solanum lycopersicum
gb|KJB38135.1|  hypothetical protein B456_006G238200                    163   6e-44   Gossypium raimondii
ref|XP_009366923.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    165   9e-44   Pyrus x bretschneideri [bai li]
ref|XP_008454481.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        164   1e-43   Cucumis melo [Oriental melon]
gb|KJB38136.1|  hypothetical protein B456_006G238200                    163   1e-43   Gossypium raimondii
gb|ACH91370.1|  lipoxygenase LOX-3                                      165   1e-43   Prunus persica
gb|AHX56187.1|  lipoxygenase                                            164   2e-43   Diospyros kaki [Japanese persimmon]
ref|XP_009344082.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    164   2e-43   
dbj|BAH57745.1|  lipoxygenase                                           164   2e-43   Actinidia arguta
ref|XP_008246454.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    164   2e-43   Prunus mume [ume]
ref|XP_002516771.1|  lipoxygenase, putative                             163   3e-43   
ref|XP_006382595.1|  hypothetical protein POPTR_0005s03580g             163   3e-43   Populus trichocarpa [western balsam poplar]
ref|XP_011036801.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    163   3e-43   Populus euphratica
ref|XP_006359917.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    163   4e-43   Solanum tuberosum [potatoes]
gb|ABF60002.1|  lipoxygenase 2                                          163   4e-43   Actinidia deliciosa [Chinese gooseberry]
ref|XP_002319014.2|  lipoxygenase family protein                        163   4e-43   
ref|XP_006344623.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    163   4e-43   Solanum tuberosum [potatoes]
ref|XP_010674736.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    163   4e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006359918.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    163   5e-43   Solanum tuberosum [potatoes]
ref|XP_010277584.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    163   5e-43   Nelumbo nucifera [Indian lotus]
gb|KJB38138.1|  hypothetical protein B456_006G238200                    163   5e-43   Gossypium raimondii
gb|KJB38137.1|  hypothetical protein B456_006G238200                    163   6e-43   Gossypium raimondii
ref|XP_011090733.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    162   8e-43   Sesamum indicum [beniseed]
ref|XP_011090735.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    162   8e-43   Sesamum indicum [beniseed]
ref|XP_010905215.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4    162   8e-43   Elaeis guineensis
ref|XP_011026291.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    162   1e-42   Populus euphratica
ref|XP_008801705.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4    162   1e-42   Phoenix dactylifera
gb|AGK82776.1|  lipoxygenase                                            162   1e-42   Malus domestica [apple tree]
gb|AGK82774.1|  lipoxygenase                                            162   1e-42   Malus domestica [apple tree]
gb|AIC82456.1|  lipoxygenase                                            162   1e-42   Cocos nucifera
gb|AGQ04454.1|  lipoxygenase 1.1                                        150   1e-42   Oryza meridionalis [Australian wild rice]
gb|AGQ04450.1|  lipoxygenase 1.1                                        150   1e-42   Oryza rufipogon [common wild rice]
ref|XP_009763875.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    161   2e-42   Nicotiana sylvestris
gb|AGQ04449.1|  lipoxygenase 1.1                                        150   2e-42   Oryza sativa f. spontanea
ref|XP_009763870.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    161   2e-42   Nicotiana sylvestris
gb|AGK82783.1|  lipoxygenase                                            161   2e-42   Malus domestica [apple tree]
gb|AGQ04451.1|  lipoxygenase 1.1                                        150   3e-42   Oryza glumipatula
ref|XP_010326548.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    160   3e-42   
ref|XP_010326551.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    160   3e-42   Solanum lycopersicum
ref|XP_011021548.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    160   3e-42   Populus euphratica
gb|AGQ04460.1|  lipoxygenase 1.1                                        149   3e-42   Oryza australiensis
ref|XP_007147045.1|  hypothetical protein PHAVU_006G091400g             160   3e-42   Phaseolus vulgaris [French bean]
ref|NP_001280980.1|  probable linoleate 9S-lipoxygenase 5               160   4e-42   Malus domestica [apple tree]
ref|XP_003591120.1|  Lipoxygenase                                       160   4e-42   Medicago truncatula
ref|XP_004296897.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    160   4e-42   Fragaria vesca subsp. vesca
gb|KJB80990.1|  hypothetical protein B456_013G124500                    160   5e-42   Gossypium raimondii
ref|XP_006607065.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    156   5e-42   
ref|XP_009626059.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    160   6e-42   Nicotiana tomentosiformis
gb|AAD09861.1|  lipoxygenase                                            159   6e-42   Persea americana
ref|XP_009626058.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    160   6e-42   Nicotiana tomentosiformis
gb|AGQ04452.1|  lipoxygenase 1.1                                        149   7e-42   Oryza longistaminata [long-staminate rice]
ref|XP_010323952.1|  PREDICTED: lipoxygenase isoform X3                 159   8e-42   
ref|XP_004230206.1|  PREDICTED: lipoxygenase isoform X2                 159   8e-42   
gb|AGK82775.1|  lipoxygenase                                            159   9e-42   Malus domestica [apple tree]
ref|XP_008454500.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    159   1e-41   Cucumis melo [Oriental melon]
ref|XP_008454526.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    159   1e-41   
ref|XP_004139356.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    159   2e-41   Cucumis sativus [cucumbers]
gb|ABF19103.2|  9-lipoxygenase                                          159   2e-41   Capsicum annuum
ref|XP_006359922.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    158   3e-41   Solanum tuberosum [potatoes]
gb|AGQ04458.1|  lipoxygenase 1.1                                        147   3e-41   Oryza punctata
ref|XP_004309944.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    158   3e-41   Fragaria vesca subsp. vesca
gb|ACD43483.1|  lipoxygenase 1                                          157   3e-41   Olea europaea
ref|XP_008370478.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    157   4e-41   
emb|CAE17327.1|  lipoxygenase                                           157   5e-41   Fragaria x ananassa
ref|XP_010935040.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...    157   5e-41   
gb|AEZ50136.1|  lipoxygenase                                            157   6e-41   
ref|XP_004247367.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    157   7e-41   Solanum lycopersicum
ref|XP_007030814.1|  Lipoxygenase 1                                     157   7e-41   
gb|AGK82779.1|  lipoxygenase                                            157   8e-41   Malus domestica [apple tree]
ref|XP_009790810.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    156   9e-41   Nicotiana sylvestris
ref|XP_010556753.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    155   1e-40   Tarenaya hassleriana [spider flower]
gb|KHN02707.1|  Linoleate 9S-lipoxygenase 5, chloroplastic              156   1e-40   Glycine soja [wild soybean]
ref|XP_011021549.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    156   1e-40   Populus euphratica
gb|ADL41189.1|  lipoxygenase                                            156   1e-40   Camellia sinensis [black tea]
ref|XP_004495725.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    155   1e-40   Cicer arietinum [garbanzo]
ref|XP_008388563.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    156   2e-40   
ref|XP_002315780.1|  lipoxygenase family protein                        155   2e-40   
ref|XP_004169780.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...    155   3e-40   
ref|XP_008454503.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like ...    155   4e-40   
gb|EYU42168.1|  hypothetical protein MIMGU_mgv1a001215mg                154   4e-40   Erythranthe guttata [common monkey flower]
ref|XP_008454513.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like ...    154   5e-40   Cucumis melo [Oriental melon]
gb|AGQ04459.1|  lipoxygenase 1.1                                        144   6e-40   Oryza officinalis
gb|AAA79186.1|  lipoxygenase                                            154   7e-40   Cucumis sativus [cucumbers]
emb|CAP59449.1|  lipoxygenase                                           154   8e-40   Momordica charantia [balsam pear]
ref|XP_004139170.1|  PREDICTED: LOW QUALITY PROTEIN: linoleate 9S...    154   9e-40   
ref|XP_011092039.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    153   1e-39   Sesamum indicum [beniseed]
gb|KGN60916.1|  hypothetical protein Csa_2G023340                       150   1e-39   Cucumis sativus [cucumbers]
ref|XP_004156418.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    153   2e-39   
gb|AAC61785.1|  lipoxygenase 1                                          152   3e-39   Cucumis sativus [cucumbers]
emb|CAA63483.1|  lipoxygenase                                           152   3e-39   Cucumis sativus [cucumbers]
ref|XP_004156415.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        152   3e-39   
gb|EYU41500.1|  hypothetical protein MIMGU_mgv1a001165mg                152   3e-39   Erythranthe guttata [common monkey flower]
ref|XP_010530359.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    152   3e-39   Tarenaya hassleriana [spider flower]
ref|XP_006344625.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    152   3e-39   Solanum tuberosum [potatoes]
gb|ABB82552.1|  13S-lipoxygenase                                        152   4e-39   Cucumis melo var. inodorus [casaba melon]
ref|XP_009418148.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    152   4e-39   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAG61118.1|  lipoxygenase                                            152   4e-39   Zea mays [maize]
ref|NP_001105515.1|  lipoxygenase                                       152   4e-39   Zea mays [maize]
ref|XP_004230207.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    151   5e-39   Solanum lycopersicum
ref|XP_009774215.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    151   8e-39   Nicotiana sylvestris
gb|EAY91797.1|  hypothetical protein OsI_13441                          151   8e-39   Oryza sativa Indica Group [Indian rice]
ref|NP_001051212.1|  Os03g0738600                                       151   8e-39   
emb|CDP20619.1|  unnamed protein product                                149   9e-39   Coffea canephora [robusta coffee]
ref|XP_004496744.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    150   1e-38   
ref|XP_009626060.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    150   1e-38   Nicotiana tomentosiformis
gb|ACU81176.1|  13S-lipoxygenase                                        150   1e-38   Cucumis melo var. inodorus [casaba melon]
ref|XP_008454470.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        150   1e-38   Cucumis melo [Oriental melon]
ref|XP_004144826.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    150   1e-38   Cucumis sativus [cucumbers]
ref|XP_004158761.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    150   1e-38   
ref|XP_004139173.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    150   1e-38   Cucumis sativus [cucumbers]
ref|XP_011092040.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    150   2e-38   Sesamum indicum [beniseed]
gb|EYU26430.1|  hypothetical protein MIMGU_mgv1a023655mg                150   2e-38   Erythranthe guttata [common monkey flower]
emb|CAA45738.1|  lipoxygenase                                           149   3e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007225308.1|  hypothetical protein PRUPE_ppa001207mg             149   4e-38   Prunus persica
ref|XP_007030815.1|  Lipoxygenase 1                                     149   5e-38   
ref|XP_006344624.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    148   7e-38   Solanum tuberosum [potatoes]
gb|AES82497.2|  linoleate 9S-lipoxygenase-like protein                  148   8e-38   Medicago truncatula
gb|EMT25349.1|  Lipoxygenase 2                                          148   1e-37   
ref|XP_003560911.1|  PREDICTED: linoleate 9S-lipoxygenase 1             148   1e-37   Brachypodium distachyon [annual false brome]
ref|XP_010934565.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    148   1e-37   Elaeis guineensis
gb|AGI37654.1|  lipoxygenase                                            147   1e-37   Cucumis sativus [cucumbers]
ref|XP_006296682.1|  hypothetical protein CARUB_v10012957mg             147   1e-37   Capsella rubella
ref|XP_006650559.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like        147   1e-37   Oryza brachyantha
ref|XP_003626279.1|  Chalcone synthase                                  148   2e-37   
dbj|BAJ91632.1|  predicted protein                                      147   2e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007143236.1|  hypothetical protein PHAVU_007G055600g             147   2e-37   
gb|EMS61315.1|  Lipoxygenase 1                                          142   2e-37   
gb|KFK39531.1|  hypothetical protein AALP_AA3G256400                    147   2e-37   
gb|AAB41791.1|  lipoxygenase isoenzyme 1                                138   2e-37   
emb|CDO99039.1|  unnamed protein product                                147   3e-37   
ref|XP_008777614.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        146   3e-37   
gb|EAY91529.1|  hypothetical protein OsI_13162                          146   4e-37   
ref|XP_008370473.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    146   5e-37   
ref|XP_009108895.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    145   7e-37   
ref|NP_001050993.1|  Os03g0700400                                       145   8e-37   
ref|XP_003559944.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like        145   9e-37   
ref|XP_004972287.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like        136   9e-37   
ref|XP_003559938.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like        145   9e-37   
ref|XP_002883361.1|  lipoxygenase                                       145   1e-36   
ref|XP_009407000.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4    145   1e-36   
gb|AAD09202.1|  lipoxygenase                                            145   1e-36   
gb|EMS61461.1|  Lipoxygenase 2                                          144   1e-36   
gb|ACV84249.1|  LOX1                                                    144   2e-36   
ref|XP_009625816.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    144   2e-36   
ref|XP_003592410.1|  Lipoxygenase                                       144   2e-36   
ref|XP_002466614.1|  hypothetical protein SORBIDRAFT_01g011050          144   2e-36   
ref|XP_009406999.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4    143   2e-36   
gb|AEO13837.1|  lipoxygenase                                            144   2e-36   
gb|EAZ28267.1|  hypothetical protein OsJ_12238                          144   2e-36   
emb|CDY38326.1|  BnaC05g30190D                                          144   2e-36   
ref|XP_009376662.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    144   3e-36   
ref|XP_004982083.1|  PREDICTED: putative linoleate 9S-lipoxygenas...    144   3e-36   
gb|ACS34908.1|  lipoxygenase 2                                          144   3e-36   
ref|XP_010488264.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    144   3e-36   
ref|XP_009387657.1|  PREDICTED: linoleate 9S-lipoxygenase A-like        144   3e-36   
ref|XP_010431179.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    143   3e-36   
gb|EMT18292.1|  Putative lipoxygenase 3                                 144   3e-36   
dbj|BAJ87153.1|  predicted protein                                      143   4e-36   
ref|XP_004139169.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    143   5e-36   
ref|XP_004156414.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    143   5e-36   
ref|XP_006650443.1|  PREDICTED: putative linoleate 9S-lipoxygenas...    143   5e-36   
ref|XP_010667400.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    143   5e-36   
ref|XP_009145332.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    143   6e-36   
ref|XP_006406169.1|  hypothetical protein EUTSA_v10020023mg             143   6e-36   
ref|XP_008224534.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    143   6e-36   
gb|KHG06114.1|  putative linoleate 9S-lipoxygenase 5                    142   7e-36   
ref|XP_004486858.1|  PREDICTED: seed linoleate 9S-lipoxygenase-2-...    142   1e-35   
gb|AAB70865.1|  lipoxygenase 2                                          142   1e-35   
gb|ADR71860.1|  lipoxygenase-1                                          138   1e-35   
ref|XP_010470260.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    142   1e-35   
gb|AAL73498.1|AF465642_1  lipoxygenase                                  133   1e-35   
ref|XP_008454430.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        142   1e-35   
gb|EMS64854.1|  Putative lipoxygenase 3                                 141   2e-35   
ref|XP_010511294.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    142   2e-35   
ref|NP_188879.2|  lipoxygenase 5                                        142   2e-35   
dbj|BAB01777.1|  lipoxygenase                                           141   2e-35   
gb|KJB26432.1|  hypothetical protein B456_004G241300                    141   2e-35   
emb|CBI26229.3|  unnamed protein product                                141   2e-35   
ref|XP_010511287.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    141   2e-35   
gb|AHI86055.1|  lipoxygenase                                            141   2e-35   
ref|XP_008449553.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    141   2e-35   
gb|KHN15782.1|  Linoleate 9S-lipoxygenase 5, chloroplastic              141   2e-35   
gb|ADR71856.1|  lipoxygenase-1                                          141   2e-35   
gb|ADR71858.1|  lipoxygenase-1                                          141   2e-35   
gb|KJB26433.1|  hypothetical protein B456_004G241400                    140   3e-35   
ref|XP_004169568.1|  PREDICTED: LOW QUALITY PROTEIN: linoleate 9S...    141   3e-35   
ref|XP_004150982.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        141   3e-35   
ref|XP_003556040.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    140   3e-35   
ref|XP_002278007.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    140   3e-35   
gb|KJB26434.1|  hypothetical protein B456_004G241400                    140   3e-35   
emb|CDY46325.1|  BnaC01g31590D                                          140   4e-35   
emb|CAC19365.1|  lipoxygenase                                           140   5e-35   
gb|AHG59316.1|  lipoxygenase                                            140   5e-35   
gb|AEB70991.1|  lipoxygenase 4                                          140   5e-35   
gb|AEB70990.1|  lipoxygenase 3                                          140   5e-35   
ref|XP_007150490.1|  hypothetical protein PHAVU_005G157000g             140   6e-35   
gb|ADR71859.1|  lipoxygenase-1                                          140   6e-35   
gb|KHG15901.1|  putative linoleate 9S-lipoxygenase 5                    140   8e-35   
ref|XP_010488263.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    140   8e-35   
gb|AHG59315.1|  lipoxygenase                                            139   9e-35   
gb|AHX56188.1|  lipoxygenase                                            139   9e-35   
ref|XP_009406047.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        139   1e-34   
ref|XP_004486857.1|  PREDICTED: seed linoleate 9S-lipoxygenase-3-...    139   1e-34   
gb|AEI71780.1|  bacterial-induced lipoxygenase                          139   1e-34   
gb|ADR71857.1|  lipoxygenase-1                                          139   1e-34   
ref|XP_003597559.1|  Seed lipoxygenase-3                                139   1e-34   
gb|ACS34909.1|  lipoxygenase 1                                          139   2e-34   
gb|ADP02185.1|  putative lipoxygenase                                   139   2e-34   
ref|XP_009406046.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        139   2e-34   
gb|EMT09206.1|  Lipoxygenase 1                                          139   2e-34   
gb|AEL03787.1|  lipoxygenase                                            138   2e-34   
ref|XP_004970879.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like        138   2e-34   
emb|CDY64191.1|  BnaA01g36630D                                          138   3e-34   
ref|XP_007030813.1|  Lipoxygenase 1                                     138   3e-34   
sp|P29114.2|LOX1_HORVU  RecName: Full=Linoleate 9S-lipoxygenase 1...    138   4e-34   
ref|XP_010674740.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    137   4e-34   
ref|XP_010466519.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    137   5e-34   
gb|ACF74339.1|  lipoxygenase 1                                          130   5e-34   
ref|XP_010674744.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    137   6e-34   
ref|NP_001267584.1|  probable linoleate 9S-lipoxygenase 5-like          137   6e-34   
ref|XP_007030811.1|  Lipoxygenase 1                                     137   7e-34   
pdb|1ROV|A  Chain A, Lipoxygenase-3 Treated With Cumene Hydropero...    137   8e-34   
gb|ABX60408.1|  lipoxygenase L-3                                        137   8e-34   
ref|NP_001235383.1|  seed linoleate 9S-lipoxygenase-3                   137   8e-34   
gb|ADG03095.1|  lipoxygenase 3                                          137   8e-34   
gb|KHN32710.1|  Seed linoleate 9S-lipoxygenase-3                        137   8e-34   
ref|XP_011092037.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    137   9e-34   
sp|P09918.1|LOX3_PEA  RecName: Full=Seed linoleate 9S-lipoxygenas...    136   1e-33   
ref|XP_011092038.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    137   1e-33   
gb|KDP23726.1|  hypothetical protein JCGZ_23559                         136   1e-33   
ref|XP_004970878.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like        136   2e-33   
ref|XP_008454442.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    135   3e-33   
ref|XP_003597558.1|  Lipoxygenase                                       135   3e-33   
ref|XP_002458908.1|  hypothetical protein SORBIDRAFT_03g042450          135   4e-33   
gb|ABX60407.1|  lipoxygease L-2                                         134   8e-33   
gb|KHN11253.1|  Seed linoleate 9S-lipoxygenase-2                        134   8e-33   
gb|ADG03092.1|  lipoxygenase 2                                          134   9e-33   
ref|NP_001237685.1|  seed linoleate 9S-lipoxygenase-2                   134   9e-33   
sp|P09439.1|LOX2_SOYBN  RecName: Full=Seed linoleate 9S-lipoxygen...    134   9e-33   
gb|ADG03091.1|  lipoxygenase 2                                          134   9e-33   
gb|AFK32352.1|  lipoxygenase-2                                          134   9e-33   
ref|XP_010674739.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    134   1e-32   
tpg|DAA56392.1|  TPA: lipoxygenase1                                     133   1e-32   
tpg|DAA56391.1|  TPA: lipoxygenase1                                     133   2e-32   
ref|NP_001105973.1|  lipoxygenase                                       133   2e-32   
ref|XP_007150486.1|  hypothetical protein PHAVU_005G156700g             132   2e-32   
gb|AAY87057.1|  13-lipoxygenase                                         132   3e-32   
emb|CAA31664.1|  unnamed protein product                                132   3e-32   
gb|AAY87056.1|  13-lipoxygenase                                         132   3e-32   
ref|XP_002458905.1|  hypothetical protein SORBIDRAFT_03g042440          132   4e-32   
gb|KHN11251.1|  Seed linoleate 9S-lipoxygenase-2                        132   5e-32   
ref|XP_003531596.1|  PREDICTED: seed linoleate 9S-lipoxygenase-3        132   5e-32   
gb|AGH13205.1|  lipoxygenase                                            131   7e-32   
ref|XP_010674738.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    131   8e-32   
ref|XP_006650444.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    131   9e-32   
sp|P14856.1|LOX2_PEA  RecName: Full=Seed linoleate 9S-lipoxygenas...    130   1e-31   
gb|EPS66745.1|  lipoxygenase                                            129   1e-31   
emb|CAA55318.1|  lipoxygenase                                           130   1e-31   
ref|XP_002521992.1|  lipoxygenase, putative                             130   2e-31   
gb|ACL53478.1|  unknown                                                 130   2e-31   
ref|NP_001105003.1|  lipoxygenase                                       130   2e-31   
ref|XP_009387658.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    130   2e-31   
gb|ACG43480.1|  lipoxygenase 2                                          129   3e-31   
sp|P09186.1|LOX3_SOYBN  RecName: Full=Seed linoleate 9S-lipoxygen...    129   3e-31   
prf||1502333A  lipoxygenase 3                                           129   4e-31
gb|KHN11255.1|  Linoleate 9S-lipoxygenase                               128   8e-31   
ref|NP_001237338.1|  lipoxygenase-10                                    128   9e-31   
ref|XP_006387350.1|  hypothetical protein POPTR_1202s002002g            118   1e-30   
gb|KCW61804.1|  hypothetical protein EUGRSUZ_H04500                     125   4e-30   
ref|XP_003560916.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4    126   5e-30   
gb|AGS94394.3|  lipoxygenase                                            126   6e-30   
gb|AEW08315.1|  hypothetical protein 2_6308_02                          117   6e-30   
gb|AFG54211.1|  hypothetical protein 2_6308_02                          117   7e-30   
gb|AFG54206.1|  hypothetical protein 2_6308_02                          117   8e-30   
gb|AET01657.2|  seed linoleate 9S-lipoxygenase                          125   8e-30   
gb|KHN11257.1|  Linoleate 9S-lipoxygenase                               125   1e-29   
ref|XP_010025191.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    125   1e-29   
gb|AFW67907.1|  hypothetical protein ZEAMMB73_739462                    123   1e-29   
ref|XP_006472029.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    125   1e-29   
gb|AAG42354.1|  lipoxygenase                                            125   1e-29   
gb|ABQ10187.1|  lipoxygenase                                            124   2e-29   
gb|KHN30070.1|  Linoleate 9S-lipoxygenase-4                             124   2e-29   
gb|EAY91532.1|  hypothetical protein OsI_13165                          124   2e-29   
gb|AEU04516.1|  lipoxygenase 1                                          124   2e-29   
sp|Q53RB0.1|LOX4_ORYSJ  RecName: Full=Probable linoleate 9S-lipox...    124   2e-29   
gb|ACL53637.1|  unknown                                                 124   2e-29   
ref|NP_001105975.1|  lipoxygenase                                       124   2e-29   
sp|P38417.1|LOX4_SOYBN  RecName: Full=Linoleate 9S-lipoxygenase-4...    124   3e-29   
ref|XP_010674737.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    124   3e-29   
gb|ABX60409.1|  lipoxygease L-4                                         124   3e-29   
ref|XP_003531600.2|  PREDICTED: LOW QUALITY PROTEIN: linoleate 9S...    124   3e-29   
ref|XP_007135516.1|  hypothetical protein PHAVU_010G135900g             124   3e-29   
gb|ABD47523.1|  dual positional specificity lipoxygenase                124   4e-29   
gb|AFG54207.1|  hypothetical protein 2_6308_02                          115   4e-29   
ref|XP_004510413.1|  PREDICTED: linoleate 9S-lipoxygenase-like          123   5e-29   
emb|CAA53730.1|  lipoxygenase                                           122   8e-29   
emb|CAA97845.1|  lipoxygenase                                           122   8e-29   
emb|CDP20620.1|  unnamed protein product                                122   1e-28   
gb|ADG03094.1|  mutant lipoxygenase 1                                   120   1e-28   
ref|XP_003627174.1|  Lipoxygenase                                       122   1e-28   
ref|XP_009415714.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    122   1e-28   
gb|KHN30072.1|  Seed linoleate 9S-lipoxygenase-2                        121   2e-28   
ref|NP_001238203.1|  lipoxygenase L-5                                   121   3e-28   
ref|XP_007150488.1|  hypothetical protein PHAVU_005G1568000g            118   4e-28   
ref|XP_003546741.1|  PREDICTED: linoleate 9S-lipoxygenase-4-like ...    120   4e-28   
gb|KHN32711.1|  Linoleate 9S-lipoxygenase-4                             120   4e-28   
ref|XP_007135514.1|  hypothetical protein PHAVU_010G135700g             120   5e-28   
dbj|BAJ97226.1|  predicted protein                                      120   5e-28   
gb|KHN32712.1|  Linoleate 9S-lipoxygenase-4                             120   5e-28   
ref|XP_003627181.1|  Lipoxygenase                                       120   5e-28   
gb|AAF60270.1|  lipoxygenase 1                                          120   6e-28   
ref|NP_001235250.1|  lipoxygenase                                       120   8e-28   
ref|XP_007135515.1|  hypothetical protein PHAVU_010G135800g             119   1e-27   
ref|XP_003627185.1|  Lipoxygenase                                       119   1e-27   
gb|AAB60715.1|  lipoxygenase                                            119   1e-27   
ref|XP_003627173.1|  Seed lipoxygenase-3                                119   2e-27   
gb|ACN29156.1|  unknown                                                 118   3e-27   
ref|NP_001105974.1|  lipoxygenase                                       118   3e-27   
ref|XP_004510412.1|  PREDICTED: linoleate 9S-lipoxygenase-like          118   3e-27   
gb|ACJ83328.1|  unknown                                                 113   3e-27   
pdb|4WHA|A  Chain A, Lipoxygenase-1 (soybean) L546a/l754a Mutant        118   3e-27   
ref|NP_001237323.1|  lipoxygenase-9                                     118   3e-27   
ref|XP_007143238.1|  hypothetical protein PHAVU_007G055800g             118   3e-27   
ref|NP_001236153.1|  seed linoleate 13S-lipoxygenase-1                  118   4e-27   
pdb|3BND|A  Chain A, Lipoxygenase-1 (Soybean), I553v Mutant             118   4e-27   
pdb|3PZW|A  Chain A, Soybean Lipoxygenase-1 - Re-Refinement             118   4e-27   
pdb|3BNC|A  Chain A, Lipoxygenase-1 (Soybean) I553g Mutant              118   4e-27   
pdb|1Y4K|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, N694g Mutant     118   4e-27   
pdb|1FGO|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, Q495a Mutant     118   4e-27   
pdb|3BNE|A  Chain A, Lipoxygenase-1 (Soybean) I553a Mutant              118   4e-27   
pdb|1FGM|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, N694h Mutant     118   4e-27   
pdb|3BNB|A  Chain A, Lipoxygenase-1 (Soybean) I553l Mutant              118   4e-27   
pdb|1FGR|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, Q697e Mutant     117   4e-27   
pdb|1FGQ|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, Q495e Mutant     117   4e-27   
pdb|1FGT|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, Q697n Mutant     117   4e-27   
gb|ADG03093.1|  lipoxygenase 1                                          117   4e-27   
gb|EPS73035.1|  hypothetical protein M569_01717                         118   4e-27   
ref|XP_003627196.1|  Lipoxygenase                                       117   4e-27   
ref|XP_003627197.1|  Lipoxygenase                                       117   5e-27   
ref|XP_009774054.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    117   8e-27   
ref|XP_007135505.1|  hypothetical protein PHAVU_010G134800g             117   8e-27   
sp|P27480.1|LOXA_PHAVU  RecName: Full=Linoleate 9S-lipoxygenase 1...    117   8e-27   
pdb|2IUK|A  Chain A, Crystal Structure Of Soybean Lipoxygenase-D        117   9e-27   
ref|NP_001238676.1|  seed linoleate 9S-lipoxygenase                     117   1e-26   
sp|P24095.1|LOXX_SOYBN  RecName: Full=Seed linoleate 9S-lipoxygen...    117   1e-26   
gb|KEH35160.1|  seed linoleate 9S-lipoxygenase                          116   1e-26   



>gb|ADN92993.2| lipoxygenase LOX1 [Ipomoea nil]
Length=857

 Score =   300 bits (767),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 145/146 (99%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = +3

Query  69   GKLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN  248
            GKLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN
Sbjct  4    GKLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN  63

Query  249  GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTL  428
            GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVP AFIIKNNHPNEFYLKTL
Sbjct  64   GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPGAFIIKNNHPNEFYLKTL  123

Query  429  TLEDVPNHGEVHFACFSWVYPASKYN  506
            TLEDVPNHGEVHFACFSWVYPASKYN
Sbjct  124  TLEDVPNHGEVHFACFSWVYPASKYN  149



>ref|XP_009774053.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana sylvestris]
Length=862

 Score =   201 bits (511),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 123/149 (83%), Gaps = 4/149 (3%)
 Frame = +3

Query  69   GKLAEALSPT---KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQAD  239
            GK+ +A++     KK+KG VVLM+KNVLDF D NAS++D + +FLG++VSLEL+SSV AD
Sbjct  4    GKIVDAITGKDDGKKVKGTVVLMKKNVLDFTDINASVLDGVLEFLGRRVSLELISSVHAD  63

Query  240  LGNGLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEW-SEDFGVPAAFIIKNNHPNEFY  416
              NGL+GKRSKAAYL++W+  NT +A+GESAF++ F+W  E+FGVP AFIIKN H +EF+
Sbjct  64   PANGLQGKRSKAAYLENWLTNNTPIAAGESAFRVTFDWDDEEFGVPGAFIIKNLHFSEFF  123

Query  417  LKTLTLEDVPNHGEVHFACFSWVYPASKY  503
            LK+LTLEDVPNHG+VHF C SWVYPA KY
Sbjct  124  LKSLTLEDVPNHGKVHFVCNSWVYPAKKY  152



>emb|CAA58859.1| lipoxygenase [Nicotiana tabacum]
Length=862

 Score =   198 bits (503),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 117/136 (86%), Gaps = 1/136 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KK+KG VVLM+KNVLDF D NAS++D + +FLG++VSLEL+SSV AD  NGL+GKRSKAA
Sbjct  17   KKVKGTVVLMKKNVLDFTDINASVLDGVLEFLGRRVSLELISSVNADPANGLQGKRSKAA  76

Query  279  YLDHWVLKNTVLASGESAFKIEFEW-SEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            YL++W+  +T +A+GESAF++ F+W  E+FGVP AFIIKN H +EF+LK+LTLEDVPNHG
Sbjct  77   YLENWLTNSTPIAAGESAFRVTFDWDDEEFGVPGAFIIKNLHFSEFFLKSLTLEDVPNHG  136

Query  456  EVHFACFSWVYPASKY  503
            +VHF C SWVYPA+KY
Sbjct  137  KVHFVCNSWVYPANKY  152



>emb|CDP15504.1| unnamed protein product [Coffea canephora]
Length=856

 Score =   198 bits (503),  Expect = 8e-56, Method: Composition-based stats.
 Identities = 95/145 (66%), Positives = 113/145 (78%), Gaps = 2/145 (1%)
 Frame = +3

Query  72   KLAEALS-PTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN  248
            K+ +ALS   KKIKG VVLM+KNVLD NDFNAS +D + + LGQKVSL+L+S+V  D G 
Sbjct  4    KIVDALSGNNKKIKGTVVLMKKNVLDLNDFNASFLDGIHELLGQKVSLQLISAVNVDQGT  63

Query  249  GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTL  428
             LKGK  KAAYL+ W+  NT LA+GE+A  I F+W ED G+P AFIIKNNHP +FYLKTL
Sbjct  64   -LKGKLGKAAYLEDWITTNTFLAAGETAADITFDWDEDQGIPGAFIIKNNHPTQFYLKTL  122

Query  429  TLEDVPNHGEVHFACFSWVYPASKY  503
            TLE+VP HG VHF C SWVYPA+KY
Sbjct  123  TLEEVPGHGRVHFVCNSWVYPAAKY  147



>ref|XP_009610900.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana tomentosiformis]
Length=862

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 117/136 (86%), Gaps = 1/136 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KK+KG VVLM+KNVLDF D NAS++D + +FLG++VSLEL+SSV AD  NGL+GKRSKAA
Sbjct  17   KKVKGTVVLMKKNVLDFTDINASVLDGVLEFLGRRVSLELISSVNADPANGLQGKRSKAA  76

Query  279  YLDHWVLKNTVLASGESAFKIEFEW-SEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            YL++W+  +T +A+GESAF++ F+W  E+FGVP AFIIKN H +EF+LK+LTLEDVPNHG
Sbjct  77   YLENWLTNSTPIAAGESAFRVTFDWDDEEFGVPEAFIIKNLHFSEFFLKSLTLEDVPNHG  136

Query  456  EVHFACFSWVYPASKY  503
            +VHF C SWVYPA+KY
Sbjct  137  KVHFVCNSWVYPANKY  152



>gb|AGL96414.1| 9-lipoxygenase, partial [Nicotiana benthamiana]
Length=862

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 115/136 (85%), Gaps = 1/136 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KK+KG VVLM+KNVLDF D NAS++D + +FLG++VSLEL+SSV  D  NGL+GKRSKAA
Sbjct  17   KKVKGTVVLMKKNVLDFTDINASVLDGVLEFLGRRVSLELISSVHVDPANGLQGKRSKAA  76

Query  279  YLDHWVLKNTVLASGESAFKIEFEW-SEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            YL++W+   T +A+GESAF++ F+W  E+FGVP AFIIKN H +EF+LK+LTLEDVPNHG
Sbjct  77   YLENWLTNKTPIAAGESAFRVTFDWDDEEFGVPGAFIIKNLHFSEFFLKSLTLEDVPNHG  136

Query  456  EVHFACFSWVYPASKY  503
            +VHF C SWVYPA+KY
Sbjct  137  KVHFVCNSWVYPANKY  152



>ref|NP_001274916.1| probable linoleate 9S-lipoxygenase 5 [Solanum tuberosum]
 sp|Q43191.1|LOX15_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 5; AltName: 
Full=Leaf lipoxygenase [Solanum tuberosum]
 gb|AAB67865.1| lipoxygenase [Solanum tuberosum]
Length=862

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 113/149 (76%), Gaps = 5/149 (3%)
 Frame = +3

Query  72   KLAEALSPT-----KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQA  236
            K+ EA+S       KK+KG +VLM+KNVLDFND NAS++D + +FLG++VSL+L+S V A
Sbjct  5    KIVEAISGRSEDNGKKVKGTIVLMKKNVLDFNDVNASLLDGVLEFLGKRVSLQLISVVHA  64

Query  237  DLGNGLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFY  416
            D GN L+GKRS  AYL+ W+   T L +GESAF + F+W ED GVP AFII N H NEFY
Sbjct  65   DPGNSLQGKRSNPAYLEKWLTTGTSLVAGESAFDVTFDWDEDIGVPGAFIINNFHFNEFY  124

Query  417  LKTLTLEDVPNHGEVHFACFSWVYPASKY  503
            LK+LTLEDVPNHG VHF C SWVYPA KY
Sbjct  125  LKSLTLEDVPNHGNVHFVCNSWVYPAKKY  153



>ref|XP_004244890.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Solanum lycopersicum]
Length=861

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 108/135 (80%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KK+KG VVLM+KNVLDFND NAS++D + +FLG++VSL+L+S+V AD GN L+GKRS  A
Sbjct  18   KKVKGTVVLMKKNVLDFNDVNASLLDGVLEFLGKRVSLQLISAVHADPGNTLQGKRSNPA  77

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ W+   T L +GESAF + F+W +D GVP AFII N H NEFYLK+LTLEDVPNHG 
Sbjct  78   YLEKWLTTGTSLVAGESAFDVTFDWDDDIGVPGAFIINNFHFNEFYLKSLTLEDVPNHGS  137

Query  459  VHFACFSWVYPASKY  503
            VHF C SWVYPA +Y
Sbjct  138  VHFVCNSWVYPAKRY  152



>gb|ACO57136.1| lipoxygenase 1 [Capsicum annuum]
Length=861

 Score =   192 bits (489),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 108/135 (80%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KK+KG VVLM+KN LDFND NAS +D + +FLG++VSL+L+SSV  D  NGL+GKRSK A
Sbjct  18   KKMKGTVVLMKKNALDFNDVNASFLDGVLEFLGKRVSLQLISSVHGDPANGLQGKRSKPA  77

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL++W+   T L +GESAF + F+W ED GVP AFII N H NEF+LK+LTLEDVPNHG+
Sbjct  78   YLENWLTTRTPLVAGESAFDVTFDWDEDIGVPGAFIINNLHFNEFFLKSLTLEDVPNHGK  137

Query  459  VHFACFSWVYPASKY  503
            +HF C SWVYPA +Y
Sbjct  138  IHFVCNSWVYPAKRY  152



>ref|XP_010102744.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
 gb|EXB94013.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
Length=882

 Score =   191 bits (485),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 88/135 (65%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            K IKG VVLM+KNVLDFNDF+ASI+D + + LGQ+VSL+L+S+V AD  NGLKG   KAA
Sbjct  21   KIIKGSVVLMKKNVLDFNDFHASILDRVHELLGQRVSLQLISAVNADRANGLKGMLGKAA  80

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ W+     L  G+SAFK+ FEW ++ GVP AF+I+NNH +EFYLKTLTLEDVP  G 
Sbjct  81   YLEDWITTIAPLTPGDSAFKVSFEWEDEIGVPGAFLIRNNHHSEFYLKTLTLEDVPGEGR  140

Query  459  VHFACFSWVYPASKY  503
            VHF C SWVYPASKY
Sbjct  141  VHFVCNSWVYPASKY  155



>ref|XP_010659819.1| PREDICTED: lipoxygenase isoform X1 [Vitis vinifera]
Length=859

 Score =   189 bits (481),  Expect = 9e-53, Method: Composition-based stats.
 Identities = 86/135 (64%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKIKG VVLM+KNVLDFNDFNAS++D + + LGQ VSL+LVS+V  D  NGL+GK  K A
Sbjct  16   KKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLVSAVHGDPANGLQGKLGKPA  75

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ W+   T L +GESAFK+ F+W E+ G P AFII+NNH +EFYL+TLTLEDVP  G 
Sbjct  76   YLEDWITTITSLTAGESAFKVTFDWDEEIGEPGAFIIRNNHHSEFYLRTLTLEDVPGRGR  135

Query  459  VHFACFSWVYPASKY  503
            +HF C SWVYPA  Y
Sbjct  136  IHFVCNSWVYPAKHY  150



>emb|CBI36801.3| unnamed protein product [Vitis vinifera]
Length=738

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKIKG VVLM+KNVLDFNDFNAS++D + + LGQ VSL+LVS+V  D  NGL+GK  K A
Sbjct  16   KKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLVSAVHGDPANGLQGKLGKPA  75

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ W+   T L +GESAFK+ F+W E+ G P AFII+NNH +EFYL+TLTLEDVP  G 
Sbjct  76   YLEDWITTITSLTAGESAFKVTFDWDEEIGEPGAFIIRNNHHSEFYLRTLTLEDVPGRGR  135

Query  459  VHFACFSWVYPASKY  503
            +HF C SWVYPA  Y
Sbjct  136  IHFVCNSWVYPAKHY  150



>ref|XP_006382594.1| hypothetical protein POPTR_0005s03560g [Populus trichocarpa]
 gb|ERP60391.1| hypothetical protein POPTR_0005s03560g [Populus trichocarpa]
Length=866

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 109/137 (80%), Gaps = 1/137 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLKGKRSKA  275
            KKIKG VVLM+KNVLDFNDFNAS++D + +FLGQ+VSL+LVS+V +D   N LKGK  + 
Sbjct  22   KKIKGTVVLMKKNVLDFNDFNASVLDRVHEFLGQRVSLQLVSAVNSDPSENDLKGKLGEP  81

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            AYL+ W+   T L +GESAFK+ F+W E+ GVP AF+I+NNH +EFYLKT+TLEDVP  G
Sbjct  82   AYLEEWITTITSLTAGESAFKVTFDWDEEIGVPGAFLIRNNHHSEFYLKTVTLEDVPGQG  141

Query  456  EVHFACFSWVYPASKYN  506
             VHF C SW+YP ++YN
Sbjct  142  RVHFVCNSWIYPTTRYN  158



>ref|NP_001268178.1| lipoxygenase [Vitis vinifera]
 gb|ACZ17392.1| lipoxygenase [Vitis vinifera]
Length=859

 Score =   187 bits (476),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKIKG VVLM+KNVLDFNDFNAS++D + + LGQ VSL+LVS+V  D  NGL+GK  K A
Sbjct  16   KKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLVSAVHGDPANGLQGKLGKPA  75

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ W+   T L +GESAFK+ F+W E+ G P AFII+NNH +EFYL+TLTLEDVP  G 
Sbjct  76   YLEDWITTITSLTAGESAFKVTFDWDEEIGEPGAFIIRNNHHSEFYLRTLTLEDVPGCGR  135

Query  459  VHFACFSWVYPASKY  503
            +HF C SWVYPA  Y
Sbjct  136  IHFVCNSWVYPAKHY  150



>gb|AGU28274.1| lipoxygenase 1 [Vitis vinifera]
Length=859

 Score =   187 bits (476),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKIKG VVLM+KNVLDFNDFNAS++D + + LGQ VSL+LVS+V  D  NGL+GK  K A
Sbjct  16   KKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLVSAVHGDPANGLQGKLGKPA  75

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ W+   T L +GESAFK+ F+W E+ G P AFII+NNH +EFYL+TLTLEDVP  G 
Sbjct  76   YLEDWITTITSLTAGESAFKVTFDWDEEIGEPGAFIIRNNHHSEFYLRTLTLEDVPGCGR  135

Query  459  VHFACFSWVYPASKY  503
            +HF C SWVYPA  Y
Sbjct  136  IHFVCNSWVYPAKHY  150



>gb|KCW61797.1| hypothetical protein EUGRSUZ_H04495 [Eucalyptus grandis]
Length=443

 Score =   182 bits (463),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 105/136 (77%), Gaps = 0/136 (0%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            +KK+KG VVLM+KNVLDFNDFNAS++D + +  GQK+SL+LVS+V  D   GL+GK  K 
Sbjct  21   SKKVKGTVVLMKKNVLDFNDFNASVLDRVHELFGQKISLQLVSAVHGDPEKGLRGKLGKP  80

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            AYL+ W+   T L +G+SAFK+ F+W E+ GVP A I++N H ++FYLKT+TLEDVP  G
Sbjct  81   AYLEDWITTITPLTAGDSAFKVTFDWDEEVGVPGAIIVQNKHHSQFYLKTVTLEDVPGEG  140

Query  456  EVHFACFSWVYPASKY  503
            +VHF C SWVYPA +Y
Sbjct  141  QVHFVCNSWVYPADQY  156



>ref|XP_010025193.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61802.1| hypothetical protein EUGRSUZ_H04499 [Eucalyptus grandis]
Length=871

 Score =   187 bits (474),  Expect = 9e-52, Method: Composition-based stats.
 Identities = 83/136 (61%), Positives = 108/136 (79%), Gaps = 0/136 (0%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            +KK+KG VVLM+K VLDFNDFNAS++DN+++ LG+KVSL LVS+V  D   GL+GK  K 
Sbjct  27   SKKVKGTVVLMKKYVLDFNDFNASVLDNVAELLGKKVSLRLVSAVHGDPEKGLRGKLGKP  86

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            AYL+ W+   T LA+G+SAFK+ F+W E+ GVP A I++NNH ++FYLKT+TLEDVP  G
Sbjct  87   AYLEEWITTITPLAAGDSAFKVTFDWDEEVGVPGAIIVQNNHHSQFYLKTITLEDVPGEG  146

Query  456  EVHFACFSWVYPASKY  503
             VHF C SWVYPA++Y
Sbjct  147  RVHFVCNSWVYPANQY  162



>ref|XP_009365900.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=863

 Score =   187 bits (474),  Expect = 9e-52, Method: Composition-based stats.
 Identities = 85/145 (59%), Positives = 110/145 (76%), Gaps = 0/145 (0%)
 Frame = +3

Query  69   GKLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN  248
            G+  +  S   KI G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V  D  N
Sbjct  11   GQQQDGESNIGKINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDN  70

Query  249  GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTL  428
            GLKGK  K AYL+ W+   T L +GESAFK+ F+W E+ GVP AFII+NNH +EF+LKT+
Sbjct  71   GLKGKLGKQAYLEDWISTITPLTAGESAFKVTFDWEEEVGVPGAFIIQNNHHSEFFLKTV  130

Query  429  TLEDVPNHGEVHFACFSWVYPASKY  503
            TL++VP+ G VHF C SWVYPA KY
Sbjct  131  TLDNVPDEGRVHFVCNSWVYPAEKY  155



>ref|XP_006382593.1| hypothetical protein POPTR_0005s03550g [Populus trichocarpa]
 gb|ERP60390.1| hypothetical protein POPTR_0005s03550g [Populus trichocarpa]
Length=847

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 107/137 (78%), Gaps = 1/137 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLKGKRSKA  275
            KKIKG VVLM+KNVLDFNDFNAS++D + +FLGQ VSL+LVS+V +D   N LKGK  + 
Sbjct  3    KKIKGTVVLMKKNVLDFNDFNASVLDRVHEFLGQGVSLQLVSAVNSDPSENDLKGKLGEP  62

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            AYL+ W+   T L +GESAFK+ F+W E+ GVP AF+I+NNH +EFYLKT+TLEDVP  G
Sbjct  63   AYLEEWITTITSLTAGESAFKVTFDWDEEIGVPGAFLIRNNHHSEFYLKTVTLEDVPGQG  122

Query  456  EVHFACFSWVYPASKYN  506
             VHF C SW+YP  +YN
Sbjct  123  RVHFVCNSWIYPTKRYN  139



>gb|AGI16377.1| lipoxygenase [Malus domestica]
Length=863

 Score =   186 bits (471),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 85/145 (59%), Positives = 109/145 (75%), Gaps = 0/145 (0%)
 Frame = +3

Query  69   GKLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN  248
            G+  +  S   KI G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V  D  N
Sbjct  11   GQQQDGESNIGKINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDN  70

Query  249  GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTL  428
            GLKG   K AYL+ W+   T L +GESAFKI F+W E+ GVP AFII+NNH +EF+LKT+
Sbjct  71   GLKGNLGKQAYLEDWITTITPLTAGESAFKITFDWEEEVGVPGAFIIQNNHHSEFFLKTV  130

Query  429  TLEDVPNHGEVHFACFSWVYPASKY  503
            TL++VP+ G VHF C SWVYPA KY
Sbjct  131  TLDNVPDEGHVHFVCNSWVYPAEKY  155



>gb|AGI16382.1| lipoxygenase [Malus domestica]
Length=863

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +3

Query  69   GKLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN  248
            G+  +  S   KI G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V  D  N
Sbjct  11   GQQQDGESNIGKINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDN  70

Query  249  GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTL  428
            GLKG   K AYL+ W+   T L +GESAFK+ F+W E+ GVP AFII+NNH +EF+LKT+
Sbjct  71   GLKGNLGKQAYLEDWITTITPLTAGESAFKVTFDWEEEVGVPGAFIIQNNHHSEFFLKTV  130

Query  429  TLEDVPNHGEVHFACFSWVYPASKYN  506
            TL++VPN G VHF C SWVYPA KY 
Sbjct  131  TLDNVPNEGRVHFVCNSWVYPAEKYT  156



>emb|CAD10740.1| lipoxygenase [Corylus avellana]
Length=873

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 108/141 (77%), Gaps = 1/141 (1%)
 Frame = +3

Query  84   ALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADL-GNGLKG  260
            A    +KI+G VVLM+KNVLDFNDFNAS++D + + LGQKVSL+L+S+V AD   NGL+G
Sbjct  25   AAEKCRKIEGSVVLMKKNVLDFNDFNASVLDRVHELLGQKVSLQLISAVNADPSANGLQG  84

Query  261  KRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLED  440
            K    AYL+HW+   T L +GESAFK+ F+W ED  +P AF+I+NNH +EFYLK+LTLED
Sbjct  85   KLGNLAYLEHWISTITPLIAGESAFKVTFDWDEDIAIPGAFLIRNNHHSEFYLKSLTLED  144

Query  441  VPNHGEVHFACFSWVYPASKY  503
            VP  G +HF C SWVYPA +Y
Sbjct  145  VPGQGRIHFVCNSWVYPADQY  165



>ref|XP_008348093.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Malus domestica]
Length=863

 Score =   185 bits (470),  Expect = 3e-51, Method: Composition-based stats.
 Identities = 84/145 (58%), Positives = 109/145 (75%), Gaps = 0/145 (0%)
 Frame = +3

Query  69   GKLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN  248
            G+  +  S   KI G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V  D  N
Sbjct  11   GQQQDGESNIGKINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDN  70

Query  249  GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTL  428
            GLKG   K AYL+ W+   T L +GESAFK+ F+W E+ GVP AFII+NNH +EF+LKT+
Sbjct  71   GLKGNLGKQAYLEDWITTITPLTAGESAFKVTFDWEEEVGVPGAFIIQNNHHSEFFLKTV  130

Query  429  TLEDVPNHGEVHFACFSWVYPASKY  503
            TL++VP+ G VHF C SWVYPA KY
Sbjct  131  TLDNVPDEGRVHFVCNSWVYPAEKY  155



>sp|Q43190.1|LOX14_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 4; AltName: 
Full=Root lipoxygenase [Solanum tuberosum]
 gb|AAB67860.1| lipoxygenase [Solanum tuberosum]
Length=860

 Score =   184 bits (468),  Expect = 5e-51, Method: Composition-based stats.
 Identities = 82/136 (60%), Positives = 108/136 (79%), Gaps = 0/136 (0%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            +KK+KG VV+M+KN LDF D   S+ D + + LGQKVS +L+SSVQ+D  NGL+GK S  
Sbjct  16   SKKVKGTVVMMKKNALDFTDLAGSLTDKIFEALGQKVSFQLISSVQSDPANGLQGKHSNP  75

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            AYL++++   T LA+GE+AF + F+W+E+FGVP AFIIKN H NEF+LK+LTLEDVPNHG
Sbjct  76   AYLENFLFTLTPLAAGETAFGVTFDWNEEFGVPGAFIIKNTHINEFFLKSLTLEDVPNHG  135

Query  456  EVHFACFSWVYPASKY  503
            +VHF C SWVYP+ +Y
Sbjct  136  KVHFVCNSWVYPSFRY  151



>emb|CCD74473.1| lipoxygenase 1, partial [Arabidopsis halleri subsp. halleri]
Length=381

 Score =   179 bits (453),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            TKK+KG VVLM+KNVLDFNDFNAS +D L +FLG K++L L+SS   D  NG KGK  KA
Sbjct  16   TKKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLRLISSDVTDSENGSKGKLGKA  75

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            A+L+ W+   T L +GESAFK+ F++  DFG P AF+IKN+H +EF+L++LTLEDVP HG
Sbjct  76   AHLEDWITTITSLTAGESAFKVTFDYDSDFGYPGAFLIKNSHFSEFFLRSLTLEDVPGHG  135

Query  456  EVHFACFSWVYPASKYN  506
             VH+ C SW+YPA  Y 
Sbjct  136  RVHYICNSWIYPAKHYT  152



>gb|KCW61796.1| hypothetical protein EUGRSUZ_H04495 [Eucalyptus grandis]
Length=614

 Score =   182 bits (463),  Expect = 7e-51, Method: Composition-based stats.
 Identities = 80/136 (59%), Positives = 105/136 (77%), Gaps = 0/136 (0%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            +KK+KG VVLM+KNVLDFNDFNAS++D + +  GQK+SL+LVS+V  D   GL+GK  K 
Sbjct  21   SKKVKGTVVLMKKNVLDFNDFNASVLDRVHELFGQKISLQLVSAVHGDPEKGLRGKLGKP  80

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            AYL+ W+   T L +G+SAFK+ F+W E+ GVP A I++N H ++FYLKT+TLEDVP  G
Sbjct  81   AYLEDWITTITPLTAGDSAFKVTFDWDEEVGVPGAIIVQNKHHSQFYLKTVTLEDVPGEG  140

Query  456  EVHFACFSWVYPASKY  503
            +VHF C SWVYPA +Y
Sbjct  141  QVHFVCNSWVYPADQY  156



>ref|XP_011023610.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=871

 Score =   184 bits (467),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 109/146 (75%), Gaps = 1/146 (1%)
 Frame = +3

Query  72   KLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-N  248
            KL       KKIKG VVLM+KNVL FNDF+ASI+D + + LGQ+VSL+L+S+V +D   N
Sbjct  18   KLKRGDGECKKIKGTVVLMKKNVLSFNDFHASILDRVHELLGQRVSLQLISAVNSDRSEN  77

Query  249  GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTL  428
             LKGK  + AYL+ WV   T L +GE+AFK+ F+W E+ GVP AF+I+NNH NEFYL+T+
Sbjct  78   DLKGKLGEPAYLEEWVTTVTPLTAGEAAFKVTFDWDEEIGVPGAFLIRNNHLNEFYLRTV  137

Query  429  TLEDVPNHGEVHFACFSWVYPASKYN  506
            TLE VP HG VHF C SW+YPA +YN
Sbjct  138  TLEGVPGHGRVHFVCNSWIYPAKRYN  163



>gb|AGI16378.1| lipoxygenase [Malus domestica]
 gb|AGI16381.1| lipoxygenase [Malus domestica]
 gb|AGK82777.1| lipoxygenase [Malus domestica]
 gb|AGK82799.1| lipoxygenase [Malus domestica]
Length=863

 Score =   184 bits (467),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +3

Query  69   GKLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN  248
            G+  +  S   KI G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V  D  N
Sbjct  11   GQQQDGESNIGKINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDN  70

Query  249  GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTL  428
            GLKG   K AYL+ W+   T L +GESAFK+ F+W E+ GVP AFII+NNH +EF+LKT+
Sbjct  71   GLKGNLGKQAYLEDWITTITPLTAGESAFKVTFDWEEEVGVPGAFIIQNNHHSEFFLKTV  130

Query  429  TLEDVPNHGEVHFACFSWVYPASKYN  506
            TL++VP+ G VHF C SWVYPA KY 
Sbjct  131  TLDNVPDEGRVHFVCNSWVYPAEKYT  156



>gb|AGI16380.1| lipoxygenase [Malus domestica]
Length=863

 Score =   184 bits (467),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +3

Query  69   GKLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN  248
            G+  +  S   KI G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V  D  N
Sbjct  11   GQQQDGESNIGKINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDN  70

Query  249  GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTL  428
            GLKG   K AYL+ W+   T L +GESAFK+ F+W E+ GVP AFII+NNH +EF+LKT+
Sbjct  71   GLKGNLGKQAYLEDWITTITPLTAGESAFKVTFDWEEEVGVPGAFIIQNNHHSEFFLKTV  130

Query  429  TLEDVPNHGEVHFACFSWVYPASKYN  506
            TL++VP+ G VHF C SWVYPA KY 
Sbjct  131  TLDNVPDEGRVHFVCNSWVYPAEKYT  156



>ref|XP_009597615.1| PREDICTED: linoleate 9S-lipoxygenase 6 [Nicotiana tomentosiformis]
Length=861

 Score =   184 bits (467),  Expect = 9e-51, Method: Composition-based stats.
 Identities = 83/136 (61%), Positives = 104/136 (76%), Gaps = 0/136 (0%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            +KK+KG VV+M+KN LDF D   S+VD + +FLGQKVSL+L+SS   D  N L+GK S  
Sbjct  17   SKKVKGIVVMMKKNALDFTDIAGSVVDGVLEFLGQKVSLQLISSAHGDPANDLQGKHSNP  76

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            AYL+ W+   T L +GESA+ + F+W E+FGVP AFIIKN H  EF+LK++TLEDVPNHG
Sbjct  77   AYLEKWLTTITPLTAGESAYSVTFDWEEEFGVPGAFIIKNLHFTEFFLKSVTLEDVPNHG  136

Query  456  EVHFACFSWVYPASKY  503
            +VHF C SWVYPASKY
Sbjct  137  KVHFVCNSWVYPASKY  152



>ref|XP_010659859.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Vitis vinifera]
Length=875

 Score =   183 bits (465),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 82/135 (61%), Positives = 102/135 (76%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKI+G +VLM+KNVLDFNDFNA + D + +  GQ VSL+LVS+V  D  NGL+GK  K A
Sbjct  32   KKIEGTIVLMKKNVLDFNDFNAPVRDRVHELFGQGVSLQLVSAVHGDPANGLQGKIGKPA  91

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ W++  T L +GESAFK+ F+W E+ G P AFII+NNH +EFYL+TLTLEDVP  G 
Sbjct  92   YLEDWIITITSLTAGESAFKVTFDWDEEIGEPGAFIIRNNHHSEFYLRTLTLEDVPGRGR  151

Query  459  VHFACFSWVYPASKY  503
            +HF C SWVYPA  Y
Sbjct  152  IHFVCNSWVYPAQHY  166



>gb|AAG00881.1|AC064840_12 lipoxygenase - partial coding sequence [Arabidopsis thaliana]
Length=391

 Score =   177 bits (450),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 103/137 (75%), Gaps = 0/137 (0%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            TKK+KG VVLM+KNVLDFNDFNAS +D L +FLG K++L LVSS   D  NG KGK  KA
Sbjct  18   TKKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLRLVSSDVTDSENGSKGKLGKA  77

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            A+L+ W+   T L +GESAFK+ F++  DFG P AF+I+N+H +EF LK+LTLEDVP HG
Sbjct  78   AHLEDWITTITSLTAGESAFKVTFDYETDFGYPGAFLIRNSHFSEFLLKSLTLEDVPGHG  137

Query  456  EVHFACFSWVYPASKYN  506
             VH+ C SW+YPA  Y 
Sbjct  138  RVHYICNSWIYPAKHYT  154



>emb|CBI36802.3| unnamed protein product [Vitis vinifera]
Length=900

 Score =   183 bits (465),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 82/135 (61%), Positives = 102/135 (76%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKI+G +VLM+KNVLDFNDFNA + D + +  GQ VSL+LVS+V  D  NGL+GK  K A
Sbjct  57   KKIEGTIVLMKKNVLDFNDFNAPVRDRVHELFGQGVSLQLVSAVHGDPANGLQGKIGKPA  116

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ W++  T L +GESAFK+ F+W E+ G P AFII+NNH +EFYL+TLTLEDVP  G 
Sbjct  117  YLEDWIITITSLTAGESAFKVTFDWDEEIGEPGAFIIRNNHHSEFYLRTLTLEDVPGRGR  176

Query  459  VHFACFSWVYPASKY  503
            +HF C SWVYPA  Y
Sbjct  177  IHFVCNSWVYPAQHY  191



>ref|XP_010025196.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61795.1| hypothetical protein EUGRSUZ_H04495 [Eucalyptus grandis]
Length=864

 Score =   182 bits (463),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 80/136 (59%), Positives = 105/136 (77%), Gaps = 0/136 (0%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            +KK+KG VVLM+KNVLDFNDFNAS++D + +  GQK+SL+LVS+V  D   GL+GK  K 
Sbjct  21   SKKVKGTVVLMKKNVLDFNDFNASVLDRVHELFGQKISLQLVSAVHGDPEKGLRGKLGKP  80

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            AYL+ W+   T L +G+SAFK+ F+W E+ GVP A I++N H ++FYLKT+TLEDVP  G
Sbjct  81   AYLEDWITTITPLTAGDSAFKVTFDWDEEVGVPGAIIVQNKHHSQFYLKTVTLEDVPGEG  140

Query  456  EVHFACFSWVYPASKY  503
            +VHF C SWVYPA +Y
Sbjct  141  QVHFVCNSWVYPADQY  156



>emb|CDP20618.1| unnamed protein product [Coffea canephora]
Length=857

 Score =   182 bits (463),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 89/146 (61%), Positives = 104/146 (71%), Gaps = 2/146 (1%)
 Frame = +3

Query  69   GKLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN  248
            GK  EA    KKIKG VVLM+KNVLDF DFNASI D + + LG+KVSL+LVSSV  D   
Sbjct  6    GKHGEA--NKKKIKGTVVLMKKNVLDFTDFNASIADEVHELLGKKVSLQLVSSVNGDPEK  63

Query  249  GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTL  428
            G +GK    AYL+ W+  N  L  GES F I F+W E+  VP AFIIKN+H +EF+LKT+
Sbjct  64   GQQGKLGSPAYLEGWITTNHRLTVGESVFNITFDWEEEVEVPGAFIIKNHHHSEFFLKTV  123

Query  429  TLEDVPNHGEVHFACFSWVYPASKYN  506
            TLEDVP HG +HF C SWVYPA KYN
Sbjct  124  TLEDVPGHGRIHFVCNSWVYPAKKYN  149



>ref|XP_011036799.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=866

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 105/137 (77%), Gaps = 1/137 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLKGKRSKA  275
            KKIKG VVLM+KNVLDFNDFNAS++D + + LG  VSL+LVS+V +D   N LKGK  + 
Sbjct  22   KKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGHGVSLQLVSAVNSDPSENDLKGKLGEP  81

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            AYL+ W+   T L +GESAFK+ F+W E+ GVP AF+I+NNH +EFYLKT+TLEDVP  G
Sbjct  82   AYLEEWITTITSLTAGESAFKVTFDWDEEIGVPGAFLIRNNHHSEFYLKTVTLEDVPGQG  141

Query  456  EVHFACFSWVYPASKYN  506
             VHF C SWVYP  +YN
Sbjct  142  RVHFVCNSWVYPTKRYN  158



>ref|NP_001234856.1| linoleate 9S-lipoxygenase A [Solanum lycopersicum]
 sp|P38415.1|LOXA_SOLLC RecName: Full=Linoleate 9S-lipoxygenase A; AltName: Full=Lipoxygenase 
A [Solanum lycopersicum]
 gb|AAA53184.1| lipoxygenase [Solanum lycopersicum]
Length=860

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 109/136 (80%), Gaps = 0/136 (0%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            +KK+KG VV+M+KN LDF D   S+ D + + LGQKVS +L+SSVQ+D  NGL+GK S  
Sbjct  16   SKKVKGTVVMMKKNALDFTDLAGSLTDKIFEALGQKVSFQLISSVQSDPANGLQGKHSNP  75

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            AYL++++L  T LA+GE+AF + F+W+E+FGVP AF+IKN H NEF+LK+LTLEDVPNHG
Sbjct  76   AYLENFLLTLTPLAAGETAFGVTFDWNEEFGVPGAFVIKNMHINEFFLKSLTLEDVPNHG  135

Query  456  EVHFACFSWVYPASKY  503
            +VHF C SWVYP+ +Y
Sbjct  136  KVHFVCNSWVYPSFRY  151



>sp|Q41238.1|LOX16_SOLTU RecName: Full=Linoleate 9S-lipoxygenase 6; AltName: Full=Lipoxygenase 
1-5; Short=StLOX1; Short=lox1:St:3, partial [Solanum 
tuberosum]
 gb|AAB31252.1| linoleate:oxygen oxidoreductase, partial [Solanum tuberosum]
Length=857

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 108/136 (79%), Gaps = 0/136 (0%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            +KK+KG VV+M+KN LDF D   S+ D + + LGQKVS +L+SSVQ+D  NGL+GK S  
Sbjct  13   SKKVKGTVVMMKKNALDFTDLAGSLTDKIFEALGQKVSFQLISSVQSDPANGLQGKHSNP  72

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            AYL++++   T LA+GE+AF + F+W+E+FGVP AFIIKN H NEF+LK+LTLEDVPNHG
Sbjct  73   AYLENFLFTLTPLAAGETAFGVTFDWNEEFGVPGAFIIKNTHINEFFLKSLTLEDVPNHG  132

Query  456  EVHFACFSWVYPASKY  503
            +VHF C SWVYP+ +Y
Sbjct  133  KVHFVCNSWVYPSFRY  148



>gb|ABF19102.2| 9-lipoxygenase [Capsicum annuum]
Length=862

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 110/136 (81%), Gaps = 2/136 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            +K+KG+VVLM+KNVLDF D  AS++D + +FLGQ+VS EL+S+   D  NGL+GKRSK A
Sbjct  17   EKVKGRVVLMKKNVLDFTDVTASVLDGVLEFLGQRVSFELISTSLHD-ENGLEGKRSKPA  75

Query  279  YLDHWVLKNTVLASGESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            YL+HW+   T +A+GESAF + F+W  E+ GVP AFIIKN H +EF+LK+LTLEDVPNHG
Sbjct  76   YLEHWLTNITPIAAGESAFSVTFDWDHEELGVPGAFIIKNLHFSEFFLKSLTLEDVPNHG  135

Query  456  EVHFACFSWVYPASKY  503
            ++HF C SWVYPASKY
Sbjct  136  KIHFVCDSWVYPASKY  151



>gb|AGI16379.1| lipoxygenase [Malus domestica]
 gb|AGK82797.1| lipoxygenase [Malus domestica]
Length=863

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +3

Query  69   GKLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN  248
            G+  +  S   KI G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V  D  N
Sbjct  11   GQQQDGESNIGKINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDN  70

Query  249  GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTL  428
            GLKG   K AYL+ W+   T L +GESAFK+ F+W E+ GVP AFII+NNH +EF+LKT+
Sbjct  71   GLKGNLGKQAYLEDWITTFTPLTAGESAFKVTFDWEEEVGVPGAFIIQNNHHSEFFLKTV  130

Query  429  TLEDVPNHGEVHFACFSWVYPASKYN  506
            TL++VP+ G VHF C SWVYPA  Y 
Sbjct  131  TLDNVPDEGRVHFVCNSWVYPAENYT  156



>gb|AGK82798.1| lipoxygenase [Malus domestica]
Length=864

 Score =   182 bits (461),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +3

Query  69   GKLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN  248
            G+  +  S   KI G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V  D  N
Sbjct  11   GQQQDGESNIGKINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDN  70

Query  249  GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTL  428
            GLKG   K AYL+ W+   T L +GESAFK+ F+W E+ GVP AFII+NNH +EF+LKT+
Sbjct  71   GLKGNLGKQAYLEDWITTFTPLTAGESAFKVTFDWEEEVGVPGAFIIQNNHHSEFFLKTV  130

Query  429  TLEDVPNHGEVHFACFSWVYPASKYN  506
            TL++VP+ G VHF C SWVYPA  Y 
Sbjct  131  TLDNVPDEGRVHFVCNSWVYPAENYT  156



>gb|AEQ30071.1| lipoxygenase [Litchi chinensis]
Length=872

 Score =   182 bits (461),  Expect = 6e-50, Method: Composition-based stats.
 Identities = 88/145 (61%), Positives = 110/145 (76%), Gaps = 1/145 (1%)
 Frame = +3

Query  72   KLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQAD-LGN  248
            KL    S ++KI+G VVLM+KNVLDFNDF+AS++D + + LG+ VSL+LVS+V AD   N
Sbjct  19   KLKMGGSQSRKIQGTVVLMKKNVLDFNDFHASLLDRVHELLGKGVSLQLVSAVHADSQAN  78

Query  249  GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTL  428
            GL GK  + AYL  W+ K T LA+GESAFK+ F+  E+ GVP AFI+KNNH +EFYLKTL
Sbjct  79   GLGGKVGEPAYLKDWITKITPLAAGESAFKVTFDADEEIGVPGAFIVKNNHHSEFYLKTL  138

Query  429  TLEDVPNHGEVHFACFSWVYPASKY  503
            TL+DVP HG +HF C SWVYPA  Y
Sbjct  139  TLDDVPRHGRMHFVCNSWVYPAKYY  163



>gb|KHN16119.1| Putative linoleate 9S-lipoxygenase 5 [Glycine soja]
Length=852

 Score =   181 bits (460),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 105/139 (76%), Gaps = 2/139 (1%)
 Frame = +3

Query  93   PTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNG--LKGKR  266
            P  ++KG VVLM+KNVLDFNDF+AS +D L +F+G++VSL+LVSSV  D GNG  LKGK 
Sbjct  19   PGHRVKGTVVLMKKNVLDFNDFSASFLDRLHEFVGKRVSLQLVSSVNVDPGNGNGLKGKL  78

Query  267  SKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVP  446
             K AYL+ W+     L +GE+AFK+ FEW E+ G P AFII+NNH +EFYLK+LTLEDVP
Sbjct  79   GKPAYLEDWITTIAPLTAGEAAFKVTFEWDEEIGTPGAFIIRNNHHSEFYLKSLTLEDVP  138

Query  447  NHGEVHFACFSWVYPASKY  503
              G + F C SWVYPA KY
Sbjct  139  GQGVIRFICNSWVYPADKY  157



>ref|XP_003536076.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Glycine 
max]
Length=865

 Score =   181 bits (460),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 105/139 (76%), Gaps = 2/139 (1%)
 Frame = +3

Query  93   PTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNG--LKGKR  266
            P  ++KG VVLM+KNVLDFNDF+AS +D L +F+G++VSL+LVSSV  D GNG  LKGK 
Sbjct  19   PGHRVKGTVVLMKKNVLDFNDFSASFLDRLHEFVGKRVSLQLVSSVNVDPGNGNGLKGKL  78

Query  267  SKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVP  446
             K AYL+ W+     L +GE+AFK+ FEW E+ G P AFII+NNH +EFYLK+LTLEDVP
Sbjct  79   GKPAYLEDWITTIAPLTAGEAAFKVTFEWDEEIGTPGAFIIRNNHHSEFYLKSLTLEDVP  138

Query  447  NHGEVHFACFSWVYPASKY  503
              G + F C SWVYPA KY
Sbjct  139  GQGVIRFICNSWVYPADKY  157



>ref|XP_009787604.1| PREDICTED: linoleate 9S-lipoxygenase 6 [Nicotiana sylvestris]
Length=861

 Score =   181 bits (459),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 81/136 (60%), Positives = 105/136 (77%), Gaps = 0/136 (0%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            +KK+KG VV+M+KN LDF D   S+VD + +FLGQKVSL+L+SS   D  N L+GK S  
Sbjct  17   SKKVKGIVVMMKKNALDFTDIAGSVVDGVLEFLGQKVSLQLISSAHGDPANDLQGKHSNP  76

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            AYL++W+   T L +GESA+ + F+W E+FG+P AFIIKN H  EF+LK++TLEDVPNHG
Sbjct  77   AYLENWLTTITPLTAGESAYGVTFDWDEEFGLPGAFIIKNLHFTEFFLKSVTLEDVPNHG  136

Query  456  EVHFACFSWVYPASKY  503
            +VHF C SWVYPA+KY
Sbjct  137  KVHFVCNSWVYPANKY  152



>ref|XP_010025195.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61798.1| hypothetical protein EUGRSUZ_H04496 [Eucalyptus grandis]
Length=871

 Score =   181 bits (459),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 80/136 (59%), Positives = 105/136 (77%), Gaps = 0/136 (0%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            +KK+ G VVLM+K VLDFNDFNAS++D + + LG+KVSL LVS+V +D  NGL+GK  K 
Sbjct  27   SKKVIGTVVLMKKYVLDFNDFNASVLDTIHELLGEKVSLRLVSAVHSDPENGLQGKLGKP  86

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            AYL+ W+   T L +G+SAFK+ F+W ++ GVP A I++NNH ++FYLKT+TLEDVP  G
Sbjct  87   AYLEKWITTITPLTAGDSAFKVTFDWDKEVGVPGAIIVQNNHHSQFYLKTITLEDVPGEG  146

Query  456  EVHFACFSWVYPASKY  503
             VHF C SWVYPA +Y
Sbjct  147  RVHFVCNSWVYPADRY  162



>gb|ABW75772.2| lipoxygenase [Camellia sinensis]
Length=861

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 105/136 (77%), Gaps = 1/136 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLKGKRSKA  275
            KKIKG VVLM+KNVLDFNDFNASI+D + + LGQKVSL+L+S+V ADL   GLKGK  K 
Sbjct  17   KKIKGTVVLMKKNVLDFNDFNASILDRVHELLGQKVSLQLISAVNADLTVKGLKGKLGKP  76

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            AYL+ W+   T L +G+SA+ + F+W E+ GVP AFII+N H +EFYLK+LTL+ VP HG
Sbjct  77   AYLEDWITTITPLTAGDSAYDVTFDWDEEIGVPGAFIIRNFHHSEFYLKSLTLDHVPGHG  136

Query  456  EVHFACFSWVYPASKY  503
             VHF C SWVYPA  Y
Sbjct  137  RVHFVCNSWVYPAKNY  152



>ref|XP_007208098.1| hypothetical protein PRUPE_ppa001293mg [Prunus persica]
 gb|EMJ09297.1| hypothetical protein PRUPE_ppa001293mg [Prunus persica]
Length=862

 Score =   181 bits (458),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 81/136 (60%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            ++KIKG VVLM+KNVLDFNDFNAS++D + + LGQ VSL+L+S+   D  NG KGK  + 
Sbjct  19   SRKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLISADHGDSENGFKGKLGEP  78

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            AYL+ W+   T L  G+SA+K+ F+W E+ GVP A +IKNNH +EF+LKT+TLEDVP  G
Sbjct  79   AYLEDWITTITPLTVGDSAYKVTFDWEEEIGVPGAILIKNNHHSEFFLKTITLEDVPREG  138

Query  456  EVHFACFSWVYPASKY  503
             VHF C SWVYPA KY
Sbjct  139  RVHFVCNSWVYPAEKY  154



>ref|XP_004494612.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cicer arietinum]
Length=863

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  IKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAYL  284
            I+GKVVLM+KNVLDFND +AS +D+L +F+G++VSL+LVS+V+ D GN +KGK  KA YL
Sbjct  22   IRGKVVLMKKNVLDFNDLSASFLDDLHEFVGKRVSLQLVSAVKVDPGNDMKGKVGKAEYL  81

Query  285  DHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVH  464
            + W+  +T L +GES F + F+W ED G P AFIIKNNH +EFYLK+ TLE+VP+ G +H
Sbjct  82   EDWITTSTPLIAGESTFSVTFDWDEDIGTPGAFIIKNNHHSEFYLKSFTLENVPSQGVIH  141

Query  465  FACFSWVYPASKY  503
            F C SWVYPA KY
Sbjct  142  FICNSWVYPAHKY  154



>ref|XP_004302420.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=863

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            TK+I G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V AD  NGLKGK  K 
Sbjct  19   TKQITGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVNADSDNGLKGKLGKP  78

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            AYL+ W+   T L +G+SA+K+ F+W ++ GVP A +IKNNH ++FYLKT+TLE+VP  G
Sbjct  79   AYLEDWISTITPLTAGDSAYKVTFDWDDEIGVPGAILIKNNHHSQFYLKTITLENVPGEG  138

Query  456  EVHFACFSWVYPASK  500
             VHF C SWVYPA K
Sbjct  139  TVHFVCNSWVYPAEK  153



>ref|XP_010414944.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Camelina sativa]
Length=860

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            TKK+KG VVLM+KNVLDFNDFNAS +D L +FLG K++L L+SS   D  NG KGK  KA
Sbjct  19   TKKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLRLISSDVTDSANGSKGKLGKA  78

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            A+L+ W+ + T L +GESAFK+ F++  DFG P AF+I+N+H +EF+LK+LTLEDVP HG
Sbjct  79   AHLEDWITRITSLTAGESAFKVTFDYDSDFGYPGAFLIRNSHFSEFFLKSLTLEDVPGHG  138

Query  456  EVHFACFSWVYPASKYN  506
             VH+ C SW+YPA  Y 
Sbjct  139  RVHYICNSWIYPAKHYT  155



>gb|AFU51542.1| lipoxygenase 3 [Capsicum annuum]
Length=859

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 106/136 (78%), Gaps = 0/136 (0%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            +KK+KG VV+M+KN LDF D   S+ D L + LGQKVSL+L+SSVQ D  NGL+GK S  
Sbjct  15   SKKVKGTVVMMKKNALDFTDLAGSLTDKLFEALGQKVSLQLISSVQGDPANGLQGKHSNP  74

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            AYL++++   T L +GESAF + F+W+E+FGVP AF IKN+H NEF+LK+L LEDVPNHG
Sbjct  75   AYLENFLFTPTRLTAGESAFGVTFDWNEEFGVPGAFTIKNSHINEFFLKSLILEDVPNHG  134

Query  456  EVHFACFSWVYPASKY  503
            +VHF C SWVYP+ +Y
Sbjct  135  KVHFVCNSWVYPSFRY  150



>emb|CAA64767.1| lipoxygenase [Solanum tuberosum]
Length=454

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 106/137 (77%), Gaps = 1/137 (1%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            +KK+KG VV+M+KN LDF D   S+ D + + LGQKVS +L+SSVQ D  NGL+GK+S  
Sbjct  16   SKKVKGTVVMMKKNALDFTDLAGSLTDKMFEVLGQKVSFQLISSVQGDPTNGLQGKQSNP  75

Query  276  AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  452
            AYL++ +   T L +G E+AF + F+W+E+FGVP AFIIKN H NEF+LK+LTLEDVPNH
Sbjct  76   AYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNTHINEFFLKSLTLEDVPNH  135

Query  453  GEVHFACFSWVYPASKY  503
            G+VHF C SWVYP+ +Y
Sbjct  136  GKVHFVCNSWVYPSFRY  152



>emb|CAB94852.1| lipoxygenase [Prunus dulcis]
Length=862

 Score =   180 bits (457),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 81/136 (60%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            ++KIKG VVLM+KNVLDFNDFNAS++D + + LGQ VSL+L+S+   D  NG KGK  + 
Sbjct  19   SRKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLISADHGDSENGFKGKLGEP  78

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            AYL+ W+   T L  G+SA+K+ F+W E+ GVP A +IKNNH +EF+LKT+TLEDVP  G
Sbjct  79   AYLEDWITTITPLTIGDSAYKVTFDWEEEIGVPGAILIKNNHHSEFFLKTITLEDVPREG  138

Query  456  EVHFACFSWVYPASKY  503
             VHF C SWVYPA KY
Sbjct  139  RVHFVCNSWVYPAEKY  154



>gb|KDO56302.1| hypothetical protein CISIN_1g002839mg [Citrus sinensis]
Length=874

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 106/138 (77%), Gaps = 2/138 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLK-GKRSK  272
            KKIKG VVLM+KNVLDFNDFNAS +D   + LG+KV+L+L+S+V  +   NGL+ GK  K
Sbjct  33   KKIKGTVVLMKKNVLDFNDFNASFLDRFHELLGRKVTLQLISAVHGEPAENGLQAGKIGK  92

Query  273  AAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  452
             A+++ W+ K T LA+GESAF + FEW ED GVP AF+I+NNH +EFYLKTLTLEDVP  
Sbjct  93   LAHIEGWIPKCTPLAAGESAFNVTFEWDEDIGVPGAFLIRNNHHSEFYLKTLTLEDVPGE  152

Query  453  GEVHFACFSWVYPASKYN  506
            G VHF C SWVYPA  YN
Sbjct  153  GRVHFVCNSWVYPAKDYN  170



>ref|XP_006433338.1| hypothetical protein CICLE_v10000236mg [Citrus clementina]
 ref|XP_006472028.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X1 [Citrus sinensis]
 gb|ESR46578.1| hypothetical protein CICLE_v10000236mg [Citrus clementina]
Length=874

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 106/138 (77%), Gaps = 2/138 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLK-GKRSK  272
            KKIKG VVLM+KNVLDFNDFNAS +D   + LG+KV+L+L+S+V  +   NGL+ GK  K
Sbjct  33   KKIKGTVVLMKKNVLDFNDFNASFLDRFHELLGRKVTLQLISAVHGEPAENGLQAGKIGK  92

Query  273  AAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  452
             A+++ W+ K T LA+GESAF + FEW ED GVP AF+I+NNH +EFYLKTLTLEDVP  
Sbjct  93   LAHIEGWIPKCTPLAAGESAFNVTFEWDEDIGVPGAFLIRNNHHSEFYLKTLTLEDVPGE  152

Query  453  GEVHFACFSWVYPASKYN  506
            G VHF C SWVYPA  YN
Sbjct  153  GRVHFVCNSWVYPAKDYN  170



>ref|XP_008246455.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=849

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            ++KIKG +VLM+KNVLDFNDFNAS++D + + LGQ+VSL+L+S+   D  NG KGK  + 
Sbjct  19   SRKIKGTLVLMKKNVLDFNDFNASVLDGVHELLGQRVSLQLISADHGDSENGFKGKLGEP  78

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            AYL+ W+   T L  G+SA+K+ F+W E+ GVP A +IKNNH +EF+LKT+TLEDVP  G
Sbjct  79   AYLEDWITTITPLTVGDSAYKVTFDWEEEIGVPGAILIKNNHHSEFFLKTITLEDVPREG  138

Query  456  EVHFACFSWVYPASKYN  506
             VHF C SWVYPA KY 
Sbjct  139  RVHFVCNSWVYPAEKYT  155



>ref|XP_006344621.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Solanum 
tuberosum]
Length=862

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 108/136 (79%), Gaps = 2/136 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KK+KG VVLM+KNVLDF D NASIVD + DFLG++VS +L+S+   D  NGL+GK SK A
Sbjct  17   KKVKGTVVLMKKNVLDFTDVNASIVDGVLDFLGRRVSFQLISNSVHD-ANGLEGKLSKPA  75

Query  279  YLDHWVLKNTVLASGESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            YL++W+   T + +GES F + FEW  E+FGVP AFIIKN H +EF+LK+LTLEDVPNHG
Sbjct  76   YLENWITNITPVVAGESTFSVTFEWDDEEFGVPGAFIIKNLHFSEFFLKSLTLEDVPNHG  135

Query  456  EVHFACFSWVYPASKY  503
            ++HF C SWVYPASKY
Sbjct  136  KIHFVCNSWVYPASKY  151



>gb|KHN03989.1| Putative linoleate 9S-lipoxygenase 5 [Glycine soja]
Length=855

 Score =   179 bits (455),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 108/135 (80%), Gaps = 2/135 (1%)
 Frame = +3

Query  105  IKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAYL  284
            I+G V++ +KNVLDFND +AS++D L +F+G++VSL+L+S+VQAD GNG+KGK  K AYL
Sbjct  16   IRGTVIVTKKNVLDFNDLSASLLDRLHEFVGKRVSLQLISAVQADPGNGMKGKLGKPAYL  75

Query  285  DHWVLKNTVLASGESAFKIEFEWS--EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            + W+   T L +GESAF++ F+W+  ED G P AF+++NNH +EFYLK+LTLE+VP HG 
Sbjct  76   EDWITTITPLTAGESAFRVAFDWNGDEDIGTPGAFLVRNNHHSEFYLKSLTLENVPGHGV  135

Query  459  VHFACFSWVYPASKY  503
            +HF C SWVYPA KY
Sbjct  136  IHFICNSWVYPAHKY  150



>ref|XP_003521704.2| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Glycine 
max]
Length=858

 Score =   179 bits (455),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 108/135 (80%), Gaps = 2/135 (1%)
 Frame = +3

Query  105  IKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAYL  284
            I+G V++ +KNVLDFND +AS++D L +F+G++VSL+L+S+VQAD GNG+KGK  K AYL
Sbjct  16   IRGTVIVTKKNVLDFNDLSASLLDRLHEFVGKRVSLQLISAVQADPGNGMKGKLGKPAYL  75

Query  285  DHWVLKNTVLASGESAFKIEFEWS--EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            + W+   T L +GESAF++ F+W+  ED G P AF+++NNH +EFYLK+LTLE+VP HG 
Sbjct  76   EDWITTITPLTAGESAFRVAFDWNGDEDIGTPGAFLVRNNHHSEFYLKSLTLENVPGHGV  135

Query  459  VHFACFSWVYPASKY  503
            +HF C SWVYPA KY
Sbjct  136  IHFICNSWVYPAHKY  150



>ref|XP_010553735.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Tarenaya hassleriana]
Length=859

 Score =   179 bits (455),  Expect = 5e-49, Method: Composition-based stats.
 Identities = 83/134 (62%), Positives = 102/134 (76%), Gaps = 0/134 (0%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            K+KG VVLM+KNVLDFNDFNAS +D L++FLG KV+L L+SS  AD GNG KGK  K A+
Sbjct  20   KVKGTVVLMKKNVLDFNDFNASFLDRLTEFLGNKVTLRLISSDVADSGNGSKGKLGKPAH  79

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L+ W+   T L +GESAFK+ F++   FG P AF I+N+H +EFYLK+LTLEDVP HG V
Sbjct  80   LEEWITTITPLTAGESAFKVTFDYENGFGFPGAFAIRNDHFSEFYLKSLTLEDVPGHGRV  139

Query  462  HFACFSWVYPASKY  503
            HF C SWVYP+  Y
Sbjct  140  HFLCNSWVYPSHTY  153



>gb|AAP83135.1| lipoxygenase [Nicotiana attenuata]
Length=861

 Score =   179 bits (454),  Expect = 5e-49, Method: Composition-based stats.
 Identities = 80/136 (59%), Positives = 104/136 (76%), Gaps = 0/136 (0%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            +KK+KG VV+M+KN LDF D   S+VD + +F+GQKVSL+L+SS   D  N L+GK S  
Sbjct  17   SKKVKGIVVMMKKNALDFTDIAGSVVDGVLEFVGQKVSLQLISSAHGDPANDLQGKHSNL  76

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            AYL++W+   T L +GESA+ + F+W E+FG+P AFIIKN H  EF+LK++TLEDVPNHG
Sbjct  77   AYLENWLTTITPLTAGESAYGVTFDWDEEFGLPGAFIIKNLHFTEFFLKSVTLEDVPNHG  136

Query  456  EVHFACFSWVYPASKY  503
             VHF C SWVYPA+KY
Sbjct  137  TVHFVCNSWVYPANKY  152



>gb|KCW44986.1| hypothetical protein EUGRSUZ_L01433 [Eucalyptus grandis]
Length=636

 Score =   177 bits (450),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 104/136 (76%), Gaps = 0/136 (0%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            +KK+KG VVLM+KNVL+FNDFNAS++D + +  GQKVSL+LVS+V  D   GL+GK  K 
Sbjct  21   SKKVKGTVVLMKKNVLNFNDFNASVLDLVFELFGQKVSLQLVSAVHGDPEKGLRGKLGKP  80

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            AYL+ W+  +T+L +G+SAF + F+W E+ GVP A I++N H  +FYLKT+TLEDVP  G
Sbjct  81   AYLEDWITTSTLLKAGDSAFMVTFDWDEEVGVPGAIIVQNKHHRQFYLKTVTLEDVPGEG  140

Query  456  EVHFACFSWVYPASKY  503
             VHF C SWVYPA +Y
Sbjct  141  RVHFVCNSWVYPADRY  156



>ref|XP_010511239.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Camelina sativa]
Length=860

 Score =   179 bits (454),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            TKK+KG VVLM+KNVLDFNDFNAS +D L +FLG K++L L+SS   D  NG KGK  KA
Sbjct  19   TKKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLRLISSDVTDSANGSKGKLGKA  78

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            A+L+ W+   T L +GESAFK+ F++  DFG P AF+I+N+H +EF+LK+LTLEDVP HG
Sbjct  79   AHLEDWITPITSLTAGESAFKVTFDYDSDFGYPGAFLIRNSHFSEFFLKSLTLEDVPGHG  138

Query  456  EVHFACFSWVYPASKYN  506
             VH+ C SW+YPA  Y 
Sbjct  139  RVHYICNSWIYPAKHYT  155



>ref|XP_006392468.1| hypothetical protein EUTSA_v10023267mg [Eutrema salsugineum]
 gb|ESQ29754.1| hypothetical protein EUTSA_v10023267mg [Eutrema salsugineum]
Length=856

 Score =   179 bits (454),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 105/135 (78%), Gaps = 0/135 (0%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            K+KG VVLM+KNVLDFNDFNAS +D L +FLG +V+L+L+SS  +D  NG KGK  KAA+
Sbjct  17   KVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNRVTLQLISSDLSDPENGAKGKLGKAAH  76

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L+ W+   T L +GESAFK+ F++ +DFG P AF+I+N+H +EFYLK+LTLEDVP HG V
Sbjct  77   LEDWITTITSLTAGESAFKVTFDYDKDFGYPGAFLIRNSHFSEFYLKSLTLEDVPGHGRV  136

Query  462  HFACFSWVYPASKYN  506
            H+ C SWVYPA  Y 
Sbjct  137  HYVCNSWVYPAKNYT  151



>ref|XP_007030817.1| Lipoxygenase 1 [Theobroma cacao]
 gb|EOY11319.1| Lipoxygenase 1 [Theobroma cacao]
Length=866

 Score =   179 bits (454),  Expect = 7e-49, Method: Composition-based stats.
 Identities = 79/141 (56%), Positives = 103/141 (73%), Gaps = 0/141 (0%)
 Frame = +3

Query  81   EALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKG  260
            E  S + KIKG VVLM+KNVLDFNDF AS++D + + LG++VSL+L+S+ + D  NGL+G
Sbjct  17   EMESSSGKIKGTVVLMKKNVLDFNDFQASVLDGVHELLGKRVSLQLISAEKGDAANGLQG  76

Query  261  KRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLED  440
            K  K AYLD+W L +    +GES F + F+W E+ G P   +IKNNH +EFYLKT++LE 
Sbjct  77   KLGKPAYLDNWTLTDASPVAGESKFSVNFDWDEEIGTPGGLLIKNNHHSEFYLKTVSLEH  136

Query  441  VPNHGEVHFACFSWVYPASKY  503
            VP+HG VHF C SWVYP  KY
Sbjct  137  VPDHGPVHFVCNSWVYPGKKY  157



>ref|XP_010040715.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
Length=656

 Score =   177 bits (450),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 104/136 (76%), Gaps = 0/136 (0%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            +KK+KG VVLM+KNVL+FNDFNAS++D + +  GQKVSL+LVS+V  D   GL+GK  K 
Sbjct  21   SKKVKGTVVLMKKNVLNFNDFNASVLDLVFELFGQKVSLQLVSAVHGDPEKGLRGKLGKP  80

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            AYL+ W+  +T+L +G+SAF + F+W E+ GVP A I++N H  +FYLKT+TLEDVP  G
Sbjct  81   AYLEDWITTSTLLKAGDSAFMVTFDWDEEVGVPGAIIVQNKHHRQFYLKTVTLEDVPGEG  140

Query  456  EVHFACFSWVYPASKY  503
             VHF C SWVYPA +Y
Sbjct  141  RVHFVCNSWVYPADRY  156



>gb|AAZ04411.1| lipoxygenase [Adelostemma gracillimum]
Length=863

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 104/138 (75%), Gaps = 3/138 (2%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQAD---LGNGLKGKRS  269
            KKIKG+VVLM+KNVLDFNDF+A+I+D + +  GQKVSL+LV++V  D      GL+G+  
Sbjct  17   KKIKGRVVLMKKNVLDFNDFHANILDGVHELFGQKVSLQLVTAVHGDGHHPDKGLEGRLG  76

Query  270  KAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  449
              AYL+ WV   T+L +GESAF +EF+W E+ GVP AFI+KN H +EFYLKTLT+E VP 
Sbjct  77   NPAYLEDWVRTGTILDAGESAFDVEFDWDEELGVPGAFIVKNFHHSEFYLKTLTIEHVPG  136

Query  450  HGEVHFACFSWVYPASKY  503
            HG VHF C SWVYP  KY
Sbjct  137  HGRVHFICNSWVYPTDKY  154



>gb|AAP83134.1| lipoxygenase [Nicotiana attenuata]
 gb|AAP83136.1| lipoxygenase [Nicotiana attenuata]
Length=861

 Score =   178 bits (452),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 79/136 (58%), Positives = 104/136 (76%), Gaps = 0/136 (0%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            +KK+KG VV+M+KN LDF D   ++VD + +F+GQKVSL+L+SS   D  N L+GK S  
Sbjct  17   SKKVKGIVVMMKKNALDFTDIAGAVVDGVLEFVGQKVSLQLISSAHGDPANDLQGKHSNP  76

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            AYL++W+   T L +GESA+ + F+W E+FG+P AFIIKN H  EF+LK++TLEDVPNHG
Sbjct  77   AYLENWLTTITPLTAGESAYGVTFDWDEEFGLPGAFIIKNLHFTEFFLKSVTLEDVPNHG  136

Query  456  EVHFACFSWVYPASKY  503
             VHF C SWVYPA+KY
Sbjct  137  TVHFVCNSWVYPANKY  152



>ref|XP_009376659.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
 ref|XP_009376682.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=862

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 106/136 (78%), Gaps = 1/136 (1%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLKGKRSKAA  278
            KI G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V+AD   NGLKGK  K A
Sbjct  20   KINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVRADDSENGLKGKLGKPA  79

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ W+   T L +GESAFK+ F++ E+ GVP AF+IKNNH +EF+LKT+TLE+VP  G 
Sbjct  80   YLEDWITTITPLTAGESAFKVTFDYEEEVGVPGAFLIKNNHHSEFFLKTVTLENVPGEGH  139

Query  459  VHFACFSWVYPASKYN  506
            VHF C SWVYP  KY 
Sbjct  140  VHFVCNSWVYPTEKYT  155



>ref|XP_010480214.1| PREDICTED: linoleate 9S-lipoxygenase 1 [Camelina sativa]
Length=860

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 103/137 (75%), Gaps = 0/137 (0%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            TKK+KG VVLM+KNVLDFNDFNAS +D L +FLG K++L L+SS   D  NG KGK  K 
Sbjct  19   TKKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLRLISSDVTDSANGSKGKLGKT  78

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            A+L+ W+   T L +GESAFK+ F++  DFG P AF+I+N+H +EF+LK+LTLEDVP HG
Sbjct  79   AHLEDWITTITSLTAGESAFKVTFDYDSDFGYPGAFLIRNSHFSEFFLKSLTLEDVPGHG  138

Query  456  EVHFACFSWVYPASKYN  506
             VH+ C SW+YPA  Y 
Sbjct  139  RVHYICNSWIYPAKHYT  155



>gb|AAO03558.1| lipoxygenase 1 [Brassica napus]
Length=857

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 103/135 (76%), Gaps = 0/135 (0%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            K+KG VVLM+KNVLDFNDFNAS +D L +FLG KV+L L+SS   D  NG  GK  KAA+
Sbjct  18   KVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKVTLRLISSDVTDPENGSNGKLGKAAH  77

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L+ W+   T L +GESAFK+ F++ +DFG P AF+I+N+H +EFYLK+LTLEDVP HG V
Sbjct  78   LEDWITTITSLTAGESAFKVTFDYDQDFGYPGAFLIRNSHFSEFYLKSLTLEDVPGHGRV  137

Query  462  HFACFSWVYPASKYN  506
            H+ C SWVYPA +Y 
Sbjct  138  HYICNSWVYPAKRYT  152



>ref|XP_009119596.1| PREDICTED: linoleate 9S-lipoxygenase 1 [Brassica rapa]
Length=857

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 103/135 (76%), Gaps = 0/135 (0%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            K+KG VVLM+KNVLDFNDFNAS +D L +FLG KV+L L+SS   D  NG  GK  KAA+
Sbjct  18   KVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKVTLRLISSDVTDPENGSNGKLGKAAH  77

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L+ W+   T L +GESAFK+ F++ +DFG P AF+I+N+H +EFYLK+LTLEDVP HG V
Sbjct  78   LEDWITTITSLTAGESAFKVTFDYDQDFGYPGAFLIRNSHFSEFYLKSLTLEDVPGHGRV  137

Query  462  HFACFSWVYPASKYN  506
            H+ C SWVYPA +Y 
Sbjct  138  HYICNSWVYPAKRYT  152



>gb|ACG56281.1| lipoxygenase [Olea europaea]
Length=864

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 104/137 (76%), Gaps = 2/137 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKIKGKVVLM+KNVLDFNDF  S++D + + LGQKVSL+L+SS+  D  N LKGK  +AA
Sbjct  19   KKIKGKVVLMKKNVLDFNDFGGSVLDRVHELLGQKVSLQLISSINGDPENKLKGKLGRAA  78

Query  279  YLDHWVLKNTVLASGESAFKIEFEW-SEDFGVPAAFIIKNNHPNEFYLKTLTLEDVP-NH  452
            YL+ W+   T L  G+SAF + F+W  E+ G+P AFII+N H  EFYLKTLTLEDVP +H
Sbjct  79   YLEDWITTFTSLTPGDSAFHVTFDWEEEEIGIPGAFIIQNFHHTEFYLKTLTLEDVPGHH  138

Query  453  GEVHFACFSWVYPASKY  503
            G +HF C SWVYPA KY
Sbjct  139  GPIHFVCNSWVYPAEKY  155



>ref|XP_006838255.1| hypothetical protein AMTR_s00103p00053790 [Amborella trichopoda]
 gb|ERN00824.1| hypothetical protein AMTR_s00103p00053790 [Amborella trichopoda]
Length=259

 Score =   168 bits (426),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 96/134 (72%), Gaps = 0/134 (0%)
 Frame = +3

Query  105  IKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAYL  284
            +KG VVL +KNVLDFNDF+ S +D+L +FLG++VSL LVS+  AD   GLKGK  KAAYL
Sbjct  22   MKGSVVLQKKNVLDFNDFHVSFLDSLHEFLGKRVSLHLVSATHADPERGLKGKLGKAAYL  81

Query  285  DHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVH  464
            + W  K   LA GE+ F ++FEW E FG P AF+I+N H  +FYLK+LTL  VP  G VH
Sbjct  82   EEWGKKQVGLAVGEAQFTVDFEWDESFGTPGAFVIRNEHHGQFYLKSLTLHHVPGKGRVH  141

Query  465  FACFSWVYPASKYN  506
            F C SWVYP+ KY 
Sbjct  142  FVCNSWVYPSKKYT  155



>ref|NP_175900.1| lipoxygenase 1 [Arabidopsis thaliana]
 sp|Q06327.1|LOX1_ARATH RecName: Full=Linoleate 9S-lipoxygenase 1; AltName: Full=Lipoxygenase 
1; Short=AtLOX1 [Arabidopsis thaliana]
 gb|AAG51123.1|AC069144_20 lipoxygenase, putative [Arabidopsis thaliana]
 gb|AAA32827.1| lipoxygenase [Arabidopsis thaliana]
 gb|AAA17036.1| lipoxygenase 1 [Arabidopsis thaliana]
 gb|AAM13103.1| lipoxygenase, putative [Arabidopsis thaliana]
 gb|AAQ56801.1| At1g55020 [Arabidopsis thaliana]
 gb|AEE33175.1| lipoxygenase 1 [Arabidopsis thaliana]
Length=859

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 103/137 (75%), Gaps = 0/137 (0%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            TKK+KG VVLM+KNVLDFNDFNAS +D L +FLG K++L LVSS   D  NG KGK  KA
Sbjct  18   TKKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLRLVSSDVTDSENGSKGKLGKA  77

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            A+L+ W+   T L +GESAFK+ F++  DFG P AF+I+N+H +EF LK+LTLEDVP HG
Sbjct  78   AHLEDWITTITSLTAGESAFKVTFDYETDFGYPGAFLIRNSHFSEFLLKSLTLEDVPGHG  137

Query  456  EVHFACFSWVYPASKYN  506
             VH+ C SW+YPA  Y 
Sbjct  138  RVHYICNSWIYPAKHYT  154



>ref|XP_010025194.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
Length=871

 Score =   177 bits (449),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 80/136 (59%), Positives = 104/136 (76%), Gaps = 0/136 (0%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            +KK+KG VVLM+K VLDFNDFNAS++DN+ + LG+KVSL LVS V  D  N L+GK  K 
Sbjct  27   SKKVKGTVVLMKKYVLDFNDFNASVLDNVDELLGKKVSLRLVSVVHGDPENCLRGKLGKP  86

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            A+L+ W+   T L +G+SAFK+ F W ++ GVP A I++NNH ++FYLKT+TLEDVP  G
Sbjct  87   AHLEGWITTITPLTTGDSAFKVTFNWDKEVGVPGAIIVQNNHHSQFYLKTITLEDVPGEG  146

Query  456  EVHFACFSWVYPASKY  503
             VHF C SWVYPA++Y
Sbjct  147  RVHFVCNSWVYPANQY  162



>ref|XP_007208096.1| hypothetical protein PRUPE_ppa001287mg [Prunus persica]
 gb|EMJ09295.1| hypothetical protein PRUPE_ppa001287mg [Prunus persica]
Length=862

 Score =   177 bits (448),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 80/135 (59%), Positives = 101/135 (75%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            +KIKG VVLM+KNVLDFNDFNAS++D + + LGQ VSL+L+S+   D  N  KGK  + A
Sbjct  20   RKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLISADHGDSENRFKGKLGEPA  79

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ W+   T L  G+SA+K+ F+W E+ GVP A +IKNNH +EF+LKT+TLEDVP  G 
Sbjct  80   YLEDWITTITPLTVGDSAYKVTFDWEEEIGVPGAILIKNNHHSEFFLKTITLEDVPREGR  139

Query  459  VHFACFSWVYPASKY  503
            VHF C SWVYPA KY
Sbjct  140  VHFVCNSWVYPAEKY  154



>ref|XP_007204937.1| hypothetical protein PRUPE_ppa001311mg [Prunus persica]
 gb|EMJ06136.1| hypothetical protein PRUPE_ppa001311mg [Prunus persica]
Length=856

 Score =   177 bits (448),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 80/135 (59%), Positives = 100/135 (74%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKIKG+VVLM+KNVLD NDF AS++D + + LG+ VSL L+SSV+ D   G +GK    A
Sbjct  15   KKIKGRVVLMKKNVLDLNDFKASVLDRVHELLGKAVSLRLISSVKGDPEKGFQGKLGNPA  74

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ W+   T L +GESAFK+ F+W ++ GVP AF+I NNH  EF+LKT+TLEDVP  G 
Sbjct  75   YLEDWITTITPLTAGESAFKVTFDWEDEIGVPGAFLIINNHHTEFFLKTVTLEDVPGEGR  134

Query  459  VHFACFSWVYPASKY  503
            VHF C SWVYPA KY
Sbjct  135  VHFVCNSWVYPAEKY  149



>gb|KDP23508.1| hypothetical protein JCGZ_23341 [Jatropha curcas]
Length=870

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 102/135 (76%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKI G VVLM+KNVLDFNDF+AS++D + +  G  VSL+L+SSV ++  NGL+GK  + A
Sbjct  27   KKITGSVVLMKKNVLDFNDFHASLLDRVHELFGHGVSLQLISSVTSESENGLQGKVGEPA  86

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ W+     L  G+SAFK+ F+W+E+ G+P AFIIKNNH +EFYLKTLTLEDVP  G 
Sbjct  87   YLEDWITTIAPLTPGDSAFKVTFDWNEEIGIPGAFIIKNNHHSEFYLKTLTLEDVPGQGR  146

Query  459  VHFACFSWVYPASKY  503
            +HF C SWVYPA  Y
Sbjct  147  IHFVCNSWVYPAKHY  161



>ref|XP_008246456.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=915

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 103/137 (75%), Gaps = 0/137 (0%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            ++KIKG VVL++KNVLDFND NAS++D + + LGQ+VSL+L+S+   D  NG KGK  + 
Sbjct  72   SRKIKGTVVLIKKNVLDFNDINASVLDRVHELLGQRVSLQLISADHGDSENGFKGKLGEP  131

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            AYL+ W+   T L  G+SA+K+ F+W E+ GVP A +IKNNH +EF+LKT+TLEDVP  G
Sbjct  132  AYLEDWITTITPLTVGDSAYKVTFDWEEEIGVPGAILIKNNHHSEFFLKTITLEDVPREG  191

Query  456  EVHFACFSWVYPASKYN  506
             VHF C SWVYPA KY 
Sbjct  192  RVHFVCNSWVYPAEKYT  208



>emb|CAD10779.2| lipoxygenase [Prunus dulcis]
 gb|AGT02046.1| lipoxygenase [synthetic construct]
Length=862

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 101/136 (74%), Gaps = 0/136 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            +KIKG VVLM+KNVLDFNDFNAS++D + + LGQ VSL+L+S+   D  NG KGK  + A
Sbjct  20   RKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLISADHGDSENGFKGKLGEPA  79

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ W+   T L  G+SA+ + F+W E+ GVP A +IKNNH +EF+LKT+TLEDVP  G 
Sbjct  80   YLEDWITTITPLTVGDSAYNVTFDWEEEIGVPGAILIKNNHHSEFFLKTVTLEDVPREGR  139

Query  459  VHFACFSWVYPASKYN  506
            VHF C SWVYPA KY 
Sbjct  140  VHFVCNSWVYPAEKYT  155



>ref|NP_001281030.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGK82778.1| lipoxygenase [Malus domestica]
Length=862

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 105/136 (77%), Gaps = 1/136 (1%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLKGKRSKAA  278
            KI G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V AD   NGLKGK  + A
Sbjct  20   KINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHADDSENGLKGKLGQPA  79

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ W+   T L +GESAFK+ F++ E+ GVP AF+IKNNH +EF+LKT+TLE+VP  G 
Sbjct  80   YLEDWITTITPLTAGESAFKVTFDYEEEVGVPGAFLIKNNHHSEFFLKTVTLENVPGEGR  139

Query  459  VHFACFSWVYPASKYN  506
            VHF C SWVYP  KY 
Sbjct  140  VHFVCNSWVYPTEKYT  155



>ref|XP_008246453.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=947

 Score =   177 bits (449),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 80/135 (59%), Positives = 101/135 (75%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKIKG+VVLM+KNVLD NDF AS++D + + LG+ VSL L+SSV+ +   G +GK  K A
Sbjct  105  KKIKGRVVLMKKNVLDLNDFKASVLDRVHELLGKAVSLRLISSVKGEPEKGFQGKLGKPA  164

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ W+   T L +GESAFK+ F+W ++ GVP AF+I NNH  EF+LKT+TLEDVP  G 
Sbjct  165  YLEDWITTITPLTAGESAFKVTFDWEDEIGVPGAFLIINNHHTEFFLKTVTLEDVPGEGR  224

Query  459  VHFACFSWVYPASKY  503
            VHF C SWVYPA KY
Sbjct  225  VHFVCNSWVYPAEKY  239



>ref|NP_001281026.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGK82794.1| lipoxygenase [Malus domestica]
Length=933

 Score =   177 bits (448),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 100/135 (74%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKIKG VVLM+KNVL+ ND  AS +D   +  G+KVSL+L+SSV  D  NGL+GK  KAA
Sbjct  88   KKIKGTVVLMKKNVLELNDLKASFLDRFHELRGKKVSLQLISSVNCDPENGLQGKVGKAA  147

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ W+ K T L + E+AF I F+W E+ GVP AFII+N H +EFYLK+LTLEDVP  G 
Sbjct  148  YLEDWITKITPLTAEENAFDITFDWDEEIGVPGAFIIRNEHHSEFYLKSLTLEDVPGEGR  207

Query  459  VHFACFSWVYPASKY  503
            VHF C SWVYPA KY
Sbjct  208  VHFVCNSWVYPAKKY  222



>emb|CDY43490.1| BnaA01g21450D [Brassica napus]
Length=1203

 Score =   177 bits (450),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 103/135 (76%), Gaps = 0/135 (0%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            K+KG VVLM+KNVLDFNDFNAS +D L +FLG KV+L L+SS   D  NG  GK  KAA+
Sbjct  18   KVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKVTLRLISSDVTDPENGSNGKLGKAAH  77

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L+ W+   T L +GESAFK+ F++ +DFG P AF+I+N+H +EFYLK+LTLEDVP HG V
Sbjct  78   LEDWITTITSLTAGESAFKVTFDYDQDFGYPGAFLIRNSHFSEFYLKSLTLEDVPGHGRV  137

Query  462  HFACFSWVYPASKYN  506
            H+ C SWVYPA +Y 
Sbjct  138  HYICNSWVYPAKRYT  152


 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = +3

Query  222  SSVQADLG-NGLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNN  398
            S +  DL  NG  GK  KAA+L+ W+   T L +GESAFK+  ++ +DFG P AF+I+N+
Sbjct  403  SLIHCDLAENGSNGKLGKAAHLEDWITTITSLTAGESAFKVRIDYDQDFGYPGAFLIRNS  462

Query  399  HPNEFYLKTLTLEDVPNHGEVHFACFSWVYPASKYN  506
            H +EFYLK+LTLEDVP HG VH+ C SWVYPA +Y 
Sbjct  463  HFSEFYLKSLTLEDVPGHGRVHYICNSWVYPAKRYT  498



>ref|XP_007208102.1| hypothetical protein PRUPE_ppa001216mg [Prunus persica]
 gb|EMJ09301.1| hypothetical protein PRUPE_ppa001216mg [Prunus persica]
Length=879

 Score =   176 bits (446),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 101/135 (75%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKIKG+VVLM+KNVLD ND  AS++D + + +G+ VSL+L+SSV  D   G  GK  K A
Sbjct  34   KKIKGRVVLMKKNVLDLNDLTASVLDRVDELVGKAVSLQLISSVNGDPEKGSPGKVGKPA  93

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL++W+   T L +G+SAF I F+W E+ GVP AFII+N+H +EFYLKTLTLEDVP  G 
Sbjct  94   YLENWITTITPLTAGDSAFDITFDWDEEIGVPGAFIIRNDHHSEFYLKTLTLEDVPGEGR  153

Query  459  VHFACFSWVYPASKY  503
            +HF C SWVYPA KY
Sbjct  154  IHFVCNSWVYPADKY  168



>ref|XP_009376660.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=931

 Score =   176 bits (447),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 100/135 (74%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKI+G VVLM+KNVL+ ND  AS +D   +  G+KVSL+L+SSV  D  NGL+GK  KAA
Sbjct  86   KKIRGTVVLMKKNVLELNDLKASFLDRFHELRGKKVSLQLISSVNCDPENGLQGKVGKAA  145

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ W+ K T L + E+AF I F+W E+ GVP AFII+N H +EFYLK+LTLEDVP  G 
Sbjct  146  YLEDWITKITPLTAEENAFDITFDWDEEIGVPGAFIIRNEHHSEFYLKSLTLEDVPGEGR  205

Query  459  VHFACFSWVYPASKY  503
            VHF C SWVYPA KY
Sbjct  206  VHFVCNSWVYPAKKY  220



>ref|XP_010256003.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nelumbo nucifera]
 ref|XP_010256004.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nelumbo nucifera]
 ref|XP_010256005.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nelumbo nucifera]
Length=874

 Score =   176 bits (445),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 79/144 (55%), Positives = 106/144 (74%), Gaps = 0/144 (0%)
 Frame = +3

Query  72   KLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNG  251
            KL + +    KI+G VVLM+KN+LDFND +AS++D   + LG+ V+L+L+SSV AD  NG
Sbjct  17   KLNDEMGGKTKIRGTVVLMKKNLLDFNDLHASVLDRFDELLGEGVALQLISSVNADPVNG  76

Query  252  LKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLT  431
            ++GK  KAAYL+ W+   T L +G S+FK+ F+W  D GVP AFIIKN H +EF+LKT+T
Sbjct  77   MRGKVGKAAYLEEWITTVTPLTAGASSFKVTFDWDADIGVPGAFIIKNFHHSEFFLKTVT  136

Query  432  LEDVPNHGEVHFACFSWVYPASKY  503
            LEDVP  G +HF C SW+YPA +Y
Sbjct  137  LEDVPGVGRLHFLCNSWIYPAKRY  160



>ref|XP_009376681.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Pyrus 
x bretschneideri]
Length=927

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 100/135 (74%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKI+G VVLM+KNVL+ ND  AS +D   +  G+KVSL+L+SSV  D  NGL+GK  KAA
Sbjct  86   KKIRGTVVLMKKNVLELNDLKASFLDRFHELRGKKVSLQLISSVNCDPENGLQGKVGKAA  145

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ W+ K T L + E+AF I F+W E+ GVP AFII+N H +EFYLK+LTLEDVP  G 
Sbjct  146  YLEDWITKITPLTAEENAFDITFDWDEEIGVPGAFIIRNEHHSEFYLKSLTLEDVPGEGR  205

Query  459  VHFACFSWVYPASKY  503
            VHF C SWVYPA KY
Sbjct  206  VHFVCNSWVYPAKKY  220



>ref|XP_009376680.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Pyrus 
x bretschneideri]
Length=931

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 100/135 (74%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKI+G VVLM+KNVL+ ND  AS +D   +  G+KVSL+L+SSV  D  NGL+GK  KAA
Sbjct  86   KKIRGTVVLMKKNVLELNDLKASFLDRFHELRGKKVSLQLISSVNCDPENGLQGKVGKAA  145

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ W+ K T L + E+AF I F+W E+ GVP AFII+N H +EFYLK+LTLEDVP  G 
Sbjct  146  YLEDWITKITPLTAEENAFDITFDWDEEIGVPGAFIIRNEHHSEFYLKSLTLEDVPGEGR  205

Query  459  VHFACFSWVYPASKY  503
            VHF C SWVYPA KY
Sbjct  206  VHFVCNSWVYPAKKY  220



>ref|XP_008246451.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=923

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 101/134 (75%), Gaps = 0/134 (0%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            KIKG+VVLM+KNVLD ND  AS++D + + +G+ VSL+L+SSV  D   G  GK  K AY
Sbjct  79   KIKGRVVLMKKNVLDLNDLTASVLDRVEELVGKAVSLQLISSVNGDPEKGSPGKVGKPAY  138

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L++W+   T L +G+SAF I F+W E+ GVP AFII+N+H +EFYLKTLTLEDVP  G++
Sbjct  139  LENWITTITPLTAGDSAFDITFDWDEEIGVPGAFIIRNDHHSEFYLKTLTLEDVPGEGQI  198

Query  462  HFACFSWVYPASKY  503
            HF C SWVYPA KY
Sbjct  199  HFVCNSWVYPADKY  212



>ref|XP_008245950.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=923

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 101/134 (75%), Gaps = 0/134 (0%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            KIKG+VVLM+KNVLD ND  AS++D + + +G+ VSL+L+SSV  D   G  GK  K AY
Sbjct  79   KIKGRVVLMKKNVLDLNDLTASVLDRVEELVGKAVSLQLISSVNGDPEKGSPGKVGKPAY  138

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L++W+   T L +G+SAF I F+W E+ GVP AFII+N+H +EFYLKTLTLEDVP  G++
Sbjct  139  LENWITTITPLTAGDSAFDITFDWDEEIGVPGAFIIRNDHHSEFYLKTLTLEDVPGEGQI  198

Query  462  HFACFSWVYPASKY  503
            HF C SWVYPA KY
Sbjct  199  HFVCNSWVYPADKY  212



>ref|XP_008246452.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=896

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 101/134 (75%), Gaps = 0/134 (0%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            KIKG+VVLM+KNVLD ND  AS++D + + +G+ VSL+L+SSV  D   G  GK  K AY
Sbjct  79   KIKGRVVLMKKNVLDLNDLTASVLDRVEELVGKAVSLQLISSVNGDPEKGSPGKVGKPAY  138

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L++W+   T L +G+SAF I F+W E+ GVP AFII+N+H +EFYLKTLTLEDVP  G++
Sbjct  139  LENWITTITPLTAGDSAFDITFDWDEEIGVPGAFIIRNDHHSEFYLKTLTLEDVPGEGQI  198

Query  462  HFACFSWVYPASKY  503
            HF C SWVYPA KY
Sbjct  199  HFVCNSWVYPADKY  212



>gb|KFK35600.1| hypothetical protein AALP_AA4G012300 [Arabis alpina]
Length=857

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 101/134 (75%), Gaps = 0/134 (0%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            K+KG VVLM+KNVLDFNDFNAS +D L +FLG KV+L L+SS   D  +G KGK  KA +
Sbjct  18   KVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKVTLRLISSDLTDPADGSKGKLGKAGH  77

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L+ W+   T L +GESAFK+ F++  DFG P AF+I+N+H +EFYLK+LTLEDVP HG V
Sbjct  78   LEDWITTITSLTAGESAFKVTFDYDSDFGYPGAFLIRNSHFSEFYLKSLTLEDVPGHGRV  137

Query  462  HFACFSWVYPASKY  503
            H+ C SWVYPA  Y
Sbjct  138  HYLCNSWVYPAKNY  151



>ref|XP_002891934.1| hypothetical protein ARALYDRAFT_474776 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68193.1| hypothetical protein ARALYDRAFT_474776 [Arabidopsis lyrata subsp. 
lyrata]
Length=857

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 103/137 (75%), Gaps = 0/137 (0%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            TKK+KG VVLM+KNVLDFNDFNAS +D L +FLG K++L L+SS   D  NG KGK  KA
Sbjct  16   TKKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLRLISSDVTDSENGSKGKLGKA  75

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            A+L+ W+   T L +GESAFK+ F++  +FG P AF+IKN+H +EF L++LTLEDVP HG
Sbjct  76   AHLEDWITTITSLTAGESAFKVTFDYESNFGYPGAFLIKNSHFSEFLLRSLTLEDVPGHG  135

Query  456  EVHFACFSWVYPASKYN  506
             VH+ C SW+YPA  Y 
Sbjct  136  RVHYICNSWIYPAKHYT  152



>ref|XP_006344622.1| PREDICTED: linoleate 9S-lipoxygenase B-like [Solanum tuberosum]
Length=860

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 109/137 (80%), Gaps = 5/137 (4%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVS-SVQADLGNGLKGKRSKA  275
            +K+KG+V+LM+KNVLDF D +AS+VD ++D LGQKVS++L+S SV AD   GL+GKRSK 
Sbjct  17   EKVKGRVILMKKNVLDFTDISASVVDGVADLLGQKVSIQLISGSVNAD---GLEGKRSKP  73

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  452
            AYL+ W+   T + +GES F + F+W  ++FGVP AFIIKN H NEF+LK+LTLEDVPNH
Sbjct  74   AYLESWLTHITPIIAGESTFSVTFDWDHKEFGVPGAFIIKNLHLNEFFLKSLTLEDVPNH  133

Query  453  GEVHFACFSWVYPASKY  503
            G +HF C SWVYP+ +Y
Sbjct  134  GNIHFVCNSWVYPSFRY  150



>sp|O22507.1|LOX17_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 7 [Solanum tuberosum]
 gb|AAB81594.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   174 bits (441),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 82/137 (60%), Positives = 103/137 (75%), Gaps = 1/137 (1%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            +KK+KG VV+M KNVLDF D   S+   + D LGQKVS +L+SSVQ D  NGL+GK S  
Sbjct  16   SKKVKGTVVMMNKNVLDFTDLAGSLTGKIFDVLGQKVSFQLISSVQGDPTNGLQGKHSNP  75

Query  276  AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  452
            AYL++ +   T L +G E+AF + F+W+E+FGVP AFIIKN H NEF+LK+LTLEDVPNH
Sbjct  76   AYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNMHINEFFLKSLTLEDVPNH  135

Query  453  GEVHFACFSWVYPASKY  503
            G+VHF C SWVYP+  Y
Sbjct  136  GKVHFVCNSWVYPSLNY  152



>ref|NP_001275169.1| probable linoleate 9S-lipoxygenase 8-like [Solanum tuberosum]
 emb|CAB65460.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   174 bits (441),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 82/137 (60%), Positives = 103/137 (75%), Gaps = 1/137 (1%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            +KK+KG VV+M KNVLDF D   S+   + D LGQKVS +L+SSVQ D  NGL+GK S  
Sbjct  16   SKKVKGTVVMMNKNVLDFTDLAGSLTGKIFDVLGQKVSFQLISSVQGDPTNGLQGKHSNP  75

Query  276  AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  452
            AYL++ +   T L +G E+AF + F+W+E+FGVP AFIIKN H NEF+LK+LTLEDVPNH
Sbjct  76   AYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNMHINEFFLKSLTLEDVPNH  135

Query  453  GEVHFACFSWVYPASKY  503
            G+VHF C SWVYP+  Y
Sbjct  136  GKVHFVCNSWVYPSLNY  152



>ref|XP_009376663.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
 ref|XP_009376684.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=868

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 100/135 (74%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKIKG+VVLM+K VLD ND  ASI+D + + LG+ VSL L+SSV  D  N LKGK  K A
Sbjct  24   KKIKGRVVLMKKVVLDVNDLKASILDRVDELLGKAVSLRLISSVNGDPENELKGKVGKPA  83

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL++WV   T L +GE+AF + F+W ++ GVP AF+++N H +EFYLKTLTLEDVP  G 
Sbjct  84   YLENWVTTITPLTAGEAAFDVTFDWDKEIGVPGAFVVRNEHHSEFYLKTLTLEDVPGEGR  143

Query  459  VHFACFSWVYPASKY  503
            VHF C SWVYPA KY
Sbjct  144  VHFVCNSWVYPADKY  158



>ref|NP_001275357.1| linoleate 9S-lipoxygenase 2 [Solanum tuberosum]
 sp|O24379.1|LOX12_SOLTU RecName: Full=Linoleate 9S-lipoxygenase 2; AltName: Full=Lipoxygenase 
1-2 [Solanum tuberosum]
 emb|CAA64766.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   174 bits (441),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 81/137 (59%), Positives = 103/137 (75%), Gaps = 1/137 (1%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            +KK+KG VV+M KN LDF D   S+ D   +FLGQ VS +L+SSVQ D  NGL+GK S  
Sbjct  16   SKKLKGTVVMMNKNALDFTDLAGSLTDKAFEFLGQTVSFQLISSVQGDPTNGLQGKHSNP  75

Query  276  AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  452
            AYL++ +   T L +G E+AF + F+W+E+FGVP AFIIKN H NEF+LK+LTLEDVPNH
Sbjct  76   AYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNTHINEFFLKSLTLEDVPNH  135

Query  453  GEVHFACFSWVYPASKY  503
            G+VHF C SWVYP+ +Y
Sbjct  136  GKVHFVCNSWVYPSFRY  152



>ref|XP_008340967.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Malus domestica]
Length=182

 Score =   163 bits (412),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 104/142 (73%), Gaps = 3/142 (2%)
 Frame = +3

Query  87   LSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQAD-LGNGLK--  257
            +S   +I+GKVVLM+KNVL FND  AS+VD + + LG+ VS++L+S+   +   NGLK  
Sbjct  27   VSGGNRIRGKVVLMKKNVLXFNDLKASVVDRIHELLGKGVSMQLISATHPEPAANGLKSR  86

Query  258  GKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  437
            GK  + AYL+ WV   T L++GE++F I  +W+E  GVP A +I+N+H ++FYLKT+TLE
Sbjct  87   GKLGEVAYLEKWVTTTTSLSAGEASFSISLDWNESHGVPGALLIRNHHHSQFYLKTITLE  146

Query  438  DVPNHGEVHFACFSWVYPASKY  503
            DVP HG++HF C SWVYPA +Y
Sbjct  147  DVPGHGQLHFVCNSWVYPAHRY  168



>ref|XP_002512386.1| lipoxygenase, putative [Ricinus communis]
 gb|EEF49838.1| lipoxygenase, putative [Ricinus communis]
Length=871

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 101/135 (75%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKIKG VVLM+KNVLDFNDFNAS +D + +  G  VSL+L+SSV ++  NGL+GK  + A
Sbjct  27   KKIKGTVVLMKKNVLDFNDFNASFLDGIHELAGHGVSLQLISSVNSEPENGLQGKVGEPA  86

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
             L+ W+   T    G+SAF++ F+W ++ G+P AFII+NNH +EFYLKTLTLEDVP  G 
Sbjct  87   LLEDWITTFTPATPGDSAFRVTFDWDDEIGIPGAFIIRNNHHSEFYLKTLTLEDVPGQGR  146

Query  459  VHFACFSWVYPASKY  503
            +HF C SWVYPA +Y
Sbjct  147  IHFVCNSWVYPAKRY  161



>sp|P37831.1|LOX11_SOLTU RecName: Full=Linoleate 9S-lipoxygenase 1; AltName: Full=Lipoxygenase 
1; Short=StLOX1 [Solanum tuberosum]
 emb|CAA55724.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   174 bits (440),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 82/137 (60%), Positives = 103/137 (75%), Gaps = 1/137 (1%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            +KK+KG VV+M KNVLDF D   S+   + D LGQKVS +L+SSVQ D  NGL+GK S  
Sbjct  16   SKKVKGTVVMMNKNVLDFTDLAGSLTGKIFDVLGQKVSFQLISSVQGDPTNGLQGKHSNP  75

Query  276  AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  452
            AYL++ +   T L +G E+AF + F+W+E+FGVP AFIIKN H NEF+LK+LTLEDVPNH
Sbjct  76   AYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNMHINEFFLKSLTLEDVPNH  135

Query  453  GEVHFACFSWVYPASKY  503
            G+VHF C SWVYP+  Y
Sbjct  136  GKVHFVCNSWVYPSLNY  152



>ref|XP_006850111.1| hypothetical protein AMTR_s00022p00225700 [Amborella trichopoda]
 gb|ERN11692.1| hypothetical protein AMTR_s00022p00225700 [Amborella trichopoda]
Length=618

 Score =   172 bits (435),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 99/139 (71%), Gaps = 0/139 (0%)
 Frame = +3

Query  90   SPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRS  269
            S T  I+G +VL +KNVLDFNDF+ S +DNL +FLG++VSL+LVS+  AD   GLKGK  
Sbjct  21   SSTTMIEGWLVLKKKNVLDFNDFHLSFLDNLDEFLGKRVSLQLVSATHADPERGLKGKLG  80

Query  270  KAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  449
            KAAYL+ W  K+  LA GE+ F + FEW E FG+P  FII+N H  EFYLK LTL  VP 
Sbjct  81   KAAYLEEWSKKHDGLAVGEAQFIVNFEWDESFGIPGGFIIRNEHHAEFYLKALTLHHVPG  140

Query  450  HGEVHFACFSWVYPASKYN  506
             G VHF C SWVYPA KYN
Sbjct  141  KGRVHFVCNSWVYPAKKYN  159



>ref|XP_010549787.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Tarenaya hassleriana]
Length=861

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 99/134 (74%), Gaps = 0/134 (0%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            K+KG VVLM+KNVLDFNDFNAS +D+L +FLG KV+L L+SS  AD  NG KGK  K A+
Sbjct  20   KVKGMVVLMKKNVLDFNDFNASFLDHLHEFLGNKVTLRLISSDVADSENGSKGKLGKPAH  79

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L+ W+   T L  GESAFK+ F+    FG P AF I+NNH +EFYLK+LTLEDVP HG V
Sbjct  80   LEDWITTVTPLTVGESAFKVTFDCENGFGFPGAFTIRNNHFSEFYLKSLTLEDVPGHGTV  139

Query  462  HFACFSWVYPASKY  503
            HF C SWVYPA  Y
Sbjct  140  HFVCNSWVYPAKNY  153



>ref|NP_001275351.1| 5-lipoxygenase [Solanum tuberosum]
 gb|AAD04258.1| 5-lipoxygenase [Solanum tuberosum]
Length=864

 Score =   173 bits (438),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 104/137 (76%), Gaps = 1/137 (1%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            +KK+KG VV+M+KN LDF D   S+ D   D LGQKVS +L+SSVQ D  NGL+GK S  
Sbjct  19   SKKVKGTVVMMKKNALDFTDLAGSLTDIAFDVLGQKVSFQLISSVQGDPTNGLQGKHSNP  78

Query  276  AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  452
            AYL++ +   T L +G E+AF + F+W+E+FGVP AFIIKN H NEF+LK+LTLEDVPNH
Sbjct  79   AYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNTHINEFFLKSLTLEDVPNH  138

Query  453  GEVHFACFSWVYPASKY  503
            G+VHF C SWVYP+ +Y
Sbjct  139  GKVHFDCNSWVYPSFRY  155



>ref|XP_007144726.1| hypothetical protein PHAVU_007G179600g [Phaseolus vulgaris]
 gb|ESW16720.1| hypothetical protein PHAVU_007G179600g [Phaseolus vulgaris]
Length=861

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 102/136 (75%), Gaps = 2/136 (1%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG--NGLKGKRSKA  275
            ++KG VVLM+KNVLDFNDF+AS +D L +F+G++VSL+LVS+V  D G  NGLKGK  K 
Sbjct  18   RVKGTVVLMKKNVLDFNDFSASFLDRLHEFVGKRVSLQLVSAVNVDSGDSNGLKGKLGKP  77

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            A+L+ W+     L  GE+AFK+ FEW E+   P AFII+NNH +EFYLK+LTLEDVP  G
Sbjct  78   AHLEDWITTIAPLTVGETAFKVTFEWDEEIRTPGAFIIRNNHHSEFYLKSLTLEDVPGQG  137

Query  456  EVHFACFSWVYPASKY  503
             + F C SWVYPA KY
Sbjct  138  VIRFICNSWVYPADKY  153



>sp|O22508.1|LOX18_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 8 [Solanum tuberosum]
 gb|AAB81595.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   172 bits (436),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 81/137 (59%), Positives = 103/137 (75%), Gaps = 1/137 (1%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            +KK+KG VV+M KNVLDF D  +S+   + D LGQKVS +L+SSVQ D  NGL+GK S  
Sbjct  16   SKKVKGTVVMMNKNVLDFTDLASSLTGKIFDVLGQKVSFQLISSVQGDPTNGLQGKHSNP  75

Query  276  AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  452
            AYL++ +   T L +G E+AF + F+W+E+FGVP AFIIKN H  EF+LK+LTLEDVPNH
Sbjct  76   AYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNMHITEFFLKSLTLEDVPNH  135

Query  453  GEVHFACFSWVYPASKY  503
            G+VHF C SWVYP+  Y
Sbjct  136  GKVHFVCNSWVYPSLNY  152



>gb|KJB80989.1| hypothetical protein B456_013G124500 [Gossypium raimondii]
Length=865

 Score =   172 bits (436),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 79/142 (56%), Positives = 102/142 (72%), Gaps = 1/142 (1%)
 Frame = +3

Query  81   EALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKG  260
            E + P +KIKG V+LM+KNVLDFNDF+AS +D   + LG++VS +L+SS   D  NGL+G
Sbjct  17   EKMKP-EKIKGTVILMKKNVLDFNDFHASFLDGFHELLGKRVSFQLISSQHVDADNGLQG  75

Query  261  KRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLED  440
            K  K AYL+ W    T   +GES F + F++ E+ G+P AF+IKNNH +EFYLKTLTLE 
Sbjct  76   KLGKEAYLEDWNSTETSAVAGESKFDVNFDFEEEIGLPGAFLIKNNHHSEFYLKTLTLEH  135

Query  441  VPNHGEVHFACFSWVYPASKYN  506
            VP HG +HF C SWVYP  KY+
Sbjct  136  VPGHGRLHFVCNSWVYPDKKYD  157



>sp|Q43189.1|LOX13_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 3 [Solanum tuberosum]
 gb|AAB67858.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   172 bits (435),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 81/137 (59%), Positives = 103/137 (75%), Gaps = 1/137 (1%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            +KK+KG VV+M KNVLDF D  +S+   + D LGQKVS +L+SSVQ D  NGL+GK S  
Sbjct  16   SKKVKGTVVMMNKNVLDFTDLASSLTGKIFDVLGQKVSFQLISSVQGDPTNGLQGKHSNP  75

Query  276  AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  452
            AYL++ +   T L +G E+AF + F+W+E+FGVP AFIIKN H  EF+LK+LTLEDVPNH
Sbjct  76   AYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNMHITEFFLKSLTLEDVPNH  135

Query  453  GEVHFACFSWVYPASKY  503
            G+VHF C SWVYP+  Y
Sbjct  136  GKVHFVCNSWVYPSLNY  152



>ref|XP_006419897.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
 gb|ESR33137.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
Length=656

 Score =   170 bits (431),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 76/134 (57%), Positives = 98/134 (73%), Gaps = 0/134 (0%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            KIKG VVLM+KNVLDFND  AS +D L + LG+ VS++L+S+V AD  N L+G+  K AY
Sbjct  36   KIKGTVVLMKKNVLDFNDMKASFLDRLHELLGKGVSMQLISAVNADPANELRGRLGKVAY  95

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L+ W+   T L + E+ F I F+W E  GVP AFII+N+H ++FYLKT+TLEDVP HG +
Sbjct  96   LEKWITTITPLTAVETLFTITFDWDEAMGVPGAFIIRNHHHSQFYLKTVTLEDVPGHGRI  155

Query  462  HFACFSWVYPASKY  503
            HF C SWVYP  +Y
Sbjct  156  HFVCNSWVYPTHRY  169



>gb|AGI16415.1| lipoxygenase [Malus domestica]
Length=868

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 99/135 (73%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKIKG+VVLM+K VLD ND  ASI+D + + LG+ VSL L+SSV  D  N LKGK  K A
Sbjct  24   KKIKGRVVLMKKVVLDVNDLKASILDRVDELLGKAVSLRLISSVNGDPENELKGKVGKPA  83

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL++WV     L +GE+AF + F+W ++ GVP AF+++N H +EFYLKTLTLEDVP  G 
Sbjct  84   YLENWVTTIAPLTAGEAAFDVTFDWEKEIGVPGAFVVRNEHHSEFYLKTLTLEDVPGEGR  143

Query  459  VHFACFSWVYPASKY  503
            VHF C SWVYPA KY
Sbjct  144  VHFVCNSWVYPADKY  158



>gb|AGI16414.1| lipoxygenase [Malus domestica]
Length=868

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 99/135 (73%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKIKG+VVLM+K VLD ND  ASI+D + + LG+ VSL L+SSV  D  N LKGK  K A
Sbjct  24   KKIKGRVVLMKKVVLDVNDLKASILDRVDELLGKAVSLRLISSVNGDPENELKGKVGKPA  83

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL++WV     L +GE+AF + F+W ++ GVP AF+++N H +EFYLKTLTLEDVP  G 
Sbjct  84   YLENWVTTIAPLTAGEAAFDVTFDWEKEIGVPGAFVVRNEHHSEFYLKTLTLEDVPGEGR  143

Query  459  VHFACFSWVYPASKY  503
            VHF C SWVYPA KY
Sbjct  144  VHFVCNSWVYPADKY  158



>ref|NP_001281022.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGI16411.1| lipoxygenase [Malus domestica]
 gb|AGI16412.1| lipoxygenase [Malus domestica]
 gb|AGK82792.1| lipoxygenase [Malus domestica]
Length=868

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 99/135 (73%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKIKG+VVLM+K VLD ND  ASI+D + + LG+ VSL L+SSV  D  N LKGK  K A
Sbjct  24   KKIKGRVVLMKKVVLDVNDLKASILDRVDELLGKAVSLRLISSVNGDPENELKGKVGKPA  83

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL++WV     L +GE+AF + F+W ++ GVP AF+++N H +EFYLKTLTLEDVP  G 
Sbjct  84   YLENWVTTIAPLTAGEAAFDVTFDWEKEIGVPGAFVVRNEHHSEFYLKTLTLEDVPGEGR  143

Query  459  VHFACFSWVYPASKY  503
            VHF C SWVYPA KY
Sbjct  144  VHFVCNSWVYPADKY  158



>emb|CAA64764.1| lipoxygenase [Solanum tuberosum]
Length=447

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 103/137 (75%), Gaps = 4/137 (3%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            +KK+KG VV+M KNVLDF D   S+   + D LGQKVS +L+SSVQA   NGL+GK S  
Sbjct  12   SKKVKGTVVMMNKNVLDFTDLAGSLTGKIFDVLGQKVSFQLISSVQA---NGLQGKHSNP  68

Query  276  AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  452
            AYL++ +   T L +G E+AF + F+W+E+FGVP AFIIKN H NEF+LK+LTLEDVPNH
Sbjct  69   AYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNMHINEFFLKSLTLEDVPNH  128

Query  453  GEVHFACFSWVYPASKY  503
            G+VHF C SWVYP+  Y
Sbjct  129  GKVHFVCNSWVYPSLNY  145



>gb|KDO74649.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
Length=627

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 98/134 (73%), Gaps = 0/134 (0%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            KIKG VVLM+KNVLDFND  AS +D L + LG+ VS++L+S+V AD  N L+G+  K AY
Sbjct  36   KIKGTVVLMKKNVLDFNDMKASFLDRLHELLGKGVSMQLISAVNADPANELRGRLGKVAY  95

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L+ W+   T L + E+ F I F+W E  GVP AFII+N+H ++FYLKT+TLEDVP HG +
Sbjct  96   LEKWITTITPLTAVETLFTITFDWDEAMGVPGAFIIRNHHHSQFYLKTVTLEDVPGHGRI  155

Query  462  HFACFSWVYPASKY  503
            HF C SWVYP  +Y
Sbjct  156  HFVCNSWVYPTHRY  169



>gb|KDO74650.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
 gb|KDO74651.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
Length=555

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 98/134 (73%), Gaps = 0/134 (0%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            KIKG VVLM+KNVLDFND  AS +D L + LG+ VS++L+S+V AD  N L+G+  K AY
Sbjct  36   KIKGTVVLMKKNVLDFNDMKASFLDRLHELLGKGVSMQLISAVNADPANELRGRLGKVAY  95

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L+ W+   T L + E+ F I F+W E  GVP AFII+N+H ++FYLKT+TLEDVP HG +
Sbjct  96   LEKWITTITPLTAVETLFTITFDWDEAMGVPGAFIIRNHHHSQFYLKTVTLEDVPGHGRI  155

Query  462  HFACFSWVYPASKY  503
            HF C SWVYP  +Y
Sbjct  156  HFVCNSWVYPTHRY  169



>ref|XP_006300394.1| hypothetical protein CARUB_v10019783mg [Capsella rubella]
 gb|EOA33292.1| hypothetical protein CARUB_v10019783mg [Capsella rubella]
Length=859

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KK+KG VVL++KNVLDFNDFNAS +D L +FL  K++L L+SS   D  NG KGK  KAA
Sbjct  19   KKVKGTVVLIKKNVLDFNDFNASFLDRLHEFLNNKITLRLISSDVTDSANGSKGKLGKAA  78

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            +L+ W+   T L +GESAFK+ F++  DFG P AF+I+N+H +EF+LK+LTLEDVP HG 
Sbjct  79   HLEDWITTITSLTAGESAFKVTFDYDSDFGYPGAFLIRNSHFSEFFLKSLTLEDVPGHGR  138

Query  459  VHFACFSWVYPASKYN  506
            VH+ C SW+YP+  Y 
Sbjct  139  VHYICNSWIYPSKHYT  154



>ref|XP_006419896.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
 gb|ESR33136.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
Length=627

 Score =   170 bits (430),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 76/134 (57%), Positives = 98/134 (73%), Gaps = 0/134 (0%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            KIKG VVLM+KNVLDFND  AS +D L + LG+ VS++L+S+V AD  N L+G+  K AY
Sbjct  36   KIKGTVVLMKKNVLDFNDMKASFLDRLHELLGKGVSMQLISAVNADPANELRGRLGKVAY  95

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L+ W+   T L + E+ F I F+W E  GVP AFII+N+H ++FYLKT+TLEDVP HG +
Sbjct  96   LEKWITTITPLTAVETLFTITFDWDEAMGVPGAFIIRNHHHSQFYLKTVTLEDVPGHGRI  155

Query  462  HFACFSWVYPASKY  503
            HF C SWVYP  +Y
Sbjct  156  HFVCNSWVYPTHRY  169



>gb|AGI16416.1| lipoxygenase [Malus domestica]
Length=868

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 99/135 (73%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKIKG+VVLM+K VLD ND  ASI+D + + LG+ VSL L+SSV  D  N LKGK  K A
Sbjct  24   KKIKGRVVLMKKVVLDVNDLKASILDRVDELLGKVVSLRLISSVNGDPENELKGKVGKPA  83

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL++WV     L +GE+AF + F+W ++ GVP AF+++N H +EFYLKTLTLEDVP  G 
Sbjct  84   YLENWVTTIAPLTAGEAAFDVTFDWEKEIGVPGAFVVRNEHHSEFYLKTLTLEDVPGEGR  143

Query  459  VHFACFSWVYPASKY  503
            VHF C SWVYPA KY
Sbjct  144  VHFVCNSWVYPADKY  158



>gb|AGN75068.1| lipoxygenase 2 [Momordica charantia]
Length=845

 Score =   171 bits (432),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 76/136 (56%), Positives = 104/136 (76%), Gaps = 1/136 (1%)
 Frame = +3

Query  87   LSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKR  266
            L   KKI+G V+LM+ NVLDFNDF+ S++D L +FLG++VSL+LVS++  D  NGL+GK 
Sbjct  7    LGEKKKIEGTVILMKSNVLDFNDFHESLLDYLYEFLGKRVSLQLVSAINGDHSNGLRGKL  66

Query  267  SKAAYLDHWVLKNTVLASGESAFKIEFEW-SEDFGVPAAFIIKNNHPNEFYLKTLTLEDV  443
             +AAYL+ W+   T L +GE+AFK+ F+W  E+ G+P AF I+N+H +EFYLK+LTLE V
Sbjct  67   GEAAYLEDWITTRTPLIAGEAAFKVRFDWDEEEMGIPGAFFIRNDHHSEFYLKSLTLEHV  126

Query  444  PNHGEVHFACFSWVYP  491
            P HG ++F C SWVYP
Sbjct  127  PGHGRIYFLCNSWVYP  142



>gb|KFK35599.1| hypothetical protein AALP_AA4G012300 [Arabis alpina]
Length=856

 Score =   171 bits (432),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 101/134 (75%), Gaps = 1/134 (1%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            K+KG VVLM+KNVLDFNDFNAS +D L +FLG KV+L L+SS   D  +G KGK  KA +
Sbjct  18   KVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKVTLRLISSDLTD-PDGSKGKLGKAGH  76

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L+ W+   T L +GESAFK+ F++  DFG P AF+I+N+H +EFYLK+LTLEDVP HG V
Sbjct  77   LEDWITTITSLTAGESAFKVTFDYDSDFGYPGAFLIRNSHFSEFYLKSLTLEDVPGHGRV  136

Query  462  HFACFSWVYPASKY  503
            H+ C SWVYPA  Y
Sbjct  137  HYLCNSWVYPAKNY  150



>gb|AAK50778.4|AF361893_1 bacterial-induced lipoxygenase [Gossypium hirsutum]
Length=865

 Score =   170 bits (431),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 77/136 (57%), Positives = 98/136 (72%), Gaps = 0/136 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            +KIKG V+LM+KNVLDFNDF+AS +D   + LG++VS +L+SS   D  NGL+GK  K A
Sbjct  22   EKIKGTVILMKKNVLDFNDFHASFLDGFHELLGKRVSFQLISSQHVDADNGLQGKLGKEA  81

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ W    T   +GES F + F++ E+ G+P AF+IKNNH +EFYLKTLTLE VP HG 
Sbjct  82   YLEDWNSTETSAVAGESKFDVNFDFEEEIGLPGAFLIKNNHHSEFYLKTLTLEHVPGHGR  141

Query  459  VHFACFSWVYPASKYN  506
             HF C SWVYP  KY+
Sbjct  142  FHFVCNSWVYPDKKYD  157



>ref|XP_010324011.1| PREDICTED: linoleate 9S-lipoxygenase B isoform X1 [Solanum lycopersicum]
Length=859

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 104/134 (78%), Gaps = 1/134 (1%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            K+KG+V+LM+KNVLDF +  AS+VD +SD LGQKVS++L+S    +  +GL+GK S  AY
Sbjct  18   KVKGRVILMKKNVLDFINIGASVVDGISDLLGQKVSIQLISG-SVNYADGLEGKLSNPAY  76

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L+ W+   T + +GES F + F+W ++FGVP AFIIKN H NEF+LK+LTLEDVPN+G++
Sbjct  77   LESWLTDITPITAGESTFSVTFDWDDEFGVPGAFIIKNFHLNEFFLKSLTLEDVPNYGKI  136

Query  462  HFACFSWVYPASKY  503
            HF C SWVYPA +Y
Sbjct  137  HFVCNSWVYPAFRY  150



>ref|XP_008388961.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Malus domestica]
Length=922

 Score =   170 bits (431),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 80/135 (59%), Positives = 99/135 (73%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKIKG+VVLM+K VLD ND  ASI+D + + LG+ VSL L+SSV +D  N   GK  K A
Sbjct  78   KKIKGRVVLMKKIVLDLNDLKASILDRVHELLGKAVSLRLISSVNSDPENESTGKVGKPA  137

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL++WV   T L +GE+AF + F+W E+ GVP AFI++N H +EFYLKT+TLEDVP  G 
Sbjct  138  YLENWVTTITPLTAGETAFDVTFDWDEEIGVPGAFIVRNYHHSEFYLKTVTLEDVPGEGR  197

Query  459  VHFACFSWVYPASKY  503
            VHF C SWVYPA KY
Sbjct  198  VHFVCNSWVYPADKY  212



>ref|XP_006419898.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
 ref|XP_006489365.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Citrus 
sinensis]
 gb|ESR33138.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
Length=882

 Score =   170 bits (430),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 76/134 (57%), Positives = 98/134 (73%), Gaps = 0/134 (0%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            KIKG VVLM+KNVLDFND  AS +D L + LG+ VS++L+S+V AD  N L+G+  K AY
Sbjct  36   KIKGTVVLMKKNVLDFNDMKASFLDRLHELLGKGVSMQLISAVNADPANELRGRLGKVAY  95

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L+ W+   T L + E+ F I F+W E  GVP AFII+N+H ++FYLKT+TLEDVP HG +
Sbjct  96   LEKWITTITPLTAVETLFTITFDWDEAMGVPGAFIIRNHHHSQFYLKTVTLEDVPGHGRI  155

Query  462  HFACFSWVYPASKY  503
            HF C SWVYP  +Y
Sbjct  156  HFVCNSWVYPTHRY  169



>gb|KDO74647.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
Length=882

 Score =   170 bits (430),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 76/134 (57%), Positives = 98/134 (73%), Gaps = 0/134 (0%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            KIKG VVLM+KNVLDFND  AS +D L + LG+ VS++L+S+V AD  N L+G+  K AY
Sbjct  36   KIKGTVVLMKKNVLDFNDMKASFLDRLHELLGKGVSMQLISAVNADPANELRGRLGKVAY  95

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L+ W+   T L + E+ F I F+W E  GVP AFII+N+H ++FYLKT+TLEDVP HG +
Sbjct  96   LEKWITTITPLTAVETLFTITFDWDEAMGVPGAFIIRNHHHSQFYLKTVTLEDVPGHGRI  155

Query  462  HFACFSWVYPASKY  503
            HF C SWVYP  +Y
Sbjct  156  HFVCNSWVYPTHRY  169



>ref|XP_011023611.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=861

 Score =   169 bits (429),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 79/137 (58%), Positives = 100/137 (73%), Gaps = 1/137 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQAD-LGNGLKGKRSKA  275
            KKI+G VVLM+KNVLD  D NASI D + +FLGQ VSL+LVS+V +D   N LKGK  K 
Sbjct  19   KKIRGTVVLMKKNVLDLTDLNASIHDRVHEFLGQGVSLQLVSAVNSDPSANDLKGKLGKP  78

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            AYL+ W+   T L +GE+AF++ F W E+ G+P A ++KNNH +EFYLKT+TLE VP  G
Sbjct  79   AYLEKWITTVTPLTAGETAFQVTFNWDEEIGIPGALLVKNNHQSEFYLKTVTLEGVPGLG  138

Query  456  EVHFACFSWVYPASKYN  506
             VHF C SW+YPA  Y+
Sbjct  139  RVHFVCKSWIYPAEHYS  155



>emb|CAA64765.1| lipoxygenase [Solanum tuberosum]
Length=844

 Score =   169 bits (428),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 80/135 (59%), Positives = 101/135 (75%), Gaps = 1/135 (1%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            K+KG VV+M KNVLDF D  +S+   + D LGQKVS +L+SSVQ D  NGL+GK S  AY
Sbjct  1    KVKGTVVMMNKNVLDFTDLASSLTGKIFDVLGQKVSFQLISSVQGDPTNGLQGKHSNPAY  60

Query  282  LDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            L++ +   T L +G E+AF + F+W+E+FGVP AFIIKN H  EF+LK+LTLEDVPNHG+
Sbjct  61   LENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNMHITEFFLKSLTLEDVPNHGK  120

Query  459  VHFACFSWVYPASKY  503
            VHF C SWVYP+  Y
Sbjct  121  VHFVCNSWVYPSLNY  135



>ref|XP_010108010.1| Linoleate 9S-lipoxygenase 5 [Morus notabilis]
 gb|EXC17575.1| Linoleate 9S-lipoxygenase 5 [Morus notabilis]
Length=884

 Score =   169 bits (429),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 75/136 (55%), Positives = 99/136 (73%), Gaps = 0/136 (0%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            TKKIKG VVLM+KNVLDFND  AS++D + +  G+ VS++++SSV  D  NG +GK  K 
Sbjct  36   TKKIKGTVVLMKKNVLDFNDIKASLLDRIHELFGKVVSMQIISSVLPDPENGFRGKLGKV  95

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            AYL+ W+   +  A+ E+ F + FEW E  G+P AFIIKN+H ++F+LKT+TLEDVP HG
Sbjct  96   AYLEKWISTISPTAARETQFTVTFEWGETMGLPGAFIIKNHHHSQFFLKTVTLEDVPGHG  155

Query  456  EVHFACFSWVYPASKY  503
             VHF C SWVYP  +Y
Sbjct  156  RVHFVCNSWVYPTHRY  171



>gb|AGI16413.1| lipoxygenase [Malus domestica]
Length=868

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 98/135 (73%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKIKG+VVLM+K VLD ND  ASI+D + + LG+ VSL L+SSV     N LKGK  K A
Sbjct  24   KKIKGRVVLMKKVVLDVNDLKASILDRVDELLGKAVSLRLISSVNGAPENELKGKVGKPA  83

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL++WV     L +GE+AF + F+W ++ GVP AF+++N H +EFYLKTLTLEDVP  G 
Sbjct  84   YLENWVTTIAPLTAGEAAFDVTFDWEKEIGVPGAFVVRNEHHSEFYLKTLTLEDVPGEGR  143

Query  459  VHFACFSWVYPASKY  503
            VHF C SWVYPA KY
Sbjct  144  VHFVCNSWVYPADKY  158



>ref|NP_001234098.1| lipoxygenase [Solanum lycopersicum]
 gb|AAG21691.1| lipoxygenase [Solanum lycopersicum]
Length=862

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 104/136 (76%), Gaps = 2/136 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            +K+KG VVLM+KNVLDF D  ASIVD   +FLG++VS +L+S+   D  NGL+GK S  A
Sbjct  17   EKVKGTVVLMKKNVLDFTDVTASIVDGALEFLGRRVSFQLISNSVHD-ANGLEGKLSNPA  75

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSED-FGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            YL++W+   T + +GES F + F+W +D FGVP AFIIKN H +EF+LK+LTLE VPNHG
Sbjct  76   YLENWITNITPVVAGESTFSVTFDWDDDEFGVPGAFIIKNLHFSEFFLKSLTLEHVPNHG  135

Query  456  EVHFACFSWVYPASKY  503
            +VHF C SWVYPASKY
Sbjct  136  KVHFVCNSWVYPASKY  151



>ref|XP_011087404.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Sesamum indicum]
Length=867

 Score =   168 bits (425),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  IKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAYL  284
            IKG+VVLM+KNVLDFND  AS++D   + +G KVSL+L+SSV  D  N +KGK  KAAYL
Sbjct  25   IKGRVVLMKKNVLDFNDLAASVLDRFHELVGHKVSLQLISSVNTDSENRVKGKVGKAAYL  84

Query  285  DHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH-GEV  461
            + W+   T L  G+SAF + F+W E+ GVP AFII N H +EFYLKTLTLE VP H G +
Sbjct  85   EKWITTFTSLTPGDSAFDVSFDWEEEVGVPGAFIINNLHHSEFYLKTLTLEHVPGHSGPL  144

Query  462  HFACFSWVYPASKY  503
            HF C SW+YPA KY
Sbjct  145  HFVCNSWIYPADKY  158



>ref|XP_002319015.2| hypothetical protein POPTR_0013s02310g [Populus trichocarpa]
 gb|EEE94938.2| hypothetical protein POPTR_0013s02310g [Populus trichocarpa]
Length=862

 Score =   168 bits (425),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 99/137 (72%), Gaps = 1/137 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADL-GNGLKGKRSKA  275
            KKI+G VVLM+KNVLD  D NASI D + +FLGQ VSL+LVS+V +D   N  KGK  K 
Sbjct  19   KKIRGTVVLMKKNVLDLTDLNASIHDRVHEFLGQGVSLQLVSAVNSDPSANDFKGKLGKP  78

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            AYL+ W+   T L +GE+AFK+ F W E+ G+P A ++KNNH +EFYLKT+TLE VP  G
Sbjct  79   AYLEKWITTVTPLTAGETAFKVTFNWDEEIGIPGALLVKNNHQSEFYLKTVTLEGVPGLG  138

Query  456  EVHFACFSWVYPASKYN  506
             VHF C SW+YPA  Y+
Sbjct  139  RVHFVCKSWIYPAEHYS  155



>ref|NP_001280815.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGK82793.1| lipoxygenase [Malus domestica]
Length=885

 Score =   168 bits (425),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 96/135 (71%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KK++G VVLM+KNVL+ ND  AS+ D   +  G++V L+L+SSV  D  NG +GK  K A
Sbjct  44   KKLRGTVVLMKKNVLELNDLKASVHDRFDELRGKRVLLQLISSVNCDPENGWQGKVGKPA  103

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ W+ K T L + E+AF + F+W E+ GVP AFII+N H NEFYLK+LTLEDVP  G 
Sbjct  104  YLEDWITKITPLTAEETAFDVTFDWDEEIGVPGAFIIRNEHHNEFYLKSLTLEDVPGEGR  163

Query  459  VHFACFSWVYPASKY  503
            VHF C SWVYP  KY
Sbjct  164  VHFVCNSWVYPTEKY  178



>gb|KJB28315.1| hypothetical protein B456_005G041900 [Gossypium raimondii]
Length=877

 Score =   168 bits (425),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 96/132 (73%), Gaps = 0/132 (0%)
 Frame = +3

Query  111  GKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAYLDH  290
            G +VLM+KNVLD +D  +S++D + + LG+ VSL+L+S+V  D  NGL+GK  K  YL+ 
Sbjct  32   GALVLMKKNVLDVSDLKSSLLDRVHELLGKGVSLQLISAVHTDPANGLRGKLGKPVYLEK  91

Query  291  WVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVHFA  470
            WV  NT L +GE+   +EFEW E  GVP AF+IKNNH ++FYL TLTLEDVP HG + F 
Sbjct  92   WVTTNTPLTAGETKLDVEFEWDESMGVPGAFMIKNNHHSQFYLGTLTLEDVPGHGRLQFV  151

Query  471  CFSWVYPASKYN  506
            C SWVYPA +YN
Sbjct  152  CNSWVYPAHRYN  163



>ref|XP_008370477.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Malus 
domestica]
Length=963

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 101/136 (74%), Gaps = 1/136 (1%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLKGKRSKAA  278
            KI G VVLM+KNVLDFND NAS++D + + +GQ VSL+L+S+V AD   NG KGK  + A
Sbjct  121  KINGTVVLMKKNVLDFNDLNASVLDGVYELVGQGVSLQLISAVHADDSKNGWKGKLGQPA  180

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ W+   T L +GESAFK+ F++ E+ GVP AF+IKNNH +EF+LKT+TLE+VP  G 
Sbjct  181  YLEDWITTITPLTTGESAFKVTFDYEEEVGVPGAFLIKNNHHSEFFLKTVTLENVPGEGR  240

Query  459  VHFACFSWVYPASKYN  506
            VH  C SWVYP  KY 
Sbjct  241  VHIVCNSWVYPTEKYT  256



>ref|XP_004302419.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=919

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 98/141 (70%), Gaps = 0/141 (0%)
 Frame = +3

Query  81   EALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKG  260
            E  S    IKG VVLM+KN+L+ ND  AS +D + + LG+ VSL LVS+V  D  NG +G
Sbjct  69   EPPSDANNIKGTVVLMKKNLLELNDLGASFIDRVHELLGKAVSLRLVSAVNTDPANGNRG  128

Query  261  KRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLED  440
            K  KAAYL++W+ K T L + E AFK+ F W E  GVP AFII+N H +EFYLK+LTLE+
Sbjct  129  KIGKAAYLENWISKVTPLTAAECAFKVNFVWDEKIGVPGAFIIRNEHASEFYLKSLTLEN  188

Query  441  VPNHGEVHFACFSWVYPASKY  503
            VP  G VHF C SWVYPA KY
Sbjct  189  VPGKGRVHFDCNSWVYPADKY  209



>ref|XP_008359870.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Malus domestica]
Length=885

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 96/135 (71%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KK++G VVLM+KNVL+ ND  AS+ D   +  G++V L+L+SSV  D  NG +GK  K A
Sbjct  44   KKLRGTVVLMKKNVLELNDLKASVHDRFDELRGKRVLLQLISSVNCDPENGWQGKVGKPA  103

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ W+ K T L + E+AF + F+W E+ GVP AFII+N H NEFYLK+LTLEDVP  G 
Sbjct  104  YLEDWITKITPLTAEETAFDVTFDWDEEIGVPGAFIIRNEHHNEFYLKSLTLEDVPGEGR  163

Query  459  VHFACFSWVYPASKY  503
            VHF C SWVYP  KY
Sbjct  164  VHFXCNSWVYPXXKY  178



>ref|XP_010323943.1| PREDICTED: lipoxygenase isoform X1 [Solanum lycopersicum]
Length=862

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 103/136 (76%), Gaps = 2/136 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            +K+KG VVLM+KNVLDF D  ASIVD   +FLG++VS +L+S+   D  NGL+GK S  A
Sbjct  17   EKVKGTVVLMKKNVLDFTDVTASIVDGALEFLGRRVSFQLISNSVHD-ANGLEGKLSNPA  75

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSE-DFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            YL++W+   T + +GES F + F+W   +FGVP AFIIKN H NEF+LK+LTLEDVPNHG
Sbjct  76   YLENWITNITPIIAGESTFSVTFDWDRNEFGVPGAFIIKNFHLNEFFLKSLTLEDVPNHG  135

Query  456  EVHFACFSWVYPASKY  503
            ++HF C SWVYPA +Y
Sbjct  136  KIHFVCNSWVYPAFRY  151



>ref|XP_002311617.1| lipoxygenase family protein [Populus trichocarpa]
 gb|EEE88984.1| lipoxygenase family protein [Populus trichocarpa]
Length=880

 Score =   167 bits (423),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 77/135 (57%), Positives = 97/135 (72%), Gaps = 1/135 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            +KIKG VVLM+KNVLDFND  AS +D + + LG+ VS++LVS+V  D  +GL+GK  K A
Sbjct  34   RKIKGTVVLMKKNVLDFNDIKASFLDRVHELLGKGVSMQLVSAVHQD-PDGLRGKLGKVA  92

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ WV   T L +GE+ F I FEW E  G P A IIKN+H ++ YLKT+TLED+P HG 
Sbjct  93   YLEKWVTTITPLTAGETMFTITFEWDESMGFPGAIIIKNHHHSQLYLKTVTLEDIPGHGR  152

Query  459  VHFACFSWVYPASKY  503
            VHF C SWVYP  +Y
Sbjct  153  VHFICNSWVYPTHRY  167



>gb|KDP40158.1| hypothetical protein JCGZ_02156 [Jatropha curcas]
Length=867

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 97/134 (72%), Gaps = 0/134 (0%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            KIKGKVVLM+KNVLDFND  AS  D + +  G+ VS++L+S+V  D  N L+GK  K A+
Sbjct  21   KIKGKVVLMKKNVLDFNDVTASCFDRIHELFGKGVSIQLISAVNPDPENDLRGKHGKVAF  80

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L+ WV K T +A+ E+ F I F+W E   VP AFII+N+H ++ YLKT+TLEDVP HG V
Sbjct  81   LESWVKKITPMAAQETEFNITFDWDESMAVPGAFIIRNHHHSQLYLKTVTLEDVPGHGRV  140

Query  462  HFACFSWVYPASKY  503
            HF C SWVYPA +Y
Sbjct  141  HFVCNSWVYPAHRY  154



>gb|ACU20079.1| unknown [Glycine max]
Length=177

 Score =   156 bits (394),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 101/140 (72%), Gaps = 3/140 (2%)
 Frame = +3

Query  87   LSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKR  266
            +  +K++KG+VVLM+K VLDF+D  A+++D + + LG+ VSL+L+S+   D   GL+GK 
Sbjct  1    MERSKRVKGRVVLMKKGVLDFHDIKANVLDRVHELLGKGVSLQLISATTPD--PGLRGKL  58

Query  267  SKAAYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDV  443
             K A+L+ WV   T L S  ++ F + FEW E  GVP AFII+NNH ++FYLKT+T+ED+
Sbjct  59   GKVAHLERWVSTITSLTSATDTEFTVTFEWDESMGVPGAFIIRNNHHSQFYLKTVTIEDI  118

Query  444  PNHGEVHFACFSWVYPASKY  503
            P HG V+F C SW+YPA +Y
Sbjct  119  PGHGPVNFVCNSWIYPAHRY  138



>ref|XP_010024349.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW60798.1| hypothetical protein EUGRSUZ_H03535 [Eucalyptus grandis]
Length=899

 Score =   167 bits (422),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 99/135 (73%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKI+G V LM+KNVLD ND  AS++D + +  G+ VSL+LVS+V +D  NG +GK  K A
Sbjct  51   KKIRGTVKLMKKNVLDMNDMKASLLDRIHELFGKGVSLQLVSAVHSDPSNGSRGKLGKVA  110

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ W+ K T L +GE+ F + F+W +  G+P AFII+N+H ++FYLKT+TLEDVP HG 
Sbjct  111  YLEKWIRKITSLTAGEAEFGVTFDWDKSMGIPGAFIIRNHHHSQFYLKTVTLEDVPGHGP  170

Query  459  VHFACFSWVYPASKY  503
            V F C SWVYP+ +Y
Sbjct  171  VKFVCNSWVYPSHRY  185



>ref|XP_007208174.1| hypothetical protein PRUPE_ppa001016mg [Prunus persica]
 gb|EMJ09373.1| hypothetical protein PRUPE_ppa001016mg [Prunus persica]
Length=933

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 98/135 (73%), Gaps = 1/135 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKIKG+VVLM+KNVL+ ND  AS +D + +  G+ VSL+L+SSV  D  NG +GK  K A
Sbjct  89   KKIKGRVVLMKKNVLELNDLKASFLDRVHELWGKVVSLQLISSVNGDPENG-RGKVGKPA  147

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ WV   T L +GE  F++ F+W E+ GVP AFII+N+H +EFYLKTLTLEDVP  G 
Sbjct  148  YLEDWVTTITPLTAGECTFEVTFDWDEEIGVPGAFIIRNDHHSEFYLKTLTLEDVPGEGR  207

Query  459  VHFACFSWVYPASKY  503
            +HF C SWVYPA  Y
Sbjct  208  IHFVCNSWVYPAKNY  222



>gb|ABV32552.1| lipoxygenase [Prunus persica]
Length=933

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 98/135 (73%), Gaps = 1/135 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKIKG+VVLM+KNVL+ ND  AS +D + +  G+ VSL+L+SSV  D  NG +GK  K A
Sbjct  89   KKIKGRVVLMKKNVLELNDLKASFLDRVHELWGKVVSLQLISSVNGDPENG-RGKVGKPA  147

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ WV   T L +GE  F++ F+W E+ GVP AFII+N+H +EFYLKTLTLEDVP  G 
Sbjct  148  YLEDWVTTITPLTAGECTFEVTFDWDEEIGVPGAFIIRNDHHSEFYLKTLTLEDVPGEGR  207

Query  459  VHFACFSWVYPASKY  503
            +HF C SWVYPA  Y
Sbjct  208  IHFVCNSWVYPAKNY  222



>ref|XP_009407551.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Musa acuminata 
subsp. malaccensis]
Length=872

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 98/141 (70%), Gaps = 0/141 (0%)
 Frame = +3

Query  81   EALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKG  260
            EA   +  +KG V+LM+KNVLDFNDFNAS++D L +FLG+ VS +LVS+  AD  NG KG
Sbjct  18   EAPKSSTTVKGSVLLMKKNVLDFNDFNASLLDGLHEFLGKGVSFQLVSATVADPHNGNKG  77

Query  261  KRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLED  440
            K    AYL+ W+   T +A+GE+ F + F W E  GVP A I+KNNH + FYLKT+TLE 
Sbjct  78   KIGPPAYLEEWITTMTSVATGETKFTVHFSWDESQGVPGAIIVKNNHHSAFYLKTITLEG  137

Query  441  VPNHGEVHFACFSWVYPASKY  503
            VPN   +HF C SWVYP  KY
Sbjct  138  VPNKEHIHFVCNSWVYPVDKY  158



>ref|XP_011026284.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Populus 
euphratica]
Length=881

 Score =   166 bits (421),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 75/135 (56%), Positives = 96/135 (71%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            +KIKG VVLM+KNVLDF D  AS +D + + LG+ VS++LVS+V  D  +GL+GK  K A
Sbjct  34   RKIKGTVVLMKKNVLDFTDIKASFLDRVHELLGKGVSMQLVSAVHQDPADGLRGKLGKVA  93

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ WV   T L +GE+ F I FEW E  G P A IIKN+H ++ YLKT+TLED+P +G 
Sbjct  94   YLEKWVATITPLTAGETMFTITFEWDESMGFPGAIIIKNHHHSQLYLKTVTLEDIPGYGR  153

Query  459  VHFACFSWVYPASKY  503
            VHF C SWVYP  +Y
Sbjct  154  VHFICNSWVYPTHRY  168



>ref|XP_004139172.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=864

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 101/137 (74%), Gaps = 3/137 (2%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKI G VVL+R NVLDFNDF ++++DNL + LG  VSL+LVS+   D   G KGK  +AA
Sbjct  18   KKINGTVVLVRDNVLDFNDFGSTVLDNLHELLGGGVSLQLVSAQHGDPSKGFKGKVGEAA  77

Query  279  YLDHWVLKNTVLA--SGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  452
            YL++W+  NT++   +GE+AF I F+W E+ GVP AF I N H +EF+LK+LTLEDVP H
Sbjct  78   YLENWI-GNTIIPIFAGETAFSITFDWDEEIGVPGAFFITNQHFSEFFLKSLTLEDVPGH  136

Query  453  GEVHFACFSWVYPASKY  503
            G +HF C SWVYPA KY
Sbjct  137  GRLHFDCNSWVYPADKY  153



>ref|XP_004156417.1| PREDICTED: LOW QUALITY PROTEIN: probable linoleate 9S-lipoxygenase 
5-like [Cucumis sativus]
Length=864

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 101/137 (74%), Gaps = 3/137 (2%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKI G VVL+R NVLDFNDF ++++DNL + LG  VSL+LVS+   D   G KGK  +AA
Sbjct  18   KKINGTVVLVRDNVLDFNDFGSTVLDNLHELLGGGVSLQLVSAQHGDPSKGFKGKVGEAA  77

Query  279  YLDHWVLKNTVLA--SGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  452
            YL++W+  NT++   +GE+AF I F+W E+ GVP AF I N H +EF+LK+LTLEDVP H
Sbjct  78   YLENWI-GNTIIPIFAGETAFSITFDWDEEIGVPGAFFITNQHFSEFFLKSLTLEDVPGH  136

Query  453  GEVHFACFSWVYPASKY  503
            G +HF C SWVYPA KY
Sbjct  137  GRLHFDCNSWVYPADKY  153



>gb|KHG03761.1| Linoleate 9S-lipoxygenase 5, chloroplastic -like protein [Gossypium 
arboreum]
 gb|KHG17470.1| Linoleate 9S-lipoxygenase 5, chloroplastic -like protein [Gossypium 
arboreum]
Length=873

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 94/134 (70%), Gaps = 0/134 (0%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            KIKG VVLM+KNV+D ND  AS +D + +  G+ VSL+L+S+V  D  N ++GK  K A 
Sbjct  27   KIKGTVVLMKKNVMDMNDLTASFLDRVYELFGRGVSLQLISAVYTDPANEMRGKLGKPAN  86

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L+ W+ K T L +GE  F + FEW E  GVP AFIIKN H ++FYLKT+TLEDVP HG V
Sbjct  87   LEKWITKITPLTAGEITFSVTFEWDESIGVPGAFIIKNRHHSQFYLKTVTLEDVPGHGRV  146

Query  462  HFACFSWVYPASKY  503
            HF C SWVYP  +Y
Sbjct  147  HFVCNSWVYPTHRY  160



>ref|NP_001234873.1| linoleate 9S-lipoxygenase B [Solanum lycopersicum]
 sp|P38416.1|LOXB_SOLLC RecName: Full=Linoleate 9S-lipoxygenase B; AltName: Full=Lipoxygenase 
B [Solanum lycopersicum]
 gb|AAA53183.1| lipoxygenase [Solanum lycopersicum]
Length=859

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 104/136 (76%), Gaps = 5/136 (4%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVS-SVQADLGNGLKGKRSKAA  278
            K+KG+V+LM+KNVLDF +  AS+VD +SD LGQKVS++L+S SV  D   GL+GK S  A
Sbjct  18   KVKGRVILMKKNVLDFINIGASVVDGISDLLGQKVSIQLISGSVNYD---GLEGKLSNPA  74

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSED-FGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            YL+ W+   T + +GES F + F+W  D FGVP AFIIKN H NEF+LK+LTLEDVPN+G
Sbjct  75   YLESWLTDITPITAGESTFSVTFDWDRDEFGVPGAFIIKNLHLNEFFLKSLTLEDVPNYG  134

Query  456  EVHFACFSWVYPASKY  503
            ++HF C SWVYPA +Y
Sbjct  135  KIHFVCNSWVYPAFRY  150



>gb|AAR90846.1| lipoxygenase [Capsicum annuum]
Length=136

 Score =   153 bits (387),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KK+KG VVL +KN LDFND NAS +D + +FLG++VSL+L+SSV  D  NGL+GKRSK A
Sbjct  18   KKMKGTVVLXKKNALDFNDVNASFLDGVLEFLGKRVSLQLISSVHGDPANGLQGKRSKPA  77

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  452
            YL++W+   T L +GESAF + F+W ED GVP AFII N H NEF+LK+LTLEDVP +
Sbjct  78   YLENWLTTRTPLVAGESAFDVTFDWDEDIGVPGAFIINNLHFNEFFLKSLTLEDVPXY  135



>gb|AAA74393.1| lipoxygenase [Solanum lycopersicum]
Length=859

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 104/136 (76%), Gaps = 5/136 (4%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVS-SVQADLGNGLKGKRSKAA  278
            K+KG+V+LM+KNVLDF +  AS+VD +SD LGQKVS++L+S SV  D   GL+GK S  A
Sbjct  18   KVKGRVILMKKNVLDFINIGASVVDGISDLLGQKVSIQLISGSVNYD---GLEGKLSNPA  74

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSED-FGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            YL+ W+   T + +GES F + F+W  D FGVP AFIIKN H NEF+LK+LTLEDVPN+G
Sbjct  75   YLESWLTDITPITAGESTFSVTFDWDRDEFGVPGAFIIKNLHLNEFFLKSLTLEDVPNYG  134

Query  456  EVHFACFSWVYPASKY  503
            ++HF C SWVYPA +Y
Sbjct  135  KIHFVCNSWVYPAFRY  150



>gb|KJB38135.1| hypothetical protein B456_006G238200 [Gossypium raimondii]
Length=570

 Score =   163 bits (412),  Expect = 6e-44, Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 93/134 (69%), Gaps = 0/134 (0%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            KIKG VVLM+KNV+D ND  AS +D + +   + VSL+L+S+V  D  N ++GK  K A 
Sbjct  54   KIKGTVVLMKKNVMDMNDLTASCLDRVYELFDRGVSLQLISAVYTDPANEMRGKLGKPAN  113

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L+ W+ K T L +GE  F + FEW E  GVP AFIIKN H ++FYLKT+TLEDVP HG V
Sbjct  114  LEKWITKFTPLTAGEITFSVTFEWDESIGVPGAFIIKNRHHSQFYLKTVTLEDVPGHGRV  173

Query  462  HFACFSWVYPASKY  503
            HF C SWVYP  +Y
Sbjct  174  HFVCNSWVYPTHRY  187



>ref|XP_009366923.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=884

 Score =   165 bits (417),  Expect = 9e-44, Method: Composition-based stats.
 Identities = 74/142 (52%), Positives = 104/142 (73%), Gaps = 3/142 (2%)
 Frame = +3

Query  87   LSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQAD-LGNGLK--  257
            +S   +I+GK+VLM+KNVLDFND  AS+VD + + LG+ VS++L+S+   +   NGLK  
Sbjct  27   VSGGNRIRGKLVLMKKNVLDFNDLKASVVDRIHELLGKGVSMQLISATHPEPAANGLKSR  86

Query  258  GKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  437
            GK  + AYL+ WV   T L++GE++F I  +W E  GVP A +I+N+H ++FYLKT+TLE
Sbjct  87   GKLGEVAYLEKWVTTTTSLSAGEASFSISLDWDESHGVPGALLIRNHHHSQFYLKTITLE  146

Query  438  DVPNHGEVHFACFSWVYPASKY  503
            DVP HG++HF C SWVYPA +Y
Sbjct  147  DVPGHGQLHFVCNSWVYPAHRY  168



>ref|XP_008454481.1| PREDICTED: linoleate 9S-lipoxygenase 6-like [Cucumis melo]
Length=863

 Score =   164 bits (416),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 77/137 (56%), Positives = 100/137 (73%), Gaps = 3/137 (2%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKI G VVLMR NVLDFNDF ++++DNL + LG  VSL+LVS+   D     +GK  +AA
Sbjct  18   KKIHGTVVLMRDNVLDFNDFGSTVLDNLHELLGGGVSLQLVSAQHGDPSKEFQGKVGEAA  77

Query  279  YLDHWVLKNTVLA--SGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  452
            YL++W+  NT+L   +GE+AF I F+W E+ G+P AF I N H +EF+LK+LTL+DVP H
Sbjct  78   YLENWI-GNTILPIFAGETAFSITFDWDEEIGIPGAFFITNQHFSEFFLKSLTLDDVPGH  136

Query  453  GEVHFACFSWVYPASKY  503
            G +HF C SWVYPA KY
Sbjct  137  GRIHFDCNSWVYPADKY  153



>gb|KJB38136.1| hypothetical protein B456_006G238200 [Gossypium raimondii]
Length=645

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 93/134 (69%), Gaps = 0/134 (0%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            KIKG VVLM+KNV+D ND  AS +D + +   + VSL+L+S+V  D  N ++GK  K A 
Sbjct  54   KIKGTVVLMKKNVMDMNDLTASCLDRVYELFDRGVSLQLISAVYTDPANEMRGKLGKPAN  113

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L+ W+ K T L +GE  F + FEW E  GVP AFIIKN H ++FYLKT+TLEDVP HG V
Sbjct  114  LEKWITKFTPLTAGEITFSVTFEWDESIGVPGAFIIKNRHHSQFYLKTVTLEDVPGHGRV  173

Query  462  HFACFSWVYPASKY  503
            HF C SWVYP  +Y
Sbjct  174  HFVCNSWVYPTHRY  187



>gb|ACH91370.1| lipoxygenase LOX-3 [Prunus persica]
Length=933

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 97/135 (72%), Gaps = 1/135 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKIKG+VVLM+KNVL+ ND  AS +D + +  G+ VSL+L+SSV  D  NG +GK  K A
Sbjct  89   KKIKGRVVLMKKNVLELNDLKASFLDRVHELWGKVVSLQLISSVNGDPENG-RGKVGKPA  147

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ WV     L +GE  F++ F+W E+ GVP AFII+N+H +EFYLKTLTLEDVP  G 
Sbjct  148  YLEDWVTTIIPLTAGECTFEVTFDWDEEIGVPGAFIIRNDHHSEFYLKTLTLEDVPGEGR  207

Query  459  VHFACFSWVYPASKY  503
            +HF C SWVYPA  Y
Sbjct  208  IHFVCNSWVYPAKNY  222



>gb|AHX56187.1| lipoxygenase [Diospyros kaki]
Length=872

 Score =   164 bits (415),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 78/138 (57%), Positives = 101/138 (73%), Gaps = 5/138 (4%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQAD---LGNGLKGKRS  269
            KKIKG+VVL RK+ LDF  F+ SI+DN+ + LGQKVSL+L+S+V  D    G GL+GK  
Sbjct  28   KKIKGRVVLTRKSELDF--FSDSILDNVHELLGQKVSLQLISAVNGDPPAAGKGLRGKLG  85

Query  270  KAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  449
            KAAYL+ W+   T+   G+SAF + F+W ++ G+P AF+I+N H  EFYLKTLTL DVP 
Sbjct  86   KAAYLEDWITTITLPGHGDSAFDVAFDWEDEVGLPGAFLIRNLHHTEFYLKTLTLHDVPG  145

Query  450  HGEVHFACFSWVYPASKY  503
            HG +HF C SWVYPA +Y
Sbjct  146  HGRLHFVCNSWVYPAHRY  163



>ref|XP_009344082.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=894

 Score =   164 bits (415),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 75/142 (53%), Positives = 103/142 (73%), Gaps = 3/142 (2%)
 Frame = +3

Query  87   LSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQAD-LGNGLK--  257
            +S + +I+GKVVLM+KNVLDFND  AS VD + + LG+ VS++L+S+   +   NGLK  
Sbjct  37   VSGSNRIRGKVVLMKKNVLDFNDLKASFVDRIHELLGKGVSMQLISATHPEPAANGLKSR  96

Query  258  GKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  437
            GK  K AYL+ W    T L++GE++F I  +W E  GVP A +I+N+H ++FYLKT+TLE
Sbjct  97   GKLGKVAYLEKWATTITSLSAGETSFTISLDWDESHGVPGALLIRNHHHSQFYLKTITLE  156

Query  438  DVPNHGEVHFACFSWVYPASKY  503
            DVP HG++HF C SWVYPA +Y
Sbjct  157  DVPEHGQLHFVCNSWVYPAHRY  178



>dbj|BAH57745.1| lipoxygenase [Actinidia arguta]
Length=886

 Score =   164 bits (415),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 75/136 (55%), Positives = 100/136 (74%), Gaps = 1/136 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            +KIKG+VVLM+KNVLD N   ASI+D + + LG+ VS++L+S+ + D  NG +GK  K A
Sbjct  38   RKIKGRVVLMKKNVLDMNHLGASILDRVHEVLGKGVSIQLISANRGDPANGKRGKLGKTA  97

Query  279  YLDHWVLKNTVLASGESA-FKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            YL++W+   T +A+ + A F + FEW E  G+P AFIIKN+H  E YLKT+TLEDVP HG
Sbjct  98   YLENWIATITSVATADDASFNVSFEWDEAMGIPGAFIIKNHHHYEVYLKTVTLEDVPRHG  157

Query  456  EVHFACFSWVYPASKY  503
            +VHF C SWVYPA +Y
Sbjct  158  QVHFVCNSWVYPAHRY  173



>ref|XP_008246454.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=934

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 97/135 (72%), Gaps = 1/135 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKIKG+VVLM+KNVL+ ND  AS +D + +  G+ VSL+L+SSV  D  NG +GK  K A
Sbjct  90   KKIKGRVVLMKKNVLELNDLKASFLDRVHELWGEVVSLQLISSVNGDPENG-RGKVGKPA  148

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ WV   T L + E  F++ F+W E+ GVP AFII+N+H +EFYLKTLTLEDVP  G 
Sbjct  149  YLEDWVTTITPLTAEECTFEVTFDWDEEIGVPGAFIIRNDHHSEFYLKTLTLEDVPGEGR  208

Query  459  VHFACFSWVYPASKY  503
            +HF C SWVYPA  Y
Sbjct  209  IHFVCNSWVYPAKNY  223



>ref|XP_002516771.1| lipoxygenase, putative [Ricinus communis]
 gb|EEF45385.1| lipoxygenase, putative [Ricinus communis]
Length=868

 Score =   163 bits (413),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 74/135 (55%), Positives = 97/135 (72%), Gaps = 0/135 (0%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            KIKG VVLM+KNVLDF+D  AS +D + + LG+ VS++L+S+V  D  N L+GK  K AY
Sbjct  22   KIKGTVVLMKKNVLDFSDIKASFLDRVHELLGKGVSMQLISAVHHDPANKLRGKLGKVAY  81

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L+ WV   T + + ++ F I F+W E  GVP AFII+N+H ++ YLKT+TL+DVP HG V
Sbjct  82   LEKWVRSITPITAVDTVFNITFDWDESMGVPGAFIIRNHHHSQLYLKTVTLDDVPGHGRV  141

Query  462  HFACFSWVYPASKYN  506
            HF C SWVYPA  YN
Sbjct  142  HFVCNSWVYPAHCYN  156



>ref|XP_006382595.1| hypothetical protein POPTR_0005s03580g [Populus trichocarpa]
 gb|ERP60392.1| hypothetical protein POPTR_0005s03580g [Populus trichocarpa]
Length=863

 Score =   163 bits (413),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 74/136 (54%), Positives = 101/136 (74%), Gaps = 1/136 (1%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADL-GNGLKGKRSKAA  278
            KIKG VVLM+KNVL+FNDF+AS++D   + LGQ VSL+++ + ++D   NGLK K  K A
Sbjct  20   KIKGTVVLMKKNVLEFNDFHASVLDRGHELLGQGVSLQVIGTAKSDPPENGLKEKLGKPA  79

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
             L++W+     L +GE+ FK+ F+W E+ G+P A +I+NNH +EFYLKT+TLEDVP  G 
Sbjct  80   NLENWITTIDPLIAGETEFKVTFDWDEEIGIPVALLIRNNHHSEFYLKTVTLEDVPGQGR  139

Query  459  VHFACFSWVYPASKYN  506
            VHF C SW+YPA +YN
Sbjct  140  VHFVCNSWIYPAKRYN  155



>ref|XP_011036801.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=863

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 102/136 (75%), Gaps = 1/136 (1%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLKGKRSKAA  278
            KIKG VVLM+KNVL+FNDF+AS++D   + LGQ VSL+++ + ++D   NGLK K  K A
Sbjct  20   KIKGTVVLMKKNVLEFNDFHASVLDRGHELLGQGVSLQVIGAAKSDPPENGLKEKLGKPA  79

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
             L++W+     L +GE+AFK+ F+W E+ GVP A +I+NNH +EFYLKT+TLEDVP  G 
Sbjct  80   NLENWITTIDPLIAGETAFKVTFDWDEEIGVPVALLIRNNHHSEFYLKTVTLEDVPGEGR  139

Query  459  VHFACFSWVYPASKYN  506
            VHF C SW+YPA +Y+
Sbjct  140  VHFVCNSWIYPAKRYD  155



>ref|XP_006359917.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X1 [Solanum tuberosum]
Length=887

 Score =   163 bits (413),  Expect = 4e-43, Method: Composition-based stats.
 Identities = 70/135 (52%), Positives = 98/135 (73%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KK++G VVLM+KNVLD  D  AS++D   + +G+ VSL+L+S+  A+ GNG  GK  K A
Sbjct  41   KKVRGTVVLMKKNVLDLTDVGASLLDRFHEVIGKGVSLQLISADHAEPGNGCTGKLGKPA  100

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            +L+ W+   T +++G++ F + F+W E  GVP AFIIKN H ++FYL+T+ LEDVP HGE
Sbjct  101  FLEKWISTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVVLEDVPGHGE  160

Query  459  VHFACFSWVYPASKY  503
            +HF C SWVYPA +Y
Sbjct  161  LHFVCNSWVYPAHRY  175



>gb|ABF60002.1| lipoxygenase 2 [Actinidia deliciosa]
Length=865

 Score =   163 bits (412),  Expect = 4e-43, Method: Composition-based stats.
 Identities = 79/144 (55%), Positives = 94/144 (65%), Gaps = 0/144 (0%)
 Frame = +3

Query  72   KLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNG  251
            K    +   KKI+G VVLM+K  LD ND  AS+ D   + LG KVSL+L+S+V  D    
Sbjct  12   KTKHEVGEIKKIQGTVVLMKKKFLDSNDLTASVTDRFDEILGNKVSLQLISAVNGDPEKE  71

Query  252  LKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLT  431
            L+GK  K A L+ W  K T L +    F + FEW E+ GVP AFIIKN+H NEFYLKT+T
Sbjct  72   LRGKLGKPANLEDWDTKITALTAPGVTFNVTFEWEEEIGVPGAFIIKNSHHNEFYLKTVT  131

Query  432  LEDVPNHGEVHFACFSWVYPASKY  503
            LEDVP HG VHF C SWVYPAS Y
Sbjct  132  LEDVPGHGRVHFVCNSWVYPASCY  155



>ref|XP_002319014.2| lipoxygenase family protein [Populus trichocarpa]
 gb|EEE94937.2| lipoxygenase family protein [Populus trichocarpa]
Length=836

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 98/128 (77%), Gaps = 1/128 (1%)
 Frame = +3

Query  126  MRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLKGKRSKAAYLDHWVLK  302
            M+KNVL FNDF+AS++D + + LGQ+VSL+L+S+V +D   N LKGK  + AYL+ WV  
Sbjct  1    MKKNVLGFNDFHASVLDRVHELLGQRVSLQLISAVNSDRSDNDLKGKLGEPAYLEEWVTT  60

Query  303  NTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVHFACFSW  482
             T L +GE+AFK+ F+W E+ GVP AF+I+NNH +EFYLKT+TLE VP HG VHF C SW
Sbjct  61   VTPLTAGEAAFKVTFDWDEEIGVPGAFLIRNNHLSEFYLKTVTLEGVPGHGRVHFVCNSW  120

Query  483  VYPASKYN  506
            +Y A +YN
Sbjct  121  IYHAKRYN  128



>ref|XP_006344623.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Solanum 
tuberosum]
Length=864

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 102/137 (74%), Gaps = 2/137 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVS-SVQADLGNGLKGKRSKA  275
            K +KG+++LM+K  LDF D NAS+ D + DFLG+KVS++L+S S+  D  NG++GKRS  
Sbjct  17   KNVKGRIILMKKIFLDFTDINASVGDEVVDFLGEKVSIQLISGSIHDDPENGVEGKRSNP  76

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  452
            AYL+ W+   T + +GES F + F+W  ++FGVP AFII N H NEF+LK+LTLEDVPN 
Sbjct  77   AYLEDWLTHITPIIAGESTFSVTFDWDHKEFGVPGAFIINNFHLNEFFLKSLTLEDVPNR  136

Query  453  GEVHFACFSWVYPASKY  503
            G +HF C SWVYPA +Y
Sbjct  137  GNIHFVCNSWVYPAFRY  153



>ref|XP_010674736.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Beta vulgaris 
subsp. vulgaris]
Length=861

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 100/145 (69%), Gaps = 1/145 (1%)
 Frame = +3

Query  75   LAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGL  254
            L+  ++  K+IKG+VVLM+K VLDFNDF ASI+D   + LG+KVS +L S+V AD  N  
Sbjct  9    LSGNVTKKKEIKGRVVLMKKYVLDFNDFTASILDRFDELLGKKVSFQLASAVNADPENES  68

Query  255  KGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTL  434
            KGK  K +YL  W+   T L  GESAF I F W ED GVP A +I+N H N+FYLK++TL
Sbjct  69   KGKLGKPSYLGDWLTNFTGLTPGESAFSITFAWDEDIGVPGAIVIRNEHQNQFYLKSVTL  128

Query  435  EDVP-NHGEVHFACFSWVYPASKYN  506
            ED P N G++HF C SW+YP  +Y 
Sbjct  129  EDTPDNIGKIHFVCNSWIYPTQRYT  153



>ref|XP_006359918.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006359919.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X3 [Solanum tuberosum]
 ref|XP_006359920.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X4 [Solanum tuberosum]
 ref|XP_006359921.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X5 [Solanum tuberosum]
Length=877

 Score =   163 bits (412),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 70/135 (52%), Positives = 98/135 (73%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KK++G VVLM+KNVLD  D  AS++D   + +G+ VSL+L+S+  A+ GNG  GK  K A
Sbjct  31   KKVRGTVVLMKKNVLDLTDVGASLLDRFHEVIGKGVSLQLISADHAEPGNGCTGKLGKPA  90

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            +L+ W+   T +++G++ F + F+W E  GVP AFIIKN H ++FYL+T+ LEDVP HGE
Sbjct  91   FLEKWISTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVVLEDVPGHGE  150

Query  459  VHFACFSWVYPASKY  503
            +HF C SWVYPA +Y
Sbjct  151  LHFVCNSWVYPAHRY  165



>ref|XP_010277584.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nelumbo 
nucifera]
Length=883

 Score =   163 bits (412),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 73/129 (57%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = +3

Query  117  VVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAYLDHWV  296
            VVLM+KNVLDFND +AS++D + + +G+ V+L+L+SSV  D  NGL+GK  K AYL+ W+
Sbjct  43   VVLMKKNVLDFNDLHASVLDRVHELVGKGVALQLISSVNTDPANGLRGKLGKEAYLEEWI  102

Query  297  LKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVHFACF  476
               T L++GES+F I F+W E  GVP AFII+N H ++F+LKT+TLEDVP  G VHF C 
Sbjct  103  TTITPLSAGESSFNITFDWDEGIGVPGAFIIRNFHHSQFFLKTVTLEDVPGVGRVHFICN  162

Query  477  SWVYPASKY  503
            SWVYP   Y
Sbjct  163  SWVYPTKHY  171



>gb|KJB38138.1| hypothetical protein B456_006G238200 [Gossypium raimondii]
Length=869

 Score =   163 bits (412),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 93/134 (69%), Gaps = 0/134 (0%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            KIKG VVLM+KNV+D ND  AS +D + +   + VSL+L+S+V  D  N ++GK  K A 
Sbjct  23   KIKGTVVLMKKNVMDMNDLTASCLDRVYELFDRGVSLQLISAVYTDPANEMRGKLGKPAN  82

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L+ W+ K T L +GE  F + FEW E  GVP AFIIKN H ++FYLKT+TLEDVP HG V
Sbjct  83   LEKWITKFTPLTAGEITFSVTFEWDESIGVPGAFIIKNRHHSQFYLKTVTLEDVPGHGRV  142

Query  462  HFACFSWVYPASKY  503
            HF C SWVYP  +Y
Sbjct  143  HFVCNSWVYPTHRY  156



>gb|KJB38137.1| hypothetical protein B456_006G238200 [Gossypium raimondii]
Length=900

 Score =   163 bits (412),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 93/134 (69%), Gaps = 0/134 (0%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            KIKG VVLM+KNV+D ND  AS +D + +   + VSL+L+S+V  D  N ++GK  K A 
Sbjct  54   KIKGTVVLMKKNVMDMNDLTASCLDRVYELFDRGVSLQLISAVYTDPANEMRGKLGKPAN  113

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L+ W+ K T L +GE  F + FEW E  GVP AFIIKN H ++FYLKT+TLEDVP HG V
Sbjct  114  LEKWITKFTPLTAGEITFSVTFEWDESIGVPGAFIIKNRHHSQFYLKTVTLEDVPGHGRV  173

Query  462  HFACFSWVYPASKY  503
            HF C SWVYP  +Y
Sbjct  174  HFVCNSWVYPTHRY  187



>ref|XP_011090733.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Sesamum 
indicum]
Length=881

 Score =   162 bits (410),  Expect = 8e-43, Method: Composition-based stats.
 Identities = 75/136 (55%), Positives = 98/136 (72%), Gaps = 1/136 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKI+G+VVLM+KNV+D  D  AS++D L +  G+ VS +L+S+ + DL NG +GK  K A
Sbjct  33   KKIQGRVVLMKKNVMDAADVGASVLDRLHEIFGRGVSFQLISAEKTDLANGKRGKLGKEA  92

Query  279  YLDHWVLKNTVL-ASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            YL+ WV K T L A  E+ F + F+W E  GVP AFI++N+H ++FYLKT+TLEDVP HG
Sbjct  93   YLEGWVSKFTSLTAEAEATFDVSFKWDESLGVPGAFIVRNHHHSQFYLKTVTLEDVPGHG  152

Query  456  EVHFACFSWVYPASKY  503
             VHF C SWVYPA  Y
Sbjct  153  PVHFVCNSWVYPAHCY  168



>ref|XP_011090735.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Sesamum 
indicum]
Length=870

 Score =   162 bits (410),  Expect = 8e-43, Method: Composition-based stats.
 Identities = 75/136 (55%), Positives = 98/136 (72%), Gaps = 1/136 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKI+G+VVLM+KNV+D  D  AS++D L +  G+ VS +L+S+ + DL NG +GK  K A
Sbjct  22   KKIQGRVVLMKKNVMDAADVGASVLDRLHEIFGRGVSFQLISAEKTDLANGKRGKLGKEA  81

Query  279  YLDHWVLKNTVL-ASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            YL+ WV K T L A  E+ F + F+W E  GVP AFI++N+H ++FYLKT+TLEDVP HG
Sbjct  82   YLEGWVSKFTSLTAEAEATFDVSFKWDESLGVPGAFIVRNHHHSQFYLKTVTLEDVPGHG  141

Query  456  EVHFACFSWVYPASKY  503
             VHF C SWVYPA  Y
Sbjct  142  PVHFVCNSWVYPAHCY  157



>ref|XP_010905215.1| PREDICTED: probable linoleate 9S-lipoxygenase 4 [Elaeis guineensis]
Length=866

 Score =   162 bits (410),  Expect = 8e-43, Method: Composition-based stats.
 Identities = 72/134 (54%), Positives = 95/134 (71%), Gaps = 0/134 (0%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            KIKG VVLM+KNVLDFND +AS++D + + LGQ V+ +LVS+ + D  NG +GK    AY
Sbjct  19   KIKGTVVLMKKNVLDFNDLHASLLDRMHEILGQGVTFQLVSATEGDPNNGKRGKVGPPAY  78

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L+ W+   T L++GES F + F W E  G+P A I+KN+H +EF+LK+LTLE VP  G +
Sbjct  79   LEEWITTLTSLSAGESRFNVTFNWDESQGIPGAVIVKNSHHSEFFLKSLTLEGVPRKGRI  138

Query  462  HFACFSWVYPASKY  503
            HF C SWVYP  KY
Sbjct  139  HFVCNSWVYPVDKY  152



>ref|XP_011026291.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Populus 
euphratica]
Length=880

 Score =   162 bits (410),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 75/135 (56%), Positives = 96/135 (71%), Gaps = 1/135 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            +KIKG VVLM+KNVLDF D  AS +D + + LG+ VS++LVS+V  D  +GL+GK  K A
Sbjct  34   RKIKGTVVLMKKNVLDFTDIKASFLDRVHELLGKGVSMQLVSAVHQD-PDGLRGKLGKVA  92

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ WV   T L +GE+ F I FEW E  G P A IIKN+H ++ YLKT+TLED+P +G 
Sbjct  93   YLEKWVATITPLTAGETMFTITFEWDESMGFPGAIIIKNHHHSQLYLKTVTLEDIPGYGR  152

Query  459  VHFACFSWVYPASKY  503
            VHF C SWVYP  +Y
Sbjct  153  VHFICNSWVYPTHRY  167



>ref|XP_008801705.1| PREDICTED: probable linoleate 9S-lipoxygenase 4 [Phoenix dactylifera]
Length=867

 Score =   162 bits (409),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 72/134 (54%), Positives = 96/134 (72%), Gaps = 0/134 (0%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            KIKG VVLM+KNVLDFND +AS++D + + LG+ +S +LVS+   D  NG +GK   AAY
Sbjct  20   KIKGTVVLMKKNVLDFNDLHASLLDRMHEVLGKGISFQLVSATVGDPNNGKRGKVGPAAY  79

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L+ W+   T L++GES F + F+W E  G+P A I+KN+H +EFYLK+LTL+ VP  G +
Sbjct  80   LEEWITTLTSLSAGESRFNVTFDWDESQGIPGAVIVKNSHHSEFYLKSLTLDGVPRKGSI  139

Query  462  HFACFSWVYPASKY  503
            HF C SWVYP  KY
Sbjct  140  HFVCNSWVYPVDKY  153



>gb|AGK82776.1| lipoxygenase [Malus domestica]
Length=900

 Score =   162 bits (410),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 74/142 (52%), Positives = 102/142 (72%), Gaps = 3/142 (2%)
 Frame = +3

Query  87   LSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLK--  257
            +S + +I+GKVVLM+KNVLDFND  AS VD + + LG+ VS++L+S+   +   NGLK  
Sbjct  22   VSGSNRIRGKVVLMKKNVLDFNDLKASFVDRIHELLGKGVSMQLISATHPEAAANGLKPR  81

Query  258  GKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  437
            GK  K AYL+ W    T L++GE++F I  +W E  G P A +I+N+H ++FYLKT+TLE
Sbjct  82   GKLGKVAYLEKWATTITSLSAGETSFTISLDWDESHGAPGALLIRNHHHSQFYLKTITLE  141

Query  438  DVPNHGEVHFACFSWVYPASKY  503
            DVP HG++HF C SWVYPA +Y
Sbjct  142  DVPEHGQLHFVCNSWVYPAHRY  163



>gb|AGK82774.1| lipoxygenase [Malus domestica]
Length=900

 Score =   162 bits (410),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 74/142 (52%), Positives = 102/142 (72%), Gaps = 3/142 (2%)
 Frame = +3

Query  87   LSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLK--  257
            +S + +I+GKVVLM+KNVLDFND  AS VD + + LG+ VS++L+S+   +   NGLK  
Sbjct  22   VSGSNRIRGKVVLMKKNVLDFNDLKASFVDRIHELLGKGVSMQLISATHPEAAANGLKPR  81

Query  258  GKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  437
            GK  K AYL+ W    T L++GE++F I  +W E  G P A +I+N+H ++FYLKT+TLE
Sbjct  82   GKLGKVAYLEKWATTITSLSAGETSFTISLDWDESHGAPGALLIRNHHHSQFYLKTITLE  141

Query  438  DVPNHGEVHFACFSWVYPASKY  503
            DVP HG++HF C SWVYPA +Y
Sbjct  142  DVPEHGQLHFVCNSWVYPAHRY  163



>gb|AIC82456.1| lipoxygenase [Cocos nucifera]
Length=852

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 97/135 (72%), Gaps = 0/135 (0%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            ++KG V+LM+KNVLDF DF+AS+ D L +FLG+ VS +LVSS  AD  NG KGK  +  Y
Sbjct  5    RVKGTVILMKKNVLDFTDFHASLHDRLDEFLGKGVSFQLVSSTIADPNNGNKGKVGEPGY  64

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            ++ W+ K T +A+GES F++ F+W E  G+P A I++N+H +EFYLKTLTLE  P +G +
Sbjct  65   IEEWITKITSIAAGESKFQVTFQWDESEGIPGAVIVRNHHHSEFYLKTLTLEHFPGNGRI  124

Query  462  HFACFSWVYPASKYN  506
            HF C SWVYP   Y 
Sbjct  125  HFVCNSWVYPVDYYT  139



>gb|AGQ04454.1| lipoxygenase 1.1, partial [Oryza meridionalis]
Length=160

 Score =   150 bits (380),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 93/135 (69%), Gaps = 1/135 (1%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            ++KG +VLMRKN LD NDF A+++D +S+FLG+ V+ +LVSS   D  NG +G+    A 
Sbjct  16   RLKGSLVLMRKNALDINDFGATVIDGISEFLGRGVTCQLVSSSLVDPNNGNRGRVGTEAS  75

Query  282  LDHWVLKNTVLASGESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            L+ W+     L +GES F + FEW  E  GVP A I+KNNH  EF+LKT+TL++VP HG 
Sbjct  76   LEQWLTSLPSLTTGESKFGVTFEWEVEKMGVPGAIIVKNNHAAEFFLKTITLDNVPGHGA  135

Query  459  VHFACFSWVYPASKY  503
            V F   SW+YPASKY
Sbjct  136  VVFVANSWIYPASKY  150



>gb|AGQ04450.1| lipoxygenase 1.1, partial [Oryza rufipogon]
Length=160

 Score =   150 bits (380),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 93/135 (69%), Gaps = 1/135 (1%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            ++KG +VLMRKN LD NDF A+++D +S+FLG+ V+ +LVSS   D  NG +G+    A 
Sbjct  16   RLKGSLVLMRKNALDINDFGATVIDGISEFLGRGVTCQLVSSSLVDPNNGNRGRVGTEAS  75

Query  282  LDHWVLKNTVLASGESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            L+ W+     L +GES F + FEW  E  G+P A I+KNNH  EF+LKT+TL++VP HG 
Sbjct  76   LEQWLTSLPSLTTGESKFGVTFEWEVEKMGIPGAIIVKNNHAAEFFLKTITLDNVPGHGA  135

Query  459  VHFACFSWVYPASKY  503
            V F   SW+YPASKY
Sbjct  136  VVFVANSWIYPASKY  150



>ref|XP_009763875.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Nicotiana 
sylvestris]
Length=873

 Score =   161 bits (407),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 70/135 (52%), Positives = 98/135 (73%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KK++G VVLM+KNVLD  D  AS +D + +  G+ VSL+L+S+  A+ GNG KGK  K A
Sbjct  27   KKVRGTVVLMKKNVLDLKDVGASFLDRVHEVFGKGVSLQLISADHAEPGNGCKGKLGKPA  86

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            +L+ W+   T +++G++ F + F+W E  GVP AFIIKN H ++FYL+T+ LEDVP HG+
Sbjct  87   FLEKWMSTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVILEDVPGHGQ  146

Query  459  VHFACFSWVYPASKY  503
            +HF C SWVYPA +Y
Sbjct  147  LHFVCNSWVYPAHRY  161



>gb|AGQ04449.1| lipoxygenase 1.1, partial [Oryza nivara]
 gb|AGQ04453.1| lipoxygenase 1.1, partial [Oryza barthii]
 gb|AGQ04455.1| lipoxygenase 1.1, partial [Oryza glaberrima]
 gb|AGQ04456.1| lipoxygenase 1.1, partial [Oryza sativa Indica Group]
 gb|AGQ04457.1| lipoxygenase 1.1, partial [Oryza sativa Japonica Group]
Length=160

 Score =   150 bits (379),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 93/135 (69%), Gaps = 1/135 (1%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            ++KG +VLMRKN LD NDF A+++D +S+FLG+ V+ +LVSS   D  NG +G+    A 
Sbjct  16   RLKGSLVLMRKNALDINDFGATVIDGISEFLGRGVTCQLVSSSLVDPNNGNRGRVGTEAS  75

Query  282  LDHWVLKNTVLASGESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            L+ W+     L +GES F + FEW  E  G+P A I+KNNH  EF+LKT+TL++VP HG 
Sbjct  76   LEQWLTSLPSLTTGESKFGVTFEWEVEKMGIPGAIIVKNNHAAEFFLKTITLDNVPGHGA  135

Query  459  VHFACFSWVYPASKY  503
            V F   SW+YPASKY
Sbjct  136  VVFVANSWIYPASKY  150



>ref|XP_009763870.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nicotiana 
sylvestris]
Length=883

 Score =   161 bits (407),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 70/135 (52%), Positives = 98/135 (73%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KK++G VVLM+KNVLD  D  AS +D + +  G+ VSL+L+S+  A+ GNG KGK  K A
Sbjct  37   KKVRGTVVLMKKNVLDLKDVGASFLDRVHEVFGKGVSLQLISADHAEPGNGCKGKLGKPA  96

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            +L+ W+   T +++G++ F + F+W E  GVP AFIIKN H ++FYL+T+ LEDVP HG+
Sbjct  97   FLEKWMSTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVILEDVPGHGQ  156

Query  459  VHFACFSWVYPASKY  503
            +HF C SWVYPA +Y
Sbjct  157  LHFVCNSWVYPAHRY  171



>gb|AGK82783.1| lipoxygenase [Malus domestica]
Length=879

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 102/142 (72%), Gaps = 3/142 (2%)
 Frame = +3

Query  87   LSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLK--  257
            +S + +I+GKVVLM+KNVLDFND  AS VD + + LG+ VS++L+S+   +   NGLK  
Sbjct  22   VSGSNRIRGKVVLMKKNVLDFNDLKASFVDRIHELLGKGVSMQLISATHPEAAANGLKPR  81

Query  258  GKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  437
            GK  K AYL+ W    T L++GE++F I  +W E  G P A +I+N+H ++FYLKT+TLE
Sbjct  82   GKLGKVAYLEKWATTITSLSAGETSFTISLDWDESHGAPGALLIRNHHHSQFYLKTITLE  141

Query  438  DVPNHGEVHFACFSWVYPASKY  503
            DVP HG++HF C SWVYPA +Y
Sbjct  142  DVPEHGQLHFVCNSWVYPAHRY  163



>gb|AGQ04451.1| lipoxygenase 1.1, partial [Oryza glumipatula]
Length=160

 Score =   150 bits (378),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 93/135 (69%), Gaps = 1/135 (1%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            ++KG +VLMRKN LD NDF A+++D +S+FLG+ V+ +LVSS   D  NG +G+    A 
Sbjct  16   RLKGSLVLMRKNALDINDFGATVIDGISEFLGRGVTCQLVSSSLVDPNNGNRGRVGTGAS  75

Query  282  LDHWVLKNTVLASGESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            ++ W+     L +GES F + FEW  E  G+P A I+KNNH  EF+LKT+TL++VP HG 
Sbjct  76   VEQWLTSLPSLTTGESKFGVTFEWEVEKMGIPGAIIVKNNHAAEFFLKTITLDNVPGHGA  135

Query  459  VHFACFSWVYPASKY  503
            V F   SW+YPASKY
Sbjct  136  VVFVANSWIYPASKY  150



>ref|XP_010326548.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010326549.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010326550.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Solanum 
lycopersicum]
Length=891

 Score =   160 bits (406),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 68/135 (50%), Positives = 98/135 (73%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            +K++G VVLM+KNVLDF D  AS++D   + +G+ VSL+L+S+  A+ GNG  GK  + A
Sbjct  45   QKVRGTVVLMKKNVLDFTDVGASLLDRFHEVIGKGVSLQLISADHAEPGNGCTGKLGQPA  104

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            +L+ W+   T +++G++ F + F+W E  GVP AFIIKN H ++FYL+T+ LEDVP HGE
Sbjct  105  FLEKWISTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVVLEDVPGHGE  164

Query  459  VHFACFSWVYPASKY  503
            +HF C SWVYP  +Y
Sbjct  165  LHFVCNSWVYPEHRY  179



>ref|XP_010326551.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010326552.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Solanum 
lycopersicum]
Length=874

 Score =   160 bits (406),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 68/135 (50%), Positives = 98/135 (73%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            +K++G VVLM+KNVLDF D  AS++D   + +G+ VSL+L+S+  A+ GNG  GK  + A
Sbjct  28   QKVRGTVVLMKKNVLDFTDVGASLLDRFHEVIGKGVSLQLISADHAEPGNGCTGKLGQPA  87

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            +L+ W+   T +++G++ F + F+W E  GVP AFIIKN H ++FYL+T+ LEDVP HGE
Sbjct  88   FLEKWISTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVVLEDVPGHGE  147

Query  459  VHFACFSWVYPASKY  503
            +HF C SWVYP  +Y
Sbjct  148  LHFVCNSWVYPEHRY  162



>ref|XP_011021548.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Populus 
euphratica]
Length=881

 Score =   160 bits (406),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 97/135 (72%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            +KIKG VVLM+KNVLDF+D  AS +D + + LG+ VS++LVS+V  D  + L+G   K A
Sbjct  34   RKIKGTVVLMKKNVLDFHDIKASFLDRVHELLGKGVSMQLVSAVHQDPADSLRGTLGKVA  93

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            Y++ WV   T L +GE+ F I FEW E+ G+P A IIKN+H ++ YLKT+TLEDVP HG 
Sbjct  94   YVEKWVTSRTPLTAGETIFTITFEWDENMGLPGAIIIKNHHHSQLYLKTVTLEDVPGHGR  153

Query  459  VHFACFSWVYPASKY  503
            + F C SWVYP+ +Y
Sbjct  154  LLFICNSWVYPSHRY  168



>gb|AGQ04460.1| lipoxygenase 1.1, partial [Oryza australiensis]
Length=160

 Score =   149 bits (377),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 92/135 (68%), Gaps = 1/135 (1%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            ++KG VVLMRKN LD NDF A+++D +++FLG+ V+ +LVSS   D  NG +G+    A 
Sbjct  16   RLKGSVVLMRKNALDLNDFGATVIDGITEFLGRGVTCQLVSSTLVDPNNGNRGRVGTEAS  75

Query  282  LDHWVLKNTVLASGESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            L+ W+     L +GES F + FEW  E  GVP A I+KNNH  EF+LKT+TL++VP  G 
Sbjct  76   LEQWLTSLPSLTTGESKFGVTFEWEVEKMGVPGAVIVKNNHAAEFFLKTITLDNVPGRGT  135

Query  459  VHFACFSWVYPASKY  503
            V F   SW+YPASKY
Sbjct  136  VVFVANSWIYPASKY  150



>ref|XP_007147045.1| hypothetical protein PHAVU_006G091400g [Phaseolus vulgaris]
 gb|ESW19039.1| hypothetical protein PHAVU_006G091400g [Phaseolus vulgaris]
Length=863

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 102/137 (74%), Gaps = 3/137 (2%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            +++G V+LM+KNVLDFND ++S++D L +F+G++VSL+L+S+ Q D GN +KGK  K AY
Sbjct  19   RMRGTVILMKKNVLDFNDLSSSLLDRLHEFMGKRVSLQLISAFQTDSGNEMKGKLGKPAY  78

Query  282  LDHWVLKNTVLASGESAFKIEF---EWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  452
            L+ W+   T L +GESAF + F   +  +  G P AF+I+N+H +EFYLK++TLE VP H
Sbjct  79   LEDWITTITPLTAGESAFGVTFDWDDDDDSIGTPQAFLIRNHHHSEFYLKSMTLESVPGH  138

Query  453  GEVHFACFSWVYPASKY  503
            G VHF C SWVYPA KY
Sbjct  139  GVVHFNCNSWVYPAHKY  155



>ref|NP_001280980.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGK82784.1| lipoxygenase [Malus domestica]
Length=879

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 102/142 (72%), Gaps = 3/142 (2%)
 Frame = +3

Query  87   LSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLK--  257
            +S + +I+GKVVLM+KNVLDFND  AS VD + + LG+ VS++L+S+   +   NGLK  
Sbjct  22   VSGSNRIRGKVVLMKKNVLDFNDLKASFVDRIHELLGKGVSMQLISATHPEAAANGLKSR  81

Query  258  GKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  437
            GK  K AYL+ W    T L++GE++F +  +W E  G P A +I+N+H ++FYLKT+TLE
Sbjct  82   GKLGKVAYLEKWATTITSLSAGETSFTVSLDWDESHGAPGALLIRNHHHSQFYLKTITLE  141

Query  438  DVPNHGEVHFACFSWVYPASKY  503
            DVP HG++HF C SWVYPA +Y
Sbjct  142  DVPEHGQLHFVCNSWVYPAHRY  163



>ref|XP_003591120.1| Lipoxygenase [Medicago truncatula]
 gb|AES61371.1| linoleate 9S-lipoxygenase-like protein [Medicago truncatula]
Length=858

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            +++G VVLM+K+VLDFNDF AS++D L +F+G+ VSL+LVS+V  D  NGLKGK  K A 
Sbjct  18   QVEGTVVLMKKSVLDFNDFTASMLDGLHEFVGKGVSLQLVSTVNTDSENGLKGKLGKPAN  77

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            LD W   +  L++GES FK+ F+W E+ G P AF+I NNH NEFYLK+LTL+ VP    +
Sbjct  78   LD-WSTASKPLSTGESTFKVSFDWDEEIGTPGAFLIWNNHDNEFYLKSLTLKGVPGQDVI  136

Query  462  HFACFSWVYPASKY  503
            HF C SWVYPA  Y
Sbjct  137  HFVCNSWVYPAKNY  150



>ref|XP_004296897.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=884

 Score =   160 bits (405),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 72/142 (51%), Positives = 100/142 (70%), Gaps = 3/142 (2%)
 Frame = +3

Query  87   LSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNG---LK  257
            +S +KKI+G VVLM+KNVLDFND  AS++D + +FLG+ VS++L+S+   +       L+
Sbjct  30   VSESKKIRGTVVLMKKNVLDFNDMKASLLDRIHEFLGKGVSMQLISATHPEPAANRLVLR  89

Query  258  GKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  437
            GK  K AYL+ W+   T L +G++AF    +W E  GVP A +I N+H ++FYLKT+TL+
Sbjct  90   GKPGKIAYLEKWITTVTSLTAGDTAFSASIDWDESMGVPGALMITNHHHSQFYLKTITLD  149

Query  438  DVPNHGEVHFACFSWVYPASKY  503
            DVP HG VHF C SWVYPA +Y
Sbjct  150  DVPGHGRVHFVCNSWVYPAHRY  171



>gb|KJB80990.1| hypothetical protein B456_013G124500 [Gossypium raimondii]
Length=860

 Score =   160 bits (404),  Expect = 5e-42, Method: Composition-based stats.
 Identities = 76/142 (54%), Positives = 98/142 (69%), Gaps = 6/142 (4%)
 Frame = +3

Query  81   EALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKG  260
            E + P +KIKG V+LM+KNVLDFNDF+AS +D   + LG++VS +L+SS   D      G
Sbjct  17   EKMKP-EKIKGTVILMKKNVLDFNDFHASFLDGFHELLGKRVSFQLISSQHVD-----AG  70

Query  261  KRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLED  440
            K  K AYL+ W    T   +GES F + F++ E+ G+P AF+IKNNH +EFYLKTLTLE 
Sbjct  71   KLGKEAYLEDWNSTETSAVAGESKFDVNFDFEEEIGLPGAFLIKNNHHSEFYLKTLTLEH  130

Query  441  VPNHGEVHFACFSWVYPASKYN  506
            VP HG +HF C SWVYP  KY+
Sbjct  131  VPGHGRLHFVCNSWVYPDKKYD  152



>ref|XP_006607065.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like, partial 
[Glycine max]
Length=436

 Score =   156 bits (394),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 100/137 (73%), Gaps = 3/137 (2%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            +K++KG+VVLM+K VLDF+D  A+++D + + LG+ VSL+L+S+   D   GL+GK  K 
Sbjct  4    SKRVKGRVVLMKKGVLDFHDIKANVLDRVHELLGKGVSLQLISATTPD--PGLRGKLGKV  61

Query  276  AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  452
            A+L+ WV   T L S  ++ F + FEW E  GVP AFII+NNH ++FYLKT+T+ED+P H
Sbjct  62   AHLERWVSTITSLTSATDTEFTVTFEWDESMGVPGAFIIRNNHHSQFYLKTVTIEDIPGH  121

Query  453  GEVHFACFSWVYPASKY  503
            G V+F C SW+YPA +Y
Sbjct  122  GPVNFVCNSWIYPAHRY  138



>ref|XP_009626059.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Nicotiana 
tomentosiformis]
Length=876

 Score =   160 bits (404),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 98/135 (73%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KK++G VVLM+KNVLD  D  AS +D + +  G+ VSL+L+S+  A+ GNG KGK  K A
Sbjct  30   KKVRGTVVLMKKNVLDLKDVGASFLDRVHEVFGKGVSLQLISADHAESGNGCKGKLGKPA  89

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            +L+ W+   T +++G++ F + F+W E  GVP AFIIKN H ++FYL+T+ LEDVP HG+
Sbjct  90   FLEKWMSTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVILEDVPGHGQ  149

Query  459  VHFACFSWVYPASKY  503
            +HF C SWVYPA +Y
Sbjct  150  LHFVCNSWVYPAHRY  164



>gb|AAD09861.1| lipoxygenase [Persea americana]
Length=858

 Score =   159 bits (403),  Expect = 6e-42, Method: Composition-based stats.
 Identities = 73/134 (54%), Positives = 92/134 (69%), Gaps = 0/134 (0%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            +IKG VVLM+KNVLDFNDF AS +D + +FLG+ VS +LVS+   D  NG +GK  +AAY
Sbjct  18   QIKGSVVLMKKNVLDFNDFQASFLDRVHEFLGKGVSFQLVSAEHGDPDNGNRGKVGEAAY  77

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L+ W+   T + +GES F + F W   FG P A I+KN H +EF+LKTLTLED P    +
Sbjct  78   LEDWITTLTSIQAGESVFNVTFNWDMSFGTPGAVIVKNFHHSEFFLKTLTLEDFPAKDRI  137

Query  462  HFACFSWVYPASKY  503
            HF C SWVYP S Y
Sbjct  138  HFVCNSWVYPTSNY  151



>ref|XP_009626058.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nicotiana 
tomentosiformis]
Length=886

 Score =   160 bits (404),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 98/135 (73%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KK++G VVLM+KNVLD  D  AS +D + +  G+ VSL+L+S+  A+ GNG KGK  K A
Sbjct  40   KKVRGTVVLMKKNVLDLKDVGASFLDRVHEVFGKGVSLQLISADHAESGNGCKGKLGKPA  99

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            +L+ W+   T +++G++ F + F+W E  GVP AFIIKN H ++FYL+T+ LEDVP HG+
Sbjct  100  FLEKWMSTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVILEDVPGHGQ  159

Query  459  VHFACFSWVYPASKY  503
            +HF C SWVYPA +Y
Sbjct  160  LHFVCNSWVYPAHRY  174



>gb|AGQ04452.1| lipoxygenase 1.1, partial [Oryza longistaminata]
Length=160

 Score =   149 bits (375),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 93/135 (69%), Gaps = 1/135 (1%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            ++KG +VLMRK+ LD NDF A+++D +S+FLG+ V+ +LVSS   D  NG +G+    A 
Sbjct  16   RLKGSLVLMRKSALDINDFGATVIDGISEFLGRGVTCQLVSSSLVDPNNGNRGRVGTEAS  75

Query  282  LDHWVLKNTVLASGESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            L+ W+     L +GES F + FEW  E  GVP A I+KNNH  EF+LKT+TL++VP HG 
Sbjct  76   LEQWLTSLPSLTTGESKFGVTFEWEVEKMGVPGAIIVKNNHAAEFFLKTITLDNVPGHGA  135

Query  459  VHFACFSWVYPASKY  503
            V F   SW+YPASKY
Sbjct  136  VVFVANSWIYPASKY  150



>ref|XP_010323952.1| PREDICTED: lipoxygenase isoform X3 [Solanum lycopersicum]
Length=853

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 102/136 (75%), Gaps = 5/136 (4%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            K++KGKVVLM+KNVLDF    A++VD++++ LG+KVS +L+SS   D     +GK S  A
Sbjct  11   KRVKGKVVLMKKNVLDFTGIMAAVVDDVAELLGEKVSFQLISSSVFDD----RGKLSNPA  66

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSE-DFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            YL++W+   T + +GES F + F+W   +FGVP AFIIKN H NEF+LK+LTLEDVPNHG
Sbjct  67   YLENWITNITPIIAGESTFSVTFDWDRNEFGVPGAFIIKNFHLNEFFLKSLTLEDVPNHG  126

Query  456  EVHFACFSWVYPASKY  503
            ++HF C SWVYPA +Y
Sbjct  127  KIHFVCNSWVYPAFRY  142



>ref|XP_004230206.1| PREDICTED: lipoxygenase isoform X2 [Solanum lycopersicum]
Length=854

 Score =   159 bits (402),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 102/136 (75%), Gaps = 4/136 (3%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            K++KGKVVLM+KNVLDF    A++VD++++ LG+KVS +L+SS   D     +GK S  A
Sbjct  11   KRVKGKVVLMKKNVLDFTGIMAAVVDDVAELLGEKVSFQLISSSVFD---DREGKLSNPA  67

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSE-DFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            YL++W+   T + +GES F + F+W   +FGVP AFIIKN H NEF+LK+LTLEDVPNHG
Sbjct  68   YLENWITNITPIIAGESTFSVTFDWDRNEFGVPGAFIIKNFHLNEFFLKSLTLEDVPNHG  127

Query  456  EVHFACFSWVYPASKY  503
            ++HF C SWVYPA +Y
Sbjct  128  KIHFVCNSWVYPAFRY  143



>gb|AGK82775.1| lipoxygenase [Malus domestica]
Length=900

 Score =   159 bits (403),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 102/142 (72%), Gaps = 3/142 (2%)
 Frame = +3

Query  87   LSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLK--  257
            +S + +I+GKVVLM+KNVLDFND  AS VD + + LG+ VS++L+S+   +   NGLK  
Sbjct  22   VSGSNRIRGKVVLMKKNVLDFNDLKASFVDRIHELLGKGVSMQLISANHPEAAANGLKSR  81

Query  258  GKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  437
            GK  K AYL+ W    T L++GE++F I  +W E  G P A +I+N+H ++FYLKT+TLE
Sbjct  82   GKLGKVAYLEKWATTITSLSAGETSFTISLDWDESHGAPGALLIRNHHHSQFYLKTITLE  141

Query  438  DVPNHGEVHFACFSWVYPASKY  503
            DVP HG++HF C SWVYPA +Y
Sbjct  142  DVPEHGQLHFVCNSWVYPAHRY  163



>ref|XP_008454500.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Cucumis melo]
Length=858

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 98/135 (73%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            +KIKG+V+L+R N LD+N+  +S++DN+S+F G KVS +L+SS   D    L+GK  K  
Sbjct  16   QKIKGQVILLRSNSLDYNEIQSSVLDNISEFWGAKVSFQLISSENGDRSKELQGKVGKKT  75

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL +W+ K   ++ GE+ FKI F+W ED G+P AF+I+NNH  +F+LK+LTLEDVP  G 
Sbjct  76   YLGNWMTKMVPVSPGETVFKISFDWDEDIGIPGAFLIRNNHFTKFFLKSLTLEDVPFVGR  135

Query  459  VHFACFSWVYPASKY  503
            +HF C SW+YP+ KY
Sbjct  136  IHFDCNSWIYPSGKY  150



>ref|XP_008454526.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Cucumis melo]
Length=852

 Score =   159 bits (401),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 72/138 (52%), Positives = 102/138 (74%), Gaps = 2/138 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKI G+VVLM+ NVLDF+DFNAS++D L +F+G++VSL+LVS++  D  N L+GK  + A
Sbjct  8    KKILGEVVLMKSNVLDFDDFNASLLDTLYEFVGKRVSLQLVSAIHGDPSNELRGKLGEEA  67

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSED-FGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            YL+ W+   T L +GE+ FK+ F+W E+  G+P AF I N+H  +FYLK+LTL+ VP HG
Sbjct  68   YLEEWITTITPLTTGEATFKVTFDWDEEHMGIPGAFFITNHHHTQFYLKSLTLQHVPPHG  127

Query  456  -EVHFACFSWVYPASKYN  506
              + F C SW+YP+ +YN
Sbjct  128  TTLFFPCNSWIYPSHRYN  145



>ref|XP_004139356.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=860

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 97/135 (72%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            +KIKG+V+L+R N LD+N+  +S++DN+S+F G KVS +L+SS   D    L+GK  K  
Sbjct  18   QKIKGQVILLRSNSLDYNEIQSSVLDNISEFWGAKVSFQLISSENGDRSKELQGKVGKKT  77

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL +W+ K   ++ GE+ FKI F W ED G+P AFII+NNH  +F+LK+LTLEDVP  G 
Sbjct  78   YLGNWMTKMVPVSPGETMFKISFVWEEDIGIPGAFIIRNNHFTKFFLKSLTLEDVPFVGR  137

Query  459  VHFACFSWVYPASKY  503
            +HF C SW+YP+ KY
Sbjct  138  IHFDCNSWIYPSGKY  152



>gb|ABF19103.2| 9-lipoxygenase [Capsicum annuum]
Length=876

 Score =   159 bits (401),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 68/135 (50%), Positives = 97/135 (72%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KK++G VVLM+KNVLD  D  AS +D + +  G+ VSL+L+S+  A+ GNG KGK  K A
Sbjct  30   KKVRGTVVLMKKNVLDLTDVGASFLDRVHEVFGKGVSLQLISADHAEPGNGCKGKLGKPA  89

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            ++++WV   T +++G++ F + F+W E  G P AFIIKN H ++ YL+T+ LEDVP HG+
Sbjct  90   FMENWVSTLTSISAGDATFNVTFDWDESMGFPGAFIIKNYHHSQLYLRTVVLEDVPGHGQ  149

Query  459  VHFACFSWVYPASKY  503
            +HF C SWVYPA +Y
Sbjct  150  LHFVCNSWVYPAHRY  164



>ref|XP_006359922.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Solanum 
tuberosum]
Length=854

 Score =   158 bits (399),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 75/139 (54%), Positives = 96/139 (69%), Gaps = 1/139 (1%)
 Frame = +3

Query  90   SPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRS  269
            S T KIKG VVLM+KNVL+F D   + +D + +  G++V+++LVS+  AD  NG KGK  
Sbjct  25   SGTIKIKGTVVLMKKNVLNFKDAGCAFLDRMHELFGKRVTIQLVSAEHADPENGSKGKLG  84

Query  270  KAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  449
            K A L+ W    T ++  E+AF I F+W E  GVP AFI+KNNH ++FYLKTLTL DVP 
Sbjct  85   KPAILE-WASSKTWISVEEAAFNITFDWDESLGVPGAFIVKNNHHSQFYLKTLTLHDVPG  143

Query  450  HGEVHFACFSWVYPASKYN  506
             GEVHF C SWVYP  +YN
Sbjct  144  EGEVHFVCNSWVYPPHRYN  162



>gb|AGQ04458.1| lipoxygenase 1.1, partial [Oryza punctata]
Length=160

 Score =   147 bits (371),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 92/135 (68%), Gaps = 1/135 (1%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            ++KG VVLMRKN LD NDF A+++D +S+FLG+ V+ +LVSS   D  NG +G+    A 
Sbjct  16   RLKGSVVLMRKNALDINDFGATVIDGISEFLGRGVTCQLVSSSLVDPNNGNRGRVGTEAS  75

Query  282  LDHWVLKNTVLASGESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            L+ W+     L +GES F + F+W  E  GVP A ++KNNH  EF+LKT+TL++VP  G 
Sbjct  76   LEQWLTSLPSLTTGESKFGVTFDWEVEKMGVPGAIVVKNNHAAEFFLKTITLDNVPGRGA  135

Query  459  VHFACFSWVYPASKY  503
            V F   SW+YPASKY
Sbjct  136  VVFVANSWIYPASKY  150



>ref|XP_004309944.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=860

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 100/135 (74%), Gaps = 3/135 (2%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKIKG VVLM+ NVLDFNDF+AS++D + +FLGQ VSL+L+S    D   G +GK  K A
Sbjct  19   KKIKGTVVLMKNNVLDFNDFHASVLDRVHEFLGQGVSLQLIS---GDSSTGSQGKLGKVA  75

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL++W+     + +GE+ FK+ F+   D GVP AF+I+NNH ++F+LKT+TLEDVP+ G 
Sbjct  76   YLENWIGTLGPVTAGETTFKVTFDVEGDIGVPGAFVIRNNHHSQFFLKTVTLEDVPSAGH  135

Query  459  VHFACFSWVYPASKY  503
            + F C SWVYPASKY
Sbjct  136  ILFVCNSWVYPASKY  150



>gb|ACD43483.1| lipoxygenase 1 [Olea europaea]
Length=869

 Score =   157 bits (398),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 71/142 (50%), Positives = 101/142 (71%), Gaps = 1/142 (1%)
 Frame = +3

Query  81   EALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKG  260
            E  +  +KI+G V+LM+KNV++  D  AS +D + + +G+ V+L+L+S+  AD  NG +G
Sbjct  16   EPKTEERKIRGTVLLMKKNVMEMTDVGASFLDRVHEIVGKGVTLQLISASHADPANGSRG  75

Query  261  KRSKAAYLDHWVLKNTVLASGESA-FKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  437
            K  K AYL+HWV K T L++ + A F I F+W E  GVP AFII+N+H ++FYLK +TLE
Sbjct  76   KLGKEAYLEHWVTKFTSLSAKDDAMFNITFDWDESMGVPGAFIIRNHHHSQFYLKKVTLE  135

Query  438  DVPNHGEVHFACFSWVYPASKY  503
            DVP HG++ F C SWVYPA +Y
Sbjct  136  DVPGHGQLQFVCNSWVYPAHRY  157



>ref|XP_008370478.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Malus 
domestica]
Length=835

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 95/128 (74%), Gaps = 1/128 (1%)
 Frame = +3

Query  126  MRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLKGKRSKAAYLDHWVLK  302
            M+KNVLDFND NAS++D + + +GQ VSL+L+S+V AD   NG KGK  + AYL+ W+  
Sbjct  1    MKKNVLDFNDLNASVLDGVYELVGQGVSLQLISAVHADDSKNGWKGKLGQPAYLEDWITT  60

Query  303  NTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVHFACFSW  482
             T L +GESAFK+ F++ E+ GVP AF+IKNNH +EF+LKT+TLE+VP  G VH  C SW
Sbjct  61   ITPLTTGESAFKVTFDYEEEVGVPGAFLIKNNHHSEFFLKTVTLENVPGEGRVHIVCNSW  120

Query  483  VYPASKYN  506
            VYP  KY 
Sbjct  121  VYPTEKYT  128



>emb|CAE17327.1| lipoxygenase [Fragaria x ananassa]
Length=884

 Score =   157 bits (397),  Expect = 5e-41, Method: Composition-based stats.
 Identities = 72/142 (51%), Positives = 99/142 (70%), Gaps = 3/142 (2%)
 Frame = +3

Query  87   LSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNG---LK  257
            +S +KKI+G VVLM+KNVLDFND  AS++D + +FLG+ VSL+L+S+   +       L+
Sbjct  30   VSESKKIRGTVVLMKKNVLDFNDMKASLLDRIHEFLGKGVSLQLISATHPEPAANRLVLR  89

Query  258  GKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  437
            GK  K AYL+ W+   T L +G++AF    +W E  GVP A +I N+H ++FYLKT+TL+
Sbjct  90   GKPGKIAYLEKWITTATSLTAGDTAFSASIDWDESMGVPGALMITNHHHSQFYLKTITLD  149

Query  438  DVPNHGEVHFACFSWVYPASKY  503
            DV  HG VHF C SWVYPA +Y
Sbjct  150  DVLGHGRVHFVCNSWVYPAHRY  171



>ref|XP_010935040.1| PREDICTED: LOW QUALITY PROTEIN: probable linoleate 9S-lipoxygenase 
5 [Elaeis guineensis]
Length=851

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            ++KG VVLM+KNVLDF DFNAS  D L +F+G+ VS +LVSS  AD  NG +GK  + AY
Sbjct  5    RVKGAVVLMKKNVLDFTDFNAS-XDRLDEFVGKSVSFQLVSSTIADPDNGNRGKVGEPAY  63

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            ++ W+   T +A GES F++ F+W E  G+P A I++N H  EFYLKTLTLED P +G +
Sbjct  64   IEEWITTITSIADGESKFQVTFQWDESQGIPGAVIVRNYHHFEFYLKTLTLEDFPGNGRI  123

Query  462  HFACFSWVYPASKY  503
            HF C SWVYP   Y
Sbjct  124  HFVCNSWVYPVDYY  137



>gb|AEZ50136.1| lipoxygenase [Diospyros kaki]
Length=901

 Score =   157 bits (397),  Expect = 6e-41, Method: Composition-based stats.
 Identities = 76/136 (56%), Positives = 94/136 (69%), Gaps = 1/136 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            +KIKG VVLM+KN+LDF+D  AS  D   +  G KVSL+L+S+V  D  N  +GK  K A
Sbjct  57   EKIKGSVVLMKKNLLDFSDLVASAADRFDEIRGNKVSLQLISAVNGDPENDNRGKVGKPA  116

Query  279  YLDHWVLKNTVLASGESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            YL+ W  K   L + + AF I FEW+ E+ G+P AFIIKN+H NEFYL+TLTLEDVP HG
Sbjct  117  YLEDWFTKFDPLTAADVAFNITFEWNEEEIGLPGAFIIKNSHHNEFYLRTLTLEDVPGHG  176

Query  456  EVHFACFSWVYPASKY  503
             +HF C SWVYP   Y
Sbjct  177  RIHFICNSWVYPHQYY  192



>ref|XP_004247367.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Solanum lycopersicum]
Length=854

 Score =   157 bits (396),  Expect = 7e-41, Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 96/135 (71%), Gaps = 1/135 (1%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            KIKG VVLM+KNVL+F D  ++ +D + +  G++V+++LVS+  AD  NG KGK  K A 
Sbjct  29   KIKGTVVLMKKNVLNFKDAGSAFLDRMHELFGKRVTIQLVSAEHADPENGSKGKLGKPAT  88

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L+ W    T ++  E+AF I F+W E  GVP AFI+KNNH ++FYLKTLTL DVP  GEV
Sbjct  89   LE-WASSKTWISVEEAAFNITFDWDESLGVPGAFIVKNNHHSQFYLKTLTLHDVPGDGEV  147

Query  462  HFACFSWVYPASKYN  506
            HF C SWVYP+ +YN
Sbjct  148  HFVCNSWVYPSHRYN  162



>ref|XP_007030814.1| Lipoxygenase 1 [Theobroma cacao]
 gb|EOY11316.1| Lipoxygenase 1 [Theobroma cacao]
Length=835

 Score =   157 bits (396),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 93/136 (68%), Gaps = 0/136 (0%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            ++ IKG VVLM+KNVLDFN   +S VDN+ + +GQ+V+L+LVS+  AD  N   GK  K 
Sbjct  16   SQTIKGTVVLMKKNVLDFNAIGSSAVDNVLELVGQQVTLQLVSAQNADPANENAGKLGKL  75

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            A L+ W L  T   +GE+ +K+ FEW E FG P A II+NNH  EFYLKT+TLEDVP  G
Sbjct  76   AALESWNLTFTPPIAGETQYKVSFEWDEQFGAPGAIIIRNNHAAEFYLKTITLEDVPGQG  135

Query  456  EVHFACFSWVYPASKY  503
              HF C SW+YP  +Y
Sbjct  136  RTHFVCNSWIYPDRQY  151



>gb|AGK82779.1| lipoxygenase [Malus domestica]
Length=952

 Score =   157 bits (396),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 96/136 (71%), Gaps = 5/136 (4%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKIKG+VVL++KN LDFND  AS++D + +  G+ VSL+L+SS      NGLKGK  K A
Sbjct  112  KKIKGRVVLIKKNFLDFNDLKASVLDRVHELFGEGVSLQLISS-----ENGLKGKLGKPA  166

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ W+   T L  GESAF++ F+  E+ GVP A +IKNNH +EF+LKT+TLE+VP    
Sbjct  167  YLEDWITTITSLTPGESAFEVTFDHEEEVGVPGAILIKNNHHSEFFLKTVTLENVPGEDR  226

Query  459  VHFACFSWVYPASKYN  506
            VHF C SWVYP  KY 
Sbjct  227  VHFVCNSWVYPTEKYT  242



>ref|XP_009790810.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana sylvestris]
Length=853

 Score =   156 bits (395),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 97/144 (67%), Gaps = 0/144 (0%)
 Frame = +3

Query  72   KLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNG  251
            KL+     T  +KG VVLM+KN LD +D  AS+VD + + LG KVSL+L+ +V AD  N 
Sbjct  4    KLSNPSKKTTNVKGTVVLMKKNFLDLDDVKASVVDRVDEVLGHKVSLQLIGAVNADPANK  63

Query  252  LKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLT  431
             +GK  K A+L++W  K T L + ++ F++ FEW E+ GVP AF+IKN H  EFYLK LT
Sbjct  64   CRGKPGKPAFLENWEAKFTPLTATDATFRVTFEWEEEAGVPGAFLIKNFHQKEFYLKKLT  123

Query  432  LEDVPNHGEVHFACFSWVYPASKY  503
            L+DVP HG V F C SW+YP+  Y
Sbjct  124  LDDVPGHGRVCFICNSWIYPSEYY  147



>ref|XP_010556753.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Tarenaya 
hassleriana]
Length=733

 Score =   155 bits (392),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 70/141 (50%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +3

Query  84   ALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGK  263
            A S    I+G+VV+M+KNVLDF D  AS++D + + LG++V+L+LVSSVQ D GN  +G+
Sbjct  5    AASKMTMIQGEVVVMKKNVLDFKDVMASVLDRVHELLGRRVTLQLVSSVQPDPGNERRGR  64

Query  264  RSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDV  443
              KAA+L +WV   + + + E+AF + FEW E  G P+AF+IKN+H ++F+LK+LTL DV
Sbjct  65   LGKAAHLANWVKIKSAVTAEETAFAVAFEWDESMGTPSAFVIKNHHRSQFFLKSLTLRDV  124

Query  444  PN-HGEVHFACFSWVYPASKY  503
            P   G +HF C SW+YP+ +Y
Sbjct  125  PGASGSIHFVCNSWIYPSHRY  145



>gb|KHN02707.1| Linoleate 9S-lipoxygenase 5, chloroplastic [Glycine soja]
Length=850

 Score =   156 bits (394),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 70/137 (51%), Positives = 100/137 (73%), Gaps = 3/137 (2%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            +K++KG+VVLM+K VLDF+D  A+++D + + LG+ VSL+L+S+   D   GL+GK  K 
Sbjct  4    SKRVKGRVVLMKKGVLDFHDIKANVLDRVHELLGKGVSLQLISATTPD--PGLRGKLGKV  61

Query  276  AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  452
            A+L+ WV   T L S  ++ F + FEW E  GVP AFII+NNH ++FYLKT+T+ED+P H
Sbjct  62   AHLERWVSTITSLTSATDTEFTVTFEWDESMGVPGAFIIRNNHHSQFYLKTVTIEDIPGH  121

Query  453  GEVHFACFSWVYPASKY  503
            G V+F C SW+YPA +Y
Sbjct  122  GPVNFVCNSWIYPAHRY  138



>ref|XP_011021549.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Populus 
euphratica]
Length=880

 Score =   156 bits (395),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 97/135 (72%), Gaps = 1/135 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            +KIKG VVLM+KNVLDF+D  AS +D + + LG+ VS++LVS+V  D  + L+G   K A
Sbjct  34   RKIKGTVVLMKKNVLDFHDIKASFLDRVHELLGKGVSMQLVSAVHQD-PDSLRGTLGKVA  92

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            Y++ WV   T L +GE+ F I FEW E+ G+P A IIKN+H ++ YLKT+TLEDVP HG 
Sbjct  93   YVEKWVTSRTPLTAGETIFTITFEWDENMGLPGAIIIKNHHHSQLYLKTVTLEDVPGHGR  152

Query  459  VHFACFSWVYPASKY  503
            + F C SWVYP+ +Y
Sbjct  153  LLFICNSWVYPSHRY  167



>gb|ADL41189.1| lipoxygenase [Camellia sinensis]
Length=868

 Score =   156 bits (394),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 96/135 (71%), Gaps = 1/135 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKIKG VVLM+K++LDF+  +  +VD + + +GQKVSL+L+S+V  D G  L+GK  K A
Sbjct  18   KKIKGTVVLMKKSLLDFDGLSLPLVDRIEEVVGQKVSLQLISAVNGDPGKDLRGKIGKKA  77

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ W+ K T   S + +F + FEW E+ GVP AF I N+H NEFYLKT+TLE VP+HG+
Sbjct  78   YLEDWITKITT-PSADVSFNVTFEWDEEVGVPGAFTITNSHHNEFYLKTVTLEGVPDHGQ  136

Query  459  VHFACFSWVYPASKY  503
            + F C SWVYP   Y
Sbjct  137  IQFICNSWVYPKKYY  151



>ref|XP_004495725.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cicer arietinum]
Length=858

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 101/143 (71%), Gaps = 5/143 (3%)
 Frame = +3

Query  81   EALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKG  260
            E  S   ++KG VVLM+KNVLDFND  AS  D++ +F G+KVSL L+S+V AD  NGLKG
Sbjct  11   EEKSNRHQVKGTVVLMKKNVLDFNDSIASFRDDIREFWGKKVSLRLISAVNADPNNGLKG  70

Query  261  KRSKAAYLDHWVLKNTVLAS-GESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  437
            K  K A ++HW   +T+ A+ GES  ++ F+W E+ G P A +I+NNH +EFYLKTLTL 
Sbjct  71   KLGKPANIEHW---STIRATAGESTLQVSFDWDEEIGTPGAVLIRNNHYSEFYLKTLTLN  127

Query  438  DVP-NHGEVHFACFSWVYPASKY  503
             VP  HG++HF C SW+YP  KY
Sbjct  128  GVPGQHGDIHFICNSWIYPVEKY  150



>ref|XP_008388563.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Malus domestica]
Length=912

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 96/136 (71%), Gaps = 5/136 (4%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKIKG+VVL++KN LDFND  AS++D + +  G+ VSL+L+SS      NGLKGK  K A
Sbjct  112  KKIKGRVVLIKKNFLDFNDLKASVLDRVHELFGEGVSLQLISS-----ENGLKGKLGKPA  166

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ W+   T L  GESAF++ F+  E+ GVP A +IKNNH +EF+LKT+TLE+VP    
Sbjct  167  YLEDWITTITSLTPGESAFEVTFDHEEEVGVPGAILIKNNHHSEFFLKTVTLENVPGEDR  226

Query  459  VHFACFSWVYPASKYN  506
            +HF C SWVYP  KY 
Sbjct  227  LHFVCNSWVYPTEKYT  242



>ref|XP_002315780.1| lipoxygenase family protein [Populus trichocarpa]
 gb|EEF01951.1| lipoxygenase family protein [Populus trichocarpa]
Length=880

 Score =   155 bits (392),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 97/135 (72%), Gaps = 1/135 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            +KIKG VVLM+KNVLDF+D  AS +D + + LG+ VS++LVS+V  D  + L+GK  K A
Sbjct  34   RKIKGTVVLMKKNVLDFHDIKASFLDRVHELLGKGVSMQLVSAVHQD-PDSLRGKLGKVA  92

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
             ++ WV   T L +GE+ F I FEW E+ G+P A IIKN+H ++ YLKT+TLEDVP HG 
Sbjct  93   DVEKWVTTRTPLTAGETIFTITFEWDENMGLPGAIIIKNHHHSQLYLKTVTLEDVPGHGR  152

Query  459  VHFACFSWVYPASKY  503
            V F C SWVYP+ +Y
Sbjct  153  VLFICNSWVYPSHRY  167



>ref|XP_004169780.1| PREDICTED: LOW QUALITY PROTEIN: probable linoleate 9S-lipoxygenase 
5-like [Cucumis sativus]
Length=860

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 96/135 (71%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            +KIKG+V+L+R N LD+N+  +S++DN+S+F G KVS +L+SS   D    L+GK  K  
Sbjct  18   QKIKGQVILLRSNSLDYNEIQSSVLDNISEFWGAKVSFQLISSENGDRSKELQGKVGKXT  77

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL +W+ K   ++ GE+ FKI F W ED G+P AFII+NNH  +F+LK+LTLEDVP  G 
Sbjct  78   YLGNWMTKMVPVSPGETMFKISFVWEEDIGIPGAFIIRNNHFTKFFLKSLTLEDVPFVGR  137

Query  459  VHFACFSWVYPASKY  503
            +HF C SW+Y + KY
Sbjct  138  IHFDCNSWIYSSGKY  152



>ref|XP_008454503.1| PREDICTED: linoleate 9S-lipoxygenase 6-like isoform X1 [Cucumis 
melo]
 ref|XP_008454506.1| PREDICTED: linoleate 9S-lipoxygenase 6-like isoform X2 [Cucumis 
melo]
Length=880

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 96/135 (71%), Gaps = 1/135 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKIKGKV+LMR NVLDF +F++S++DN ++ LG  VS++L+S+      N  +GK    A
Sbjct  40   KKIKGKVILMRSNVLDFTEFHSSLLDNFTELLGGGVSIQLISATHTS-ANDSRGKVGNKA  98

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ W+     L +GES F+I F W E+FG P AF I+N H +EF+LK+LTL+DVP +G 
Sbjct  99   YLERWLTSIPPLFAGESVFQINFPWEENFGFPGAFFIRNGHTSEFFLKSLTLDDVPGYGR  158

Query  459  VHFACFSWVYPASKY  503
            VHF C SWVYP+ +Y
Sbjct  159  VHFDCNSWVYPSGRY  173



>gb|EYU42168.1| hypothetical protein MIMGU_mgv1a001215mg [Erythranthe guttata]
Length=864

 Score =   154 bits (390),  Expect = 4e-40, Method: Composition-based stats.
 Identities = 72/137 (53%), Positives = 97/137 (71%), Gaps = 2/137 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELV--SSVQADLGNGLKGKRSK  272
            K +KG VVLM+KN+L+ ND  AS+VD++ + LG+KV+ +L+  SS+  D    LKGK  K
Sbjct  19   KTMKGVVVLMKKNLLEVNDIAASVVDSVDEILGRKVAFQLITTSSLDHDSEENLKGKPGK  78

Query  273  AAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  452
             AYL+ W+ K   L +G++ + + FEW+++ GVP AF + N H +EFYLKTLTLEDVP H
Sbjct  79   IAYLEDWITKIGPLTAGDATYTVTFEWTKEMGVPGAFTVTNFHHSEFYLKTLTLEDVPGH  138

Query  453  GEVHFACFSWVYPASKY  503
            G VHF C SWVYPA  Y
Sbjct  139  GRVHFVCNSWVYPAQYY  155



>ref|XP_008454513.1| PREDICTED: linoleate 9S-lipoxygenase 6-like isoform X3 [Cucumis 
melo]
Length=879

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 96/135 (71%), Gaps = 2/135 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKIKGKV+LMR NVLDF +F++S++DN ++ LG  VS++L+S+      N  +GK    A
Sbjct  40   KKIKGKVILMRSNVLDFTEFHSSLLDNFTELLGGGVSIQLISATHT--SNDSRGKVGNKA  97

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            YL+ W+     L +GES F+I F W E+FG P AF I+N H +EF+LK+LTL+DVP +G 
Sbjct  98   YLERWLTSIPPLFAGESVFQINFPWEENFGFPGAFFIRNGHTSEFFLKSLTLDDVPGYGR  157

Query  459  VHFACFSWVYPASKY  503
            VHF C SWVYP+ +Y
Sbjct  158  VHFDCNSWVYPSGRY  172



>gb|AGQ04459.1| lipoxygenase 1.1, partial [Oryza officinalis]
Length=160

 Score =   144 bits (362),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 91/135 (67%), Gaps = 1/135 (1%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            ++KG VVLMRKN LD NDF A+++D +++FLG+ V+ +LVSS   D  NG +G+    A 
Sbjct  16   RLKGSVVLMRKNALDINDFGATVIDGITEFLGRGVTCQLVSSSLVDPNNGNRGRVGAEAS  75

Query  282  LDHWVLKNTVLASGESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            L+ W+     L +GES F + FEW  E  G+P A ++KNNH   F+LKT+TL++VP  G 
Sbjct  76   LEQWLTSLPSLTTGESKFGVTFEWEVEKMGLPGAVVVKNNHAAGFFLKTITLDNVPGRGT  135

Query  459  VHFACFSWVYPASKY  503
            V F   SW+YPASKY
Sbjct  136  VVFVANSWIYPASKY  150



>gb|AAA79186.1| lipoxygenase [Cucumis sativus]
Length=877

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 102/147 (69%), Gaps = 3/147 (2%)
 Frame = +3

Query  69   GKLAEALSPT--KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADL  242
            G +A+ +S    +KIKGKV+LMR NV+DF +F++S++DN ++ LG  VSL+L+S+ Q   
Sbjct  28   GNIADQISNIGGQKIKGKVILMRSNVMDFTEFHSSLLDNFTELLGGGVSLQLISATQTSA  87

Query  243  GNGLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLK  422
             +  +GK  K A+L+ W+     L +GES F++ F W E FG P AF IKN H +EF+LK
Sbjct  88   LDS-RGKVGKKAFLERWLTSIPPLFAGESVFQVSFTWEEGFGFPGAFFIKNGHTSEFFLK  146

Query  423  TLTLEDVPNHGEVHFACFSWVYPASKY  503
            +LTLEDVP  G VHF C SWVYP+ +Y
Sbjct  147  SLTLEDVPGFGHVHFDCNSWVYPSGRY  173



>emb|CAP59449.1| lipoxygenase [Momordica charantia]
Length=880

 Score =   154 bits (388),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 97/135 (72%), Gaps = 2/135 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKIKG VVLMR NVLDF +F++S++D +++ LG  +SL+L+S+  A   N  +GK  K A
Sbjct  40   KKIKGTVVLMRSNVLDFTEFHSSLLDGVTELLGGGISLQLISATHA--SNDSRGKVGKGA  97

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            +L+ W+     L +GES F++ F+W E+FG P AF IKN H +EF+LK++TLEDVP  G 
Sbjct  98   FLERWLTSVPPLFAGESVFQVNFDWEENFGFPGAFFIKNGHTSEFFLKSVTLEDVPGFGR  157

Query  459  VHFACFSWVYPASKY  503
            VHF C SWVYP+ +Y
Sbjct  158  VHFDCNSWVYPSRRY  172



>ref|XP_004139170.1| PREDICTED: LOW QUALITY PROTEIN: linoleate 9S-lipoxygenase 6-like 
[Cucumis sativus]
Length=867

 Score =   154 bits (388),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 95/134 (71%), Gaps = 2/134 (1%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            KIKGKV+LMR NVLDF +F++S++DN ++ LG  VS +L+S+      N  +GK    AY
Sbjct  41   KIKGKVILMRSNVLDFTEFHSSLLDNFTELLGGGVSFQLISATHT--SNDSRGKVGNKAY  98

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L+ W+     L +GES F+I F+W E+FG P AF IKN H +EF+LK+LTL+DVP +G V
Sbjct  99   LERWLTSIPPLFAGESVFQINFQWDENFGFPGAFFIKNGHTSEFFLKSLTLDDVPGYGRV  158

Query  462  HFACFSWVYPASKY  503
            HF C SWVYP+ +Y
Sbjct  159  HFDCNSWVYPSGRY  172



>ref|XP_011092039.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X3 [Sesamum 
indicum]
Length=867

 Score =   153 bits (387),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 72/137 (53%), Positives = 94/137 (69%), Gaps = 3/137 (2%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQA---DLGNGLKGKRSK  272
            K++G VVLM+K VL  ND  AS+VD + +  G+KV+L+L+SS  A   D     +GK  K
Sbjct  22   KMRGVVVLMKKKVLGVNDIAASVVDRVDEIRGRKVALQLISSTAALDHDSAESYRGKVGK  81

Query  273  AAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  452
             AYL+ W+ K + L +G++A+ + FEW+ + GVP AF I N H NEFYLKTLTLEDVP H
Sbjct  82   KAYLEDWITKISPLTAGDTAYDVTFEWTREMGVPGAFTITNFHHNEFYLKTLTLEDVPGH  141

Query  453  GEVHFACFSWVYPASKY  503
            G VHF C SWVYP+  Y
Sbjct  142  GRVHFICNSWVYPSEYY  158



>gb|KGN60916.1| hypothetical protein Csa_2G023340 [Cucumis sativus]
Length=485

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 99/137 (72%), Gaps = 2/137 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            +KI G+VVLM+ NVLDF+DF+ S++D L +F+G++VSL+LVS++  D  N L+GK  + A
Sbjct  8    RKILGEVVLMKSNVLDFDDFSTSLLDTLYEFVGKRVSLQLVSAIHGDPSNELRGKLGEEA  67

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSED-FGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            YL+ W+   T L +GE+ FK+ F+W E   G+P AF I N+H + FYLK+LTL+ VP HG
Sbjct  68   YLEEWITTITPLTTGEATFKVTFDWDEQRMGIPGAFFITNHHHSHFYLKSLTLQHVPPHG  127

Query  456  -EVHFACFSWVYPASKY  503
              + F C SW+YP+ +Y
Sbjct  128  TTLFFPCNSWIYPSHRY  144



>ref|XP_004156418.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=852

 Score =   153 bits (386),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 70/137 (51%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKI G+VVLM+ NVLDF+DF+AS++D L +F+G++VSL+LVS++  D  N L+GK  + A
Sbjct  8    KKILGEVVLMKSNVLDFDDFSASLLDTLYEFVGKRVSLQLVSAIHGDPSNELRGKLGEEA  67

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSED-FGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            YL+ W+   T L +GE+ FK+ F+W E   G+P AF I N+H + FYLK+LTL+ VP HG
Sbjct  68   YLEEWITTITPLTTGEATFKVTFDWDEQRMGIPGAFFITNHHHSHFYLKSLTLQHVPPHG  127

Query  456  -EVHFACFSWVYPASKY  503
              + F C SW+YP+ +Y
Sbjct  128  TTLFFPCNSWIYPSHRY  144



>gb|AAC61785.1| lipoxygenase 1 [Cucumis sativus]
Length=878

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 95/134 (71%), Gaps = 2/134 (1%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            KIKGKV+LMR NVLDF +F+++++DN ++ LG  VS +L+S+      N  +GK    AY
Sbjct  41   KIKGKVILMRSNVLDFTEFHSNLLDNFTELLGGGVSFQLISATHT--SNDSRGKVGNKAY  98

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L+ W+     L +GES F+I F+W E+FG P AF IKN H +EF+LK+LTL+DVP +G V
Sbjct  99   LERWLTSIPPLFAGESVFQINFQWDENFGFPGAFFIKNGHTSEFFLKSLTLDDVPGYGRV  158

Query  462  HFACFSWVYPASKY  503
            HF C SWVYP+ +Y
Sbjct  159  HFDCNSWVYPSGRY  172



>emb|CAA63483.1| lipoxygenase [Cucumis sativus]
Length=878

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 95/134 (71%), Gaps = 2/134 (1%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            KIKGKV+LMR NVLDF +F+++++DN ++ LG  VS +L+S+      N  +GK    AY
Sbjct  41   KIKGKVILMRSNVLDFTEFHSNLLDNFTELLGGGVSFQLISATHT--SNDSRGKVGNKAY  98

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L+ W+     L +GES F+I F+W E+FG P AF IKN H +EF+LK+LTL+DVP +G V
Sbjct  99   LERWLTSIPPLFAGESVFQINFQWDENFGFPGAFFIKNGHTSEFFLKSLTLDDVPGYGRV  158

Query  462  HFACFSWVYPASKY  503
            HF C SWVYP+ +Y
Sbjct  159  HFDCNSWVYPSGRY  172



>ref|XP_004156415.1| PREDICTED: linoleate 9S-lipoxygenase 6-like [Cucumis sativus]
Length=878

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 95/134 (71%), Gaps = 2/134 (1%)
 Frame = +3

Query  102  KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  281
            KIKGKV+LMR NVLDF +F+++++DN ++ LG  VS +L+S+      N  +GK    AY
Sbjct  41   KIKGKVILMRSNVLDFTEFHSNLLDNFTELLGGGVSFQLISATHT--SNDSRGKVGNKAY  98

Query  282  LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  461
            L+ W+     L +GES F+I F+W E+FG P AF IKN H +EF+LK+LTL+DVP +G V
Sbjct  99   LERWLTSIPPLFAGESVFQINFQWDENFGFPGAFFIKNGHTSEFFLKSLTLDDVPGYGRV  158

Query  462  HFACFSWVYPASKY  503
            HF C SWVYP+ +Y
Sbjct  159  HFDCNSWVYPSGRY  172



>gb|EYU41500.1| hypothetical protein MIMGU_mgv1a001165mg [Erythranthe guttata]
Length=874

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 99/143 (69%), Gaps = 2/143 (1%)
 Frame = +3

Query  81   EALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKG  260
            E +   KK+KG VVLM+KNV+D  DF +SI+D   +  G+ VSL+LVSSV  D  N  KG
Sbjct  16   EPIVELKKVKGTVVLMKKNVMDVTDFGSSILDRFHELFGKGVSLQLVSSVNGDSANENKG  75

Query  261  KRSKAAYLDHWVLKNTVL-ASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  437
            K  K A+L++W+ K T L A  E++F + F W E  G+P AFIIKN+H ++FYLK+LTLE
Sbjct  76   KLGKEAFLENWISKITSLNAKDEASFDVVFNWDESHGIPGAFIIKNHHHSQFYLKSLTLE  135

Query  438  DVPNH-GEVHFACFSWVYPASKY  503
            D P+H G +HF C SWVYP  +Y
Sbjct  136  DFPSHEGPIHFDCNSWVYPTHRY  158



>ref|XP_010530359.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Tarenaya 
hassleriana]
Length=883

 Score =   152 bits (384),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 70/135 (52%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +3

Query  105  IKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAYL  284
            I G+VV+M+KNVLDF D  AS++D + + LG++VS++LVSSVQ D GNG +G+  KAA+L
Sbjct  36   IHGEVVVMKKNVLDFKDVMASVLDRVHELLGRRVSIQLVSSVQPDPGNGRRGRLGKAAHL  95

Query  285  DHWVLK-NTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVP-NHGE  458
            + WV K  + + + E+AF I FEW E  G P+AF+IKN+H ++F+LK++TL +VP   G 
Sbjct  96   EKWVTKIKSAVTAEETAFAIAFEWDESMGTPSAFVIKNHHRSQFFLKSVTLHEVPGGSGP  155

Query  459  VHFACFSWVYPASKY  503
            VHF C SW+YP  +Y
Sbjct  156  VHFVCNSWIYPWHRY  170



>ref|XP_006344625.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X2 [Solanum tuberosum]
Length=863

 Score =   152 bits (384),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 71/136 (52%), Positives = 95/136 (70%), Gaps = 2/136 (1%)
 Frame = +3

Query  96   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  275
            TK IKG VVLM+KN LD  D   ++VD + + LG KVSL+L+S+V  D+ N  +GK  K 
Sbjct  25   TKTIKGTVVLMKKNFLDLTDAKDAVVDQIDEILGHKVSLQLISAVNTDVANKGRGKLGKP  84

Query  276  AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  455
            A+L+ W  K + L   ++ F + FEW+E+ GVP AF+IKN+H NEFYLKTLTL+DVP HG
Sbjct  85   AHLEGW--KISTLTERDATFSVNFEWNEEIGVPGAFLIKNSHHNEFYLKTLTLDDVPGHG  142

Query  456  EVHFACFSWVYPASKY  503
            +V F C SW+Y +  Y
Sbjct  143  KVCFVCNSWIYHSEYY  158



>gb|ABB82552.1| 13S-lipoxygenase [Cucumis melo var. inodorus]
Length=877

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 97/135 (72%), Gaps = 1/135 (1%)
 Frame = +3

Query  99   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  278
            KKIKGKV+LMR NVLDF +F++S++DNL++ LG  VS++L+S+      +  +GK  K A
Sbjct  40   KKIKGKVILMRSNVLDFTEFHSSLLDNLTELLGGGVSIQLISATHTSALDS-RGKVGKKA  98

Query  279  YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  458
            +L+ W+     L +GES F++ F W + FG P AF I+N H +EF+LK+LTLEDVP +G 
Sbjct  99   FLEKWLTSIPPLFAGESVFQVNFTWEDGFGFPGAFFIQNGHTSEFFLKSLTLEDVPGYGR  158

Query  459  VHFACFSWVYPASKY  503
            VHF C SWVYP+ +Y
Sbjct  159  VHFDCNSWVYPSGRY  173



>ref|XP_009418148.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Musa acuminata 
subsp. malaccensis]
Length=855

 Score =   152 bits (383),  Expect = 4e-39, Method: Composition-based stats.
 Identities = 70/133 (53%), Positives = 91/133 (68%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  IKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAYL  284
            +KG VVLMRKN LDF DF AS++D + + LGQ+VSL+LVS+   D  +G +G     AYL
Sbjct  15   VKGTVVLMRKNTLDFTDFTASLLDGVQELLGQRVSLQLVSATVGDPKHGNRGVVGDPAYL  74

Query  285  DHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVH  464
            D +V K   +A+GES F + F W E  GVP A I+KN H ++FYLK++TL+D P  G +H
Sbjct  75   DGFVSKLPSIAAGESTFDVTFHWQEKNGVPGAVIVKNRHASQFYLKSITLKDFPGKGRIH  134

Query  465  FACFSWVYPASKY  503
            F C SWVY A KY
Sbjct  135  FVCNSWVYSADKY  147



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559877061510