BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS028H01

Length=633
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006351083.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    112   4e-25   Solanum tuberosum [potatoes]
ref|XP_006351081.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...    112   4e-25   Solanum tuberosum [potatoes]
ref|XP_004244785.1|  PREDICTED: ankyrin repeat protein SKIP35 iso...    111   2e-24   Solanum lycopersicum
ref|XP_010324730.1|  PREDICTED: ankyrin repeat protein SKIP35 iso...    111   2e-24   Solanum lycopersicum
ref|XP_004251971.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...    105   1e-22   Solanum lycopersicum
ref|XP_010313979.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...    105   1e-22   
ref|XP_006344946.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...  99.4    2e-20   Solanum tuberosum [potatoes]
ref|XP_006344945.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...  99.4    2e-20   Solanum tuberosum [potatoes]
ref|XP_009760838.1|  PREDICTED: ankyrin repeat protein SKIP35-like    93.2    3e-18   Nicotiana sylvestris
ref|XP_009615190.1|  PREDICTED: ankyrin repeat protein SKIP35         92.0    8e-18   
ref|XP_010650761.1|  PREDICTED: ankyrin repeat protein SKIP35-like    85.9    8e-16   
ref|XP_011074019.1|  PREDICTED: ankyrin repeat protein SKIP35-like    76.6    1e-12   
ref|XP_010251448.1|  PREDICTED: ankyrin repeat protein SKIP35-like    74.3    6e-12   Nelumbo nucifera [Indian lotus]
ref|XP_011085079.1|  PREDICTED: ankyrin repeat protein SKIP35-like    74.3    7e-12   Sesamum indicum [beniseed]
gb|EYU36630.1|  hypothetical protein MIMGU_mgv1a002704mg              73.6    1e-11   Erythranthe guttata [common monkey flower]
ref|XP_004288739.1|  PREDICTED: ankyrin repeat protein SKIP35-like    73.2    1e-11   Fragaria vesca subsp. vesca
ref|XP_010277855.1|  PREDICTED: ankyrin repeat protein SKIP35         72.8    2e-11   Nelumbo nucifera [Indian lotus]
emb|CBI24769.3|  unnamed protein product                              73.2    2e-11   Vitis vinifera
ref|XP_008337167.1|  PREDICTED: ankyrin repeat protein SKIP35-like    69.7    2e-11   
ref|XP_009618028.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...  72.4    2e-11   
ref|XP_009618034.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...  72.4    3e-11   Nicotiana tomentosiformis
ref|XP_009797824.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...  71.6    4e-11   Nicotiana sylvestris
ref|XP_009797820.1|  PREDICTED: ankyrin repeat protein SKIP35-lik...  71.6    5e-11   Nicotiana sylvestris
ref|XP_009366266.1|  PREDICTED: ankyrin repeat protein SKIP35-like    71.2    7e-11   
gb|EYU22360.1|  hypothetical protein MIMGU_mgv1a017835mg              69.7    2e-10   Erythranthe guttata [common monkey flower]
gb|KHN27707.1|  F-box/ankyrin repeat protein SKIP35                   69.7    2e-10   Glycine soja [wild soybean]
ref|XP_006600252.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...  69.3    2e-10   Glycine max [soybeans]
ref|XP_006372306.1|  hypothetical protein POPTR_0017s00410g           69.3    2e-10   
ref|XP_011005246.1|  PREDICTED: ankyrin repeat protein SKIP35-like    68.9    3e-10   Populus euphratica
ref|XP_002309709.2|  hypothetical protein POPTR_0007s00280g           68.9    4e-10   
ref|XP_007153901.1|  hypothetical protein PHAVU_003G074400g           68.2    6e-10   Phaseolus vulgaris [French bean]
ref|XP_008344056.1|  PREDICTED: LOW QUALITY PROTEIN: ankyrin repe...  67.4    8e-10   
ref|XP_008394247.1|  PREDICTED: ankyrin repeat protein SKIP35         67.4    1e-09   
gb|KDP29537.1|  hypothetical protein JCGZ_19250                       67.0    1e-09   Jatropha curcas
emb|CAN70678.1|  hypothetical protein VITISV_044152                   67.0    1e-09   Vitis vinifera
ref|XP_002533338.1|  conserved hypothetical protein                   66.6    2e-09   Ricinus communis
ref|XP_011004557.1|  PREDICTED: ankyrin repeat protein SKIP35         65.9    3e-09   Populus euphratica
ref|XP_006584140.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...  63.2    3e-08   Glycine max [soybeans]
gb|KHN22618.1|  F-box/ankyrin repeat protein SKIP35                   63.2    3e-08   Glycine soja [wild soybean]
emb|CDX71861.1|  BnaC08g30130D                                        62.4    4e-08   
ref|NP_191550.1|  Ankyrin repeat family protein                       62.0    5e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006402640.1|  hypothetical protein EUTSA_v10005846mg           62.0    5e-08   Eutrema salsugineum [saltwater cress]
gb|KDO49748.1|  hypothetical protein CISIN_1g006847mg                 62.0    5e-08   Citrus sinensis [apfelsine]
ref|XP_006441987.1|  hypothetical protein CICLE_v10019310mg           62.0    7e-08   
ref|XP_006478490.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...  62.0    7e-08   Citrus sinensis [apfelsine]
gb|KEH32772.1|  F-box/ankyrin repeat SKIP35-like protein              61.6    8e-08   Medicago truncatula
ref|XP_007026464.1|  Ankyrin repeat family protein isoform 2          61.2    1e-07   
ref|XP_007026463.1|  Ankyrin repeat family protein isoform 1          61.2    1e-07   Theobroma cacao [chocolate]
ref|XP_004499381.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...  60.8    2e-07   Cicer arietinum [garbanzo]
ref|XP_010469258.1|  PREDICTED: ankyrin repeat protein SKIP35         60.1    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_009390785.1|  PREDICTED: ankyrin repeat protein SKIP35-like    60.1    2e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002878304.1|  hypothetical protein ARALYDRAFT_486455           59.3    4e-07   
ref|XP_010413621.1|  PREDICTED: ankyrin repeat protein SKIP35-like    58.9    6e-07   Camelina sativa [gold-of-pleasure]
emb|CDY05963.1|  BnaA09g38170D                                        58.5    8e-07   
ref|XP_010672531.1|  PREDICTED: ankyrin repeat protein SKIP35-like    57.4    2e-06   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG16914.1|  F-box/ankyrin repeat SKIP35 -like protein             57.0    3e-06   Gossypium arboreum [tree cotton]
ref|XP_009116666.1|  PREDICTED: ankyrin repeat protein SKIP35         55.8    6e-06   Brassica rapa
ref|XP_010512283.1|  PREDICTED: ankyrin repeat protein SKIP35-like    55.8    7e-06   Camelina sativa [gold-of-pleasure]
gb|AJF94393.1|  F-box/ankyrin repeat protein SKIP35                   55.5    8e-06   Gossypium hirsutum [American cotton]
ref|XP_006290752.1|  hypothetical protein CARUB_v10016852mg           55.5    9e-06   
ref|XP_008445478.1|  PREDICTED: ankyrin repeat protein SKIP35-like    55.5    1e-05   Cucumis melo [Oriental melon]
ref|XP_004144185.1|  PREDICTED: F-box/ankyrin repeat protein SKIP...  55.1    1e-05   Cucumis sativus [cucumbers]
ref|XP_010912734.1|  PREDICTED: ankyrin repeat protein SKIP35-like    54.7    1e-05   Elaeis guineensis
ref|XP_010930324.1|  PREDICTED: ankyrin repeat protein SKIP35         53.5    4e-05   Elaeis guineensis
ref|XP_008781953.1|  PREDICTED: ankyrin repeat protein SKIP35-like    52.8    7e-05   Phoenix dactylifera
ref|XP_008243090.1|  PREDICTED: ankyrin repeat protein SKIP35-like    52.4    8e-05   Prunus mume [ume]
ref|XP_009404281.1|  PREDICTED: ankyrin repeat protein SKIP35-like    52.4    8e-05   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS60182.1|  hypothetical protein M569_14622                       52.4    1e-04   Genlisea aurea
gb|KJB11213.1|  hypothetical protein B456_001G247600                  51.6    2e-04   Gossypium raimondii
ref|XP_010524207.1|  PREDICTED: ankyrin repeat protein SKIP35         50.8    3e-04   Tarenaya hassleriana [spider flower]
ref|XP_007203611.1|  hypothetical protein PRUPE_ppa002867mg           50.4    4e-04   Prunus persica
ref|XP_008801302.1|  PREDICTED: ankyrin repeat protein SKIP35         49.7    9e-04   Phoenix dactylifera
ref|XP_009379908.1|  PREDICTED: ankyrin repeat protein SKIP35-like    49.3    0.001   Musa acuminata subsp. malaccensis [pisang utan]



>ref|XP_006351083.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X3 
[Solanum tuberosum]
Length=635

 Score =   112 bits (281),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 69/132 (52%), Positives = 85/132 (64%), Gaps = 6/132 (5%)
 Frame = +2

Query  245  MEEDKGTYLVENQDLNLVAEDNNMREPHCCGMEVE---TGISGMSGQNFVSDSENGEGSN  415
            MEED  T++  +++L       N  E  C  MEVE   TG  G+S ++ V  SENGEGSN
Sbjct  1    MEEDGITFVAGSENLE-SGIKINAEESQCFEMEVESCETGTLGVSNESVVFPSENGEGSN  59

Query  416  GNVVFSGQTPHVGKDFRGPG--GPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDR  589
            GN+VFS ++P V K FR     G C  GV K K R A+SD E GKNEKSG EKKL++Q+R
Sbjct  60   GNMVFSRESPLVRKGFRSSAVVGGCNCGVNKLKARMASSDGEIGKNEKSGAEKKLNRQER  119

Query  590  IELGRSFQDAVT  625
            IELGR FQ AV+
Sbjct  120  IELGRLFQGAVS  131



>ref|XP_006351081.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X1 
[Solanum tuberosum]
 ref|XP_006351082.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X2 
[Solanum tuberosum]
Length=636

 Score =   112 bits (281),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 69/132 (52%), Positives = 85/132 (64%), Gaps = 6/132 (5%)
 Frame = +2

Query  245  MEEDKGTYLVENQDLNLVAEDNNMREPHCCGMEVE---TGISGMSGQNFVSDSENGEGSN  415
            MEED  T++  +++L       N  E  C  MEVE   TG  G+S ++ V  SENGEGSN
Sbjct  1    MEEDGITFVAGSENLE-SGIKINAEESQCFEMEVESCETGTLGVSNESVVFPSENGEGSN  59

Query  416  GNVVFSGQTPHVGKDFRGPG--GPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDR  589
            GN+VFS ++P V K FR     G C  GV K K R A+SD E GKNEKSG EKKL++Q+R
Sbjct  60   GNMVFSRESPLVRKGFRSSAVVGGCNCGVNKLKARMASSDGEIGKNEKSGAEKKLNRQER  119

Query  590  IELGRSFQDAVT  625
            IELGR FQ AV+
Sbjct  120  IELGRLFQGAVS  131



>ref|XP_004244785.1| PREDICTED: ankyrin repeat protein SKIP35 isoform X2 [Solanum 
lycopersicum]
Length=635

 Score =   111 bits (277),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 68/132 (52%), Positives = 84/132 (64%), Gaps = 6/132 (5%)
 Frame = +2

Query  245  MEEDKGTYLVENQDLNLVAEDNNMREPHCCGMEVE---TGISGMSGQNFVSDSENGEGSN  415
            MEED   ++  +++L       N  E  C  MEVE   TG  G+S ++ V  SENGEGSN
Sbjct  1    MEEDGMAFVAGSENLE-SGIKINAEESQCFEMEVESCETGTLGVSNESVVFPSENGEGSN  59

Query  416  GNVVFSGQTPHVGKDFRGPG--GPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDR  589
            GNVVFS ++P V KDFR     G C  GV K K R ++SD E GKNE SG EKKL++Q+R
Sbjct  60   GNVVFSRESPLVRKDFRSSAVVGGCNCGVNKLKARLSSSDGENGKNEISGAEKKLNRQER  119

Query  590  IELGRSFQDAVT  625
            IELGR FQ AV+
Sbjct  120  IELGRLFQGAVS  131



>ref|XP_010324730.1| PREDICTED: ankyrin repeat protein SKIP35 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010324731.1| PREDICTED: ankyrin repeat protein SKIP35 isoform X1 [Solanum 
lycopersicum]
Length=636

 Score =   111 bits (277),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 68/132 (52%), Positives = 84/132 (64%), Gaps = 6/132 (5%)
 Frame = +2

Query  245  MEEDKGTYLVENQDLNLVAEDNNMREPHCCGMEVE---TGISGMSGQNFVSDSENGEGSN  415
            MEED   ++  +++L       N  E  C  MEVE   TG  G+S ++ V  SENGEGSN
Sbjct  1    MEEDGMAFVAGSENLE-SGIKINAEESQCFEMEVESCETGTLGVSNESVVFPSENGEGSN  59

Query  416  GNVVFSGQTPHVGKDFRGPG--GPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDR  589
            GNVVFS ++P V KDFR     G C  GV K K R ++SD E GKNE SG EKKL++Q+R
Sbjct  60   GNVVFSRESPLVRKDFRSSAVVGGCNCGVNKLKARLSSSDGENGKNEISGAEKKLNRQER  119

Query  590  IELGRSFQDAVT  625
            IELGR FQ AV+
Sbjct  120  IELGRLFQGAVS  131



>ref|XP_004251971.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X2 [Solanum 
lycopersicum]
Length=631

 Score =   105 bits (263),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 67/132 (51%), Positives = 82/132 (62%), Gaps = 11/132 (8%)
 Frame = +2

Query  245  MEEDKGTYLVENQDLNLVAEDNNMREPHCCGMEVETG---ISGMSGQNFVSDSENGEGSN  415
            MEEDK  ++      ++++E+  +       MEVET    IS  + +N V  SE GEGSN
Sbjct  1    MEEDKAVFVGSRN--SIISEEKTVFSE----MEVETADMDISDRNNENVVLPSEEGEGSN  54

Query  416  GNVVFSGQTPHVGKDFRGPG--GPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDR  589
            GNVVFS + P V KDFR     G C  GV K K   ANSD E GK+E+SG EKKLS+QDR
Sbjct  55   GNVVFSREAPLVHKDFRSSAVAGGCSCGVNKIKSGIANSDSELGKSEESGLEKKLSRQDR  114

Query  590  IELGRSFQDAVT  625
            IELGR FQ AV+
Sbjct  115  IELGRLFQGAVS  126



>ref|XP_010313979.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010313980.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Solanum 
lycopersicum]
Length=632

 Score =   105 bits (263),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 67/132 (51%), Positives = 82/132 (62%), Gaps = 11/132 (8%)
 Frame = +2

Query  245  MEEDKGTYLVENQDLNLVAEDNNMREPHCCGMEVETG---ISGMSGQNFVSDSENGEGSN  415
            MEEDK  ++      ++++E+  +       MEVET    IS  + +N V  SE GEGSN
Sbjct  1    MEEDKAVFVGSRN--SIISEEKTVFSE----MEVETADMDISDRNNENVVLPSEEGEGSN  54

Query  416  GNVVFSGQTPHVGKDFRGPG--GPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDR  589
            GNVVFS + P V KDFR     G C  GV K K   ANSD E GK+E+SG EKKLS+QDR
Sbjct  55   GNVVFSREAPLVHKDFRSSAVAGGCSCGVNKIKSGIANSDSELGKSEESGLEKKLSRQDR  114

Query  590  IELGRSFQDAVT  625
            IELGR FQ AV+
Sbjct  115  IELGRLFQGAVS  126



>ref|XP_006344946.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X2 
[Solanum tuberosum]
Length=628

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 80/132 (61%), Gaps = 14/132 (11%)
 Frame = +2

Query  245  MEEDKGTYLVENQDLNLVAEDNNMREPHCCGMEVETG---ISGMSGQNFVSDSENGEGSN  415
            MEEDK  ++      N ++E+  +       MEVET    IS  + +N V  SE GEGSN
Sbjct  1    MEEDKAAFVG-----NSISEEKTVFSE----MEVETADMEISDRNDENVVLPSEKGEGSN  51

Query  416  GNVVFSGQTPHVGKDFRGP--GGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDR  589
            GNVVFS + P V KDFR     G C  GV K K   A SD E GK+EKSG EKKLS+Q+R
Sbjct  52   GNVVFSREAPLVHKDFRSSVVAGGCSCGVNKIKSGIAISDLELGKSEKSGLEKKLSRQNR  111

Query  590  IELGRSFQDAVT  625
            IELGR FQ AV+
Sbjct  112  IELGRLFQGAVS  123



>ref|XP_006344945.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X1 
[Solanum tuberosum]
Length=629

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 80/132 (61%), Gaps = 14/132 (11%)
 Frame = +2

Query  245  MEEDKGTYLVENQDLNLVAEDNNMREPHCCGMEVETG---ISGMSGQNFVSDSENGEGSN  415
            MEEDK  ++      N ++E+  +       MEVET    IS  + +N V  SE GEGSN
Sbjct  1    MEEDKAAFVG-----NSISEEKTVFSE----MEVETADMEISDRNDENVVLPSEKGEGSN  51

Query  416  GNVVFSGQTPHVGKDFRGP--GGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDR  589
            GNVVFS + P V KDFR     G C  GV K K   A SD E GK+EKSG EKKLS+Q+R
Sbjct  52   GNVVFSREAPLVHKDFRSSVVAGGCSCGVNKIKSGIAISDLELGKSEKSGLEKKLSRQNR  111

Query  590  IELGRSFQDAVT  625
            IELGR FQ AV+
Sbjct  112  IELGRLFQGAVS  123



>ref|XP_009760838.1| PREDICTED: ankyrin repeat protein SKIP35-like [Nicotiana sylvestris]
 ref|XP_009760839.1| PREDICTED: ankyrin repeat protein SKIP35-like [Nicotiana sylvestris]
Length=621

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 72/107 (67%), Gaps = 9/107 (8%)
 Frame = +2

Query  320  EPHCCGMEVETGISGMSGQNFVSDSENGEGSNGNVVFSGQTPHVGKDFRGPG-----GPC  484
            E  C  MEVE+  +G+ G N    +ENGEGSNGNVVFS ++P V KDFR        G C
Sbjct  16   ESQCFEMEVESCETGIPGLN----NENGEGSNGNVVFSRESPLVSKDFRSSAIVGGGGGC  71

Query  485  ISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGRSFQDAVT  625
              GV K K R ++SD E GKNEKSG EKKL++Q+RIELGR FQ AV+
Sbjct  72   NCGVNKLKARLSSSDCEVGKNEKSGHEKKLNRQERIELGRLFQGAVS  118



>ref|XP_009615190.1| PREDICTED: ankyrin repeat protein SKIP35 [Nicotiana tomentosiformis]
 ref|XP_009615191.1| PREDICTED: ankyrin repeat protein SKIP35 [Nicotiana tomentosiformis]
 ref|XP_009615192.1| PREDICTED: ankyrin repeat protein SKIP35 [Nicotiana tomentosiformis]
 emb|CAI84657.1| hypothetical protein [Nicotiana tabacum]
Length=621

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 73/113 (65%), Gaps = 15/113 (13%)
 Frame = +2

Query  311  NMREPHCCGMEVE---TGISGMSGQNFVSDSENGEGSNGNVVFSGQTPHVGKDFRGPG--  475
            N  E  C  MEVE   TGI G+S       +ENGEGS+GNVVFS ++P V KDFR     
Sbjct  13   NTEESQCFEMEVESCETGIPGLS-------NENGEGSHGNVVFSRESPLVSKDFRSSAIV  65

Query  476  ---GPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGRSFQDAVT  625
               G C  GV K K R ++SD E GKNEKSG EKKL++Q+RIELGR FQ AV+
Sbjct  66   GGGGGCNCGVNKLKARLSSSDCEVGKNEKSGHEKKLNRQERIELGRLFQGAVS  118



>ref|XP_010650761.1| PREDICTED: ankyrin repeat protein SKIP35-like [Vitis vinifera]
 ref|XP_010650762.1| PREDICTED: ankyrin repeat protein SKIP35-like [Vitis vinifera]
Length=626

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 66/110 (60%), Gaps = 8/110 (7%)
 Frame = +2

Query  308  NNMREPHCCGMEVETGISGM---SGQNFVSDSENGEGSNGNVVFSGQTPHVGKDFRGPGG  478
             N ++P C  ME      G    + +NF   SENGEGSN  VVFS + P V KD R  GG
Sbjct  20   TNPKDPLCAEMESNNNGIGHPKDASENF--SSENGEGSN--VVFSREAPLVSKDSRTSGG  75

Query  479  PCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGRSFQDAVTS  628
             C    KK K R   +D EPGK +K G EKKLS+QDRIELGR FQ AV+S
Sbjct  76   -CSCSPKKLKSRMVVTDSEPGKKDKVGNEKKLSRQDRIELGRMFQGAVSS  124



>ref|XP_011074019.1| PREDICTED: ankyrin repeat protein SKIP35-like [Sesamum indicum]
 ref|XP_011074020.1| PREDICTED: ankyrin repeat protein SKIP35-like [Sesamum indicum]
 ref|XP_011074021.1| PREDICTED: ankyrin repeat protein SKIP35-like [Sesamum indicum]
Length=640

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 56/122 (46%), Positives = 70/122 (57%), Gaps = 19/122 (16%)
 Frame = +2

Query  302  EDNNMREPHCCG---MEVETGISGMS--------GQNFVS-DSENGEG-SNGNVVFSGQT  442
            ++ NM EPHC     ME+ET    +S        G + V+  SE GEG S+GNVVFS + 
Sbjct  25   DEVNMEEPHCSEIEMMEMETAEDEISRASNESKHGTDIVAFSSEKGEGGSDGNVVFSREA  84

Query  443  PHVGKDFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGRSFQDAV  622
            P V K+       C  G +K K R A S+ EPGKN +     KLS+QDRIELGR FQ AV
Sbjct  85   PLVIKE-DSTISSCSCGAEKLKSRLAASNSEPGKNGR-----KLSRQDRIELGRLFQGAV  138

Query  623  TS  628
            +S
Sbjct  139  SS  140



>ref|XP_010251448.1| PREDICTED: ankyrin repeat protein SKIP35-like [Nelumbo nucifera]
 ref|XP_010251449.1| PREDICTED: ankyrin repeat protein SKIP35-like [Nelumbo nucifera]
Length=625

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 68/117 (58%), Gaps = 10/117 (9%)
 Frame = +2

Query  287  LNLVAEDNNMREPHCCGMEVE---TGISGMSGQNFVSDSENGEGSNGNVVFSGQTPHVGK  457
            L+LV E N  ++  C  ME +    G  G  G+ F  + + G     NVVFS + P +GK
Sbjct  14   LHLVNETNP-KDLQCAEMETDDNGVGTPGDDGELFSCEKDKG----SNVVFSREAPLMGK  68

Query  458  DFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGRSFQDAVTS  628
            D R  GG C    KK K R + +D +  K EK+G +KKLS+QDRIELGR FQ AV+S
Sbjct  69   DLRTSGG-CSCSAKKLKSRMSAADFDLCK-EKNGHDKKLSRQDRIELGRMFQSAVSS  123



>ref|XP_011085079.1| PREDICTED: ankyrin repeat protein SKIP35-like [Sesamum indicum]
 ref|XP_011085080.1| PREDICTED: ankyrin repeat protein SKIP35-like [Sesamum indicum]
Length=645

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 54/133 (41%), Positives = 73/133 (55%), Gaps = 22/133 (17%)
 Frame = +2

Query  272  VENQDLNLVAEDNNMREPHCC-----GMEV-ETGISGMSGQ--------NFVSDSENGEG  409
            + +QDLN + +D NM EP C      GME  E G+S +S +         F S+  +G G
Sbjct  19   IGSQDLN-IGDDINMEEPQCAEVEMMGMETAEAGVSSLSNEIELGTEIAGFCSEKSDG-G  76

Query  410  SNGNVVFSGQTPHVGKDFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDR  589
             +GNV+FS + P V K+       C  G +K K + A  D + GKN++     KLS+QDR
Sbjct  77   CHGNVIFSREAPLVIKEDLSTSA-CSCGAEKLKSKLAAYDSKNGKNDR-----KLSRQDR  130

Query  590  IELGRSFQDAVTS  628
            IELGR FQ AV S
Sbjct  131  IELGRLFQGAVCS  143



>gb|EYU36630.1| hypothetical protein MIMGU_mgv1a002704mg [Erythranthe guttata]
Length=645

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 63/149 (42%), Positives = 80/149 (54%), Gaps = 26/149 (17%)
 Frame = +2

Query  230  VGRYKMEEDKGTYLVENQDLNLVAEDNNMREPHCCGME------VETGISGMSGQN----  379
            V R  ME +  T  +E+Q ++ + E   M EP C  +E      VETG S +   N    
Sbjct  6    VLRLGMESE--TSKIESQGVDTM-EQLKMEEPQCSDIETMEKDAVETGKSMVEYGNKHET  62

Query  380  ----FVSDSENGEGSNGNVVFSGQTPHVGKDFRGPG-GPCISGVKKHKFR-QANSDPEPG  541
                F S+  +G GS+GNVVFS + P V K+   P    C  G +K K R  A SD EPG
Sbjct  63   EIEDFSSEKGDGGGSHGNVVFSREAPLVIKE--DPSMSSCSCGAEKLKSRLAAASDSEPG  120

Query  542  KNEKSGQEKKLSKQDRIELGRSFQDAVTS  628
            KN +     KLS+QDRIELGR FQ AV+S
Sbjct  121  KNGR-----KLSRQDRIELGRLFQGAVSS  144



>ref|XP_004288739.1| PREDICTED: ankyrin repeat protein SKIP35-like [Fragaria vesca 
subsp. vesca]
 ref|XP_011466463.1| PREDICTED: ankyrin repeat protein SKIP35-like [Fragaria vesca 
subsp. vesca]
 ref|XP_011466484.1| PREDICTED: ankyrin repeat protein SKIP35-like [Fragaria vesca 
subsp. vesca]
Length=612

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 66/117 (56%), Gaps = 12/117 (10%)
 Frame = +2

Query  293  LVAEDNNMREPHCCGMEVETGISGMSG-----QNFVSDSENGEGSNGNVVFSGQTPHVGK  457
            +VA+  N  +P    M++++  SG+ G     Q F SD  N EGSN  VVFS   P V K
Sbjct  1    MVADATNSEDP--IYMDMDSEESGIVGPRNGLQGFTSD--NAEGSN--VVFSRDGPLVRK  54

Query  458  DFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGRSFQDAVTS  628
            + R     C S  KK K R A  D  P K EK  QEKKLS+ DRIELGR FQ AV+S
Sbjct  55   ESRMSTTCCCS-TKKLKSRVAMMDSNPDKKEKPWQEKKLSRHDRIELGRLFQSAVSS  110



>ref|XP_010277855.1| PREDICTED: ankyrin repeat protein SKIP35 [Nelumbo nucifera]
 ref|XP_010277856.1| PREDICTED: ankyrin repeat protein SKIP35 [Nelumbo nucifera]
Length=626

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 63/108 (58%), Gaps = 4/108 (4%)
 Frame = +2

Query  308  NNMREPHCCGMEVE-TGISGMSGQNFVSDSENGEGSNGNVVFSGQTPHVGKDFRGPGGPC  484
            +N  +P C  ME +  GI        +  SE GEGSN  VVFS + P + KD R  GG C
Sbjct  20   SNSEDPLCAEMETDGNGIGNAKDDGELFSSEKGEGSN--VVFSREAPLMNKDPRMSGG-C  76

Query  485  ISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGRSFQDAVTS  628
               V+K K R + +D +  K +K+G +KK S+QDRIELGR FQ A+ S
Sbjct  77   SCSVRKPKSRTSAADFDIYKKDKNGHDKKFSRQDRIELGRMFQSALNS  124



>emb|CBI24769.3| unnamed protein product [Vitis vinifera]
Length=969

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 51/109 (47%), Positives = 58/109 (53%), Gaps = 20/109 (18%)
 Frame = +2

Query  311  NMREPHCCGMEVETGISGM---SGQNFVSDSENGEGSNGNVVFSGQTPHVGKDFRGPGGP  481
            N ++P C  ME      G    + +NF   SENGEGSN  VVFS + P V KD R  GG 
Sbjct  376  NPKDPLCAEMESNNNGIGHPKDASENF--SSENGEGSN--VVFSREAPLVSKDSRTSGG-  430

Query  482  CISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGRSFQDAVTS  628
            C    KK K R              G EKKLS+QDRIELGR FQ AV+S
Sbjct  431  CSCSPKKLKSRMV------------GNEKKLSRQDRIELGRMFQGAVSS  467



>ref|XP_008337167.1| PREDICTED: ankyrin repeat protein SKIP35-like [Malus domestica]
Length=223

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 70/128 (55%), Gaps = 8/128 (6%)
 Frame = +2

Query  254  DKGTYLVENQDLNLVAEDNNMREPHCCGMEVE-TGI-SGMSG-QNFVSDSENGEGSNGNV  424
            +KG   +E  D  +V  + N  +P    ME E  GI S  +G Q F SD   GEGSN  V
Sbjct  2    EKGMAPLEGNDGCIVVNETNSEDPIYIDMETEQYGIDSSKNGIQAFASD--KGEGSN--V  57

Query  425  VFSGQTPHVGKDFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGR  604
            VFS + P   K+ R P   C    KK K R  + D    +  K GQEKKLS+QDRIELGR
Sbjct  58   VFSREGPLARKESRMPTS-CSCSAKKLKSRVDSVDSNLERKGKVGQEKKLSRQDRIELGR  116

Query  605  SFQDAVTS  628
             FQ AV+S
Sbjct  117  MFQGAVSS  124



>ref|XP_009618028.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618029.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618030.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618031.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618033.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Nicotiana 
tomentosiformis]
Length=601

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 49/76 (64%), Gaps = 6/76 (8%)
 Frame = +2

Query  401  GEGSNGNVVFSGQTPHV-GKDFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLS  577
            GEGSNG VVFS + P V  KD    G  C  GV K K R  NSD E   NEK G EKKLS
Sbjct  26   GEGSNGKVVFSREAPLVHNKDLIAGGCSC--GVNKIKSRLENSDSE---NEKLGPEKKLS  80

Query  578  KQDRIELGRSFQDAVT  625
            +QDRIELGR FQ AV+
Sbjct  81   RQDRIELGRLFQGAVS  96



>ref|XP_009618034.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X2 [Nicotiana 
tomentosiformis]
Length=600

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 49/76 (64%), Gaps = 6/76 (8%)
 Frame = +2

Query  401  GEGSNGNVVFSGQTPHV-GKDFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLS  577
            GEGSNG VVFS + P V  KD    G  C  GV K K R  NSD E   NEK G EKKLS
Sbjct  26   GEGSNGKVVFSREAPLVHNKDLIAGGCSC--GVNKIKSRLENSDSE---NEKLGPEKKLS  80

Query  578  KQDRIELGRSFQDAVT  625
            +QDRIELGR FQ AV+
Sbjct  81   RQDRIELGRLFQGAVS  96



>ref|XP_009797824.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X2 [Nicotiana 
sylvestris]
Length=602

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 58/101 (57%), Gaps = 10/101 (10%)
 Frame = +2

Query  338  MEVETGISGMSGQNFVSDSEN----GEGSNGNVVFSGQTPHVG-KDFRGPGGPCISGVKK  502
            ME +   S +S +  +   E     GEGSNG VVFS + P V  KD    G  C  GV K
Sbjct  1    MEEDKAASNISEEETICSVETVQVKGEGSNGKVVFSREAPLVHYKDLIAGGCSC--GVNK  58

Query  503  HKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGRSFQDAVT  625
             K R  NSD E   NEKS  EKKLS+QDRIELGR FQ AV+
Sbjct  59   IKSRLENSDSE---NEKSVPEKKLSRQDRIELGRLFQGAVS  96



>ref|XP_009797820.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009797821.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009797822.1| PREDICTED: ankyrin repeat protein SKIP35-like isoform X1 [Nicotiana 
sylvestris]
Length=603

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 58/101 (57%), Gaps = 10/101 (10%)
 Frame = +2

Query  338  MEVETGISGMSGQNFVSDSEN----GEGSNGNVVFSGQTPHVG-KDFRGPGGPCISGVKK  502
            ME +   S +S +  +   E     GEGSNG VVFS + P V  KD    G  C  GV K
Sbjct  1    MEEDKAASNISEEETICSVETVQVKGEGSNGKVVFSREAPLVHYKDLIAGGCSC--GVNK  58

Query  503  HKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGRSFQDAVT  625
             K R  NSD E   NEKS  EKKLS+QDRIELGR FQ AV+
Sbjct  59   IKSRLENSDSE---NEKSVPEKKLSRQDRIELGRLFQGAVS  96



>ref|XP_009366266.1| PREDICTED: ankyrin repeat protein SKIP35-like [Pyrus x bretschneideri]
 ref|XP_009366267.1| PREDICTED: ankyrin repeat protein SKIP35-like [Pyrus x bretschneideri]
 ref|XP_009366268.1| PREDICTED: ankyrin repeat protein SKIP35-like [Pyrus x bretschneideri]
Length=619

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 68/127 (54%), Gaps = 7/127 (6%)
 Frame = +2

Query  254  DKGTYLVENQDLNLVAEDNNMREPHCCGMEVETGISGMSG--QNFVSDSENGEGSNGNVV  427
            +KG   +E  D  +V  + N  +P    ME E  I       Q F SD   GEGSN  VV
Sbjct  2    EKGMAPLEGNDGWIVVNETNSEDPIYIDMETEYVIDSPKNGIQGFASD--KGEGSN--VV  57

Query  428  FSGQTPHVGKDFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGRS  607
             S + P V K+ R P   C    KK K +   +D  P + +K GQEKKLS+QDRIELGR 
Sbjct  58   SSREGPLVRKESRMPTS-CSCSAKKLKSQVDAADSNPERKDKVGQEKKLSRQDRIELGRM  116

Query  608  FQDAVTS  628
            FQ AV+S
Sbjct  117  FQGAVSS  123



>gb|EYU22360.1| hypothetical protein MIMGU_mgv1a017835mg [Erythranthe guttata]
Length=645

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 58/138 (42%), Positives = 73/138 (53%), Gaps = 24/138 (17%)
 Frame = +2

Query  263  TYLVENQDLNLVAEDNNMREPHCCGME------VETGISGMSGQN--------FVSDSEN  400
            T  +E+Q ++   E     EP C  +E      VETG S +   N        F S+  +
Sbjct  15   TIKIESQGVD-TREQLKTEEPQCSDIETMETDAVETGKSMVEYGNKHETEIEDFSSEKGD  73

Query  401  GEGSNGNVVFSGQTPHVGKDFRGPG-GPCISGVKKHKFR-QANSDPEPGKNEKSGQEKKL  574
            G GS+GNVVFS + P V K+   P    C  G +K K R  A SD EPGKN +     KL
Sbjct  74   GGGSHGNVVFSREAPLVIKE--DPSMSSCSCGAEKLKSRLAAASDSEPGKNGR-----KL  126

Query  575  SKQDRIELGRSFQDAVTS  628
            S+QDRIELGR FQ AV+S
Sbjct  127  SRQDRIELGRLFQGAVSS  144



>gb|KHN27707.1| F-box/ankyrin repeat protein SKIP35 [Glycine soja]
Length=605

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 50/79 (63%), Gaps = 3/79 (4%)
 Frame = +2

Query  392  SENGEGSNGNVVFSGQTPHVGKDFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKK  571
            SE GEGS+  VVFS + P + K+ R     C +  KK K R   +D E G NEK G EKK
Sbjct  28   SEKGEGSS--VVFSREAPLMRKESRMSTPYCCNA-KKLKSRDVTTDCELGSNEKFGLEKK  84

Query  572  LSKQDRIELGRSFQDAVTS  628
            L +QDRIELGR FQ AV+S
Sbjct  85   LCRQDRIELGRLFQSAVSS  103



>ref|XP_006600252.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X1 
[Glycine max]
 ref|XP_006600253.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X2 
[Glycine max]
 ref|XP_006600254.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X3 
[Glycine max]
 ref|XP_006600255.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X4 
[Glycine max]
Length=605

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 50/79 (63%), Gaps = 3/79 (4%)
 Frame = +2

Query  392  SENGEGSNGNVVFSGQTPHVGKDFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKK  571
            SE GEGS+  VVFS + P + K+ R     C +  KK K R   +D E G NEK G EKK
Sbjct  28   SEKGEGSS--VVFSREAPLMRKESRMSTPYCCNA-KKLKSRDVTTDCELGSNEKFGLEKK  84

Query  572  LSKQDRIELGRSFQDAVTS  628
            L +QDRIELGR FQ AV+S
Sbjct  85   LCRQDRIELGRLFQSAVSS  103



>ref|XP_006372306.1| hypothetical protein POPTR_0017s00410g [Populus trichocarpa]
 ref|XP_006372307.1| hypothetical protein POPTR_0017s00410g [Populus trichocarpa]
 gb|ERP50103.1| hypothetical protein POPTR_0017s00410g [Populus trichocarpa]
 gb|ERP50104.1| hypothetical protein POPTR_0017s00410g [Populus trichocarpa]
Length=625

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 47/78 (60%), Gaps = 3/78 (4%)
 Frame = +2

Query  392  SENGEGSNGNVVFSGQTPHVGKDFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKK  571
            SE GEGSN  VVFS + P + K+ R   G C    KK K R      E G  E  GQEKK
Sbjct  48   SETGEGSN--VVFSREAPLISKETR-ISGVCSCSTKKLKPRVVAMKSEIGNKENFGQEKK  104

Query  572  LSKQDRIELGRSFQDAVT  625
            LS+QDRIELGR FQ AV+
Sbjct  105  LSRQDRIELGRMFQSAVS  122



>ref|XP_011005246.1| PREDICTED: ankyrin repeat protein SKIP35-like [Populus euphratica]
Length=625

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 66/128 (52%), Gaps = 11/128 (9%)
 Frame = +2

Query  254  DKGTYLVENQDLNLVAEDN-NMREPHCCGMEVE---TGISGMSGQNFVSDSENGEGSNGN  421
            +K T LVE  D++L  ED  N  E     ME E    G      Q F   SE GEGSN  
Sbjct  2    EKETALVEGTDIHL--EDVFNPEESFTVEMETEENEIGSPKSEIQCF--SSEMGEGSN--  55

Query  422  VVFSGQTPHVGKDFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELG  601
            VVFS + PH+  + R   G C     K K      + E G  E  GQEKKLS+QDRIELG
Sbjct  56   VVFSREAPHISTESR-VSGVCSCSATKIKPHVVAMESEIGDKENFGQEKKLSRQDRIELG  114

Query  602  RSFQDAVT  625
            R FQ AV+
Sbjct  115  RMFQSAVS  122



>ref|XP_002309709.2| hypothetical protein POPTR_0007s00280g [Populus trichocarpa]
 gb|EEE90159.2| hypothetical protein POPTR_0007s00280g [Populus trichocarpa]
Length=625

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 66/128 (52%), Gaps = 11/128 (9%)
 Frame = +2

Query  254  DKGTYLVENQDLNLVAEDN-NMREPHCCGMEVE---TGISGMSGQNFVSDSENGEGSNGN  421
            +K T LVE  D++L  ED  N  E     ME E    G      Q F   SE GEGSN  
Sbjct  2    EKETALVEGTDMHL--EDVFNPEESFTVEMETEENEIGSPKSEIQCF--SSEMGEGSN--  55

Query  422  VVFSGQTPHVGKDFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELG  601
            VVFS + PH+  + R   G C     K K      + E G  E  GQEKKLS+QDRIELG
Sbjct  56   VVFSREAPHISTESR-VSGVCSCSATKIKPHVVAMESEIGDKENFGQEKKLSRQDRIELG  114

Query  602  RSFQDAVT  625
            R FQ AV+
Sbjct  115  RMFQSAVS  122



>ref|XP_007153901.1| hypothetical protein PHAVU_003G074400g [Phaseolus vulgaris]
 gb|ESW25895.1| hypothetical protein PHAVU_003G074400g [Phaseolus vulgaris]
Length=610

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 50/79 (63%), Gaps = 3/79 (4%)
 Frame = +2

Query  392  SENGEGSNGNVVFSGQTPHVGKDFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKK  571
            SE GEGS+  VVFS + P + K+ R     C +  KK K R  + D E G NEK G EKK
Sbjct  33   SEKGEGSS--VVFSREAPLMRKESRMSTSYCCNA-KKLKSRAVSIDCELGSNEKIGLEKK  89

Query  572  LSKQDRIELGRSFQDAVTS  628
            L +QDRIELGR FQ AV+S
Sbjct  90   LGRQDRIELGRLFQGAVSS  108



>ref|XP_008344056.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat protein SKIP35-like 
[Malus domestica]
Length=534

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 70/128 (55%), Gaps = 8/128 (6%)
 Frame = +2

Query  254  DKGTYLVENQDLNLVAEDNNMREPHCCGMEVETGI--SGMSG-QNFVSDSENGEGSNGNV  424
            +KG   +E  D  +V  + N  +P    ME E  +  S  +G Q F +D   GEGSN  V
Sbjct  2    EKGXXPLEGNDGWIVVNETNSEBPIYIEMETEEYVIDSPKNGIQGFAAD--KGEGSN--V  57

Query  425  VFSGQTPHVGKDFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGR  604
            V S + P V K+  G    C    KK K     +DP P + +K GQEKKLS+QDRIELGR
Sbjct  58   VSSREGPLVRKE-SGMPTSCSCSAKKLKSXVDAADPNPERKDKVGQEKKLSRQDRIELGR  116

Query  605  SFQDAVTS  628
             FQ AV+S
Sbjct  117  MFQGAVSS  124



>ref|XP_008394247.1| PREDICTED: ankyrin repeat protein SKIP35 [Malus domestica]
Length=620

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 70/128 (55%), Gaps = 8/128 (6%)
 Frame = +2

Query  254  DKGTYLVENQDLNLVAEDNNMREPHCCGMEVETGI--SGMSG-QNFVSDSENGEGSNGNV  424
            +KG   +E  D  +V  + N  +P    ME E  +  S  +G Q F +D   GEGSN  V
Sbjct  2    EKGXXPLEGNDGWIVVNETNSEBPIYIEMETEEYVIDSPKNGIQGFAAD--KGEGSN--V  57

Query  425  VFSGQTPHVGKDFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGR  604
            V S + P V K+  G    C    KK K     +DP P + +K GQEKKLS+QDRIELGR
Sbjct  58   VSSREGPLVRKE-SGMPTSCSCSAKKLKSXVDAADPNPERKDKVGQEKKLSRQDRIELGR  116

Query  605  SFQDAVTS  628
             FQ AV+S
Sbjct  117  MFQGAVSS  124



>gb|KDP29537.1| hypothetical protein JCGZ_19250 [Jatropha curcas]
Length=625

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 65/114 (57%), Gaps = 8/114 (7%)
 Frame = +2

Query  296  VAEDNNMREPHCCGMEVETGISGMSGQNFVS--DSENGEGSNGNVVFSGQTPHVGKDFRG  469
            V +D N  E  C  ME+E    G S +N +     E GEGSN  VVFS + P + K+ + 
Sbjct  15   VGDDVNPEESFCAEMEIEENEIG-SPKNEIQRLTPEKGEGSN--VVFSREGPLISKESKR  71

Query  470  PGGP-CISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGRSFQDAVTS  628
             G   C  G KK K     ++ E GK E SG +KKL+KQDRIELGR FQ AV+S
Sbjct  72   CGVYRC--GAKKLKSHAVVTESEIGKKENSGHDKKLTKQDRIELGRLFQGAVSS  123



>emb|CAN70678.1| hypothetical protein VITISV_044152 [Vitis vinifera]
Length=581

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 50/87 (57%), Gaps = 21/87 (24%)
 Frame = +2

Query  368  SGQNFVSDSENGEGSNGNVVFSGQTPHVGKDFRGPGGPCISGVKKHKFRQANSDPEPGKN  547
            + +NF   SENGEGSN  VVFS + P                  K K R   +D EPGK 
Sbjct  14   ASENF--SSENGEGSN--VVFSREAP-----------------LKLKSRMVVTDSEPGKK  52

Query  548  EKSGQEKKLSKQDRIELGRSFQDAVTS  628
            +K G EKKLS+QDRIELGR FQ AV+S
Sbjct  53   DKVGNEKKLSRQDRIELGRMFQGAVSS  79



>ref|XP_002533338.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29047.1| conserved hypothetical protein [Ricinus communis]
Length=626

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 69/127 (54%), Gaps = 6/127 (5%)
 Frame = +2

Query  254  DKGTYLVENQDLNLVAEDNNMREPHCCGMEVETGISG--MSGQNFVSDSENGEGSNGNVV  427
            +K    VE  +L +  ++ N     C  MEVE   +G   S    ++ SE GEGSN  VV
Sbjct  2    EKEIVCVEGTNLCM-GDEINSENTFCAEMEVEENETGSPKSEIQLLAASEKGEGSN--VV  58

Query  428  FSGQTPHVGKDFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGRS  607
            FS + P + K+ R   G    G KK K     ++ + GK E  G ++KL+KQDRIELGR 
Sbjct  59   FSREGPLISKESR-RSGVYRCGAKKLKSHMVITESDIGKKENFGHDRKLTKQDRIELGRL  117

Query  608  FQDAVTS  628
            FQ AV+S
Sbjct  118  FQGAVSS  124



>ref|XP_011004557.1| PREDICTED: ankyrin repeat protein SKIP35 [Populus euphratica]
Length=625

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 46/78 (59%), Gaps = 3/78 (4%)
 Frame = +2

Query  392  SENGEGSNGNVVFSGQTPHVGKDFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKK  571
            SE GEGSN  VV S + P + K+ R   G C    KK K R      E G  E  GQEKK
Sbjct  48   SEMGEGSN--VVISREAPLISKESR-ISGVCSCSTKKLKPRVVAMKSEIGNKENFGQEKK  104

Query  572  LSKQDRIELGRSFQDAVT  625
            LS+QDRIELGR FQ AV+
Sbjct  105  LSRQDRIELGRMFQSAVS  122



>ref|XP_006584140.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X1 
[Glycine max]
 ref|XP_006584141.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like isoform X2 
[Glycine max]
Length=605

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 49/79 (62%), Gaps = 3/79 (4%)
 Frame = +2

Query  392  SENGEGSNGNVVFSGQTPHVGKDFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKK  571
            SE GEGS+  VVFS + P + K+ R     C +  KK K      D + G NEK+G EKK
Sbjct  28   SEKGEGSS--VVFSREAPLMRKESRMSTPYCCNA-KKLKSGAVTIDCDLGSNEKNGLEKK  84

Query  572  LSKQDRIELGRSFQDAVTS  628
            L +QDRIELGR FQ AV+S
Sbjct  85   LCRQDRIELGRLFQGAVSS  103



>gb|KHN22618.1| F-box/ankyrin repeat protein SKIP35 [Glycine soja]
Length=605

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 49/79 (62%), Gaps = 3/79 (4%)
 Frame = +2

Query  392  SENGEGSNGNVVFSGQTPHVGKDFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKK  571
            SE GEGS+  VVFS + P + K+ R     C +  KK K      D + G NEK+G EKK
Sbjct  28   SEKGEGSS--VVFSREAPLMRKESRMSTPYCCNA-KKLKSGAVTIDCDLGSNEKNGLEKK  84

Query  572  LSKQDRIELGRSFQDAVTS  628
            L +QDRIELGR FQ AV+S
Sbjct  85   LCRQDRIELGRLFQGAVSS  103



>emb|CDX71861.1| BnaC08g30130D [Brassica napus]
Length=604

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 50/81 (62%), Gaps = 6/81 (7%)
 Frame = +2

Query  395  ENGEGSNGNVVFSGQTPHVGKDFRG--PGGPCISGVKKHKFRQANSDPEPGKNEKSGQEK  568
            E GEG + NVVFS + P +GKD  G  PG  C    KK  F+ +    +    E + Q+K
Sbjct  30   EEGEGGS-NVVFSREAPLIGKDPAGTSPGECCGCSAKKLNFKASEDLID---KENNSQQK  85

Query  569  KLSKQDRIELGRSFQDAVTSM  631
            KLS+Q+RIELGR FQ AVTSM
Sbjct  86   KLSRQERIELGRVFQGAVTSM  106



>ref|NP_191550.1| Ankyrin repeat family protein [Arabidopsis thaliana]
 sp|Q9M1Y3.1|SKI35_ARATH RecName: Full=Ankyrin repeat protein SKIP35; AltName: Full=SKP1-interacting 
partner 35 [Arabidopsis thaliana]
 emb|CAB75810.1| putative protein [Arabidopsis thaliana]
 gb|AAM20716.1| putative protein [Arabidopsis thaliana]
 gb|AAP37740.1| At3g59910 [Arabidopsis thaliana]
 gb|AEE79984.1| Ankyrin repeat family protein [Arabidopsis thaliana]
Length=611

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 58/106 (55%), Gaps = 14/106 (13%)
 Frame = +2

Query  320  EPHCCGMEVETGISGMSGQNFVSDSENGEGSNGNVVFSGQTPHVGKDFRGP--GGPCISG  493
            EP C  M+ ET     S Q F    E GEGS   VVFS + P +GKD  G   G  C   
Sbjct  20   EPFCSEMKTETI---ASSQKF----EGGEGSK--VVFSREAPLIGKDSAGTNSGECCGCS  70

Query  494  VKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGRSFQDAVTSM  631
             KK  F+    D +  + E   Q+KKL++Q+RIELGR FQ AVTS+
Sbjct  71   AKKLNFK---GDDDLVEKENIEQQKKLNRQERIELGRLFQGAVTSL  113



>ref|XP_006402640.1| hypothetical protein EUTSA_v10005846mg [Eutrema salsugineum]
 gb|ESQ44093.1| hypothetical protein EUTSA_v10005846mg [Eutrema salsugineum]
Length=606

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 56/104 (54%), Gaps = 17/104 (16%)
 Frame = +2

Query  320  EPHCCGMEVETGISGMSGQNFVSDSENGEGSNGNVVFSGQTPHVGKDFRGPGGPCISGVK  499
            EP+C  +  ET  S           E GEGSN  VVFS + P +GKD   P   C    K
Sbjct  22   EPYCSEIGTETFASS-------QKIEGGEGSN--VVFSTEAPLIGKD---PYCGC--SAK  67

Query  500  KHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGRSFQDAVTSM  631
            K  F+ +    E    E  GQ+KKL++QDRIELGR FQ AVTS+
Sbjct  68   KLNFKGSEDLIE---KENIGQQKKLNRQDRIELGRLFQGAVTSL  108



>gb|KDO49748.1| hypothetical protein CISIN_1g006847mg [Citrus sinensis]
Length=629

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 63/128 (49%), Gaps = 10/128 (8%)
 Frame = +2

Query  257  KGTYLVENQDLNLVAEDN-NMREPHCCGMEV---ETGISGMSGQNFVSDSENGEGSNGNV  424
            K  + V   D N+  ED  +  EP C  ME    ETG        F S  E  EGSN  V
Sbjct  3    KERFFVSKND-NMYLEDGIDHEEPFCAEMEADENETGTPANEVHGFTS--EGSEGSN--V  57

Query  425  VFSGQTPHVGKDFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGR  604
            VFS + P + K+ R   G C    K  K R+  +       EK G EKKLSK +R+ELG+
Sbjct  58   VFSREAPLISKESRISSG-CSCSAKNLKSRRIIATDSDFATEKIGHEKKLSKSERVELGK  116

Query  605  SFQDAVTS  628
             FQ A++S
Sbjct  117  MFQSAMSS  124



>ref|XP_006441987.1| hypothetical protein CICLE_v10019310mg [Citrus clementina]
 ref|XP_006441988.1| hypothetical protein CICLE_v10019310mg [Citrus clementina]
 gb|ESR55227.1| hypothetical protein CICLE_v10019310mg [Citrus clementina]
 gb|ESR55228.1| hypothetical protein CICLE_v10019310mg [Citrus clementina]
Length=626

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 63/128 (49%), Gaps = 10/128 (8%)
 Frame = +2

Query  257  KGTYLVENQDLNLVAEDN-NMREPHCCGMEV---ETGISGMSGQNFVSDSENGEGSNGNV  424
            K  + V   D N+  ED  +  EP C  ME    ETG        F S  E  EGSN  V
Sbjct  3    KERFFVSKND-NMYLEDGIDHEEPFCAEMEADENETGTPANEVHGFTS--EGSEGSN--V  57

Query  425  VFSGQTPHVGKDFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGR  604
            VFS + P + K+ R   G C    K  K R+  +       EK G EKKLSK +R+ELG+
Sbjct  58   VFSREAPLISKESRISSG-CSCSAKNLKSRRIIATDSDFATEKIGHEKKLSKSERVELGK  116

Query  605  SFQDAVTS  628
             FQ A++S
Sbjct  117  MFQSAMSS  124



>ref|XP_006478490.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like [Citrus sinensis]
Length=626

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 63/128 (49%), Gaps = 10/128 (8%)
 Frame = +2

Query  257  KGTYLVENQDLNLVAEDN-NMREPHCCGMEV---ETGISGMSGQNFVSDSENGEGSNGNV  424
            K  + V   D N+  ED  +  EP C  ME    ETG        F S  E  EGSN  V
Sbjct  3    KERFFVSKND-NMYLEDGIDHEEPFCAEMEADENETGTPANEVHGFTS--EGSEGSN--V  57

Query  425  VFSGQTPHVGKDFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGR  604
            VFS + P + K+ R   G C    K  K R+  +       EK G EKKLSK +R+ELG+
Sbjct  58   VFSREAPLISKESRISSG-CSCSAKNLKSRRIIATDSDFATEKIGHEKKLSKSERVELGK  116

Query  605  SFQDAVTS  628
             FQ A++S
Sbjct  117  MFQSAMSS  124



>gb|KEH32772.1| F-box/ankyrin repeat SKIP35-like protein [Medicago truncatula]
Length=600

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 46/79 (58%), Gaps = 2/79 (3%)
 Frame = +2

Query  392  SENGEGSNGNVVFSGQTPHVGKDFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKK  571
            SE GE  N +VVFS +TP + KD            KK K R A +D E G ++    EKK
Sbjct  22   SEKGE--NSSVVFSRETPLMRKDSTMSSSLHCCNTKKLKSRAATTDHELGSSDNILLEKK  79

Query  572  LSKQDRIELGRSFQDAVTS  628
            L +QDRIELGRS Q AV+S
Sbjct  80   LCRQDRIELGRSLQGAVSS  98



>ref|XP_007026464.1| Ankyrin repeat family protein isoform 2 [Theobroma cacao]
 gb|EOY06966.1| Ankyrin repeat family protein isoform 2 [Theobroma cacao]
Length=597

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 63/116 (54%), Gaps = 9/116 (8%)
 Frame = +2

Query  293  LVAEDN-NMREPHCCGM---EVETGISGMSGQNFVSDSENGEGSNGNVVFSGQTPHVGKD  460
            +V  DN ++ EP   GM   E E G      Q F    E GEGS+  VVFS + P V K+
Sbjct  8    VVGSDNMHLEEPWFTGMDNEETEMGQPNSEVQGFAL--EKGEGSS--VVFSREAPLVNKE  63

Query  461  FRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGRSFQDAVTS  628
                G      +KK K R A  + E    EKSG +KKLS+QDRIELG+ FQ AV+S
Sbjct  64   STTSGSC-SCSLKKLKSRVAAKESELCPKEKSGHDKKLSRQDRIELGQLFQGAVSS  118



>ref|XP_007026463.1| Ankyrin repeat family protein isoform 1 [Theobroma cacao]
 gb|EOY06965.1| Ankyrin repeat family protein isoform 1 [Theobroma cacao]
Length=620

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 63/116 (54%), Gaps = 9/116 (8%)
 Frame = +2

Query  293  LVAEDN-NMREPHCCGM---EVETGISGMSGQNFVSDSENGEGSNGNVVFSGQTPHVGKD  460
            +V  DN ++ EP   GM   E E G      Q F    E GEGS+  VVFS + P V K+
Sbjct  8    VVGSDNMHLEEPWFTGMDNEETEMGQPNSEVQGFAL--EKGEGSS--VVFSREAPLVNKE  63

Query  461  FRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGRSFQDAVTS  628
                G      +KK K R A  + E    EKSG +KKLS+QDRIELG+ FQ AV+S
Sbjct  64   STTSGSC-SCSLKKLKSRVAAKESELCPKEKSGHDKKLSRQDRIELGQLFQGAVSS  118



>ref|XP_004499381.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like [Cicer arietinum]
Length=611

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 47/83 (57%), Gaps = 5/83 (6%)
 Frame = +2

Query  380  FVSDSENGEGSNGNVVFSGQTPHVGKDFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSG  559
            F SD    +G N  VVFS +TP +  + R     C +  KK K R A  D E G +EK  
Sbjct  31   FASD----KGENSGVVFSRETPFIRTESRMSTHHCCNA-KKLKSRAATIDCELGSSEKVV  85

Query  560  QEKKLSKQDRIELGRSFQDAVTS  628
             +KKL +QDRIELGR  Q AV+S
Sbjct  86   LDKKLCRQDRIELGRLLQGAVSS  108



>ref|XP_010469258.1| PREDICTED: ankyrin repeat protein SKIP35 [Camelina sativa]
Length=612

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 64/119 (54%), Gaps = 22/119 (18%)
 Frame = +2

Query  305  DNNMR--------EPHCCGMEVETGISGMSGQNFVSDSENGEGSNGNVVFSGQTPHVGKD  460
            DNN++        EP C  ++ ET     S Q +    E GEGSN  V FS + P +GKD
Sbjct  8    DNNIKLCDQMYPDEPFCSEVKTETI---ASSQKY----EGGEGSN--VFFSREAPLIGKD  58

Query  461  FRGP--GGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGRSFQDAVTSM  631
              G   G  C    KK  F+  N D    +N   GQ+KKL++Q+RIELGR FQ AVTS+
Sbjct  59   PAGTNSGECCGCSAKKLNFK-GNDDLVEVEN--IGQQKKLNRQERIELGRLFQGAVTSL  114



>ref|XP_009390785.1| PREDICTED: ankyrin repeat protein SKIP35-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009390786.1| PREDICTED: ankyrin repeat protein SKIP35-like [Musa acuminata 
subsp. malaccensis]
Length=627

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 67/125 (54%), Gaps = 10/125 (8%)
 Frame = +2

Query  269  LVENQDLNLVAEDNNMREPHCCGMEVETG--ISGMSGQNFVSDSENGEGSNGNVVFSGQT  442
            +VE  DL  + +DN   +  C  ME++    +S M+  + V  SE GEGS   VVFS + 
Sbjct  1    MVEEMDLVHLVKDNQAEDVLCSEMEIDENDVLSCMNDHHNVG-SEKGEGST--VVFSREA  57

Query  443  PHVGKD-FRGPGGPCISGVKKHKFRQA--NSDPEPGKNEKSGQEKKLSKQDRIELGRSFQ  613
            P + KD        C  G KK + R +    + E    +K  QEKKLS+QDRIELGR FQ
Sbjct  58   PLLTKDALISKDYGC--GSKKIRSRASVLMEESEVRSKDKWKQEKKLSRQDRIELGRLFQ  115

Query  614  DAVTS  628
              V+S
Sbjct  116  RVVSS  120



>ref|XP_002878304.1| hypothetical protein ARALYDRAFT_486455 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54563.1| hypothetical protein ARALYDRAFT_486455 [Arabidopsis lyrata subsp. 
lyrata]
Length=611

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 56/106 (53%), Gaps = 14/106 (13%)
 Frame = +2

Query  320  EPHCCGMEVETGISGMSGQNFVSDSENGEGSNGNVVFSGQTPHVGKDFRGP--GGPCISG  493
            EP C  M+ ET  S          +E GEGSN  VVFS + P +GKD  G   G  C   
Sbjct  20   EPFCSEMKTETIASS-------QKTEGGEGSN--VVFSREAPLIGKDPAGTNSGECCGCS  70

Query  494  VKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGRSFQDAVTSM  631
              K  F++ +   E    E   Q KKL++Q+RIELGR FQ AVTS+
Sbjct  71   ANKLNFKENDDLIE---KENIEQLKKLNRQERIELGRLFQGAVTSL  113



>ref|XP_010413621.1| PREDICTED: ankyrin repeat protein SKIP35-like [Camelina sativa]
Length=600

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 50/81 (62%), Gaps = 7/81 (9%)
 Frame = +2

Query  395  ENGEGSNGNVVFSGQTPHVGKDFRGP--GGPCISGVKKHKFRQANSDPEPGKNEKSGQEK  568
            E GEGSN  VVFS + P +GKD  G   G  C    KK  F+  N D    +N   GQ+K
Sbjct  29   EGGEGSN--VVFSREAPLIGKDPAGTNSGECCGCSAKKLNFK-GNDDLVEVEN--IGQQK  83

Query  569  KLSKQDRIELGRSFQDAVTSM  631
            KL++Q+RIELGR FQ AVTS+
Sbjct  84   KLNRQERIELGRLFQGAVTSL  104



>emb|CDY05963.1| BnaA09g38170D [Brassica napus]
Length=604

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 50/84 (60%), Gaps = 12/84 (14%)
 Frame = +2

Query  395  ENGEGSNGNVVFSGQTPHVGKDFRGPGGP-----CISGVKKHKFRQANSDPEPGKNEKSG  559
            E GEG++ NVVFS + P +GKD   P G      C    KK  F+ +    +    E + 
Sbjct  30   EEGEGAS-NVVFSREAPLIGKD---PAGTNSNECCGCSAKKLNFKGSEDLID---KENNS  82

Query  560  QEKKLSKQDRIELGRSFQDAVTSM  631
            Q+KKLS+Q+RIELGR FQ AVTSM
Sbjct  83   QQKKLSRQERIELGRVFQGAVTSM  106



>ref|XP_010672531.1| PREDICTED: ankyrin repeat protein SKIP35-like [Beta vulgaris 
subsp. vulgaris]
Length=622

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 65/131 (50%), Gaps = 14/131 (11%)
 Frame = +2

Query  245  MEEDKGTYLVENQDLNLVAEDNNMREPHCCGMEVETGISGMSGQNFVSDS---ENGEGSN  415
            ME D G      + L L  E+ +  +  C   E+E   SG     F  +S   E GEGSN
Sbjct  1    MENDVG-----RERLRLKVENKDEEQIPC---EMEIDYSGTGSPKFEIESKFTELGEGSN  52

Query  416  GNVVFSGQTPHVGKDFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIE  595
              VVF+ + P   +D  G       G KK K +      + GK   +G EKKLS+QDR+E
Sbjct  53   --VVFAREGPLYIED-SGISKVGCCGAKKQKLKVVTMSSQVGKKGNAGNEKKLSRQDRME  109

Query  596  LGRSFQDAVTS  628
            LG+ FQ AV+S
Sbjct  110  LGKVFQSAVSS  120



>gb|KHG16914.1| F-box/ankyrin repeat SKIP35 -like protein [Gossypium arboreum]
Length=620

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 59/113 (52%), Gaps = 8/113 (7%)
 Frame = +2

Query  299  AEDNNMREPHCCGM---EVETGISGMSGQNFVSDSENGEGSNGNVVFSGQTPHVGKDFRG  469
            +E  ++ EP   GM   E E G      Q F    E GE SN  +VFS + P V K+   
Sbjct  11   SESMHLEEPWFTGMDTEETEMGQPNSEIQGF--RLEKGEASN--MVFSTEAPLVIKE-SP  65

Query  470  PGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGRSFQDAVTS  628
              G C   +KK K   A    E  + +KSG +KKLS+Q RIELG+ FQ AV+S
Sbjct  66   TSGSCSCSLKKIKSTVAPKGSEFCQKDKSGHDKKLSRQYRIELGQLFQGAVSS  118



>ref|XP_009116666.1| PREDICTED: ankyrin repeat protein SKIP35 [Brassica rapa]
Length=604

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 45/79 (57%), Gaps = 2/79 (3%)
 Frame = +2

Query  395  ENGEGSNGNVVFSGQTPHVGKDFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKL  574
            E GEG++ NVVFS + P +GKD  G       G    K     S+    K   S Q KKL
Sbjct  30   EEGEGAS-NVVFSREAPLIGKDPAGTNSNECCGCSAKKLNFKGSEDLIDKENNSPQ-KKL  87

Query  575  SKQDRIELGRSFQDAVTSM  631
            S+Q+RIELGR FQ AVTSM
Sbjct  88   SRQERIELGRVFQGAVTSM  106



>ref|XP_010512283.1| PREDICTED: ankyrin repeat protein SKIP35-like [Camelina sativa]
Length=606

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 53/104 (51%), Gaps = 17/104 (16%)
 Frame = +2

Query  320  EPHCCGMEVETGISGMSGQNFVSDSENGEGSNGNVVFSGQTPHVGKDFRGPGGPCISGVK  499
            EP C  ++ ET  S        S    G G   NVVFS + P +G+        C    K
Sbjct  22   EPFCSEVKTETIAS--------SQKHEGGGEGSNVVFSREAPLIGE-------CCGCSAK  66

Query  500  KHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGRSFQDAVTSM  631
            K  F+   +D    + E  GQ+KKL++Q+RIELGR FQ AVTS+
Sbjct  67   KLNFK--GNDDHLVEVENIGQQKKLNRQERIELGRLFQGAVTSL  108



>gb|AJF94393.1| F-box/ankyrin repeat protein SKIP35 [Gossypium hirsutum]
Length=620

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 59/113 (52%), Gaps = 8/113 (7%)
 Frame = +2

Query  299  AEDNNMREPHCCGM---EVETGISGMSGQNFVSDSENGEGSNGNVVFSGQTPHVGKDFRG  469
            +E+ ++ EP   GM   E E G      Q F    E GE SN  +VFS + P V K+   
Sbjct  11   SENMHLEEPWFTGMDTEETEMGQPNSEIQGF--RLERGEASN--MVFSTEAPLVIKE-SP  65

Query  470  PGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGRSFQDAVTS  628
              G C   +KK K   A    E  + +KSG +KKLS+Q RIELG+ FQ  V+S
Sbjct  66   TSGSCSCSLKKIKSTVAPKGSEFCQKDKSGHDKKLSRQYRIELGQLFQGTVSS  118



>ref|XP_006290752.1| hypothetical protein CARUB_v10016852mg [Capsella rubella]
 ref|XP_006290753.1| hypothetical protein CARUB_v10016852mg [Capsella rubella]
 gb|EOA23650.1| hypothetical protein CARUB_v10016852mg [Capsella rubella]
 gb|EOA23651.1| hypothetical protein CARUB_v10016852mg [Capsella rubella]
Length=615

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 64/122 (52%), Gaps = 20/122 (16%)
 Frame = +2

Query  296  VAEDNNMR--------EPHCCGMEVETGISGMSGQNFVSDSENGEGSNGNVVFSGQTPHV  451
            V E++N++        EP C  ++ ET     S Q +    E GEGSN  VVF    P +
Sbjct  6    VCEEDNIKLSDQMYPDEPFCSEVKTETI---ASSQRY----EGGEGSN--VVFPRDAPLI  56

Query  452  GKDFRGP--GGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGRSFQDAVT  625
            G D  G   G  C    KK  F+ ++ D    +N    Q+KKL++Q+RIELGR FQ AVT
Sbjct  57   GNDPAGTNSGECCGCSAKKLHFKGSD-DLVEIENIGQQQQKKLNRQERIELGRLFQGAVT  115

Query  626  SM  631
            S+
Sbjct  116  SL  117



>ref|XP_008445478.1| PREDICTED: ankyrin repeat protein SKIP35-like [Cucumis melo]
 ref|XP_008445479.1| PREDICTED: ankyrin repeat protein SKIP35-like [Cucumis melo]
Length=623

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 55/100 (55%), Gaps = 6/100 (6%)
 Frame = +2

Query  338  MEVETG---ISGMSGQNFVSDSENGEGSNGNVVFSGQTPHVGKDFRGPGGPCISGVKKHK  508
            ME++T    I    G  +   SE GEGS+  VVFS + P V K+     G C S  +  K
Sbjct  25   MEIKTEENEIDIQKGDVYAPASEKGEGSS--VVFSREGPLVKKESVLAHG-CNSNEQSPK  81

Query  509  FRQANSDPEPGKNEKSGQEKKLSKQDRIELGRSFQDAVTS  628
                 +D + GK  KS  EKKLS+QDR ELGR FQ AV+S
Sbjct  82   SMLMVTDHKQGKKGKSCHEKKLSRQDRFELGRLFQGAVSS  121



>ref|XP_004144185.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like [Cucumis 
sativus]
 ref|XP_004158248.1| PREDICTED: F-box/ankyrin repeat protein SKIP35-like [Cucumis 
sativus]
 gb|KGN47633.1| hypothetical protein Csa_6G366310 [Cucumis sativus]
Length=623

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 55/100 (55%), Gaps = 6/100 (6%)
 Frame = +2

Query  338  MEVETG---ISGMSGQNFVSDSENGEGSNGNVVFSGQTPHVGKDFRGPGGPCISGVKKHK  508
            ME++T    I    G  +   SE GEGS+  VVFS + P V K+     G C S  +  K
Sbjct  25   MEIKTEENEIDIQKGDVYAPASEKGEGSS--VVFSREGPLVKKESVLAHG-CNSNEQSPK  81

Query  509  FRQANSDPEPGKNEKSGQEKKLSKQDRIELGRSFQDAVTS  628
                 +D + GK  KS  EKKLS+QDR ELGR FQ AV+S
Sbjct  82   SMLMVTDHKQGKKGKSCHEKKLSRQDRFELGRLFQGAVSS  121



>ref|XP_010912734.1| PREDICTED: ankyrin repeat protein SKIP35-like [Elaeis guineensis]
Length=635

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 38/84 (45%), Positives = 50/84 (60%), Gaps = 10/84 (12%)
 Frame = +2

Query  392  SENGEGSNGNVVFSGQTPHVGKDFR-GPGGPCISGVKKHKFRQAN----SDPEPGKNEKS  556
            +E GEGSN   VFS + P   KD R   G  C  G KK + R ++    ++      +K+
Sbjct  52   AEKGEGSN---VFSREAPLRAKDPRVTRGHSC--GTKKLRSRASDLVEETEARRKDKDKN  106

Query  557  GQEKKLSKQDRIELGRSFQDAVTS  628
             QE+KLS+QDRIELGR FQ AV+S
Sbjct  107  KQERKLSRQDRIELGRLFQAAVSS  130



>ref|XP_010930324.1| PREDICTED: ankyrin repeat protein SKIP35 [Elaeis guineensis]
 ref|XP_010930325.1| PREDICTED: ankyrin repeat protein SKIP35 [Elaeis guineensis]
Length=637

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 43/117 (37%), Positives = 63/117 (54%), Gaps = 10/117 (9%)
 Frame = +2

Query  296  VAEDNNMREPHCCGMEVET--GISGMSGQNFVSDSENGEGSNGNVVFSGQTPHVGKDFRG  469
            +A++ +  +  C  ME++   G+  +   +     + GEGSN   VFS + P   KD RG
Sbjct  18   LAKERHSEDRLCSEMEMDEKGGLGSLDDGSESLVPDKGEGSN---VFSREAPLRAKDPRG  74

Query  470  PGGPCISGVKKHKFRQANSDPEP----GKNEKSGQEKKLSKQDRIELGRSFQDAVTS  628
                  S  KK + R ++S  E        +K+ QE+KLS+QDRIELGR FQ AV+S
Sbjct  75   TRSYGCSN-KKLRSRASDSMEESEARRKDKDKNKQERKLSRQDRIELGRLFQGAVSS  130



>ref|XP_008781953.1| PREDICTED: ankyrin repeat protein SKIP35-like [Phoenix dactylifera]
Length=635

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 42/118 (36%), Positives = 61/118 (52%), Gaps = 12/118 (10%)
 Frame = +2

Query  296  VAEDNNMREPHCCGMEVET--GISGMSGQNFVSDSENGEGSNGNVVFSGQTPHVGKDFR-  466
            + ++ +  +P C  +E++   G+  +         E GEGSN   VFS + P   KD R 
Sbjct  18   LTKERHSEDPLCPEIEMDENGGLGSLEDPGEPLSPEKGEGSN---VFSREAPLRAKDPRV  74

Query  467  GPGGPCISGVKKHKFRQANSDPEP----GKNEKSGQEKKLSKQDRIELGRSFQDAVTS  628
              G  C  G K  + R ++S  E        +K+ QE+KL +QDRIELGR FQ AV+S
Sbjct  75   TRGHSC--GTKMLRSRASDSVEETEVRRKDKDKNKQERKLCRQDRIELGRLFQGAVSS  130



>ref|XP_008243090.1| PREDICTED: ankyrin repeat protein SKIP35-like [Prunus mume]
Length=626

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 62/120 (52%), Gaps = 18/120 (15%)
 Frame = +2

Query  293  LVAEDNNMREPHCCGMEVE--------TGISGMSGQNFVSDSENGEGSNGNVVFSGQTPH  448
            +V  + N  +P    ME E         G+ G++       S+ GEGSN  VVFS + P 
Sbjct  15   IVVNETNSEDPTYIEMEAEESGIDCPNNGVQGLA-------SDKGEGSN--VVFSREGPL  65

Query  449  VGKDFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGRSFQDAVTS  628
            V K+ R     C    KK K R A  D    K EK  QEKKLS+QDRIELGR FQ AV+S
Sbjct  66   VRKESRMSTN-CSCSAKKLKSRAAVVDSNLEKKEKIEQEKKLSRQDRIELGRLFQGAVSS  124



>ref|XP_009404281.1| PREDICTED: ankyrin repeat protein SKIP35-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009404282.1| PREDICTED: ankyrin repeat protein SKIP35-like [Musa acuminata 
subsp. malaccensis]
Length=628

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 66/129 (51%), Gaps = 8/129 (6%)
 Frame = +2

Query  245  MEEDKGTYLVENQDLNLVAEDNNMREPHCCGMEV-ETGISGMSGQNFVSDSENGEGSNGN  421
            ME +K   +V+  D   + +D    +  C  + + E G+      N   + E GEGSN  
Sbjct  1    MESEKKILMVDENDRGDLVKDCKPEDILCSEIVMDENGVLWYVDGNDGFEGEKGEGSN--  58

Query  422  VVFSGQTPHVGKDFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELG  601
            VVF+ + P   KD   P          +KFR   S  E  + +K+ QEKKLS++DRIELG
Sbjct  59   VVFAREAPLSTKD---PLTSKDYSCGTNKFRLMES--EIRRKDKNKQEKKLSRKDRIELG  113

Query  602  RSFQDAVTS  628
            R FQ A++S
Sbjct  114  RLFQGALSS  122



>gb|EPS60182.1| hypothetical protein M569_14622 [Genlisea aurea]
Length=606

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 54/110 (49%), Gaps = 22/110 (20%)
 Frame = +2

Query  338  MEVETGISGMSGQNFVSDSENG------------EGSNGNVVFSGQ-TPHVGKDFRGPGG  478
            MEVE   S     + ++ +ENG            E   GN VF G+  P +  +      
Sbjct  1    MEVEASES----DSLITSNENGDEVAVFGTEKVEEEEQGNPVFKGEEAPLMSNEAELGLN  56

Query  479  PCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGRSFQDAVTS  628
            PC    +K K R A S+ E GKN +     KLS+QDRIELGR FQ AV+S
Sbjct  57   PCHCSAEKLKSRLAASEFEAGKNSR-----KLSRQDRIELGRLFQGAVSS  101



>gb|KJB11213.1| hypothetical protein B456_001G247600 [Gossypium raimondii]
 gb|KJB11214.1| hypothetical protein B456_001G247600 [Gossypium raimondii]
Length=620

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 59/113 (52%), Gaps = 8/113 (7%)
 Frame = +2

Query  299  AEDNNMREPHCCGM---EVETGISGMSGQNFVSDSENGEGSNGNVVFSGQTPHVGKDFRG  469
            +E+ ++ EP   GM   E E G      Q F    E GE SN  +VFS + P V K+   
Sbjct  11   SENMHLEEPWFTGMDTEETEMGQPNSEIQGF--RLEKGEASN--MVFSTEAPLVIKESST  66

Query  470  PGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGRSFQDAVTS  628
             G      +KK K   A    E  + +KSG +KKLS+Q RIELG+ FQ AV+S
Sbjct  67   SGSC-SCSLKKIKSTVAAKGSEFCQKDKSGHDKKLSRQYRIELGQLFQGAVSS  118



>ref|XP_010524207.1| PREDICTED: ankyrin repeat protein SKIP35 [Tarenaya hassleriana]
Length=616

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 57/108 (53%), Gaps = 17/108 (16%)
 Frame = +2

Query  320  EPHCCGMEVETGISGMSGQNFVSD--SENGEGSNGNVVFSGQTPHVGK-DFRGP--GGPC  484
            EP C  ME E   +  S +N + D  SE GEGS+  VVFS + P +G  D  G   G  C
Sbjct  20   EPFCSEMETEES-AAESPKNELPDFSSEGGEGSD--VVFSREAPLIGHHDSAGTNSGECC  76

Query  485  ISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGRSFQDAVTS  628
                KK KFR   +  E         +KKL++ DRIELGR FQ AV+S
Sbjct  77   GCSAKKLKFRTKGNLRE---------DKKLNRHDRIELGRLFQGAVSS  115



>ref|XP_007203611.1| hypothetical protein PRUPE_ppa002867mg [Prunus persica]
 gb|EMJ04810.1| hypothetical protein PRUPE_ppa002867mg [Prunus persica]
Length=626

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 62/120 (52%), Gaps = 18/120 (15%)
 Frame = +2

Query  293  LVAEDNNMREPHCCGMEVE--------TGISGMSGQNFVSDSENGEGSNGNVVFSGQTPH  448
            +V  + N  +P    ME E         G+ G++       S+ GEGSN  VVFS + P 
Sbjct  15   IVVNETNSEDPTYIEMEAEESGIDCPNNGVQGLA-------SDKGEGSN--VVFSREGPL  65

Query  449  VGKDFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGRSFQDAVTS  628
            V K+ R     C    KK K + A  D    K EK  QEKKLS+QDRIELGR FQ AV+S
Sbjct  66   VRKESRMSTN-CSCSAKKLKSQAAVVDSNLEKKEKIEQEKKLSRQDRIELGRLFQGAVSS  124



>ref|XP_008801302.1| PREDICTED: ankyrin repeat protein SKIP35 [Phoenix dactylifera]
Length=637

 Score = 49.7 bits (117),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 42/124 (34%), Positives = 64/124 (52%), Gaps = 24/124 (19%)
 Frame = +2

Query  296  VAEDNNMREPHCCGMEVETGISGMSGQNFVSDS---ENGEGSNGNVVFSGQTPHVGKDFR  466
            +A++ ++ +  C  ME++    G+   +  S+S   + GEGSN   VFS + P   KD R
Sbjct  18   LAKERHLEDRLCSEMEMDEK-GGLGSLDDGSESLVPDKGEGSN---VFSREAPLRAKDPR  73

Query  467  ----------GPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIELGRSFQD  616
                        G      V++ + R+ + D       K+ QE+KLS+QDRIELGR FQ 
Sbjct  74   DMRSYGCSAKNLGSRASDSVEESEARRKDKD-------KNKQERKLSRQDRIELGRLFQA  126

Query  617  AVTS  628
            AV+S
Sbjct  127  AVSS  130



>ref|XP_009379908.1| PREDICTED: ankyrin repeat protein SKIP35-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009379909.1| PREDICTED: ankyrin repeat protein SKIP35-like [Musa acuminata 
subsp. malaccensis]
Length=627

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 67/131 (51%), Gaps = 6/131 (5%)
 Frame = +2

Query  245  MEEDKGTYLVENQDLNLVAEDNNMREPHCCGMEV---ETGISGMSGQNFVSDSENGEGSN  415
            ME +     V+ +D   + +++   +  C  ME+   E G+ G +  +   + E GE SN
Sbjct  1    MEGENTIVTVDEKDHVHLVKESQPEDILCPEMEMDENENGVIGCADGSAGFEGEMGEESN  60

Query  416  GNVVFSGQTPHVGKDFRGPGGPCISGVKKHKFRQANSDPEPGKNEKSGQEKKLSKQDRIE  595
              V+FS + P + K      G C  G K         + E  + +K+ QEKKLS+Q+RIE
Sbjct  61   --VIFSREAPILTKGSLISKGHC-CGSKVRSKSSELMESEIQRKDKNKQEKKLSRQERIE  117

Query  596  LGRSFQDAVTS  628
            LGR FQ AV+S
Sbjct  118  LGRLFQGAVSS  128



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 920235338500