BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS028G05

Length=639
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004230310.1|  PREDICTED: uncharacterized protein LOC101249681    317   8e-98   
ref|XP_006344767.1|  PREDICTED: uncharacterized protein LOC102580046    317   8e-98   Solanum tuberosum [potatoes]
ref|XP_009616023.1|  PREDICTED: uncharacterized protein LOC104108647    315   3e-97   Nicotiana tomentosiformis
ref|XP_009783972.1|  PREDICTED: uncharacterized protein LOC104232454    311   9e-96   Nicotiana sylvestris
ref|XP_007208429.1|  hypothetical protein PRUPE_ppa000798mg             303   2e-92   Prunus persica
gb|KHG26707.1|  Efr3b                                                   303   3e-92   Gossypium arboreum [tree cotton]
ref|XP_007031156.1|  Uncharacterized protein isoform 2                  302   3e-92   
gb|KHG26706.1|  Protein EFR3 B                                          303   3e-92   Gossypium arboreum [tree cotton]
ref|XP_007031155.1|  Uncharacterized protein isoform 1                  302   3e-92   
ref|XP_008246002.1|  PREDICTED: uncharacterized protein LOC103344152    301   4e-92   Prunus mume [ume]
gb|KJB45453.1|  hypothetical protein B456_007G306600                    300   1e-91   Gossypium raimondii
ref|XP_002318950.2|  hypothetical protein POPTR_0013s00990g             297   2e-90   
gb|KJB81105.1|  hypothetical protein B456_013G129500                    295   2e-90   Gossypium raimondii
emb|CDP18254.1|  unnamed protein product                                298   2e-90   Coffea canephora [robusta coffee]
gb|KJB81106.1|  hypothetical protein B456_013G129500                    295   2e-90   Gossypium raimondii
ref|XP_011466140.1|  PREDICTED: uncharacterized protein LOC101313...    297   3e-90   Fragaria vesca subsp. vesca
ref|XP_004302237.1|  PREDICTED: uncharacterized protein LOC101313...    296   3e-90   Fragaria vesca subsp. vesca
gb|KHG02153.1|  Protein EFR3                                            295   7e-90   Gossypium arboreum [tree cotton]
gb|KJB81104.1|  hypothetical protein B456_013G129500                    295   8e-90   Gossypium raimondii
gb|EYU40497.1|  hypothetical protein MIMGU_mgv1a000785mg                295   1e-89   Erythranthe guttata [common monkey flower]
ref|XP_009373286.1|  PREDICTED: uncharacterized protein LOC103962316    293   4e-89   Pyrus x bretschneideri [bai li]
ref|XP_008370375.1|  PREDICTED: uncharacterized protein LOC103433867    293   5e-89   Malus domestica [apple tree]
ref|XP_011023781.1|  PREDICTED: uncharacterized protein LOC105125162    292   1e-88   Populus euphratica
ref|XP_011092150.1|  PREDICTED: uncharacterized protein LOC105172430    291   3e-88   Sesamum indicum [beniseed]
ref|XP_010546763.1|  PREDICTED: uncharacterized protein LOC104818746    291   3e-88   Tarenaya hassleriana [spider flower]
ref|XP_006394915.1|  hypothetical protein EUTSA_v10003593mg             290   1e-87   Eutrema salsugineum [saltwater cress]
ref|XP_006394914.1|  hypothetical protein EUTSA_v10003593mg             289   1e-87   Eutrema salsugineum [saltwater cress]
gb|KDP23388.1|  hypothetical protein JCGZ_23221                         289   2e-87   Jatropha curcas
gb|AAB61061.1|  Hypothetical protein F2P16.24                           288   2e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008359849.1|  PREDICTED: uncharacterized protein LOC103423542    288   4e-87   
dbj|BAC41892.1|  unknown protein                                        288   4e-87   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198037.3|  uncharacterized protein                               288   5e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872241.1|  hypothetical protein ARALYDRAFT_489516             288   5e-87   
emb|CAN82509.1|  hypothetical protein VITISV_012725                     290   2e-86   Vitis vinifera
ref|XP_002512512.1|  conserved hypothetical protein                     285   3e-86   
ref|XP_010455044.1|  PREDICTED: uncharacterized protein LOC104736707    283   2e-85   Camelina sativa [gold-of-pleasure]
ref|XP_010493942.1|  PREDICTED: protein EFR3 homolog B-like isofo...    282   6e-85   Camelina sativa [gold-of-pleasure]
ref|XP_010421542.1|  PREDICTED: uncharacterized protein LOC104706...    282   6e-85   Camelina sativa [gold-of-pleasure]
gb|KEH43106.1|  cyclin-like protein                                     282   8e-85   Medicago truncatula
ref|XP_002282109.1|  PREDICTED: uncharacterized protein LOC100264846    281   1e-84   Vitis vinifera
emb|CDX87029.1|  BnaC09g03440D                                          280   4e-84   
ref|XP_010024133.1|  PREDICTED: uncharacterized protein LOC104414673    279   1e-83   Eucalyptus grandis [rose gum]
ref|XP_009111721.1|  PREDICTED: protein EFR3 homolog B-like             278   1e-83   Brassica rapa
ref|XP_006433539.1|  hypothetical protein CICLE_v10000144mg             278   2e-83   Citrus clementina [clementine]
ref|XP_010493940.1|  PREDICTED: protein EFR3 homolog B-like isofo...    277   4e-83   Camelina sativa [gold-of-pleasure]
ref|XP_004495652.1|  PREDICTED: uncharacterized protein LOC101508...    277   4e-83   
emb|CDY19753.1|  BnaA09g04060D                                          276   1e-82   Brassica napus [oilseed rape]
ref|XP_010267985.1|  PREDICTED: uncharacterized protein LOC104605...    275   2e-82   Nelumbo nucifera [Indian lotus]
gb|KHN23227.1|  Protein EFR3 like cmp44E                                274   2e-82   Glycine soja [wild soybean]
ref|XP_010267987.1|  PREDICTED: uncharacterized protein LOC104605...    275   2e-82   Nelumbo nucifera [Indian lotus]
ref|XP_006472204.1|  PREDICTED: uncharacterized protein LOC102623618    275   4e-82   Citrus sinensis [apfelsine]
ref|XP_003536043.1|  PREDICTED: uncharacterized protein LOC100785...    274   4e-82   Glycine max [soybeans]
ref|XP_006589118.1|  PREDICTED: uncharacterized protein LOC100785...    274   4e-82   
ref|XP_003555181.1|  PREDICTED: uncharacterized protein LOC100788290    274   5e-82   
ref|XP_010674649.1|  PREDICTED: protein EFR3 homolog A                  268   5e-80   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007145003.1|  hypothetical protein PHAVU_007G201500g             267   2e-79   Phaseolus vulgaris [French bean]
ref|XP_010092978.1|  hypothetical protein L484_018915                   265   1e-78   
ref|XP_006840435.1|  hypothetical protein AMTR_s00045p00164850          263   8e-78   Amborella trichopoda
ref|XP_008453377.1|  PREDICTED: uncharacterized protein LOC103494111    262   9e-78   Cucumis melo [Oriental melon]
ref|XP_009384434.1|  PREDICTED: uncharacterized protein LOC103971...    261   3e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009384437.1|  PREDICTED: uncharacterized protein LOC103971...    261   3e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004144747.1|  PREDICTED: uncharacterized protein LOC101202927    261   3e-77   Cucumis sativus [cucumbers]
ref|XP_008778937.1|  PREDICTED: protein EFR3 homolog cmp44E-like        247   3e-77   
ref|XP_004165925.1|  PREDICTED: uncharacterized LOC101202927            261   3e-77   
ref|XP_008808672.1|  PREDICTED: uncharacterized protein LOC103720...    254   1e-74   Phoenix dactylifera
ref|XP_008808671.1|  PREDICTED: uncharacterized protein LOC103720...    254   1e-74   Phoenix dactylifera
emb|CDX80597.1|  BnaC07g28470D                                          253   2e-74   
ref|XP_010938251.1|  PREDICTED: uncharacterized protein LOC105057...    253   3e-74   Elaeis guineensis
ref|XP_010938250.1|  PREDICTED: uncharacterized protein LOC105057...    252   3e-74   
gb|ABF95548.1|  cyclin, putative, expressed                             248   1e-73   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008781115.1|  PREDICTED: uncharacterized protein LOC103700...    250   2e-73   Phoenix dactylifera
ref|XP_008781114.1|  PREDICTED: protein EFR3 homolog cmp44E-like ...    250   3e-73   
ref|XP_010921489.1|  PREDICTED: uncharacterized protein LOC105045026    249   5e-73   Elaeis guineensis
ref|XP_004984608.1|  PREDICTED: uncharacterized protein LOC101782956    249   5e-73   Setaria italica
ref|XP_006649970.1|  PREDICTED: uncharacterized protein LOC102701065    248   7e-73   Oryza brachyantha
ref|NP_001049903.1|  Os03g0308200                                       247   2e-72   
ref|XP_002465372.1|  hypothetical protein SORBIDRAFT_01g037420          247   3e-72   Sorghum bicolor [broomcorn]
emb|CDX88246.1|  BnaA06g28370D                                          244   2e-71   
ref|XP_009151505.1|  PREDICTED: uncharacterized protein LOC103874824    242   3e-71   
ref|XP_008646153.1|  PREDICTED: uncharacterized protein LOC100384...    244   3e-71   
ref|XP_010228707.1|  PREDICTED: uncharacterized protein LOC100831...    242   2e-70   Brachypodium distachyon [annual false brome]
ref|XP_003558072.1|  PREDICTED: uncharacterized protein LOC100831...    242   2e-70   Brachypodium distachyon [annual false brome]
ref|XP_008646145.1|  PREDICTED: uncharacterized protein LOC100384...    239   1e-69   Zea mays [maize]
ref|XP_010094723.1|  hypothetical protein L484_003597                   229   5e-68   
ref|XP_009765963.1|  PREDICTED: protein EFR3 homolog cmp44E-like        216   8e-67   Nicotiana sylvestris
ref|XP_008798151.1|  PREDICTED: uncharacterized protein LOC103713119    222   2e-63   Phoenix dactylifera
gb|KDO53678.1|  hypothetical protein CISIN_1g0359231mg                  205   9e-63   Citrus sinensis [apfelsine]
ref|XP_009405043.1|  PREDICTED: uncharacterized protein LOC103988214    219   2e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010313082.1|  PREDICTED: uncharacterized protein LOC101250...    219   2e-62   Solanum lycopersicum
ref|XP_010932401.1|  PREDICTED: uncharacterized protein LOC105053...    218   2e-62   
ref|XP_004250744.1|  PREDICTED: uncharacterized protein LOC101250...    219   2e-62   Solanum lycopersicum
ref|XP_006352099.1|  PREDICTED: uncharacterized protein LOC102584...    219   2e-62   Solanum tuberosum [potatoes]
ref|XP_006352098.1|  PREDICTED: uncharacterized protein LOC102584...    219   2e-62   Solanum tuberosum [potatoes]
ref|XP_009393518.1|  PREDICTED: uncharacterized protein LOC103979184    218   4e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003591099.1|  EFR3-like protein                                  203   8e-62   
ref|XP_006858684.1|  hypothetical protein AMTR_s00066p00085830          217   2e-61   Amborella trichopoda
ref|XP_009401306.1|  PREDICTED: uncharacterized protein LOC103985362    217   2e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008784320.1|  PREDICTED: uncharacterized protein LOC103703...    216   4e-61   Phoenix dactylifera
ref|XP_008784321.1|  PREDICTED: uncharacterized protein LOC103703...    216   4e-61   Phoenix dactylifera
ref|XP_006838291.1|  hypothetical protein AMTR_s00103p00108190          216   4e-61   Amborella trichopoda
ref|XP_008784316.1|  PREDICTED: protein EFR3 homolog isoform X1         216   4e-61   
ref|XP_011457274.1|  PREDICTED: uncharacterized protein LOC101313...    215   6e-61   Fragaria vesca subsp. vesca
ref|XP_004309822.1|  PREDICTED: uncharacterized protein LOC101313...    215   8e-61   Fragaria vesca subsp. vesca
ref|XP_009625867.1|  PREDICTED: protein EFR3 homolog isoform X2         214   8e-61   Nicotiana tomentosiformis
ref|XP_009625862.1|  PREDICTED: protein EFR3 homolog isoform X1         214   1e-60   
emb|CDP16550.1|  unnamed protein product                                213   3e-60   Coffea canephora [robusta coffee]
ref|XP_002264735.1|  PREDICTED: uncharacterized protein LOC100264...    213   3e-60   Vitis vinifera
ref|XP_009355500.1|  PREDICTED: uncharacterized protein LOC103946512    213   5e-60   Pyrus x bretschneideri [bai li]
ref|XP_011078902.1|  PREDICTED: uncharacterized protein LOC105162543    213   5e-60   Sesamum indicum [beniseed]
ref|XP_009626575.1|  PREDICTED: protein EFR3 homolog B-like             198   6e-60   Nicotiana tomentosiformis
dbj|BAK01387.1|  predicted protein                                      213   8e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006443048.1|  hypothetical protein CICLE_v100186802mg            197   8e-60   
ref|XP_010241226.1|  PREDICTED: uncharacterized protein LOC104585...    212   9e-60   Nelumbo nucifera [Indian lotus]
ref|XP_009391228.1|  PREDICTED: uncharacterized protein LOC103977445    212   9e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008231409.1|  PREDICTED: uncharacterized protein LOC103330592    212   1e-59   Prunus mume [ume]
ref|XP_010257180.1|  PREDICTED: uncharacterized protein LOC104597...    212   1e-59   
ref|XP_007218911.1|  hypothetical protein PRUPE_ppa000649mg             212   1e-59   
ref|XP_010257179.1|  PREDICTED: uncharacterized protein LOC104597...    212   1e-59   Nelumbo nucifera [Indian lotus]
gb|EAY92960.1|  hypothetical protein OsI_14753                          200   1e-59   Oryza sativa Indica Group [Indian rice]
ref|XP_007203221.1|  hypothetical protein PRUPE_ppa000725mg             211   2e-59   
gb|EPS68493.1|  hypothetical protein M569_06272                         211   2e-59   Genlisea aurea
ref|XP_004304390.1|  PREDICTED: uncharacterized protein LOC101298629    211   3e-59   Fragaria vesca subsp. vesca
ref|XP_010523667.1|  PREDICTED: protein EFR3 homolog isoform X1         211   3e-59   Tarenaya hassleriana [spider flower]
ref|XP_010523668.1|  PREDICTED: protein EFR3 homolog isoform X2         210   4e-59   Tarenaya hassleriana [spider flower]
ref|XP_006421414.1|  hypothetical protein CICLE_v10006843mg             211   4e-59   
ref|XP_002322714.1|  cyclin-related family protein                      209   8e-59   
ref|XP_002975992.1|  hypothetical protein SELMODRAFT_443103             209   9e-59   
ref|XP_002968494.1|  hypothetical protein SELMODRAFT_90004              208   1e-58   
ref|XP_009379628.1|  PREDICTED: uncharacterized protein LOC103968...    209   1e-58   Pyrus x bretschneideri [bai li]
ref|XP_009379627.1|  PREDICTED: uncharacterized protein LOC103968...    209   1e-58   
gb|KEH23652.1|  cyclin-like protein                                     209   1e-58   Medicago truncatula
ref|XP_004308677.1|  PREDICTED: uncharacterized protein LOC101307642    209   1e-58   Fragaria vesca subsp. vesca
ref|XP_010653791.1|  PREDICTED: uncharacterized protein LOC100255...    208   2e-58   Vitis vinifera
ref|XP_011075240.1|  PREDICTED: uncharacterized protein LOC105159...    209   2e-58   Sesamum indicum [beniseed]
ref|XP_011075238.1|  PREDICTED: uncharacterized protein LOC105159...    209   2e-58   Sesamum indicum [beniseed]
ref|XP_002277870.1|  PREDICTED: uncharacterized protein LOC100255...    209   2e-58   Vitis vinifera
ref|XP_008443197.1|  PREDICTED: uncharacterized protein LOC103486...    208   2e-58   Cucumis melo [Oriental melon]
gb|KCW90195.1|  hypothetical protein EUGRSUZ_A02368                     208   3e-58   Eucalyptus grandis [rose gum]
ref|XP_011033323.1|  PREDICTED: uncharacterized protein LOC105131...    208   3e-58   Populus euphratica
ref|XP_010057214.1|  PREDICTED: uncharacterized protein LOC104445...    208   3e-58   Eucalyptus grandis [rose gum]
ref|XP_006489936.1|  PREDICTED: uncharacterized protein LOC102624456    208   4e-58   Citrus sinensis [apfelsine]
ref|XP_010057221.1|  PREDICTED: uncharacterized protein LOC104445...    208   4e-58   Eucalyptus grandis [rose gum]
ref|XP_011033324.1|  PREDICTED: protein EFR3 homolog B-like isofo...    207   4e-58   Populus euphratica
ref|XP_010241507.1|  PREDICTED: uncharacterized protein LOC104586...    207   5e-58   Nelumbo nucifera [Indian lotus]
ref|NP_197607.5|  uncharacterized protein                               207   5e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010241506.1|  PREDICTED: uncharacterized protein LOC104586...    207   5e-58   Nelumbo nucifera [Indian lotus]
ref|XP_007033975.1|  ARM repeat superfamily protein isoform 5           207   6e-58   
ref|XP_007033971.1|  ARM repeat superfamily protein isoform 1           207   6e-58   
ref|XP_006286974.1|  hypothetical protein CARUB_v10000121mg             207   7e-58   Capsella rubella
ref|XP_010069300.1|  PREDICTED: protein EFR3 homolog B isoform X1       207   8e-58   Eucalyptus grandis [rose gum]
gb|KGN59399.1|  hypothetical protein Csa_3G816120                       206   8e-58   Cucumis sativus [cucumbers]
ref|XP_010493228.1|  PREDICTED: uncharacterized protein LOC104770495    207   9e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010420957.1|  PREDICTED: uncharacterized protein LOC104706460    207   9e-58   Camelina sativa [gold-of-pleasure]
ref|XP_006657548.1|  PREDICTED: uncharacterized protein LOC102712271    207   1e-57   Oryza brachyantha
ref|XP_006597228.1|  PREDICTED: uncharacterized protein LOC100811...    206   1e-57   Glycine max [soybeans]
ref|XP_003605757.1|  EFR3-like protein                                  206   1e-57   Medicago truncatula
gb|EMS53000.1|  Protein EFR3-like protein B                             206   1e-57   Triticum urartu
gb|KCW57602.1|  hypothetical protein EUGRSUZ_H00374                     206   1e-57   Eucalyptus grandis [rose gum]
ref|XP_004166917.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    206   1e-57   
ref|XP_011048039.1|  PREDICTED: uncharacterized protein LOC105142218    206   1e-57   Populus euphratica
ref|XP_002874031.1|  hypothetical protein ARALYDRAFT_489019             206   1e-57   
ref|XP_004136762.1|  PREDICTED: uncharacterized protein LOC101210251    206   2e-57   
emb|CDP18636.1|  unnamed protein product                                206   2e-57   Coffea canephora [robusta coffee]
ref|XP_004493505.1|  PREDICTED: uncharacterized protein LOC101511...    206   2e-57   Cicer arietinum [garbanzo]
ref|XP_004493504.1|  PREDICTED: uncharacterized protein LOC101511...    206   2e-57   Cicer arietinum [garbanzo]
emb|CDY09095.1|  BnaA02g05210D                                          205   3e-57   Brassica napus [oilseed rape]
ref|XP_009124331.1|  PREDICTED: uncharacterized protein LOC103849280    205   3e-57   Brassica rapa
ref|XP_009789125.1|  PREDICTED: protein EFR3 homolog B isoform X4       204   4e-57   Nicotiana sylvestris
ref|XP_002529611.1|  conserved hypothetical protein                     204   4e-57   
gb|EMT11310.1|  hypothetical protein F775_16040                         205   5e-57   
ref|XP_009789120.1|  PREDICTED: protein EFR3 homolog B isoform X1       204   5e-57   Nicotiana sylvestris
ref|XP_009789122.1|  PREDICTED: protein EFR3 homolog B isoform X2       204   5e-57   Nicotiana sylvestris
ref|XP_009789124.1|  PREDICTED: protein EFR3 homolog B isoform X3       204   5e-57   Nicotiana sylvestris
gb|KDO47318.1|  hypothetical protein CISIN_1g001882mg                   204   5e-57   Citrus sinensis [apfelsine]
ref|XP_003540587.1|  PREDICTED: uncharacterized protein LOC100816475    204   6e-57   Glycine max [soybeans]
gb|KDO47319.1|  hypothetical protein CISIN_1g001882mg                   204   7e-57   Citrus sinensis [apfelsine]
ref|XP_010907685.1|  PREDICTED: uncharacterized protein LOC105034...    203   7e-57   
gb|KDO47320.1|  hypothetical protein CISIN_1g001882mg                   204   7e-57   Citrus sinensis [apfelsine]
ref|XP_007028783.1|  Uncharacterized protein isoform 3                  202   8e-57   
gb|EYU27043.1|  hypothetical protein MIMGU_mgv1a000818mg                204   8e-57   Erythranthe guttata [common monkey flower]
gb|KFK26320.1|  hypothetical protein AALP_AA8G232400                    204   8e-57   Arabis alpina [alpine rockcress]
ref|XP_007225374.1|  hypothetical protein PRUPE_ppa000810mg             203   1e-56   Prunus persica
ref|XP_008222533.1|  PREDICTED: uncharacterized protein LOC103322398    203   1e-56   Prunus mume [ume]
ref|XP_010907684.1|  PREDICTED: uncharacterized protein LOC105034...    203   1e-56   Elaeis guineensis
ref|XP_010907683.1|  PREDICTED: uncharacterized protein LOC105034...    203   1e-56   Elaeis guineensis
ref|XP_010907681.1|  PREDICTED: uncharacterized protein LOC105034...    203   2e-56   Elaeis guineensis
ref|XP_010907682.1|  PREDICTED: uncharacterized protein LOC105034...    203   2e-56   Elaeis guineensis
ref|XP_007131432.1|  hypothetical protein PHAVU_011G013000g             203   2e-56   Phaseolus vulgaris [French bean]
ref|XP_009789840.1|  PREDICTED: protein EFR3 homolog B-like isofo...    202   3e-56   Nicotiana sylvestris
ref|XP_010666756.1|  PREDICTED: uncharacterized protein LOC104883885    202   3e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009789839.1|  PREDICTED: protein EFR3 homolog B-like isofo...    202   3e-56   Nicotiana sylvestris
ref|XP_006400678.1|  hypothetical protein EUTSA_v10012553mg             202   3e-56   Eutrema salsugineum [saltwater cress]
ref|XP_009610957.1|  PREDICTED: protein EFR3 homolog B isoform X5       202   3e-56   Nicotiana tomentosiformis
ref|XP_002308951.2|  cyclin-related family protein                      201   3e-56   
ref|XP_004229640.1|  PREDICTED: protein EFR3 homolog B-like             202   3e-56   Solanum lycopersicum
ref|XP_006345431.1|  PREDICTED: uncharacterized protein LOC102584593    202   3e-56   Solanum tuberosum [potatoes]
ref|XP_010319193.1|  PREDICTED: protein EFR3 homolog B isoform X3       202   3e-56   Solanum lycopersicum
ref|NP_001059150.1|  Os07g0205900                                       202   3e-56   
gb|EEC81712.1|  hypothetical protein OsI_25322                          202   3e-56   Oryza sativa Indica Group [Indian rice]
gb|KJB71806.1|  hypothetical protein B456_011G143200                    201   3e-56   Gossypium raimondii
ref|XP_009610919.1|  PREDICTED: protein EFR3 homolog B isoform X1       202   3e-56   Nicotiana tomentosiformis
ref|XP_009610937.1|  PREDICTED: protein EFR3 homolog B isoform X2       202   4e-56   Nicotiana tomentosiformis
ref|XP_009610943.1|  PREDICTED: protein EFR3 homolog B isoform X3       202   4e-56   Nicotiana tomentosiformis
ref|XP_006587694.1|  PREDICTED: uncharacterized protein LOC100808352    202   4e-56   Glycine max [soybeans]
ref|XP_006350206.1|  PREDICTED: protein EFR3 homolog B-like isofo...    202   4e-56   
ref|XP_009610949.1|  PREDICTED: protein EFR3 homolog B isoform X4       202   4e-56   Nicotiana tomentosiformis
ref|XP_007028781.1|  Uncharacterized protein isoform 1                  202   4e-56   
ref|XP_006648006.1|  PREDICTED: protein EFR3 homolog B-like isofo...    202   4e-56   Oryza brachyantha
ref|XP_010319191.1|  PREDICTED: protein EFR3 homolog B isoform X1       202   4e-56   Solanum lycopersicum
ref|XP_004236620.1|  PREDICTED: protein EFR3 homolog B isoform X2       202   5e-56   Solanum lycopersicum
ref|XP_006350204.1|  PREDICTED: protein EFR3 homolog B-like isofo...    202   5e-56   Solanum tuberosum [potatoes]
ref|XP_006595061.1|  PREDICTED: uncharacterized protein LOC100806...    201   5e-56   Glycine max [soybeans]
ref|XP_010930207.1|  PREDICTED: uncharacterized protein LOC105051451    202   6e-56   Elaeis guineensis
ref|XP_010546486.1|  PREDICTED: uncharacterized protein LOC104818...    202   6e-56   
ref|XP_004951914.1|  PREDICTED: uncharacterized protein LOC101783...    202   6e-56   Setaria italica
ref|XP_006478683.1|  PREDICTED: uncharacterized protein LOC102614...    201   7e-56   Citrus sinensis [apfelsine]
ref|XP_007162229.1|  hypothetical protein PHAVU_001G134800g             201   7e-56   Phaseolus vulgaris [French bean]
ref|XP_002517810.1|  conserved hypothetical protein                     201   8e-56   
ref|XP_010555004.1|  PREDICTED: uncharacterized protein LOC104824606    201   8e-56   
ref|XP_007162228.1|  hypothetical protein PHAVU_001G134800g             201   9e-56   Phaseolus vulgaris [French bean]
gb|KEH39475.1|  cyclin-like protein                                     201   9e-56   Medicago truncatula
ref|XP_009363645.1|  PREDICTED: uncharacterized protein LOC103953608    201   9e-56   Pyrus x bretschneideri [bai li]
gb|KJB71809.1|  hypothetical protein B456_011G143200                    200   1e-55   Gossypium raimondii
gb|KJB49179.1|  hypothetical protein B456_008G105100                    200   1e-55   Gossypium raimondii
ref|XP_003597513.1|  EFR3-like protein                                  200   1e-55   
gb|EPS68833.1|  hypothetical protein M569_05934                         197   1e-55   Genlisea aurea
gb|KHN11694.1|  Protein EFR3 like B                                     201   1e-55   Glycine soja [wild soybean]
gb|KJB71808.1|  hypothetical protein B456_011G143200                    200   1e-55   Gossypium raimondii
ref|XP_001767624.1|  predicted protein                                  199   1e-55   
gb|KJB71804.1|  hypothetical protein B456_011G143200                    200   1e-55   Gossypium raimondii
gb|KHG10450.1|  Protein EFR3                                            200   2e-55   Gossypium arboreum [tree cotton]
ref|XP_006648302.1|  PREDICTED: uncharacterized protein LOC102704216    201   2e-55   Oryza brachyantha
ref|NP_001048304.1|  Os02g0780500                                       200   2e-55   
ref|XP_003520520.1|  PREDICTED: uncharacterized protein LOC100817...    200   2e-55   Glycine max [soybeans]
ref|XP_006576825.1|  PREDICTED: uncharacterized protein LOC100817...    200   2e-55   Glycine max [soybeans]
gb|KHN30101.1|  Protein EFR3 like B                                     199   2e-55   Glycine soja [wild soybean]
gb|KJB49180.1|  hypothetical protein B456_008G105100                    199   3e-55   Gossypium raimondii
gb|KJB37960.1|  hypothetical protein B456_006G228200                    198   3e-55   Gossypium raimondii
gb|KJB49178.1|  hypothetical protein B456_008G105100                    199   4e-55   Gossypium raimondii
ref|XP_006293443.1|  hypothetical protein CARUB_v10022560mg             199   5e-55   Capsella rubella
ref|XP_010546363.1|  PREDICTED: uncharacterized protein LOC104818...    199   5e-55   
ref|XP_011087843.1|  PREDICTED: uncharacterized protein LOC105169196    199   5e-55   Sesamum indicum [beniseed]
gb|KJB37959.1|  hypothetical protein B456_006G228200                    198   7e-55   Gossypium raimondii
ref|XP_002277709.2|  PREDICTED: uncharacterized protein LOC100265428    198   7e-55   Vitis vinifera
ref|XP_004506319.1|  PREDICTED: uncharacterized protein LOC101489771    199   8e-55   Cicer arietinum [garbanzo]
ref|XP_010672158.1|  PREDICTED: uncharacterized protein LOC104888...    198   9e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004486920.1|  PREDICTED: uncharacterized protein LOC101509...    197   9e-55   Cicer arietinum [garbanzo]
ref|XP_009118564.1|  PREDICTED: protein EFR3 homolog                    197   9e-55   Brassica rapa
ref|XP_010672159.1|  PREDICTED: uncharacterized protein LOC104888...    198   9e-55   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY06190.1|  BnaA09g50130D                                          197   1e-54   
emb|CDY09999.1|  BnaC08g44520D                                          197   1e-54   Brassica napus [oilseed rape]
ref|XP_004140882.1|  PREDICTED: uncharacterized protein LOC101203725    197   1e-54   Cucumis sativus [cucumbers]
dbj|BAK04246.1|  predicted protein                                      197   2e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008445732.1|  PREDICTED: uncharacterized protein LOC103488...    197   2e-54   Cucumis melo [Oriental melon]
gb|KGN64805.1|  hypothetical protein Csa_1G108300                       197   2e-54   Cucumis sativus [cucumbers]
ref|XP_011026408.1|  PREDICTED: uncharacterized protein LOC105127...    197   2e-54   Populus euphratica
ref|XP_008445731.1|  PREDICTED: uncharacterized protein LOC103488...    197   2e-54   Cucumis melo [Oriental melon]
ref|XP_011026411.1|  PREDICTED: uncharacterized protein LOC105127...    197   2e-54   Populus euphratica
ref|XP_002309810.1|  hypothetical protein POPTR_0007s02020g             197   2e-54   
gb|EYU20743.1|  hypothetical protein MIMGU_mgv1a000711mg                197   3e-54   Erythranthe guttata [common monkey flower]
ref|XP_006417969.1|  hypothetical protein EUTSA_v10006704mg             196   4e-54   
ref|XP_004147289.1|  PREDICTED: uncharacterized protein LOC101219905    197   4e-54   Cucumis sativus [cucumbers]
emb|CDY06905.1|  BnaA04g24100D                                          196   4e-54   
ref|NP_001045867.1|  Os02g0143200                                       196   4e-54   
emb|CDY14788.1|  BnaC04g47850D                                          196   5e-54   Brassica napus [oilseed rape]
gb|EEE56284.1|  hypothetical protein OsJ_05346                          196   5e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004158232.1|  PREDICTED: protein EFR3 homolog cmp44E-like        194   5e-54   
gb|EEC72466.1|  hypothetical protein OsI_05818                          196   5e-54   Oryza sativa Indica Group [Indian rice]
ref|XP_002457472.1|  hypothetical protein SORBIDRAFT_03g007790          196   6e-54   
ref|XP_008463075.1|  PREDICTED: uncharacterized protein LOC103501...    196   6e-54   Cucumis melo [Oriental melon]
ref|XP_008463083.1|  PREDICTED: uncharacterized protein LOC103501...    196   6e-54   Cucumis melo [Oriental melon]
gb|AAK56279.1|AF367291_1  At1g05960/T21E18_20                           194   7e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007150426.1|  hypothetical protein PHAVU_005G152600g             196   7e-54   Phaseolus vulgaris [French bean]
ref|XP_008799995.1|  PREDICTED: uncharacterized protein LOC103714...    196   8e-54   Phoenix dactylifera
ref|XP_010485557.1|  PREDICTED: uncharacterized protein LOC104763859    195   8e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010457707.1|  PREDICTED: uncharacterized protein LOC104739144    195   9e-54   Camelina sativa [gold-of-pleasure]
ref|XP_006411452.1|  hypothetical protein EUTSA_v10016171mg             196   9e-54   Eutrema salsugineum [saltwater cress]
tpg|DAA53702.1|  TPA: hypothetical protein ZEAMMB73_302622              193   9e-54   
gb|KEH30318.1|  cyclin-like protein                                     195   1e-53   Medicago truncatula
ref|XP_010508669.1|  PREDICTED: uncharacterized protein LOC104785...    195   1e-53   
ref|XP_010505973.1|  PREDICTED: uncharacterized protein LOC104782671    195   1e-53   
ref|XP_009142008.1|  PREDICTED: uncharacterized protein LOC103865...    195   1e-53   
ref|XP_009142010.1|  PREDICTED: uncharacterized protein LOC103865...    195   1e-53   
gb|KHG08769.1|  Protein EFR3 B                                          195   1e-53   
ref|XP_009142011.1|  PREDICTED: uncharacterized protein LOC103865...    195   1e-53   
ref|XP_009142012.1|  PREDICTED: uncharacterized protein LOC103865...    195   1e-53   
ref|NP_563755.1|  ARM repeat superfamily protein                        194   2e-53   
ref|XP_008461314.1|  PREDICTED: uncharacterized protein LOC103499...    195   2e-53   
ref|XP_006303900.1|  hypothetical protein CARUB_v10008206mg             193   2e-53   
emb|CDY63789.1|  BnaA08g31700D                                          193   3e-53   
ref|XP_008790619.1|  PREDICTED: uncharacterized protein LOC103707...    194   3e-53   
ref|XP_004136123.1|  PREDICTED: uncharacterized protein LOC101211879    194   4e-53   
ref|XP_006303899.1|  hypothetical protein CARUB_v10008206mg             193   4e-53   
ref|XP_008673097.1|  PREDICTED: uncharacterized protein LOC100381...    193   5e-53   
ref|XP_008673100.1|  PREDICTED: uncharacterized protein LOC100381...    193   6e-53   
emb|CDX86545.1|  BnaC08g01580D                                          192   6e-53   
ref|XP_008673099.1|  PREDICTED: uncharacterized protein LOC100381...    193   6e-53   
ref|XP_006592150.1|  PREDICTED: uncharacterized protein LOC100799...    192   9e-53   
ref|XP_010475319.1|  PREDICTED: uncharacterized protein LOC104754751    192   1e-52   
gb|AAF80120.1|AC024174_2  Contains similarity to an unknown prote...    194   1e-52   
ref|XP_003539042.1|  PREDICTED: uncharacterized protein LOC100817...    192   1e-52   
emb|CDY10165.1|  BnaC05g04080D                                          191   1e-52   
gb|KHN06209.1|  Protein EFR3 like B                                     192   1e-52   
ref|XP_004954123.1|  PREDICTED: protein EFR3 homolog B-like             192   1e-52   
ref|XP_002881801.1|  hypothetical protein ARALYDRAFT_483264             192   2e-52   
emb|CDY47707.1|  BnaA10g03960D                                          191   3e-52   
ref|XP_008655586.1|  PREDICTED: uncharacterized protein LOC103634...    191   3e-52   
ref|XP_009119100.1|  PREDICTED: uncharacterized protein LOC103844080    191   3e-52   
gb|KHN25286.1|  Protein EFR3 like B                                     191   3e-52   
ref|XP_002892313.1|  predicted protein                                  192   4e-52   
dbj|BAF00551.1|  hypothetical protein                                   191   4e-52   
ref|XP_010522184.1|  PREDICTED: uncharacterized protein LOC104800...    191   4e-52   
ref|XP_010522186.1|  PREDICTED: uncharacterized protein LOC104800...    191   4e-52   
ref|XP_007131956.1|  hypothetical protein PHAVU_011G054800g             191   5e-52   
ref|NP_181714.3|  uncharacterized protein                               191   5e-52   
ref|XP_009111016.1|  PREDICTED: protein EFR3 homolog isoform X1         189   9e-52   
ref|XP_009111018.1|  PREDICTED: protein EFR3 homolog isoform X3         189   9e-52   
ref|NP_001045092.1|  Os01g0898300                                       189   1e-51   
gb|EEE55815.1|  hypothetical protein OsJ_04415                          189   1e-51   
ref|XP_004507331.1|  PREDICTED: uncharacterized protein LOC101496...    189   1e-51   
gb|EAZ26671.1|  hypothetical protein OsJ_10574                          189   1e-51   
ref|XP_002533049.1|  conserved hypothetical protein                     189   2e-51   
ref|XP_010454428.1|  PREDICTED: uncharacterized protein LOC104736187    189   2e-51   
emb|CDX79909.1|  BnaA05g02470D                                          188   3e-51   
gb|AFW70121.1|  hypothetical protein ZEAMMB73_889435                    188   4e-51   
ref|XP_008644201.1|  PREDICTED: uncharacterized protein LOC100501...    188   5e-51   
ref|XP_008644196.1|  PREDICTED: uncharacterized protein LOC100501...    188   5e-51   
ref|XP_008644200.1|  PREDICTED: uncharacterized protein LOC100501...    188   5e-51   
ref|XP_008644198.1|  PREDICTED: uncharacterized protein LOC100501...    188   6e-51   
ref|XP_008644197.1|  PREDICTED: uncharacterized protein LOC100501...    188   6e-51   
ref|XP_008644199.1|  PREDICTED: uncharacterized protein LOC100501...    187   6e-51   
ref|XP_008644195.1|  PREDICTED: uncharacterized protein LOC100501...    187   7e-51   
gb|AFW84297.1|  hypothetical protein ZEAMMB73_469985                    185   8e-51   
ref|XP_002451526.1|  hypothetical protein SORBIDRAFT_04g003310          187   9e-51   
gb|EAY89716.1|  hypothetical protein OsI_11254                          186   9e-51   
ref|XP_004970911.1|  PREDICTED: uncharacterized protein LOC101769...    186   2e-50   
ref|XP_004970908.1|  PREDICTED: uncharacterized protein LOC101769...    186   2e-50   
gb|KJB16447.1|  hypothetical protein B456_002G230500                    186   2e-50   
gb|AFW84299.1|  hypothetical protein ZEAMMB73_469985                    186   3e-50   
gb|AFW84298.1|  hypothetical protein ZEAMMB73_469985                    186   3e-50   
gb|EMS54754.1|  Protein EFR3-like protein A                             184   7e-50   
gb|KHG30683.1|  Protein EFR3 cmp44E                                     184   8e-50   
gb|EMT28557.1|  Protein EFR3-like protein                               183   1e-49   
gb|KDP42800.1|  hypothetical protein JCGZ_23742                         183   2e-49   
ref|XP_006645172.1|  PREDICTED: uncharacterized protein LOC102710074    183   2e-49   
ref|XP_010557094.1|  PREDICTED: uncharacterized protein LOC104826...    183   3e-49   
ref|XP_010232688.1|  PREDICTED: uncharacterized protein LOC100842...    182   5e-49   
ref|XP_003564842.1|  PREDICTED: uncharacterized protein LOC100842...    182   5e-49   
ref|XP_010232687.1|  PREDICTED: uncharacterized protein LOC100842...    182   5e-49   
ref|XP_010413002.1|  PREDICTED: uncharacterized protein LOC104699388    182   5e-49   
ref|XP_003570918.1|  PREDICTED: uncharacterized protein LOC100821...    182   5e-49   
ref|NP_001154308.1|  ARM repeat superfamily protein                     181   1e-48   
ref|XP_008655589.1|  PREDICTED: uncharacterized protein LOC103634...    181   1e-48   
gb|EMS60662.1|  Protein EFR3-like protein                               180   2e-48   
ref|XP_002456786.1|  hypothetical protein SORBIDRAFT_03g042720          180   2e-48   
emb|CDM85315.1|  unnamed protein product                                180   2e-48   
gb|EMT06694.1|  Putative mitochondrial protein                          180   4e-48   
gb|EYU18743.1|  hypothetical protein MIMGU_mgv1a0012531mg               166   4e-48   
ref|XP_008240995.1|  PREDICTED: uncharacterized protein LOC103339476    179   1e-47   
ref|XP_011033325.1|  PREDICTED: uncharacterized protein LOC105131...    176   5e-47   
ref|XP_008790620.1|  PREDICTED: uncharacterized protein LOC103707...    175   2e-46   
ref|XP_008790616.1|  PREDICTED: uncharacterized protein LOC103707...    175   2e-46   
gb|EMT12879.1|  hypothetical protein F775_15212                         175   2e-46   
ref|XP_010523669.1|  PREDICTED: uncharacterized protein LOC104801...    174   4e-46   
ref|XP_008647478.1|  PREDICTED: uncharacterized protein LOC100217...    172   1e-45   
ref|XP_008647477.1|  PREDICTED: uncharacterized protein LOC100217...    172   1e-45   
gb|AFW69349.1|  hypothetical protein ZEAMMB73_015704                    172   3e-45   
gb|KHN33312.1|  Protein EFR3 like B                                     170   7e-45   
ref|XP_007052501.1|  Uncharacterized protein TCM_005862                 169   1e-44   
gb|KGN45115.1|  hypothetical protein Csa_7G426560                       170   1e-44   
ref|XP_008645036.1|  PREDICTED: uncharacterized protein LOC103626...    170   1e-44   
ref|XP_008645035.1|  PREDICTED: uncharacterized protein LOC103626...    170   1e-44   
ref|XP_001770437.1|  predicted protein                                  170   2e-44   
gb|KJB37958.1|  hypothetical protein B456_006G228200                    168   4e-44   
gb|EPS74671.1|  hypothetical protein M569_00084                         152   3e-43   
ref|XP_004966105.1|  PREDICTED: uncharacterized protein LOC101758656    166   3e-43   
gb|AAC02765.1|  hypothetical protein                                    164   1e-42   
gb|KJB46322.1|  hypothetical protein B456_007G360200                    164   2e-42   
ref|XP_008354962.1|  PREDICTED: protein EFR3 homolog A-like             146   7e-41   
gb|KHN32414.1|  Protein EFR3 like B                                     152   2e-38   
ref|XP_008355520.1|  PREDICTED: uncharacterized protein LOC103419180    139   5e-38   
gb|KHN11423.1|  hypothetical protein glysoja_015318                     149   1e-37   
emb|CDY48767.1|  BnaC04g02200D                                          150   2e-37   
ref|XP_010097525.1|  hypothetical protein L484_024736                   137   6e-37   
emb|CBI29857.3|  unnamed protein product                                145   1e-35   
gb|AFK33385.1|  unknown                                                 132   3e-35   
ref|XP_008461315.1|  PREDICTED: uncharacterized protein LOC103499...    143   3e-35   
emb|CBI24919.3|  unnamed protein product                                143   5e-35   
gb|EEE57911.1|  hypothetical protein OsJ_08605                          140   2e-34   
gb|EEC74114.1|  hypothetical protein OsI_09170                          136   2e-34   
gb|AES61350.2|  cyclin-like protein                                     127   2e-33   
ref|XP_010557096.1|  PREDICTED: uncharacterized protein LOC104826...    135   1e-32   
ref|XP_008463089.1|  PREDICTED: uncharacterized protein LOC103501...    135   2e-32   
dbj|BAH57285.1|  AT5G26850                                              133   6e-32   
ref|XP_006287016.1|  hypothetical protein CARUB_v10000164mg             133   1e-31   
ref|XP_010236037.1|  PREDICTED: uncharacterized protein LOC100837488    123   2e-28   
gb|AFK46351.1|  unknown                                                 115   2e-27   
ref|XP_004160819.1|  PREDICTED: uncharacterized LOC101203725            105   8e-25   
ref|XP_010092917.1|  hypothetical protein L484_004958                   104   1e-24   
gb|KDO83457.1|  hypothetical protein CISIN_1g035569mg                   110   3e-24   
ref|XP_008350293.1|  PREDICTED: polygalacturonase ADPG2-like            106   4e-24   
ref|XP_009412884.1|  PREDICTED: uncharacterized protein LOC103994280    110   5e-24   
ref|XP_008387322.1|  PREDICTED: uncharacterized protein LOC103449776    105   1e-23   
gb|KHN07377.1|  hypothetical protein glysoja_012675                     104   6e-22   
emb|CAJ44368.1|  putative cyclin-related protein                        104   7e-22   
gb|KDP26045.1|  hypothetical protein JCGZ_21078                         101   8e-21   
ref|XP_008463098.1|  PREDICTED: uncharacterized protein LOC103501...  96.3    5e-19   
gb|KJB71039.1|  hypothetical protein B456_011G101600                  89.4    9e-19   
ref|XP_004168868.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  93.2    5e-18   
gb|KJB71038.1|  hypothetical protein B456_011G101600                  86.7    1e-17   
gb|KDO81671.1|  hypothetical protein CISIN_1g0461822mg                84.0    1e-17   
ref|XP_006350205.1|  PREDICTED: protein EFR3 homolog B-like isofo...  92.0    1e-17   
ref|XP_006482855.1|  PREDICTED: uncharacterized protein LOC102612183  85.5    2e-17   
ref|XP_010313083.1|  PREDICTED: uncharacterized protein LOC101250...  86.7    8e-16   
ref|XP_010927191.1|  PREDICTED: uncharacterized protein LOC105049285  86.3    1e-15   
gb|KJB16446.1|  hypothetical protein B456_002G230500                  84.7    4e-15   
ref|XP_006439087.1|  hypothetical protein CICLE_v10033334mg           82.0    3e-14   
ref|XP_008443202.1|  PREDICTED: uncharacterized protein LOC103486...  78.6    3e-13   
ref|XP_006648008.1|  PREDICTED: protein EFR3 homolog B-like isofo...  78.2    4e-13   
ref|XP_008655590.1|  PREDICTED: uncharacterized protein LOC103634...  77.4    7e-13   
ref|XP_005846281.1|  hypothetical protein CHLNCDRAFT_135622           73.2    2e-12   
ref|XP_010932402.1|  PREDICTED: uncharacterized protein LOC105053...  75.1    4e-12   
ref|XP_010069302.1|  PREDICTED: uncharacterized protein LOC104456...  72.4    4e-11   
ref|XP_008784322.1|  PREDICTED: uncharacterized protein LOC103703...  70.1    2e-10   
ref|XP_010319194.1|  PREDICTED: uncharacterized protein LOC101246...  70.1    2e-10   
ref|XP_006597230.1|  PREDICTED: uncharacterized protein LOC100811...  69.3    3e-10   
ref|XP_009610963.1|  PREDICTED: uncharacterized protein LOC104104...  68.9    4e-10   
ref|XP_010313084.1|  PREDICTED: uncharacterized protein LOC101250...  68.9    5e-10   
ref|XP_010650558.1|  PREDICTED: uncharacterized protein LOC100264...  68.6    6e-10   
gb|EAZ45073.1|  hypothetical protein OsJ_29714                        64.7    8e-10   
ref|XP_010672160.1|  PREDICTED: uncharacterized protein LOC104888...  67.0    2e-09   
ref|XP_006590941.1|  PREDICTED: uncharacterized protein LOC100817...  65.9    3e-09   
ref|XP_002405516.1|  transmembrane protein cmp44E, putative           65.1    6e-09   
ref|XP_008800011.1|  PREDICTED: uncharacterized protein LOC103714...  64.7    1e-08   
ref|XP_003744820.1|  PREDICTED: protein EFR3 homolog B-like           64.3    1e-08   
ref|XP_006478686.1|  PREDICTED: uncharacterized protein LOC102614...  64.3    1e-08   
ref|XP_010097526.1|  hypothetical protein L484_024737                 63.9    2e-08   
ref|XP_008350700.1|  PREDICTED: uncharacterized protein LOC103414060  63.5    2e-08   
ref|XP_008443203.1|  PREDICTED: uncharacterized protein LOC103486...  63.5    2e-08   
ref|XP_001689991.1|  predicted protein                                62.8    3e-08   
ref|XP_005457730.1|  PREDICTED: protein EFR3 homolog A-like isofo...  61.2    4e-08   
ref|XP_008286006.1|  PREDICTED: protein EFR3 homolog A                62.4    5e-08   
ref|XP_006634590.1|  PREDICTED: protein EFR3 homolog A-like           62.4    5e-08   
ref|XP_005457731.1|  PREDICTED: protein EFR3 homolog A-like isofo...  60.8    5e-08   
ref|XP_008333292.1|  PREDICTED: protein EFR3 homolog A isoform X1     62.4    6e-08   
ref|XP_008333293.1|  PREDICTED: protein EFR3 homolog A isoform X2     62.0    6e-08   
ref|XP_008369216.1|  PREDICTED: uncharacterized protein LOC103432787  62.0    7e-08   
ref|XP_004359079.1|  hypothetical protein DFA_01104                   62.0    7e-08   
gb|AFW70125.1|  hypothetical protein ZEAMMB73_889435                  62.0    7e-08   
gb|KFM73651.1|  Protein EFR3-like protein                             60.5    7e-08   
ref|XP_010744204.1|  PREDICTED: protein EFR3 homolog A                61.6    8e-08   
ref|XP_005645965.1|  hypothetical protein COCSUDRAFT_48103            61.6    9e-08   
dbj|BAC31942.1|  unnamed protein product                              61.6    9e-08   
ref|XP_008432998.1|  PREDICTED: protein EFR3 homolog A isoform X6     61.6    1e-07   
ref|XP_008432994.1|  PREDICTED: protein EFR3 homolog A isoform X3     61.6    1e-07   
ref|XP_008432992.1|  PREDICTED: protein EFR3 homolog A isoform X1     61.6    1e-07   
ref|XP_008433000.1|  PREDICTED: protein EFR3 homolog A isoform X8     61.6    1e-07   
ref|XP_004935930.1|  PREDICTED: protein EFR3 homolog B isoform X8     61.6    1e-07   
ref|XP_008432997.1|  PREDICTED: protein EFR3 homolog A isoform X5     61.6    1e-07   
gb|AFW70122.1|  hypothetical protein ZEAMMB73_889435                  61.6    1e-07   
gb|AFW70123.1|  hypothetical protein ZEAMMB73_889435                  61.6    1e-07   
ref|XP_004935931.1|  PREDICTED: protein EFR3 homolog B isoform X9     61.6    1e-07   
ref|XP_002585860.1|  hypothetical protein BRAFLDRAFT_256891           60.8    1e-07   
ref|XP_008432999.1|  PREDICTED: protein EFR3 homolog A isoform X7     61.6    1e-07   
ref|XP_008433001.1|  PREDICTED: protein EFR3 homolog A isoform X9     61.2    1e-07   
ref|XP_008433002.1|  PREDICTED: protein EFR3 homolog A isoform X10    61.2    1e-07   
gb|AFW70124.1|  hypothetical protein ZEAMMB73_889435                  61.2    1e-07   
ref|XP_008432993.1|  PREDICTED: protein EFR3 homolog A isoform X2     60.8    2e-07   
ref|XP_008790621.1|  PREDICTED: uncharacterized protein LOC103707...  60.8    2e-07   
ref|XP_008172122.1|  PREDICTED: protein EFR3 homolog B isoform X3     60.8    2e-07   
ref|XP_010842616.1|  PREDICTED: protein EFR3 homolog A isoform X3     60.8    2e-07   
ref|XP_008432996.1|  PREDICTED: protein EFR3 homolog A isoform X4     60.8    2e-07   
gb|ELV13761.1|  Protein EFR3 like protein B                           60.8    2e-07   
ref|XP_010842614.1|  PREDICTED: protein EFR3 homolog A isoform X1     60.8    2e-07   
ref|XP_010842617.1|  PREDICTED: protein EFR3 homolog A isoform X4     60.8    2e-07   
ref|XP_010891302.1|  PREDICTED: protein EFR3 homolog A isoform X2     60.8    2e-07   
ref|XP_010891293.1|  PREDICTED: protein EFR3 homolog A isoform X1     60.8    2e-07   
ref|NP_957121.1|  protein EFR3 homolog A                              60.5    2e-07   
ref|XP_010603223.1|  PREDICTED: protein EFR3 homolog B                60.8    2e-07   
gb|ELK14036.1|  Protein EFR3 like protein B                           60.5    2e-07   
ref|XP_005746415.1|  PREDICTED: LOW QUALITY PROTEIN: protein EFR3...  60.1    3e-07   
ref|XP_004656384.1|  PREDICTED: protein EFR3 homolog A                60.1    3e-07   
gb|ERE67357.1|  putative protein EFR3                                 60.1    3e-07   
ref|XP_005934153.1|  PREDICTED: LOW QUALITY PROTEIN: protein EFR3...  60.1    3e-07   
ref|XP_008119523.1|  PREDICTED: LOW QUALITY PROTEIN: protein EFR3...  60.1    3e-07   
gb|ETE64925.1|  Protein EFR3-like B                                   60.1    3e-07   
ref|XP_005024084.1|  PREDICTED: protein EFR3 homolog B isoform X1     60.1    3e-07   
ref|XP_007488407.1|  PREDICTED: protein EFR3 homolog A isoform X2     60.1    3e-07   
gb|ELW57135.1|  Protein EFR3 like protein A                           59.7    3e-07   
ref|XP_004569518.1|  PREDICTED: protein EFR3 homolog A-like isofo...  59.7    3e-07   
ref|XP_011484516.1|  PREDICTED: protein EFR3 homolog A isoform X2     59.7    3e-07   
ref|XP_010129665.1|  PREDICTED: protein EFR3 homolog B-like           57.8    4e-07   
gb|ELR56400.1|  Protein EFR3-like protein B                           59.7    4e-07   
ref|XP_004569517.1|  PREDICTED: protein EFR3 homolog A-like isofo...  59.7    4e-07   
ref|XP_007488406.1|  PREDICTED: protein EFR3 homolog A isoform X1     59.7    4e-07   
ref|XP_011484515.1|  PREDICTED: protein EFR3 homolog A isoform X1     59.7    4e-07   
ref|XP_011484517.1|  PREDICTED: protein EFR3 homolog A isoform X3     59.7    4e-07   
ref|XP_003497111.1|  PREDICTED: protein EFR3 homolog B                59.7    4e-07   
dbj|BAC35197.1|  unnamed protein product                              57.0    4e-07   
gb|KDR18451.1|  EFR3-like protein cmp44E                              59.3    4e-07   



>ref|XP_004230310.1| PREDICTED: uncharacterized protein LOC101249681 [Solanum lycopersicum]
Length=988

 Score =   317 bits (812),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SRKLFPAC +MCICCPA+RSRSRQPVKRYKKLLA+IFPKSPDGS N RKI+KLCEY
Sbjct  1    MGFISRKLFPACGNMCICCPAMRSRSRQPVKRYKKLLAEIFPKSPDGSPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKIAK LEERCYKELRS H K +NVIAEVYN+LLCMCKEQMA FA +LL++V
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRSEHIKFINVIAEVYNKLLCMCKEQMAYFAASLLDMV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
            VE+LD +K DAV+  GC T T+FIYSQVDGTYTYNIE LV KVCSLARETGEE +KR LR
Sbjct  121  VELLDDSKKDAVRITGCQTLTRFIYSQVDGTYTYNIETLVPKVCSLARETGEEHEKRSLR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>ref|XP_006344767.1| PREDICTED: uncharacterized protein LOC102580046 [Solanum tuberosum]
Length=993

 Score =   317 bits (812),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SRKLFPAC +MCICCPA+RSRSRQPVKRYKKLLA+IFPKSPDGS N RKI+KLCEY
Sbjct  1    MGFISRKLFPACGNMCICCPAMRSRSRQPVKRYKKLLAEIFPKSPDGSPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKIAK LEERCYKELRS H K +NVIAEVYN+LLCMCKEQMA FA +LL++V
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRSEHIKFINVIAEVYNKLLCMCKEQMAYFAASLLDMV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
            VE+LD +K DAV+  GC T T+FIYSQVDGTYTYNIE LV KVCSLARETGEE +KR LR
Sbjct  121  VELLDDSKKDAVRITGCQTLTRFIYSQVDGTYTYNIETLVPKVCSLARETGEEHEKRSLR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>ref|XP_009616023.1| PREDICTED: uncharacterized protein LOC104108647 [Nicotiana tomentosiformis]
Length=993

 Score =   315 bits (808),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SRKLFPAC +MCICCPA+RSRSRQPVKRYKKLLA+IFPK+PDGS N RKI+KLCEY
Sbjct  1    MGFISRKLFPACGNMCICCPAMRSRSRQPVKRYKKLLAEIFPKTPDGSPNDRKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKIAK LEERC+KELRS H K +NVIAEVYN+LLCMCKEQMACFA +LL++V
Sbjct  61   AAKNPFRIPKIAKYLEERCHKELRSEHIKFINVIAEVYNKLLCMCKEQMACFAASLLDMV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
            VE+LD +K DA++ IGC T T+FIYSQVDGTYTYNIE LV KVCSLARETGEE QK  LR
Sbjct  121  VELLDDSKRDAIRIIGCQTLTRFIYSQVDGTYTYNIETLVPKVCSLARETGEEHQKCSLR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>ref|XP_009783972.1| PREDICTED: uncharacterized protein LOC104232454 [Nicotiana sylvestris]
Length=991

 Score =   311 bits (797),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 164/184 (89%), Gaps = 2/184 (1%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SRKLFPAC +MCICCPA+RSRSRQPVKRYKKLLA+IFPK+PDGS N RKI+KLCEY
Sbjct  1    MGFISRKLFPACGNMCICCPAMRSRSRQPVKRYKKLLAEIFPKTPDGSPNDRKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKIAK LEERC+KELRS H K +NVIAEVYN+LLCMCKEQMACFA +LL++V
Sbjct  61   AAKNPFRIPKIAKYLEERCHKELRSEHIKFINVIAEVYNKLLCMCKEQMACFAASLLDMV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
            VE+LD +K DA++ IGC T T+FIYSQVDGTYTYNIE LV KVCSLARETGEE Q   LR
Sbjct  121  VELLDDSKRDAIRIIGCQTLTRFIYSQVDGTYTYNIETLVPKVCSLARETGEEHQN--LR  178

Query  628  ASSL  639
            ASSL
Sbjct  179  ASSL  182



>ref|XP_007208429.1| hypothetical protein PRUPE_ppa000798mg [Prunus persica]
 gb|EMJ09628.1| hypothetical protein PRUPE_ppa000798mg [Prunus persica]
Length=1000

 Score =   303 bits (775),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRKLFPACESMCICCPA+RSRSRQPVKRYKKLLA+IFPKSPDG  N RKI+KLCEY
Sbjct  1    MGIISRKLFPACESMCICCPAMRSRSRQPVKRYKKLLAEIFPKSPDGPPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKIAK LE+RCYKELR  H K +N++AE YN+LLC+CKEQMA FAV+LL+VV
Sbjct  61   AAKNPFRIPKIAKYLEDRCYKELRLEHVKFINIVAEAYNKLLCLCKEQMAYFAVSLLSVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+LD  K D ++ +GC T T+FI+SQ DGTYT+ IE+LV +VC LARE+GE+ QKRCLR
Sbjct  121  TELLDNPKQDPLRILGCQTLTRFIFSQTDGTYTHTIESLVHRVCKLARESGEDHQKRCLR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>gb|KHG26707.1| Efr3b [Gossypium arboreum]
Length=1041

 Score =   303 bits (775),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 165/209 (79%), Gaps = 8/209 (4%)
 Frame = +1

Query  37   SRFCGSSSSPDLSL--------QGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKK  192
            S FCG  SS  LSL        + +MG +SRK+FPAC SMC+CCPALRSRSRQPVKRYKK
Sbjct  17   SEFCGLPSSVSLSLADLPVTAAEQEMGFISRKIFPACGSMCVCCPALRSRSRQPVKRYKK  76

Query  193  LLADIFPKSPDGSANGRKIMKLCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIA  372
            LL++IFPKSPD   N RKI+KLCEYAAKNPFRIPKIAK LEERCYKELR  H K +N++ 
Sbjct  77   LLSEIFPKSPDSPPNERKIVKLCEYAAKNPFRIPKIAKYLEERCYKELRYEHIKFINIVT  136

Query  373  EVYNELLCMCKEQMACFAVNLLNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYN  552
            E YN+LLCMCK QMA FAVNLLNVV E+LD +K DA++ +GC T T FIYSQVDGTYT++
Sbjct  137  EAYNKLLCMCKAQMAYFAVNLLNVVTELLDNSKQDAMRILGCETLTTFIYSQVDGTYTHS  196

Query  553  IENLVQKVCSLARETGEEDQKRCLRASSL  639
            IE  V KVC LA E  EE Q+RCL+ASSL
Sbjct  197  IEKFVHKVCKLAHEDREEHQRRCLKASSL  225



>ref|XP_007031156.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY11658.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=1000

 Score =   302 bits (774),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SRK+FPAC SMC+CCPALRSRSRQPVKRYKKLL++IFPKSPD   N RKI KLCEY
Sbjct  1    MGFISRKIFPACGSMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPDAPPNERKIAKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKIAK LEERCYKELR  H K +N++ E Y++LLCMCKEQMA FAVNLLNVV
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRHEHIKFINIVTEAYHKLLCMCKEQMAYFAVNLLNVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+LD +K DA++ +GC T TKFIYSQ DGTYT+NIE  V KVC L+RE GEE Q+RCLR
Sbjct  121  GELLDNSKQDAMRILGCQTLTKFIYSQADGTYTHNIEKFVPKVCKLSREDGEEHQRRCLR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>gb|KHG26706.1| Protein EFR3 B [Gossypium arboreum]
Length=1050

 Score =   303 bits (775),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 165/209 (79%), Gaps = 8/209 (4%)
 Frame = +1

Query  37   SRFCGSSSSPDLSL--------QGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKK  192
            S FCG  SS  LSL        + +MG +SRK+FPAC SMC+CCPALRSRSRQPVKRYKK
Sbjct  17   SEFCGLPSSVSLSLADLPVTAAEQEMGFISRKIFPACGSMCVCCPALRSRSRQPVKRYKK  76

Query  193  LLADIFPKSPDGSANGRKIMKLCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIA  372
            LL++IFPKSPD   N RKI+KLCEYAAKNPFRIPKIAK LEERCYKELR  H K +N++ 
Sbjct  77   LLSEIFPKSPDSPPNERKIVKLCEYAAKNPFRIPKIAKYLEERCYKELRYEHIKFINIVT  136

Query  373  EVYNELLCMCKEQMACFAVNLLNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYN  552
            E YN+LLCMCK QMA FAVNLLNVV E+LD +K DA++ +GC T T FIYSQVDGTYT++
Sbjct  137  EAYNKLLCMCKAQMAYFAVNLLNVVTELLDNSKQDAMRILGCETLTTFIYSQVDGTYTHS  196

Query  553  IENLVQKVCSLARETGEEDQKRCLRASSL  639
            IE  V KVC LA E  EE Q+RCL+ASSL
Sbjct  197  IEKFVHKVCKLAHEDREEHQRRCLKASSL  225



>ref|XP_007031155.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY11657.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=1019

 Score =   302 bits (774),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SRK+FPAC SMC+CCPALRSRSRQPVKRYKKLL++IFPKSPD   N RKI KLCEY
Sbjct  1    MGFISRKIFPACGSMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPDAPPNERKIAKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKIAK LEERCYKELR  H K +N++ E Y++LLCMCKEQMA FAVNLLNVV
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRHEHIKFINIVTEAYHKLLCMCKEQMAYFAVNLLNVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+LD +K DA++ +GC T TKFIYSQ DGTYT+NIE  V KVC L+RE GEE Q+RCLR
Sbjct  121  GELLDNSKQDAMRILGCQTLTKFIYSQADGTYTHNIEKFVPKVCKLSREDGEEHQRRCLR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>ref|XP_008246002.1| PREDICTED: uncharacterized protein LOC103344152 [Prunus mume]
Length=999

 Score =   301 bits (772),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRKLFPACESMCICCPA+RSRSRQPVKRYKKLLA+IFPKSPDG  N RKI+KLCEY
Sbjct  1    MGIISRKLFPACESMCICCPAMRSRSRQPVKRYKKLLAEIFPKSPDGPPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKIAK LE+RCYKELR  H K +N++AE YN+LLC+CKEQMA FAV+LL+VV
Sbjct  61   AAKNPFRIPKIAKYLEDRCYKELRLEHIKFINIVAEAYNKLLCLCKEQMAYFAVSLLSVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+LD  K D +  +GC T T+FIYSQ DGTYT+ IE+LV +VC LARE+GE+ Q+RCLR
Sbjct  121  TELLDNPKQDPLGILGCQTLTRFIYSQTDGTYTHTIESLVHRVCKLARESGEDHQRRCLR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>gb|KJB45453.1| hypothetical protein B456_007G306600 [Gossypium raimondii]
 gb|KJB45454.1| hypothetical protein B456_007G306600 [Gossypium raimondii]
Length=1000

 Score =   300 bits (769),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SRK+FPAC SMC+CCPALRSRSRQPVKRYKKLL++IFPKSPD   N RKI+KLCEY
Sbjct  1    MGFISRKIFPACGSMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPDSPPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKIAK LEERCYKELR  H K +N++ E YN+LLCMCK QMA FAVNLLNVV
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRYEHIKFINIVTEAYNKLLCMCKAQMAYFAVNLLNVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+LD +K DA++ +GC T T FIYSQVDGTYT++IE  V KVC LARE GEE Q+RCL+
Sbjct  121  TELLDNSKQDAMRILGCETLTSFIYSQVDGTYTHSIEKFVHKVCKLAREDGEEHQRRCLK  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>ref|XP_002318950.2| hypothetical protein POPTR_0013s00990g [Populus trichocarpa]
 gb|EEE94873.2| hypothetical protein POPTR_0013s00990g [Populus trichocarpa]
Length=994

 Score =   297 bits (761),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MGL+SR +FPACESMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG  N RKI+KLCEY
Sbjct  1    MGLISRNIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKSLDGHPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKIAK LEERCYKELRSGH K +N++ E YN+LLCMCK+QMA FA++LLNVV
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRSGHVKFINIVTEAYNKLLCMCKDQMAYFAISLLNVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+L+ +K D +  +GC T T+FIYSQ DGTY++NIE  V KVC+LARE G E+ K CLR
Sbjct  121  NELLEKSKQDPLMILGCQTLTRFIYSQADGTYSHNIEKFVHKVCNLARENGNENNKSCLR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>gb|KJB81105.1| hypothetical protein B456_013G129500 [Gossypium raimondii]
Length=847

 Score =   295 bits (754),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+FPACESMC+CCPALRSRSRQPVKRYKKLL++IFPKSP    N RKI KLCEY
Sbjct  1    MGIISRKIFPACESMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPGAPPNERKITKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AA+NPFRIPKIAK LEERCYKELR  H K +N++ E YN+LLCMCKEQMA FAVNLLNVV
Sbjct  61   AARNPFRIPKIAKYLEERCYKELRYKHVKFINIVIEAYNKLLCMCKEQMAYFAVNLLNVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+LD +K +A + +GC T TKFIYSQ DGTYT+NIE  V KVC LA E GEE  + CLR
Sbjct  121  SELLDNSKQEATQILGCQTLTKFIYSQADGTYTHNIEKFVHKVCKLAHEDGEEHLRSCLR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>emb|CDP18254.1| unnamed protein product [Coffea canephora]
Length=1034

 Score =   298 bits (762),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 166/202 (82%), Gaps = 1/202 (0%)
 Frame = +1

Query  37   SRFCGSSSSPDLSLQG-KMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFP  213
            S FCGS  SP L  Q  KMG +SRK+FPAC +MC+CCPALRSRSRQPVKRYKKLLADIFP
Sbjct  29   SSFCGSFYSPYLVSQARKMGFISRKVFPACGNMCVCCPALRSRSRQPVKRYKKLLADIFP  88

Query  214  KSPDGSANGRKIMKLCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELL  393
            KSPD  +N RK++KLCEYAAKNPFRIPKI K LE+RCYKELRS + K V ++ E YN+LL
Sbjct  89   KSPDSPSNERKVVKLCEYAAKNPFRIPKITKYLEDRCYKELRSQNIKFVEIVVEAYNKLL  148

Query  394  CMCKEQMACFAVNLLNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQK  573
             +CK+QMA FA+NLL++VVE+LD +K DAV+ IGC   T+FIYSQVDGTY+YN+E+LV K
Sbjct  149  SICKDQMAYFAINLLSLVVELLDESKQDAVRIIGCQMLTQFIYSQVDGTYSYNLESLVHK  208

Query  574  VCSLARETGEEDQKRCLRASSL  639
            V  +A ETGEE QK  LRASSL
Sbjct  209  VSIIAHETGEEPQKHRLRASSL  230



>gb|KJB81106.1| hypothetical protein B456_013G129500 [Gossypium raimondii]
Length=870

 Score =   295 bits (755),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+FPACESMC+CCPALRSRSRQPVKRYKKLL++IFPKSP    N RKI KLCEY
Sbjct  1    MGIISRKIFPACESMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPGAPPNERKITKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AA+NPFRIPKIAK LEERCYKELR  H K +N++ E YN+LLCMCKEQMA FAVNLLNVV
Sbjct  61   AARNPFRIPKIAKYLEERCYKELRYKHVKFINIVIEAYNKLLCMCKEQMAYFAVNLLNVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+LD +K +A + +GC T TKFIYSQ DGTYT+NIE  V KVC LA E GEE  + CLR
Sbjct  121  SELLDNSKQEATQILGCQTLTKFIYSQADGTYTHNIEKFVHKVCKLAHEDGEEHLRSCLR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>ref|XP_011466140.1| PREDICTED: uncharacterized protein LOC101313033 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=1004

 Score =   297 bits (760),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+FPAC +MC+CCPA+RSRSRQPVKRYKKLLA+IFPKSPDG +N RKI+KLCEY
Sbjct  1    MGIISRKIFPACGNMCVCCPAMRSRSRQPVKRYKKLLAEIFPKSPDGPSNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKIAK LE+RCYKELR  H K +N++AE YN+LLC+CK QMA FA ++LNVV
Sbjct  61   AAKNPFRIPKIAKHLEDRCYKELRLEHVKFINIVAEAYNKLLCLCKNQMAYFAGSVLNVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+LD +K DA++ IGC T T+FI SQ DGTYT+NIE+LV KVC LA E+GE+ QKRCLR
Sbjct  121  TELLDNSKQDALRIIGCQTLTRFISSQTDGTYTHNIESLVHKVCELAHESGEDIQKRCLR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>ref|XP_004302237.1| PREDICTED: uncharacterized protein LOC101313033 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=1003

 Score =   296 bits (759),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+FPAC +MC+CCPA+RSRSRQPVKRYKKLLA+IFPKSPDG +N RKI+KLCEY
Sbjct  1    MGIISRKIFPACGNMCVCCPAMRSRSRQPVKRYKKLLAEIFPKSPDGPSNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKIAK LE+RCYKELR  H K +N++AE YN+LLC+CK QMA FA ++LNVV
Sbjct  61   AAKNPFRIPKIAKHLEDRCYKELRLEHVKFINIVAEAYNKLLCLCKNQMAYFAGSVLNVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+LD +K DA++ IGC T T+FI SQ DGTYT+NIE+LV KVC LA E+GE+ QKRCLR
Sbjct  121  TELLDNSKQDALRIIGCQTLTRFISSQTDGTYTHNIESLVHKVCELAHESGEDIQKRCLR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>gb|KHG02153.1| Protein EFR3 [Gossypium arboreum]
Length=999

 Score =   295 bits (756),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+FPACESMC+CCPALRSRSRQPVKRYKKLL++IFPKSP    N RKI KLCEY
Sbjct  1    MGIISRKIFPACESMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPGAPPNERKITKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AA+NPFRIPKIAK LEERCYKELR  H K +N++ E YN+LLCMCKEQMA FAVNLLNVV
Sbjct  61   AARNPFRIPKIAKYLEERCYKELRYKHVKFINIVTEAYNKLLCMCKEQMAYFAVNLLNVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+LD +K +A + +GC T TKFIYSQ DGTYT+NIE  V KVC LA E GEE  + CLR
Sbjct  121  SELLDNSKQEATQILGCQTLTKFIYSQADGTYTHNIEKFVHKVCKLAHEDGEEHLRSCLR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>gb|KJB81104.1| hypothetical protein B456_013G129500 [Gossypium raimondii]
Length=996

 Score =   295 bits (756),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+FPACESMC+CCPALRSRSRQPVKRYKKLL++IFPKSP    N RKI KLCEY
Sbjct  1    MGIISRKIFPACESMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPGAPPNERKITKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AA+NPFRIPKIAK LEERCYKELR  H K +N++ E YN+LLCMCKEQMA FAVNLLNVV
Sbjct  61   AARNPFRIPKIAKYLEERCYKELRYKHVKFINIVIEAYNKLLCMCKEQMAYFAVNLLNVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+LD +K +A + +GC T TKFIYSQ DGTYT+NIE  V KVC LA E GEE  + CLR
Sbjct  121  SELLDNSKQEATQILGCQTLTKFIYSQADGTYTHNIEKFVHKVCKLAHEDGEEHLRSCLR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>gb|EYU40497.1| hypothetical protein MIMGU_mgv1a000785mg [Erythranthe guttata]
 gb|EYU40498.1| hypothetical protein MIMGU_mgv1a000785mg [Erythranthe guttata]
Length=987

 Score =   295 bits (754),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR +FPACESMC+CCPALRSRSRQPVKRYKKLLA+IFPK+PDG  N RKI+KLCEY
Sbjct  1    MGVISRNIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKTPDGHPNDRKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNPFRIPKIAK LEE+CYKELRSG+ KLV ++AE YN+LLC CK+Q A FAV+L+NVV
Sbjct  61   ASKNPFRIPKIAKYLEEKCYKELRSGNIKLVGIVAEAYNKLLCSCKDQTAYFAVSLVNVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
            +E+LD +K D+V+ +GC T T F+Y QVDGTYT+NIEN V KVC LAR+T +E QKR LR
Sbjct  121  IELLDESKQDSVQKMGCDTLTTFVYCQVDGTYTHNIENFVHKVCMLARKTEDEHQKRGLR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>ref|XP_009373286.1| PREDICTED: uncharacterized protein LOC103962316 [Pyrus x bretschneideri]
Length=997

 Score =   293 bits (751),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 158/184 (86%), Gaps = 2/184 (1%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRKLFPACESMCICCPA+RSRSRQPVKRYKKLLA+IFPKSPDG  N RKI+KLCEY
Sbjct  1    MGVISRKLFPACESMCICCPAMRSRSRQPVKRYKKLLAEIFPKSPDGPPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKIAK LE+RCYKELR  H K +N++ E YN+LLC+CKEQMACFAV+L++VV
Sbjct  61   AAKNPFRIPKIAKYLEDRCYKELRLEHIKFINIVVEAYNKLLCLCKEQMACFAVSLVHVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+LD +K DA++ +GC T T FIYSQ DGTYT+ IE+LV KVC LAR++GE  Q   LR
Sbjct  121  TELLDNSKQDAMRILGCQTLTNFIYSQTDGTYTHTIESLVHKVCKLARQSGEVHQ--SLR  178

Query  628  ASSL  639
            ASSL
Sbjct  179  ASSL  182



>ref|XP_008370375.1| PREDICTED: uncharacterized protein LOC103433867 [Malus domestica]
Length=997

 Score =   293 bits (751),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 159/184 (86%), Gaps = 2/184 (1%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MGL+SRKLFPACESMCICCPA+RSRSRQPVKRYKKLLA+IFPK+PDG  N RKI+KLCEY
Sbjct  1    MGLISRKLFPACESMCICCPAMRSRSRQPVKRYKKLLAEIFPKAPDGPPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKIAK LE+RCYKELR GH K +N++A+ YN+LLC+CKEQMACFAV+L++VV
Sbjct  61   AAKNPFRIPKIAKYLEDRCYKELRLGHIKFINIVADTYNKLLCLCKEQMACFAVSLVSVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+LD +K D V+ +GC T T FIYSQ D TYT+ IE+LV KVC LAR++GE+ Q   LR
Sbjct  121  TELLDNSKQDTVRILGCQTLTNFIYSQTDCTYTHTIESLVHKVCKLARQSGEDQQ--SLR  178

Query  628  ASSL  639
            ASSL
Sbjct  179  ASSL  182



>ref|XP_011023781.1| PREDICTED: uncharacterized protein LOC105125162 [Populus euphratica]
 ref|XP_011023783.1| PREDICTED: uncharacterized protein LOC105125162 [Populus euphratica]
 ref|XP_011023784.1| PREDICTED: uncharacterized protein LOC105125162 [Populus euphratica]
Length=994

 Score =   292 bits (748),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MGL+SR +FPACESMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG  N RKI+KLCEY
Sbjct  1    MGLISRNIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKSLDGHPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKIAK LEERC+KELRSGH K +N++ E YN+LLCMCK+QMA FA++LLNVV
Sbjct  61   AAKNPFRIPKIAKYLEERCFKELRSGHVKFINIVTEAYNKLLCMCKDQMAYFAISLLNVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+LD +K D +  +GC T T+FIYSQ DGTY++NIE  V KVC+LA E G E+ + CLR
Sbjct  121  NELLDKSKQDPLMILGCQTLTRFIYSQADGTYSHNIEKFVHKVCNLACENGNENNRSCLR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>ref|XP_011092150.1| PREDICTED: uncharacterized protein LOC105172430 [Sesamum indicum]
Length=995

 Score =   291 bits (745),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+FPACESMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG +N RKI+KLCEY
Sbjct  1    MGVISRKIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKSHDGQSNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKIAK LEERCYKELRSG+ + V+++AE YN+LLC+CKEQMA F+ NLLN+V
Sbjct  61   ASKNPLRIPKIAKYLEERCYKELRSGNIRFVSIVAETYNKLLCICKEQMAYFSFNLLNMV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
            +E+LD +K DA+  IGC T T FIY Q+DGTYT NIEN V KVC LAR+T +E QKR LR
Sbjct  121  IELLDDSKQDALLIIGCDTLTTFIYCQMDGTYTRNIENFVDKVCMLARKTEDEHQKRGLR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>ref|XP_010546763.1| PREDICTED: uncharacterized protein LOC104818746 [Tarenaya hassleriana]
Length=989

 Score =   291 bits (745),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SR++FPACESMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG+ N RKI+KLCEY
Sbjct  1    MGFISRRVFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKSLDGAPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AA+NP RIPKIAK LEERCYKELRS   K ++++ E YN++LC+CKEQMA FA ++L+VV
Sbjct  61   AARNPLRIPKIAKFLEERCYKELRSEQIKFISIVTEAYNKMLCLCKEQMAYFATSVLSVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+LD +K D+ K +GC T T+FIYSQVDG+YT+NIEN V KVCSLA E G+E QKRCLR
Sbjct  121  TELLDNSKQDSTKMLGCQTLTRFIYSQVDGSYTHNIENFVHKVCSLAHEDGDEHQKRCLR  180

Query  628  ASSL  639
            AS L
Sbjct  181  ASGL  184



>ref|XP_006394915.1| hypothetical protein EUTSA_v10003593mg [Eutrema salsugineum]
 gb|ESQ32201.1| hypothetical protein EUTSA_v10003593mg [Eutrema salsugineum]
Length=983

 Score =   290 bits (741),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SR +FPACESMC+CCPALRSRSRQPVKRYKKLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNIFPACESMCVCCPALRSRSRQPVKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+LD +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLARE G+E QKRCLR
Sbjct  121  TELLDNSKQDTPTILGCQTLTRFIYSQVDGTYTHSIEKFAHKVCSLAREEGDEPQKRCLR  180

Query  628  ASSL  639
            AS L
Sbjct  181  ASGL  184



>ref|XP_006394914.1| hypothetical protein EUTSA_v10003593mg [Eutrema salsugineum]
 gb|ESQ32200.1| hypothetical protein EUTSA_v10003593mg [Eutrema salsugineum]
Length=976

 Score =   289 bits (740),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SR +FPACESMC+CCPALRSRSRQPVKRYKKLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNIFPACESMCVCCPALRSRSRQPVKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+LD +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLARE G+E QKRCLR
Sbjct  121  TELLDNSKQDTPTILGCQTLTRFIYSQVDGTYTHSIEKFAHKVCSLAREEGDEPQKRCLR  180

Query  628  ASSL  639
            AS L
Sbjct  181  ASGL  184



>gb|KDP23388.1| hypothetical protein JCGZ_23221 [Jatropha curcas]
Length=997

 Score =   289 bits (739),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 155/184 (84%), Gaps = 1/184 (1%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MGL+SRK+FPACESMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG  N RKI+KLCEY
Sbjct  1    MGLISRKIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKS-DGPPNERKIVKLCEY  59

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKIAK LEERCYKELRS H K +N++ E Y++LLCMCKEQM  FA++LLNVV
Sbjct  60   AAKNPFRIPKIAKYLEERCYKELRSEHIKFINIVTETYDKLLCMCKEQMVYFAISLLNVV  119

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+LD  + DA+  +GC T T+FI+SQ DGTYT+NIE  V KVC LARE G+E QK  LR
Sbjct  120  SELLDKPRQDALLILGCQTLTRFIFSQTDGTYTHNIEKFVHKVCKLAREHGDEHQKNRLR  179

Query  628  ASSL  639
            ASSL
Sbjct  180  ASSL  183



>gb|AAB61061.1| Hypothetical protein F2P16.24 [Arabidopsis thaliana]
Length=907

 Score =   288 bits (736),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SR +FPACESMCICCPALRSRSRQPVKRYKKLL +IFPKSPDG  N RKI+KLCEY
Sbjct  1    MGFISRNVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPDGGPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+LD +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLARE GEE QK+CLR
Sbjct  121  TELLDNSKQDTPTILGCQTLTRFIYSQVDGTYTHSIEKFALKVCSLAREEGEEHQKQCLR  180

Query  628  ASSL  639
            AS L
Sbjct  181  ASGL  184



>ref|XP_008359849.1| PREDICTED: uncharacterized protein LOC103423542 [Malus domestica]
 ref|XP_008359850.1| PREDICTED: uncharacterized protein LOC103423542 [Malus domestica]
Length=997

 Score =   288 bits (737),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 157/184 (85%), Gaps = 2/184 (1%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRKLFPACESMCICCPA+RSRSRQPVKRYKKLLA+IFPKSPD   N RKI+KLCEY
Sbjct  1    MGVISRKLFPACESMCICCPAMRSRSRQPVKRYKKLLAEIFPKSPDCPPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKIAK LE+RCYKELR  H K +N++ E YN+LLC+CKEQMACFAV+L++VV
Sbjct  61   AAKNPFRIPKIAKYLEDRCYKELRLEHIKFINIVVEAYNKLLCLCKEQMACFAVSLVHVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+LD +K DA++ +GC T T FIYSQ DGTYT+ IE+LV KVC LAR++GE  Q   LR
Sbjct  121  TELLDNSKQDAMRILGCQTLTNFIYSQTDGTYTHTIESLVHKVCKLARQSGEVHQ--SLR  178

Query  628  ASSL  639
            ASSL
Sbjct  179  ASSL  182



>dbj|BAC41892.1| unknown protein [Arabidopsis thaliana]
 gb|AAQ89612.1| At5g26850 [Arabidopsis thaliana]
Length=970

 Score =   288 bits (736),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SR +FPACESMCICCPALRSRSRQPVKRYKKLL +IFPKSPDG  N RKI+KLCEY
Sbjct  1    MGFISRNVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPDGGPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+LD +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLARE GEE QK+CLR
Sbjct  121  TELLDNSKQDTPTILGCQTLTRFIYSQVDGTYTHSIEKFALKVCSLAREEGEEHQKQCLR  180

Query  628  ASSL  639
            AS L
Sbjct  181  ASGL  184



>ref|NP_198037.3| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001031947.2| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001031948.2| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001190405.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AED93613.1| uncharacterized protein AT5G26850 [Arabidopsis thaliana]
 gb|AED93614.1| uncharacterized protein AT5G26850 [Arabidopsis thaliana]
 gb|AED93615.1| uncharacterized protein AT5G26850 [Arabidopsis thaliana]
 gb|AED93616.1| uncharacterized protein AT5G26850 [Arabidopsis thaliana]
Length=983

 Score =   288 bits (736),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SR +FPACESMCICCPALRSRSRQPVKRYKKLL +IFPKSPDG  N RKI+KLCEY
Sbjct  1    MGFISRNVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPDGGPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+LD +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLARE GEE QK+CLR
Sbjct  121  TELLDNSKQDTPTILGCQTLTRFIYSQVDGTYTHSIEKFALKVCSLAREEGEEHQKQCLR  180

Query  628  ASSL  639
            AS L
Sbjct  181  ASGL  184



>ref|XP_002872241.1| hypothetical protein ARALYDRAFT_489516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48500.1| hypothetical protein ARALYDRAFT_489516 [Arabidopsis lyrata subsp. 
lyrata]
Length=983

 Score =   288 bits (736),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SR +FPACESMC+CCPALRSRSRQPVKRYKKLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNVFPACESMCVCCPALRSRSRQPVKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+LD +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLARE GEE QK+CLR
Sbjct  121  TELLDNSKQDTPTILGCQTLTRFIYSQVDGTYTHSIEKFALKVCSLAREEGEEHQKQCLR  180

Query  628  ASSL  639
            AS L
Sbjct  181  ASGL  184



>emb|CAN82509.1| hypothetical protein VITISV_012725 [Vitis vinifera]
Length=1471

 Score =   290 bits (741),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 160/198 (81%), Gaps = 1/198 (1%)
 Frame = +1

Query  49   GSSSSPDLSLQGK-MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPD  225
            G  + PDL  QGK MG +SR++FPAC SMC+CCPALRSRSRQPVKRYKKLLA+IFPKS D
Sbjct  451  GVFAPPDLPPQGKEMGFISRRIFPACGSMCVCCPALRSRSRQPVKRYKKLLAEIFPKSID  510

Query  226  GSANGRKIMKLCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCK  405
            G  N RKI+KLCEYAAKNPFRIPKIAK LEERCYKELR  H K + ++ E YN+LLCMCK
Sbjct  511  GPPNERKIVKLCEYAAKNPFRIPKIAKYLEERCYKELRCEHIKFIAIVTEAYNKLLCMCK  570

Query  406  EQMACFAVNLLNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSL  585
            +QMA FAV+LLNVV E+LD  K DA++ +GC T T+FIY Q D TYT+NIEN V+KVC L
Sbjct  571  DQMAYFAVSLLNVVSELLDKPKKDAMRILGCQTLTRFIYCQADSTYTHNIENFVRKVCML  630

Query  586  ARETGEEDQKRCLRASSL  639
            ARE G+E Q   L+ASSL
Sbjct  631  AREAGDEQQTSTLKASSL  648



>ref|XP_002512512.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49964.1| conserved hypothetical protein [Ricinus communis]
Length=972

 Score =   285 bits (730),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 154/185 (83%), Gaps = 1/185 (1%)
 Frame = +1

Query  85   KMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCE  264
            +MG +SRK+FPACESMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG  N RKI+KLCE
Sbjct  46   EMGFVSRKIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKS-DGPPNERKIVKLCE  104

Query  265  YAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNV  444
            YAAKNPFRIPKIAK LEERC KELRS H K +N + E YN+LLC+CKEQMA FAV+LLNV
Sbjct  105  YAAKNPFRIPKIAKYLEERCCKELRSEHIKFINTVTETYNKLLCVCKEQMAYFAVSLLNV  164

Query  445  VVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCL  624
            V E+LD  K DA+  +GC T T+FIYSQ DGTYT+NIE  VQKVC LARE G+E  K  L
Sbjct  165  VSELLDKPKQDALLILGCQTLTRFIYSQTDGTYTHNIEKFVQKVCKLAREHGDEHHKSRL  224

Query  625  RASSL  639
            RASSL
Sbjct  225  RASSL  229



>ref|XP_010455044.1| PREDICTED: uncharacterized protein LOC104736707 [Camelina sativa]
 ref|XP_010455045.1| PREDICTED: uncharacterized protein LOC104736707 [Camelina sativa]
Length=984

 Score =   283 bits (725),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SR +FPACESMCICCPALRSRSRQPVKRYKKLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPDGTPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+L+ +K D    +GC T T+FIYSQVDGTYT++IE    KVC+LARE GEE QK CLR
Sbjct  121  TELLENSKLDTPTILGCQTLTRFIYSQVDGTYTHSIEKFALKVCALAREEGEEHQKLCLR  180

Query  628  ASSL  639
            AS L
Sbjct  181  ASGL  184



>ref|XP_010493942.1| PREDICTED: protein EFR3 homolog B-like isoform X2 [Camelina sativa]
Length=984

 Score =   282 bits (722),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SR +FPACESMCICCPALRSRSRQPVKRYKKLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+L+ +K D    +GC T T+FIYSQVDGTYT++IE    KVC+LARE G+E QK CLR
Sbjct  121  TELLENSKLDTPTILGCQTLTRFIYSQVDGTYTHSIEKFALKVCALAREEGDEHQKLCLR  180

Query  628  ASSL  639
            AS L
Sbjct  181  ASGL  184



>ref|XP_010421542.1| PREDICTED: uncharacterized protein LOC104706999 isoform X2 [Camelina 
sativa]
Length=984

 Score =   282 bits (721),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SR +FPACESMCICCPALRSRSRQPVKRYKKLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+L+ +K D    +GC T T+FIYSQVDGTYT++IE    KVC+LARE G+E QK CLR
Sbjct  121  TELLENSKLDTPTILGCQTLTRFIYSQVDGTYTHSIEKFTLKVCALAREEGDEHQKLCLR  180

Query  628  ASSL  639
            AS L
Sbjct  181  ASGL  184



>gb|KEH43106.1| cyclin-like protein [Medicago truncatula]
Length=997

 Score =   282 bits (721),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+FPACESMC+CCPALRSRSRQPVKRY+KLLADIFPKSPD   N RKI+KLCEY
Sbjct  1    MGVISRKIFPACESMCVCCPALRSRSRQPVKRYRKLLADIFPKSPDELPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKIAK LEERCYKELRS H KLV +IAE +N+LL +CK Q+  FAV++LNV 
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRSEHIKLVKIIAESFNKLLSICKAQITYFAVDVLNVT  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+LD +K +A++ +GC + T+FIY QVD TYT+NIE LV+KVC L++E GE  + RCLR
Sbjct  121  SELLDYSKDEAIQALGCQSLTRFIYCQVDSTYTHNIEKLVRKVCMLSQEPGETHENRCLR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>ref|XP_002282109.1| PREDICTED: uncharacterized protein LOC100264846 [Vitis vinifera]
 ref|XP_010659702.1| PREDICTED: uncharacterized protein LOC100264846 [Vitis vinifera]
 emb|CBI39597.3| unnamed protein product [Vitis vinifera]
Length=1002

 Score =   281 bits (719),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SR++FPAC SMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG  N RKI+KLCEY
Sbjct  1    MGFISRRIFPACGSMCVCCPALRSRSRQPVKRYKKLLAEIFPKSIDGPPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKIAK LEERCYKELR  H K + ++ E YN+LLCMCK+QMA FAV+LLNVV
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRCEHIKFIAIVTEAYNKLLCMCKDQMAYFAVSLLNVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+LD  K DA++ +GC T T+FIY Q D TYT+NIEN V+KVC LARE G+E Q   L+
Sbjct  121  SELLDKPKKDAMRILGCQTLTRFIYCQADSTYTHNIENFVRKVCMLAREAGDEQQTSTLK  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>emb|CDX87029.1| BnaC09g03440D [Brassica napus]
Length=982

 Score =   280 bits (716),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SR +FPACE+MC+CCPALR RS+ P KRYKKLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNVFPACETMCVCCPALRPRSKHPAKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKILEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+L+ +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLARE GEE QK+CLR
Sbjct  121  TELLENSKEDTPTILGCQTLTRFIYSQVDGTYTHSIEKFAHKVCSLAREQGEEHQKKCLR  180

Query  628  ASSL  639
            AS L
Sbjct  181  ASGL  184



>ref|XP_010024133.1| PREDICTED: uncharacterized protein LOC104414673 [Eucalyptus grandis]
 gb|KCW60561.1| hypothetical protein EUGRSUZ_H03293 [Eucalyptus grandis]
Length=993

 Score =   279 bits (713),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 148/184 (80%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SRK+FPAC SMC+CCPA+RSRSRQPVKRYKKLLADIFPKSPDGS N RKI KLCEY
Sbjct  1    MGFISRKIFPACGSMCVCCPAMRSRSRQPVKRYKKLLADIFPKSPDGSPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKI K LEERCYKELRS H K +N+  E YN+LL MCKEQM  FAV+LL VV
Sbjct  61   AAKNPFRIPKIVKYLEERCYKELRSEHIKFINIAVEAYNKLLSMCKEQMVYFAVSLLTVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+LD  K D+++ +GC T TKFIYSQ D TY +NIE  V KVC LA+++GE  Q   LR
Sbjct  121  SELLDNGKQDSLQILGCQTLTKFIYSQSDSTYAHNIEKFVHKVCILAQKSGEGHQWCALR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>ref|XP_009111721.1| PREDICTED: protein EFR3 homolog B-like [Brassica rapa]
Length=982

 Score =   278 bits (712),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SR +FPACE+MC+CCPALR RS+ P KRYKKLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNVFPACETMCVCCPALRPRSKHPAKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKILEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+L+ +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLARE G+E QK+CLR
Sbjct  121  TELLENSKEDTPTILGCQTLTRFIYSQVDGTYTHSIEKFAHKVCSLAREQGDEHQKQCLR  180

Query  628  ASSL  639
            AS L
Sbjct  181  ASGL  184



>ref|XP_006433539.1| hypothetical protein CICLE_v10000144mg [Citrus clementina]
 gb|ESR46779.1| hypothetical protein CICLE_v10000144mg [Citrus clementina]
Length=999

 Score =   278 bits (711),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 152/184 (83%), Gaps = 1/184 (1%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SRK+FPAC SMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG  N RKI+KLCEY
Sbjct  1    MGFISRKIFPACGSMCVCCPALRSRSRQPVKRYKKLLAEIFPKSIDGPPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKIAK LEERCYKELR  H KL+N++ E YN++LCMCK QMA FAV+LLNV 
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRCEHIKLINIVTEAYNKMLCMCKVQMAYFAVSLLNVA  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+LD +K + V+ +GC T ++FIYSQ DGTYT+NIE  V+KVC LA E G E Q R LR
Sbjct  121  TELLDNSKQETVQILGCQTLSRFIYSQADGTYTHNIEKFVKKVCKLACENGVEHQ-RSLR  179

Query  628  ASSL  639
            ASSL
Sbjct  180  ASSL  183



>ref|XP_010493940.1| PREDICTED: protein EFR3 homolog B-like isoform X1 [Camelina sativa]
 ref|XP_010493941.1| PREDICTED: protein EFR3 homolog B-like isoform X1 [Camelina sativa]
Length=986

 Score =   277 bits (709),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 151/186 (81%), Gaps = 2/186 (1%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSP--DGSANGRKIMKLC  261
            MG +SR +FPACESMCICCPALRSRSRQPVKRYKKLL +IFPKSP  DG+ N RKI+KLC
Sbjct  1    MGFISRNVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPVSDGAPNERKIVKLC  60

Query  262  EYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLN  441
            EYAAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLN
Sbjct  61   EYAAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLN  120

Query  442  VVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRC  621
            VV E+L+ +K D    +GC T T+FIYSQVDGTYT++IE    KVC+LARE G+E QK C
Sbjct  121  VVTELLENSKLDTPTILGCQTLTRFIYSQVDGTYTHSIEKFALKVCALAREEGDEHQKLC  180

Query  622  LRASSL  639
            LRAS L
Sbjct  181  LRASGL  186



>ref|XP_004495652.1| PREDICTED: uncharacterized protein LOC101508441 isoform X1 [Cicer 
arietinum]
 ref|XP_004495653.1| PREDICTED: uncharacterized protein LOC101508441 isoform X2 [Cicer 
arietinum]
 ref|XP_004495654.1| PREDICTED: uncharacterized protein LOC101508441 isoform X3 [Cicer 
arietinum]
 ref|XP_004495655.1| PREDICTED: uncharacterized protein LOC101508441 isoform X4 [Cicer 
arietinum]
Length=994

 Score =   277 bits (709),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+FPAC SMC+CCPALRSRSRQPVKRY+KLL DIFPKSPD   N RKI+KLCEY
Sbjct  1    MGIISRKIFPACGSMCVCCPALRSRSRQPVKRYRKLLVDIFPKSPDELPNERKIIKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKIAK LEERCYKELRS H KLV ++AE +N+LL MCK Q+A FAV++LNV+
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRSEHIKLVKIVAESFNKLLSMCKVQIAYFAVDVLNVI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+L  +K + ++T+GC + T+FIY QVD TYT+NIE LV+KVC L++E GE  +K CL+
Sbjct  121  SELLGYSKDETIQTLGCQSLTRFIYCQVDATYTHNIEKLVRKVCMLSQEPGETHEKHCLK  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>emb|CDY19753.1| BnaA09g04060D [Brassica napus]
Length=982

 Score =   276 bits (705),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SR +FPACE+MC+CCPALR RS+ P KRYKKLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNVFPACETMCVCCPALRPRSKHPAKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKIAK LEE+CYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKILEEKCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+L+ +K D    +GC T T+FIY+QVDGTYT++IE    KVCSLARE G+E QK+CLR
Sbjct  121  TELLENSKEDTPTILGCQTLTRFIYNQVDGTYTHSIEKFAHKVCSLAREQGDEHQKQCLR  180

Query  628  ASSL  639
            AS L
Sbjct  181  ASGL  184



>ref|XP_010267985.1| PREDICTED: uncharacterized protein LOC104605067 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267986.1| PREDICTED: uncharacterized protein LOC104605067 isoform X1 [Nelumbo 
nucifera]
Length=1001

 Score =   275 bits (704),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SRK+ P C +MC+CCPALRSRSRQP KRYKKLL++IFPKS DG  N RKI+KLCEY
Sbjct  1    MGFISRKVLPVCGNMCVCCPALRSRSRQPTKRYKKLLSEIFPKSLDGPPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A++NP RIPKIAK LE+R YKELRS H K VNVI E YN+LLCMCKEQMA FA++LLNVV
Sbjct  61   ASRNPIRIPKIAKYLEQRIYKELRSEHIKFVNVIMEAYNKLLCMCKEQMAYFALSLLNVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
            +E+LD  K D V+ +GC    +FIYSQ D TYT+NIE LV KVCSLA E+GEE  K+CLR
Sbjct  121  IELLDNTKQDVVRILGCQILARFIYSQADSTYTHNIEGLVHKVCSLACESGEERSKQCLR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>gb|KHN23227.1| Protein EFR3 like cmp44E [Glycine soja]
Length=896

 Score =   274 bits (701),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+FPAC +MC+CCPALRSRSRQPVKRY+KLLADIFPKSPD S + RKI KLCEY
Sbjct  1    MGVISRKIFPACGNMCVCCPALRSRSRQPVKRYRKLLADIFPKSPDESPSERKITKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKIAK LEERCYKELR  H KLVN+IAE +N+LL +CK Q+A FAV++LNV+
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRYEHLKLVNIIAESFNKLLSICKVQIAYFAVDVLNVI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
            +E+L  +K + ++T+GC   +KFIY Q+D TYT+NIE LV KVC L+RE GE  +KRCLR
Sbjct  121  LELLSYSKDETIQTLGCQCLSKFIYCQMDATYTHNIEKLVPKVCMLSREHGEACEKRCLR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>ref|XP_010267987.1| PREDICTED: uncharacterized protein LOC104605067 isoform X2 [Nelumbo 
nucifera]
Length=989

 Score =   275 bits (704),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SRK+ P C +MC+CCPALRSRSRQP KRYKKLL++IFPKS DG  N RKI+KLCEY
Sbjct  1    MGFISRKVLPVCGNMCVCCPALRSRSRQPTKRYKKLLSEIFPKSLDGPPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A++NP RIPKIAK LE+R YKELRS H K VNVI E YN+LLCMCKEQMA FA++LLNVV
Sbjct  61   ASRNPIRIPKIAKYLEQRIYKELRSEHIKFVNVIMEAYNKLLCMCKEQMAYFALSLLNVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
            +E+LD  K D V+ +GC    +FIYSQ D TYT+NIE LV KVCSLA E+GEE  K+CLR
Sbjct  121  IELLDNTKQDVVRILGCQILARFIYSQADSTYTHNIEGLVHKVCSLACESGEERSKQCLR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>ref|XP_006472204.1| PREDICTED: uncharacterized protein LOC102623618 [Citrus sinensis]
Length=1000

 Score =   275 bits (702),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 151/184 (82%), Gaps = 1/184 (1%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SRK+FPAC SMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG  N RKI+KLCEY
Sbjct  1    MGFISRKIFPACGSMCVCCPALRSRSRQPVKRYKKLLAEIFPKSIDGPPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKIAK LEERCYKELR  H KL+N++ E YN++LCMCK QMA FAV+LLNV 
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRCEHIKLINIVTEAYNKMLCMCKVQMAYFAVSLLNVA  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+LD +K + V+ +GC T ++FIYSQ D TYT+NIE  V+KVC LA E G E  +R LR
Sbjct  121  TELLDNSKQETVQILGCQTLSRFIYSQADSTYTHNIEKFVKKVCKLACENGVE-HRRSLR  179

Query  628  ASSL  639
            ASSL
Sbjct  180  ASSL  183



>ref|XP_003536043.1| PREDICTED: uncharacterized protein LOC100785587 isoform X1 [Glycine 
max]
 ref|XP_006589117.1| PREDICTED: uncharacterized protein LOC100785587 isoform X2 [Glycine 
max]
Length=997

 Score =   274 bits (701),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+FPAC +MC+CCPALRSRSRQPVKRY+KLLADIFPKSPD   + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGNMCVCCPALRSRSRQPVKRYRKLLADIFPKSPDEPPSERKIIKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKIAK LEERCYKELRS H KLVN+IAE +N+LL +CK Q+A FAV++LNV+
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRSEHIKLVNIIAESFNKLLSICKVQIAYFAVDVLNVI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
            +E+L  +K + ++T+GC   ++FIY QVD TYT++IE LV+KVC L++E GE  +KRCLR
Sbjct  121  LELLSYSKDETIQTLGCQCLSRFIYCQVDATYTHSIEKLVRKVCMLSQEHGEAREKRCLR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>ref|XP_006589118.1| PREDICTED: uncharacterized protein LOC100785587 isoform X3 [Glycine 
max]
 gb|KHN16056.1| Protein EFR3 like A [Glycine soja]
Length=996

 Score =   274 bits (701),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+FPAC +MC+CCPALRSRSRQPVKRY+KLLADIFPKSPD   + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGNMCVCCPALRSRSRQPVKRYRKLLADIFPKSPDEPPSERKIIKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKIAK LEERCYKELRS H KLVN+IAE +N+LL +CK Q+A FAV++LNV+
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRSEHIKLVNIIAESFNKLLSICKVQIAYFAVDVLNVI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
            +E+L  +K + ++T+GC   ++FIY QVD TYT++IE LV+KVC L++E GE  +KRCLR
Sbjct  121  LELLSYSKDETIQTLGCQCLSRFIYCQVDATYTHSIEKLVRKVCMLSQEHGEAREKRCLR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>ref|XP_003555181.1| PREDICTED: uncharacterized protein LOC100788290 [Glycine max]
Length=995

 Score =   274 bits (701),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+FPAC +MC+CCPALRSRSRQPVKRY+KLLADIFPKSPD S + RKI KLCEY
Sbjct  1    MGVISRKIFPACGNMCVCCPALRSRSRQPVKRYRKLLADIFPKSPDESPSERKITKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKIAK LEERCYKELR  H KLVN+IAE +N+LL +CK Q+A FAV++LNV+
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRYEHIKLVNIIAESFNKLLSICKVQIAYFAVDVLNVI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
            +E+L  +K + ++T+GC   +KFIY Q+D TYT+NIE LV KVC L+RE GE  +KRCLR
Sbjct  121  LELLSYSKDETIQTLGCQCLSKFIYCQMDATYTHNIEKLVPKVCMLSREHGEACEKRCLR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>ref|XP_010674649.1| PREDICTED: protein EFR3 homolog A [Beta vulgaris subsp. vulgaris]
Length=998

 Score =   268 bits (686),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRKLFPAC SMC+CCPALRSRSRQPVKRYKKL+ADIFPKSPDG  N RK++KLCEY
Sbjct  1    MGIISRKLFPACGSMCVCCPALRSRSRQPVKRYKKLIADIFPKSPDGQTNERKLVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKI K LEE+ ++ELR GH K+V ++ E Y++LLCMC +QMA FA +LL + 
Sbjct  61   AAKNPVRIPKITKQLEEKFFRELRYGHLKIVGIVMEAYDKLLCMCGKQMAYFAASLLLLS  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+LD +K  +V+ +GC T T+FIYSQ DGTY  NI   V KVC LA+ETGEE QKR LR
Sbjct  121  DEVLDQSKEVSVQVVGCQTLTRFIYSQTDGTYARNIGTFVNKVCMLAKETGEEHQKRSLR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>ref|XP_007145003.1| hypothetical protein PHAVU_007G201500g [Phaseolus vulgaris]
 gb|ESW16997.1| hypothetical protein PHAVU_007G201500g [Phaseolus vulgaris]
Length=999

 Score =   267 bits (682),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+FPAC +MC+CCPALRSRSRQPVKRY+KLLADIFPKSPD   + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGNMCVCCPALRSRSRQPVKRYRKLLADIFPKSPDEPPSDRKIIKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKIAK LEERC +EL+S H K+VN+I E +N+LL +CK Q+A FAV++LNV+
Sbjct  61   AAKNPFRIPKIAKYLEERCSRELKSEHIKMVNIIMESFNKLLSICKVQIAYFAVDVLNVI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+L  +K + ++T+GC   ++FIY QVD TYTYNIE LV+KV  L+R+ GE  +KRCLR
Sbjct  121  SEILSYSKDETIQTLGCQCLSRFIYCQVDSTYTYNIEKLVRKVSMLSRDHGEASEKRCLR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>ref|XP_010092978.1| hypothetical protein L484_018915 [Morus notabilis]
 gb|EXB53031.1| hypothetical protein L484_018915 [Morus notabilis]
Length=1022

 Score =   265 bits (677),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 155/204 (76%), Gaps = 20/204 (10%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+FPAC SMC+CCPALRS SR+PVKRYKKLLA+IFPKS DG  + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGSMCVCCPALRSSSRKPVKRYKKLLAEIFPKSLDGPPSERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A++NP RIPKIAK LEERCYKELR  H K +N++ + Y++LLC+CKEQMA FAV+LLNV+
Sbjct  61   ASRNPVRIPKIAKYLEERCYKELRCEHIKFINIVTDTYSKLLCLCKEQMAYFAVSLLNVI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQV--------------------DGTYTYNIENLV  567
             E+LD +K DAV+ +GC T T+FIYSQ+                    DGTYT+NIE+ V
Sbjct  121  NELLDNSKQDAVRILGCQTLTRFIYSQIFVVIDFYHELMFNGLMYEQADGTYTHNIESFV  180

Query  568  QKVCSLARETGEEDQKRCLRASSL  639
             KVC LARE G + Q+  LRASSL
Sbjct  181  HKVCLLARERGGDHQRHSLRASSL  204



>ref|XP_006840435.1| hypothetical protein AMTR_s00045p00164850 [Amborella trichopoda]
 gb|ERN02110.1| hypothetical protein AMTR_s00045p00164850 [Amborella trichopoda]
Length=1003

 Score =   263 bits (671),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 147/184 (80%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SR++FP C S+C+CCPALRSRSRQPVKRYKKLL+DIFPKS DG  N R+I KLCEY
Sbjct  1    MGFISRRVFPVCGSICVCCPALRSRSRQPVKRYKKLLSDIFPKSLDGPPNERRITKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKIAK LE+R +KEL   H K + +I + +N+LL MCKEQM  FA+ LLNV+
Sbjct  61   AAKNPFRIPKIAKFLEQRSHKELHCDHFKYIEIIMQAFNKLLSMCKEQMPYFAIYLLNVI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             + LD ++   ++ +GC T T FIYSQ DGTYT+NIE LV+KVC LARE+GEE +KR LR
Sbjct  121  SDHLDQSRPVTIQILGCQTLTNFIYSQADGTYTHNIEGLVRKVCVLARESGEESEKRRLR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>ref|XP_008453377.1| PREDICTED: uncharacterized protein LOC103494111 [Cucumis melo]
 ref|XP_008453385.1| PREDICTED: uncharacterized protein LOC103494111 [Cucumis melo]
 ref|XP_008453393.1| PREDICTED: uncharacterized protein LOC103494111 [Cucumis melo]
 ref|XP_008453402.1| PREDICTED: uncharacterized protein LOC103494111 [Cucumis melo]
Length=995

 Score =   262 bits (670),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+FPAC +MCICCPALRSRSRQPVKRYKKLLADIFPKS DG  + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGNMCICCPALRSRSRQPVKRYKKLLADIFPKSLDGPQSERKIIKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKI K LE+RC KELR+   K + +IA+ YN+LL +CK QMA FA +LL V+
Sbjct  61   AAKNPFRIPKIVKYLEDRCCKELRNEQVKCITIIADAYNKLLSLCKNQMAYFAGSLLKVI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
            VE+LD AK D ++ +GC T T FI++Q D TY +N+ENLV KVC LA E G++ +K+CLR
Sbjct  121  VELLDNAKHDDLRILGCQTLTNFIHNQADSTYMHNVENLVPKVCMLALERGDDHKKQCLR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>ref|XP_009384434.1| PREDICTED: uncharacterized protein LOC103971984 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384435.1| PREDICTED: uncharacterized protein LOC103971984 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384436.1| PREDICTED: uncharacterized protein LOC103971984 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=998

 Score =   261 bits (667),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 148/184 (80%), Gaps = 1/184 (1%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SRKL PAC +MC+CCPAL   SR+PVKRYKKLLA++FPK+ DG  N RKIMKLCEY
Sbjct  1    MGFISRKLLPACGNMCVCCPALNPSSRRPVKRYKKLLAEVFPKNLDGLPNERKIMKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AA+NP RIPKIAK LE+RCYKELR+ H   V +I EVY++LL +CKEQMA FA++LL+V+
Sbjct  61   AARNPIRIPKIAKYLEQRCYKELRNEHINFVKIITEVYSKLLYICKEQMAYFAISLLDVI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
            +E+LD  + D +K +GC T T+FI SQ D TYT+NIE LVQKVC LAR+ GEE QK  LR
Sbjct  121  IELLDSKQQDGIKILGCQTLTRFICSQADNTYTWNIEGLVQKVCMLARQNGEE-QKSLLR  179

Query  628  ASSL  639
            ASSL
Sbjct  180  ASSL  183



>ref|XP_009384437.1| PREDICTED: uncharacterized protein LOC103971984 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=997

 Score =   261 bits (666),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 148/184 (80%), Gaps = 1/184 (1%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SRKL PAC +MC+CCPAL   SR+PVKRYKKLLA++FPK+ DG  N RKIMKLCEY
Sbjct  1    MGFISRKLLPACGNMCVCCPALNPSSRRPVKRYKKLLAEVFPKNLDGLPNERKIMKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AA+NP RIPKIAK LE+RCYKELR+ H   V +I EVY++LL +CKEQMA FA++LL+V+
Sbjct  61   AARNPIRIPKIAKYLEQRCYKELRNEHINFVKIITEVYSKLLYICKEQMAYFAISLLDVI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
            +E+LD  + D +K +GC T T+FI SQ D TYT+NIE LVQKVC LAR+ GEE QK  LR
Sbjct  121  IELLDSKQQDGIKILGCQTLTRFICSQADNTYTWNIEGLVQKVCMLARQNGEE-QKSLLR  179

Query  628  ASSL  639
            ASSL
Sbjct  180  ASSL  183



>ref|XP_004144747.1| PREDICTED: uncharacterized protein LOC101202927 [Cucumis sativus]
 gb|KGN61004.1| hypothetical protein Csa_2G034570 [Cucumis sativus]
Length=995

 Score =   261 bits (666),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+FPAC ++CICCPALRSRSRQPVKRYKKLLADIFPKS DG  + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGNICICCPALRSRSRQPVKRYKKLLADIFPKSLDGPQSERKIIKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKI K LE+RC KELRS   K + +IA+ YN+LL +CK QMA FA +LL V+
Sbjct  61   AAKNPFRIPKIVKYLEDRCCKELRSEQVKCITIIADAYNKLLSLCKNQMAYFAGSLLKVI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
            VE+LD AK D ++ +GC T T FI++Q D TY + +ENLV KVC LA E GE+ +K+CLR
Sbjct  121  VELLDNAKHDDLRILGCQTLTNFIHNQADSTYMHTVENLVPKVCMLALERGEDHKKQCLR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>ref|XP_008778937.1| PREDICTED: protein EFR3 homolog cmp44E-like [Phoenix dactylifera]
Length=352

 Score =   247 bits (631),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 146/184 (79%), Gaps = 1/184 (1%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SRK+ PAC +MC+CCPALR  SR+PVKRYKKLLA+IFPK+ DG+ N RKIMKLCEY
Sbjct  1    MGFMSRKILPACGNMCVCCPALRPSSRRPVKRYKKLLAEIFPKNLDGTPNERKIMKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKIAK LE+R YKELRS H   V +I EVY++LL +CKEQMA FA++LLNV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSYKELRSEHINFVKIITEVYSKLLYICKEQMAYFAISLLNVI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
            +E+LD  + D+V+ +GC T TKFI SQ D TY  NIE LV+KVC LA   GEE QK  L+
Sbjct  121  IELLDNKQRDSVQILGCQTLTKFICSQADSTYARNIECLVRKVCVLAYRQGEE-QKSLLQ  179

Query  628  ASSL  639
            A+SL
Sbjct  180  AASL  183



>ref|XP_004165925.1| PREDICTED: uncharacterized LOC101202927 [Cucumis sativus]
Length=995

 Score =   261 bits (666),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+FPAC ++CICCPALRSRSRQPVKRYKKLLADIFPKS DG  + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGNICICCPALRSRSRQPVKRYKKLLADIFPKSLDGPQSERKIIKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNPFRIPKI K LE+RC KELRS   K + +IA+ YN+LL +CK QMA FA +LL V+
Sbjct  61   AAKNPFRIPKIVKYLEDRCCKELRSEQVKCITIIADAYNKLLSLCKNQMAYFAGSLLKVI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
            VE+LD AK D ++ +GC T T FI++Q D TY + +ENLV KVC LA E GE+ +K+CLR
Sbjct  121  VELLDNAKHDDLRILGCQTLTNFIHNQADSTYMHTVENLVPKVCMLALERGEDHKKQCLR  180

Query  628  ASSL  639
            ASSL
Sbjct  181  ASSL  184



>ref|XP_008808672.1| PREDICTED: uncharacterized protein LOC103720646 isoform X2 [Phoenix 
dactylifera]
Length=986

 Score =   254 bits (648),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 147/184 (80%), Gaps = 1/184 (1%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MGL+SRK+ PAC +MC+C PALR  SR+PVKRYKKLLA+IFPK+ DG  N RKI+KLCEY
Sbjct  1    MGLMSRKILPACGNMCVCFPALRPSSRRPVKRYKKLLAEIFPKTLDGPPNERKIIKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKIAK LE+R YKELR  H   V +I EVY++LL +CKEQMA FA++LLNV+
Sbjct  61   AAKNPVRIPKIAKFLEQRSYKELRCAHINFVKIITEVYSKLLYICKEQMAYFAISLLNVI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
            +E+LD  + D+++ +GC TFTKFIYSQ D TY  NIE+LV+KVC LA    EE+QK  LR
Sbjct  121  IELLDSKQQDSIQILGCQTFTKFIYSQADNTYARNIESLVRKVCMLAH-GQEEEQKSLLR  179

Query  628  ASSL  639
            A+SL
Sbjct  180  AASL  183



>ref|XP_008808671.1| PREDICTED: uncharacterized protein LOC103720646 isoform X1 [Phoenix 
dactylifera]
Length=994

 Score =   254 bits (648),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 147/184 (80%), Gaps = 1/184 (1%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MGL+SRK+ PAC +MC+C PALR  SR+PVKRYKKLLA+IFPK+ DG  N RKI+KLCEY
Sbjct  1    MGLMSRKILPACGNMCVCFPALRPSSRRPVKRYKKLLAEIFPKTLDGPPNERKIIKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKIAK LE+R YKELR  H   V +I EVY++LL +CKEQMA FA++LLNV+
Sbjct  61   AAKNPVRIPKIAKFLEQRSYKELRCAHINFVKIITEVYSKLLYICKEQMAYFAISLLNVI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
            +E+LD  + D+++ +GC TFTKFIYSQ D TY  NIE+LV+KVC LA    EE+QK  LR
Sbjct  121  IELLDSKQQDSIQILGCQTFTKFIYSQADNTYARNIESLVRKVCMLAH-GQEEEQKSLLR  179

Query  628  ASSL  639
            A+SL
Sbjct  180  AASL  183



>emb|CDX80597.1| BnaC07g28470D [Brassica napus]
Length=951

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 140/184 (76%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SR +FPACE + +CCPA   RS  PVKRYK LL DIFPKSPDG++N RKI+KLCEY
Sbjct  1    MGFISRTVFPACERVFVCCPAYGPRSLHPVKRYKILLLDIFPKSPDGASNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP  IPKIAKCLE  CYK+LRS   K +NV+ E YN +L  CK+ MA FA++LLNVV
Sbjct  61   AAKNPVHIPKIAKCLENMCYKDLRSRQMKFINVVTEAYNNMLFHCKDHMAYFAMSLLNVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+L  +K DA   +GC T T+FIY+QVD TYT++IE    +VCSLARE G+E QKRCLR
Sbjct  121  TELLVNSKQDAPTILGCQTLTRFIYTQVDRTYTHSIEKFAHRVCSLAREEGDEHQKRCLR  180

Query  628  ASSL  639
            AS L
Sbjct  181  ASGL  184



>ref|XP_010938251.1| PREDICTED: uncharacterized protein LOC105057345 isoform X2 [Elaeis 
guineensis]
Length=993

 Score =   253 bits (645),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 145/184 (79%), Gaps = 1/184 (1%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SRK+ PACE+MC+CCPALR  SR+PVKRYKKLL++IFPK+ DG  N RKI+KLCEY
Sbjct  1    MGFISRKILPACENMCVCCPALRPSSRRPVKRYKKLLSEIFPKTLDGPPNERKIIKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AA+NP RIPKIAK LE+R YKELR GH   V +I E Y++LL +CKEQMA FA++LLNV+
Sbjct  61   AARNPVRIPKIAKFLEQRSYKELRCGHINFVKIITEAYSKLLYVCKEQMAYFAISLLNVI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
            +E+LD  +   V+ +GC TFTKFIYSQ D TY  NIE+LVQKVC L+   G E QK  LR
Sbjct  121  IELLDSKQQVRVQILGCQTFTKFIYSQADNTYARNIESLVQKVCMLSHGQG-EGQKSLLR  179

Query  628  ASSL  639
            A+SL
Sbjct  180  AASL  183



>ref|XP_010938250.1| PREDICTED: uncharacterized protein LOC105057345 isoform X1 [Elaeis 
guineensis]
Length=1003

 Score =   252 bits (644),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 145/184 (79%), Gaps = 1/184 (1%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SRK+ PACE+MC+CCPALR  SR+PVKRYKKLL++IFPK+ DG  N RKI+KLCEY
Sbjct  1    MGFISRKILPACENMCVCCPALRPSSRRPVKRYKKLLSEIFPKTLDGPPNERKIIKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AA+NP RIPKIAK LE+R YKELR GH   V +I E Y++LL +CKEQMA FA++LLNV+
Sbjct  61   AARNPVRIPKIAKFLEQRSYKELRCGHINFVKIITEAYSKLLYVCKEQMAYFAISLLNVI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
            +E+LD  +   V+ +GC TFTKFIYSQ D TY  NIE+LVQKVC L+   G E QK  LR
Sbjct  121  IELLDSKQQVRVQILGCQTFTKFIYSQADNTYARNIESLVQKVCMLSHGQG-EGQKSLLR  179

Query  628  ASSL  639
            A+SL
Sbjct  180  AASL  183



>gb|ABF95548.1| cyclin, putative, expressed [Oryza sativa Japonica Group]
Length=729

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 145/184 (79%), Gaps = 3/184 (2%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +S KLFP+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK+PDG  N RKIMKLCEY
Sbjct  1    MGFMSAKLFPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGLPNERKIMKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKIAK LE+R +KELRS H   + +I E Y++LL +CKEQMA FA++L+NV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSHKELRSAHVNFIKIITEAYSKLLFICKEQMAYFAISLVNVL  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+L+ +K + +  +GC T  KFIYSQVD TY  NIE+LV+KVC L+R+ G E     LR
Sbjct  121  TELLE-SKQENIHILGCQTLAKFIYSQVDNTYARNIESLVRKVCVLSRQQGVEHS--LLR  177

Query  628  ASSL  639
            A+SL
Sbjct  178  AASL  181



>ref|XP_008781115.1| PREDICTED: uncharacterized protein LOC103700980 isoform X2 [Phoenix 
dactylifera]
Length=993

 Score =   250 bits (639),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 146/184 (79%), Gaps = 1/184 (1%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SRK+ PAC +MC+CCPALR  SR+PVKRYKKLLA+IFPK+ DG+ N RKIMKLCEY
Sbjct  1    MGFMSRKILPACGNMCVCCPALRPSSRRPVKRYKKLLAEIFPKNLDGTPNERKIMKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKIAK LE+R YKELRS H   V +I EVY++LL +CKEQMA FA++LLNV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSYKELRSEHINFVKIITEVYSKLLYICKEQMAYFAISLLNVI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
            +E+LD  + D+V+ +GC T TKFI SQ D TY  NIE LV+KVC LA   GEE QK  L+
Sbjct  121  IELLDNKQRDSVQILGCQTLTKFICSQADSTYARNIECLVRKVCVLAYRQGEE-QKSLLQ  179

Query  628  ASSL  639
            A+SL
Sbjct  180  AASL  183



>ref|XP_008781114.1| PREDICTED: protein EFR3 homolog cmp44E-like isoform X1 [Phoenix 
dactylifera]
Length=1013

 Score =   250 bits (638),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 146/184 (79%), Gaps = 1/184 (1%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SRK+ PAC +MC+CCPALR  SR+PVKRYKKLLA+IFPK+ DG+ N RKIMKLCEY
Sbjct  1    MGFMSRKILPACGNMCVCCPALRPSSRRPVKRYKKLLAEIFPKNLDGTPNERKIMKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKIAK LE+R YKELRS H   V +I EVY++LL +CKEQMA FA++LLNV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSYKELRSEHINFVKIITEVYSKLLYICKEQMAYFAISLLNVI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
            +E+LD  + D+V+ +GC T TKFI SQ D TY  NIE LV+KVC LA   GEE QK  L+
Sbjct  121  IELLDNKQRDSVQILGCQTLTKFICSQADSTYARNIECLVRKVCVLAYRQGEE-QKSLLQ  179

Query  628  ASSL  639
            A+SL
Sbjct  180  AASL  183



>ref|XP_010921489.1| PREDICTED: uncharacterized protein LOC105045026 [Elaeis guineensis]
Length=992

 Score =   249 bits (636),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SRK+ PAC +MC+CCPALR  SR+PVKRYKKLLA+IFPK+ DG  N RKIMKLCEY
Sbjct  1    MGFISRKILPACGNMCVCCPALRPSSRRPVKRYKKLLAEIFPKNLDGPPNERKIMKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKIAK LE+R YKELRS H   V +I E Y++LL +CKEQMA FA+ LLNV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSYKELRSEHINFVKIITETYSKLLYICKEQMAYFAIGLLNVI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
            +E+LD  + D+V+ +GC T  KFIYSQ D TY  NIE+LV  VC LA   GEE Q   L+
Sbjct  121  IELLDNKQRDSVQILGCQTLAKFIYSQADSTYARNIESLVGNVCVLAHGQGEE-QNSLLQ  179

Query  628  ASSL  639
            A+SL
Sbjct  180  AASL  183



>ref|XP_004984608.1| PREDICTED: uncharacterized protein LOC101782956 [Setaria italica]
Length=992

 Score =   249 bits (636),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 145/184 (79%), Gaps = 3/184 (2%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG LS KL P+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK+PDG+ N RKIMKLCEY
Sbjct  1    MGFLSAKLLPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGAPNERKIMKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKIAK LE+R +KELRS H   V +I E Y++LL +CKEQMA FA++L+NV+
Sbjct  61   AAKNPLRIPKIAKFLEQRTHKELRSAHVSFVRIITEAYSKLLFICKEQMAYFAISLMNVL  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+L+ +K + +  +GC T   FI SQVD TY  NIE+LV+KVC L+R+ GEE   R LR
Sbjct  121  TELLE-SKQENIHILGCQTLANFINSQVDNTYARNIESLVRKVCGLSRQQGEE--HRLLR  177

Query  628  ASSL  639
            A+SL
Sbjct  178  AASL  181



>ref|XP_006649970.1| PREDICTED: uncharacterized protein LOC102701065 [Oryza brachyantha]
Length=984

 Score =   248 bits (634),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 146/184 (79%), Gaps = 3/184 (2%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +S KLFP+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK+PDG  N RKIMKLCEY
Sbjct  1    MGFMSAKLFPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGPPNERKIMKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKIAK LE+R +KELR+ H   V +I E Y++LL +CKEQMA FA++L+NV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSHKELRAAHVNFVKIITEAYSKLLFICKEQMAYFAISLVNVL  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+L+ +K + +  +GC T  KFIYSQVD TY  NIE+LV+KVC+L+R+ G E     LR
Sbjct  121  TELLE-SKQENIHILGCQTLAKFIYSQVDNTYARNIESLVRKVCALSRQQGVE--HSLLR  177

Query  628  ASSL  639
            A+SL
Sbjct  178  AASL  181



>ref|NP_001049903.1| Os03g0308200 [Oryza sativa Japonica Group]
 gb|ABF95547.1| cyclin, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF11817.1| Os03g0308200 [Oryza sativa Japonica Group]
 dbj|BAG93123.1| unnamed protein product [Oryza sativa Japonica Group]
Length=988

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 145/184 (79%), Gaps = 3/184 (2%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +S KLFP+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK+PDG  N RKIMKLCEY
Sbjct  1    MGFMSAKLFPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGLPNERKIMKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKIAK LE+R +KELRS H   + +I E Y++LL +CKEQMA FA++L+NV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSHKELRSAHVNFIKIITEAYSKLLFICKEQMAYFAISLVNVL  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+L+ +K + +  +GC T  KFIYSQVD TY  NIE+LV+KVC L+R+ G E     LR
Sbjct  121  TELLE-SKQENIHILGCQTLAKFIYSQVDNTYARNIESLVRKVCVLSRQQGVE--HSLLR  177

Query  628  ASSL  639
            A+SL
Sbjct  178  AASL  181



>ref|XP_002465372.1| hypothetical protein SORBIDRAFT_01g037420 [Sorghum bicolor]
 gb|EER92370.1| hypothetical protein SORBIDRAFT_01g037420 [Sorghum bicolor]
Length=981

 Score =   247 bits (630),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 145/184 (79%), Gaps = 3/184 (2%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG LS KL P+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK+PDG+ N RKI+KLCEY
Sbjct  1    MGFLSAKLLPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGAPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKIAK LE+R +KELRS H   V +I E Y++LL +CKEQMA FA++L+NV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSHKELRSAHVNFVRIITEAYSKLLSICKEQMAYFAISLVNVL  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+L+ +K + +  +GC T   FI SQVD TY  NIE+LV KVC+L+R+ G+E   R LR
Sbjct  121  TELLE-SKQENIHILGCQTLANFINSQVDNTYARNIESLVHKVCALSRQQGQE--HRLLR  177

Query  628  ASSL  639
            A+SL
Sbjct  178  AASL  181



>emb|CDX88246.1| BnaA06g28370D [Brassica napus]
Length=963

 Score =   244 bits (624),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 138/184 (75%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SR +FPACE + +CCPAL  RS  PVKRYK LL DIFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRTVFPACERVFVCCPALGPRSLHPVKRYKLLLLDIFPKSPDGAPNERKIIKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP  IPKIAKCLE+ CYK+LRS   K + ++ E YN +L  CK+QM+ FA++LLNVV
Sbjct  61   AAKNPVHIPKIAKCLEKMCYKDLRSHQMKFIIIVTEAYNSMLFHCKDQMSYFAMSLLNVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+L  +K D    +GC T T+FIYSQVDGTYT+++E   +KVCSL RE G+E Q   LR
Sbjct  121  TELLVNSKQDTPTILGCQTLTRFIYSQVDGTYTHSLEKFARKVCSLVREEGDEHQNLGLR  180

Query  628  ASSL  639
            AS L
Sbjct  181  ASGL  184



>ref|XP_009151505.1| PREDICTED: uncharacterized protein LOC103874824 [Brassica rapa]
Length=767

 Score =   242 bits (618),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 137/184 (74%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +SR +FPACE + +CCPA   RS  PVKRYK LL DIFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRTVFPACERVFVCCPAYGPRSLHPVKRYKLLLLDIFPKSPDGAPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP  IPKIAKCLE+ CYK+LRS   K + ++ E YN +L  CK+QM+ FA++LLNVV
Sbjct  61   AAKNPVHIPKIAKCLEKMCYKDLRSHQMKFIIIVTEAYNSMLFHCKDQMSYFAMSLLNVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+L  +K D    +GC T T+FIYSQVDGTYT+++E   +KVCSL RE G+E Q   LR
Sbjct  121  TELLVNSKQDTPTILGCQTLTRFIYSQVDGTYTHSLEKFARKVCSLVREEGDEHQNLGLR  180

Query  628  ASSL  639
            AS L
Sbjct  181  ASGL  184



>ref|XP_008646153.1| PREDICTED: uncharacterized protein LOC100384293 isoform X2 [Zea 
mays]
 tpg|DAA45028.1| TPA: hypothetical protein ZEAMMB73_794622 [Zea mays]
Length=982

 Score =   244 bits (623),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 144/184 (78%), Gaps = 3/184 (2%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG LS KL P+CES+C+CCPALR  SR+PVKRYKKLLA+IFPK+PDG+ N RKI+KLCEY
Sbjct  1    MGFLSAKLLPSCESVCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGAPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKIAK LE+R +KELRS H   V +I E Y++LL +CKEQMA FA++L+NV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSHKELRSAHVNFVRIITEAYSKLLFICKEQMAYFAISLVNVL  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             E+L+ +K + V  +GC T   FI SQVD TY  NIE+LV KVC+L+R  GE+   R LR
Sbjct  121  TELLE-SKQENVHILGCQTLANFINSQVDNTYARNIESLVHKVCALSRRQGED--HRLLR  177

Query  628  ASSL  639
            A+SL
Sbjct  178  AASL  181



>ref|XP_010228707.1| PREDICTED: uncharacterized protein LOC100831072 isoform X1 [Brachypodium 
distachyon]
Length=995

 Score =   242 bits (617),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 142/184 (77%), Gaps = 3/184 (2%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +  KLFP+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK PDG  N RKIMKLCEY
Sbjct  1    MGFMGAKLFPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKMPDGPPNERKIMKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKIAK LE+R  KELR+ H   V +I E Y++LL +CKEQMA FA++L+NV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSRKELRAAHVNYVKIITEAYSKLLFICKEQMAYFAISLVNVL  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             ++L+ +K + +  +GC T  KFIYSQVD TY  N+E+LV KVC+L+R+ G E     LR
Sbjct  121  TDLLE-SKQENIHILGCQTLAKFIYSQVDNTYARNVESLVHKVCTLSRQQGVE--HNLLR  177

Query  628  ASSL  639
            A+SL
Sbjct  178  AASL  181



>ref|XP_003558072.1| PREDICTED: uncharacterized protein LOC100831072 isoform X2 [Brachypodium 
distachyon]
Length=994

 Score =   242 bits (617),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 142/184 (77%), Gaps = 3/184 (2%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +  KLFP+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK PDG  N RKIMKLCEY
Sbjct  1    MGFMGAKLFPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKMPDGPPNERKIMKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKIAK LE+R  KELR+ H   V +I E Y++LL +CKEQMA FA++L+NV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSRKELRAAHVNYVKIITEAYSKLLFICKEQMAYFAISLVNVL  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
             ++L+ +K + +  +GC T  KFIYSQVD TY  N+E+LV KVC+L+R+ G E     LR
Sbjct  121  TDLLE-SKQENIHILGCQTLAKFIYSQVDNTYARNVESLVHKVCTLSRQQGVE--HNLLR  177

Query  628  ASSL  639
            A+SL
Sbjct  178  AASL  181



>ref|XP_008646145.1| PREDICTED: uncharacterized protein LOC100384293 isoform X1 [Zea 
mays]
Length=983

 Score =   239 bits (610),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 144/185 (78%), Gaps = 4/185 (2%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG LS KL P+CES+C+CCPALR  SR+PVKRYKKLLA+IFPK+PDG+ N RKI+KLCEY
Sbjct  1    MGFLSAKLLPSCESVCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGAPNERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKIAK LE+R +KELRS H   V +I E Y++LL +CKEQMA FA++L+NV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSHKELRSAHVNFVRIITEAYSKLLFICKEQMAYFAISLVNVL  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYS-QVDGTYTYNIENLVQKVCSLARETGEEDQKRCL  624
             E+L+ +K + V  +GC T   FI S QVD TY  NIE+LV KVC+L+R  GE+   R L
Sbjct  121  TELLE-SKQENVHILGCQTLANFINSQQVDNTYARNIESLVHKVCALSRRQGED--HRLL  177

Query  625  RASSL  639
            RA+SL
Sbjct  178  RAASL  182



>ref|XP_010094723.1| hypothetical protein L484_003597 [Morus notabilis]
 gb|EXB56843.1| hypothetical protein L484_003597 [Morus notabilis]
Length=570

 Score =   229 bits (585),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 135/178 (76%), Gaps = 9/178 (5%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+FPAC SMC+CCPALRS SR+PVKRYKKLLA+IFPKS DG  + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGSMCVCCPALRSSSRKPVKRYKKLLAEIFPKSLDGPPSERKIVKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A++NP RIPKIAK LEERCYKELR  H K +N++ + Y++LLC+CKEQMA FAV+LLNV+
Sbjct  61   ASRNPVRIPKIAKYLEERCYKELRCEHIKFINIVTDTYSKLLCLCKEQMAYFAVSLLNVI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRC  621
             E+LD +K DAV+ +GC T T+FIYSQ+      N E             GEED +R 
Sbjct  121  NELLDNSKKDAVRILGCQTLTRFIYSQIVHVILDNYE---------PDTHGEEDDERA  169



>ref|XP_009765963.1| PREDICTED: protein EFR3 homolog cmp44E-like [Nicotiana sylvestris]
 ref|XP_009765964.1| PREDICTED: protein EFR3 homolog cmp44E-like [Nicotiana sylvestris]
 ref|XP_009765965.1| PREDICTED: protein EFR3 homolog cmp44E-like [Nicotiana sylvestris]
 ref|XP_009765966.1| PREDICTED: protein EFR3 homolog cmp44E-like [Nicotiana sylvestris]
Length=214

 Score =   216 bits (550),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 134/184 (73%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+ PAC ++C  CP+LR+RSRQPVKRYKKLLA+IFPKS D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGNLCFLCPSLRARSRQPVKRYKKLLAEIFPKSQDAEPNDRKIAKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNPFRIPKI + LE+RCYK+LR+ H   V V+  +Y +LL  CKE M  +A +LL ++
Sbjct  61   ASKNPFRIPKITEYLEQRCYKDLRNEHLGSVKVVTVIYRKLLSSCKEHMPLYATSLLGII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              + +  + D ++ +GC T   FI  Q+DGTY +N+E L+ K+C LARE G++D+   LR
Sbjct  121  RTLFEQTQHDEMQILGCNTLVDFINWQMDGTYMFNLEGLIPKMCQLAREIGDDDRALSLR  180

Query  628  ASSL  639
            ++ +
Sbjct  181  SAGM  184



>ref|XP_008798151.1| PREDICTED: uncharacterized protein LOC103713119 [Phoenix dactylifera]
Length=1043

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 136/184 (74%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+ PAC  +C  CPALR+RSRQPVKRYKKLL +IFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPACGRLCFFCPALRARSRQPVKRYKKLLVEIFPRTQDEEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A++NP RIPKI   LE+RCY+ELR+ H     +I  +Y++LL  C+EQM  FA +LL+VV
Sbjct  61   ASRNPLRIPKITSYLEQRCYRELRNEHFSFAKIIMCIYHKLLLTCREQMPLFATSLLSVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D ++ IGC T   F+ SQVDGTY +N+E L+ ++C LA+E GE+++ + LR
Sbjct  121  HTLLDQTRQDEMQIIGCQTLFDFVNSQVDGTYQFNLEGLIPRLCHLAQEVGEDERAQHLR  180

Query  628  ASSL  639
            A++L
Sbjct  181  AAAL  184



>gb|KDO53678.1| hypothetical protein CISIN_1g0359231mg, partial [Citrus sinensis]
Length=194

 Score =   205 bits (522),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 131/183 (72%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SRK+ PAC  +C  CPA+R+RSRQPVKRYKKL++DIFP++ D   N RKI KLCEYA
Sbjct  6    GVISRKVLPACGRLCFFCPAMRARSRQPVKRYKKLISDIFPRNQDEGPNDRKIGKLCEYA  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
             KNP RIPKI   LE+RCYKELR+ + +   ++  +Y +LL  CKEQM  FA +LL ++ 
Sbjct  66   NKNPLRIPKITTSLEQRCYKELRNENFQSAKIVMCIYRKLLISCKEQMPLFASSLLTIIH  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD  + D ++ IGC+T   F+ +Q DGTY +N+E  + K+C LA+E GE ++ R +R+
Sbjct  126  TLLDQTRQDEIQIIGCMTLFDFVNNQKDGTYMFNLECFIPKLCQLAQEVGENERARSIRS  185

Query  631  SSL  639
            + L
Sbjct  186  AGL  188



>ref|XP_009405043.1| PREDICTED: uncharacterized protein LOC103988214 [Musa acuminata 
subsp. malaccensis]
Length=1022

 Score =   219 bits (559),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 134/184 (73%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+ PAC ++C  CP+LR+RSRQPVKRYKKLLADIFP S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPACGNLCFFCPSLRARSRQPVKRYKKLLADIFPHSQDEEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
             ++NP RIPKI   LE+RCY+ELR+ H   V V+  +Y +LL  C+EQM  FA +LL+++
Sbjct  61   TSRNPLRIPKITNYLEQRCYRELRNEHFGYVKVVMRIYWKLLIACREQMPLFASSLLSII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              + D ++ D ++ IGC T   F+ SQVDGTY +N+E L+ ++CSLA+E GE++    LR
Sbjct  121  HTLFDQSRHDEMQIIGCHTLFDFVNSQVDGTYQFNLEGLIPRLCSLAQEMGEDENACYLR  180

Query  628  ASSL  639
            A+ L
Sbjct  181  AAGL  184



>ref|XP_010313082.1| PREDICTED: uncharacterized protein LOC101250362 isoform X1 [Solanum 
lycopersicum]
Length=994

 Score =   219 bits (558),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 134/184 (73%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRYKKLL +IFPKS D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGSLCFFCPSLRARSRQPVKRYKKLLGEIFPKSQDAEPNDRKIAKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A++NP RIPKI + LE+RCYK+LR+ H   V V+  +Y +LL  CKEQM  +A +LL ++
Sbjct  61   ASRNPLRIPKITEYLEQRCYKDLRNEHLGSVKVVTMIYRKLLSSCKEQMPLYAASLLGII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              + +  + D ++ +GC T   FI SQ+DGTY +N+E L+ K+C LARE G++D+   LR
Sbjct  121  RTLFEQTQHDEMQILGCNTLVDFINSQMDGTYMFNLEGLIPKLCQLAREVGDDDRALRLR  180

Query  628  ASSL  639
            ++ +
Sbjct  181  SAGM  184



>ref|XP_010932401.1| PREDICTED: uncharacterized protein LOC105053077 isoform X1 [Elaeis 
guineensis]
Length=797

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 133/184 (72%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRYKKLL+DIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPACGSLCFFCPSLRARSRQPVKRYKKLLSDIFPRSQDEEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKI   LE+RCYKELR  H   V V+  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITNYLEQRCYKELRIEHFGSVKVVMCIYRKLLISCKEQMPLFASSLLTII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D ++ IG  TF  F+ SQ DGTY +N+E ++ K+C LA+E GE+++   LR
Sbjct  121  CTLLDQTRQDEMRIIGSHTFFDFVNSQRDGTYMFNLEGIIPKLCYLAQEMGEDERAHNLR  180

Query  628  ASSL  639
            A+ L
Sbjct  181  AAGL  184



>ref|XP_004250744.1| PREDICTED: uncharacterized protein LOC101250362 isoform X2 [Solanum 
lycopersicum]
Length=993

 Score =   219 bits (558),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 134/184 (73%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRYKKLL +IFPKS D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGSLCFFCPSLRARSRQPVKRYKKLLGEIFPKSQDAEPNDRKIAKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A++NP RIPKI + LE+RCYK+LR+ H   V V+  +Y +LL  CKEQM  +A +LL ++
Sbjct  61   ASRNPLRIPKITEYLEQRCYKDLRNEHLGSVKVVTMIYRKLLSSCKEQMPLYAASLLGII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              + +  + D ++ +GC T   FI SQ+DGTY +N+E L+ K+C LARE G++D+   LR
Sbjct  121  RTLFEQTQHDEMQILGCNTLVDFINSQMDGTYMFNLEGLIPKLCQLAREVGDDDRALRLR  180

Query  628  ASSL  639
            ++ +
Sbjct  181  SAGM  184



>ref|XP_006352099.1| PREDICTED: uncharacterized protein LOC102584417 isoform X2 [Solanum 
tuberosum]
Length=999

 Score =   219 bits (558),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 134/184 (73%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRYKKLL +IFPKS D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGSLCFFCPSLRARSRQPVKRYKKLLGEIFPKSQDAEPNDRKIAKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A++NP RIPKI + LE+RCYK+LR+ H   V V+  +Y +LL  CKEQM  +A +LL ++
Sbjct  61   ASRNPLRIPKITEYLEQRCYKDLRNEHLGSVKVVTMIYRKLLSSCKEQMPLYAASLLGII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              + +  + D ++ +GC T   FI SQ+DGTY +N+E L+ K+C LARE G++D+   LR
Sbjct  121  RTLFEQTQHDEMQILGCNTLVDFINSQMDGTYMFNLEGLIPKLCQLAREVGDDDRALRLR  180

Query  628  ASSL  639
            ++ +
Sbjct  181  SAGM  184



>ref|XP_006352098.1| PREDICTED: uncharacterized protein LOC102584417 isoform X1 [Solanum 
tuberosum]
Length=1000

 Score =   219 bits (558),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 134/184 (73%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRYKKLL +IFPKS D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGSLCFFCPSLRARSRQPVKRYKKLLGEIFPKSQDAEPNDRKIAKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A++NP RIPKI + LE+RCYK+LR+ H   V V+  +Y +LL  CKEQM  +A +LL ++
Sbjct  61   ASRNPLRIPKITEYLEQRCYKDLRNEHLGSVKVVTMIYRKLLSSCKEQMPLYAASLLGII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              + +  + D ++ +GC T   FI SQ+DGTY +N+E L+ K+C LARE G++D+   LR
Sbjct  121  RTLFEQTQHDEMQILGCNTLVDFINSQMDGTYMFNLEGLIPKLCQLAREVGDDDRALRLR  180

Query  628  ASSL  639
            ++ +
Sbjct  181  SAGM  184



>ref|XP_009393518.1| PREDICTED: uncharacterized protein LOC103979184 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009393521.1| PREDICTED: uncharacterized protein LOC103979184 [Musa acuminata 
subsp. malaccensis]
Length=1021

 Score =   218 bits (556),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 133/184 (72%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ PAC ++C  CP+LR+RSRQPVKRYKKLL D+FP+SPDG  N R I KLCEY
Sbjct  1    MGVMSRRVLPACGNLCCFCPSLRARSRQPVKRYKKLLTDVFPRSPDGQPNDRMIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKI   LE+RCYKELR+G      V+  +Y +LL  CKEQM  +A +LL++V
Sbjct  61   ASKNPMRIPKITNYLEQRCYKELRNGQFNSAKVVPCIYRKLLASCKEQMPLYATSLLSIV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D ++ +GCLT   F+ +QVD TY +N+E  + K+C L +E GE+D+   LR
Sbjct  121  RTLLDQTQQDDMRILGCLTLVDFLNNQVDSTYMFNVEGFIPKLCQLGQEIGEDDRGLRLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>ref|XP_003591099.1| EFR3-like protein [Medicago truncatula]
Length=210

 Score =   203 bits (517),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 130/181 (72%), Gaps = 19/181 (10%)
 Frame = +1

Query  97   LSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAK  276
            +S +L  AC      CPALRSRSRQPVK Y+KLLADIFPKSP    N RKI+KLCEYAAK
Sbjct  14   ISSQLVRAC---VFTCPALRSRSRQPVKCYRKLLADIFPKSP--LPNERKIVKLCEYAAK  68

Query  277  NPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVVEM  456
            NP RIPKIAK LEERCYKELRS H KLV +IAE +N+LL +CK Q+  FAV++LNV  E+
Sbjct  69   NPLRIPKIAKYLEERCYKELRSEHIKLVKIIAESFNKLLSICKAQITYFAVDVLNVTSEL  128

Query  457  LDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASS  636
            LD +K +A+              QVD TYT+NIE LV+KVC L++E GE  +  CLRASS
Sbjct  129  LDYSKDEAI--------------QVDSTYTHNIEKLVRKVCMLSQEPGETHENGCLRASS  174

Query  637  L  639
            L
Sbjct  175  L  175



>ref|XP_006858684.1| hypothetical protein AMTR_s00066p00085830 [Amborella trichopoda]
 gb|ERN20151.1| hypothetical protein AMTR_s00066p00085830 [Amborella trichopoda]
Length=1020

 Score =   217 bits (552),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 134/184 (73%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ P C S+C  CP+LR+RSRQPVKRYKKLLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRRVLPVCGSLCFFCPSLRARSRQPVKRYKKLLADIFPRSQDAEPNDRKICKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKI K LE+RCY+ELR+ H   V V+  +Y +LL   KEQM  FA +LL+++
Sbjct  61   AAKNPLRIPKITKYLEQRCYRELRNEHFGSVKVVLCIYRKLLASSKEQMPLFASSLLSII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + D +  +GC T   FI SQVDGTY +N+E L+ K+C L++E GE+++   LR
Sbjct  121  RTLLEQTQQDEMLILGCNTLVDFINSQVDGTYMFNLEGLIPKLCQLSQEVGEDERAHNLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>ref|XP_009401306.1| PREDICTED: uncharacterized protein LOC103985362 [Musa acuminata 
subsp. malaccensis]
Length=1028

 Score =   217 bits (552),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 134/184 (73%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+ PAC ++C  CP+LR RSRQPVKRYKKLLADIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGALCFLCPSLRERSRQPVKRYKKLLADIFPRAQDEEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A++NP RIPKI   LE+RCYKE+R+     V V+  +Y +LL  C+EQM  FA +LL+++
Sbjct  61   ASRNPLRIPKITTYLEQRCYKEMRNERFGSVKVVMCIYRKLLIACREQMPLFASSLLSII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              + D  + D ++ IGC T   F+ SQVDGTY +N+E++V ++CSLA+E GE++    LR
Sbjct  121  HTLFDQTRHDEMQIIGCYTLFDFVNSQVDGTYQFNLESMVPRLCSLAQEVGEDENAGSLR  180

Query  628  ASSL  639
            A+ L
Sbjct  181  AAGL  184



>ref|XP_008784320.1| PREDICTED: uncharacterized protein LOC103703292 isoform X2 [Phoenix 
dactylifera]
Length=1034

 Score =   216 bits (550),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 132/184 (72%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRYKKLL+DIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPACGSLCFFCPSLRARSRQPVKRYKKLLSDIFPRSQDEEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKI   LE+RCYKELR  H   V ++  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITNYLEQRCYKELRIEHFGSVKIVMCIYRKLLISCKEQMPLFASSLLTII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + + ++ IGC TF  F+  Q D TY +N+E ++ K+C LA+E GE+++   LR
Sbjct  121  RTLLDQTRQEEMRIIGCNTFFDFVNGQRDSTYMFNLEGIIPKLCHLAQEMGEDERAHNLR  180

Query  628  ASSL  639
            A+ L
Sbjct  181  AAGL  184



>ref|XP_008784321.1| PREDICTED: uncharacterized protein LOC103703292 isoform X3 [Phoenix 
dactylifera]
Length=1028

 Score =   216 bits (550),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 132/184 (72%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRYKKLL+DIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPACGSLCFFCPSLRARSRQPVKRYKKLLSDIFPRSQDEEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKI   LE+RCYKELR  H   V ++  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITNYLEQRCYKELRIEHFGSVKIVMCIYRKLLISCKEQMPLFASSLLTII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + + ++ IGC TF  F+  Q D TY +N+E ++ K+C LA+E GE+++   LR
Sbjct  121  RTLLDQTRQEEMRIIGCNTFFDFVNGQRDSTYMFNLEGIIPKLCHLAQEMGEDERAHNLR  180

Query  628  ASSL  639
            A+ L
Sbjct  181  AAGL  184



>ref|XP_006838291.1| hypothetical protein AMTR_s00103p00108190 [Amborella trichopoda]
 gb|ERN00860.1| hypothetical protein AMTR_s00103p00108190 [Amborella trichopoda]
Length=1044

 Score =   216 bits (550),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 132/184 (72%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+ PAC  +C  CP+LR+RSRQPVKRYKKLLADIFPKS D   N RKI KLCEY
Sbjct  1    MGIMSRKVLPACGRLCFFCPSLRARSRQPVKRYKKLLADIFPKSQDEEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP R+PKIA  LE+RCYKELR  H     V+  +Y +LL  CKEQM   A +LL+V+
Sbjct  61   ASKNPLRVPKIADYLEQRCYKELRIEHFGFAKVVMCIYRKLLFSCKEQMPLLASSLLSVI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D ++ +GC T   F+ +Q+DGTY +N+E+ V K+C LA+E GE+D+   LR
Sbjct  121  RTLLDQTRQDDMRVLGCQTLVDFVNNQMDGTYMFNLESFVPKLCQLAQEMGEDDRGCILR  180

Query  628  ASSL  639
            +  L
Sbjct  181  SFGL  184



>ref|XP_008784316.1| PREDICTED: protein EFR3 homolog isoform X1 [Phoenix dactylifera]
 ref|XP_008784317.1| PREDICTED: protein EFR3 homolog isoform X1 [Phoenix dactylifera]
 ref|XP_008784318.1| PREDICTED: protein EFR3 homolog isoform X1 [Phoenix dactylifera]
 ref|XP_008784319.1| PREDICTED: protein EFR3 homolog isoform X1 [Phoenix dactylifera]
Length=1058

 Score =   216 bits (550),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 132/184 (72%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRYKKLL+DIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPACGSLCFFCPSLRARSRQPVKRYKKLLSDIFPRSQDEEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKI   LE+RCYKELR  H   V ++  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITNYLEQRCYKELRIEHFGSVKIVMCIYRKLLISCKEQMPLFASSLLTII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + + ++ IGC TF  F+  Q D TY +N+E ++ K+C LA+E GE+++   LR
Sbjct  121  RTLLDQTRQEEMRIIGCNTFFDFVNGQRDSTYMFNLEGIIPKLCHLAQEMGEDERAHNLR  180

Query  628  ASSL  639
            A+ L
Sbjct  181  AAGL  184



>ref|XP_011457274.1| PREDICTED: uncharacterized protein LOC101313176 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=984

 Score =   215 bits (547),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 135/184 (73%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ PAC ++C  CP+LR+RSRQPVKRYKKLL+DIFP+  D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGNLCFFCPSLRARSRQPVKRYKKLLSDIFPRHQDAEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKI + LE++CYK+LR+ H   V VI  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITELLEQKCYKDLRNEHFGSVKVILRIYRKLLSSCKEQMPLFASSLLEII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + D ++ +GC T   FI SQ+DGT+ +N+E L+ K+C LA+E G++++   LR
Sbjct  121  RILLEQTRHDEMQILGCNTLVDFINSQIDGTHMFNLEGLIPKLCELAQEMGDDERALHLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>ref|XP_004309822.1| PREDICTED: uncharacterized protein LOC101313176 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457272.1| PREDICTED: uncharacterized protein LOC101313176 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457273.1| PREDICTED: uncharacterized protein LOC101313176 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=998

 Score =   215 bits (547),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 135/184 (73%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ PAC ++C  CP+LR+RSRQPVKRYKKLL+DIFP+  D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGNLCFFCPSLRARSRQPVKRYKKLLSDIFPRHQDAEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKI + LE++CYK+LR+ H   V VI  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITELLEQKCYKDLRNEHFGSVKVILRIYRKLLSSCKEQMPLFASSLLEII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + D ++ +GC T   FI SQ+DGT+ +N+E L+ K+C LA+E G++++   LR
Sbjct  121  RILLEQTRHDEMQILGCNTLVDFINSQIDGTHMFNLEGLIPKLCELAQEMGDDERALHLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>ref|XP_009625867.1| PREDICTED: protein EFR3 homolog isoform X2 [Nicotiana tomentosiformis]
Length=924

 Score =   214 bits (545),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 133/184 (72%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+ PAC ++C  CP+LR+RSRQPVKRYKKLLA+IFPKS D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGNLCFFCPSLRARSRQPVKRYKKLLAEIFPKSQDAEPNDRKIAKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNPFRIPKI + LE+RCYK+LR+ H   V V+  +Y +LL  CKE M  +A +LL ++
Sbjct  61   ASKNPFRIPKITEYLEQRCYKDLRNEHLGSVKVVTVIYRKLLSSCKEHMPLYATSLLGII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              + +  + D ++ +GC T   FI  Q+DGTY +N+E L+ K+C LARE G++ +   LR
Sbjct  121  RTLFEQTQHDEMQILGCNTLVDFINCQMDGTYMFNLEGLIPKMCQLAREIGDDGRALRLR  180

Query  628  ASSL  639
            ++ +
Sbjct  181  SAGM  184



>ref|XP_009625862.1| PREDICTED: protein EFR3 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625864.1| PREDICTED: protein EFR3 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625865.1| PREDICTED: protein EFR3 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625866.1| PREDICTED: protein EFR3 homolog isoform X1 [Nicotiana tomentosiformis]
Length=993

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 133/184 (72%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+ PAC ++C  CP+LR+RSRQPVKRYKKLLA+IFPKS D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGNLCFFCPSLRARSRQPVKRYKKLLAEIFPKSQDAEPNDRKIAKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNPFRIPKI + LE+RCYK+LR+ H   V V+  +Y +LL  CKE M  +A +LL ++
Sbjct  61   ASKNPFRIPKITEYLEQRCYKDLRNEHLGSVKVVTVIYRKLLSSCKEHMPLYATSLLGII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              + +  + D ++ +GC T   FI  Q+DGTY +N+E L+ K+C LARE G++ +   LR
Sbjct  121  RTLFEQTQHDEMQILGCNTLVDFINCQMDGTYMFNLEGLIPKMCQLAREIGDDGRALRLR  180

Query  628  ASSL  639
            ++ +
Sbjct  181  SAGM  184



>emb|CDP16550.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   213 bits (543),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/193 (51%), Positives = 135/193 (70%), Gaps = 9/193 (5%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+ PAC ++C  CP++R+RSRQPVKRYKKLLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGNLCFFCPSMRARSRQPVKRYKKLLADIFPRSQDAEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPK---------IAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMAC  420
            A+KNP RIPK         I + LE++ YK+LR+ H   V V+  +Y +LL  CKEQM  
Sbjct  61   ASKNPLRIPKASLIHLFALITEYLEQKFYKDLRNEHFGSVKVVLRIYRKLLSSCKEQMPL  120

Query  421  FAVNLLNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETG  600
            FA +LL +V  +LD  + D ++ +GC T   FI  Q+DGTY +N+E L+ K+C LARE G
Sbjct  121  FASSLLGMVRTLLDLPQYDELQILGCNTLVDFINGQLDGTYMFNLEGLIPKLCQLAREVG  180

Query  601  EEDQKRCLRASSL  639
            ++D+  CLR++ +
Sbjct  181  DDDRALCLRSAGM  193



>ref|XP_002264735.1| PREDICTED: uncharacterized protein LOC100264644 isoform X1 [Vitis 
vinifera]
 ref|XP_010650556.1| PREDICTED: uncharacterized protein LOC100264644 isoform X1 [Vitis 
vinifera]
 ref|XP_010650557.1| PREDICTED: uncharacterized protein LOC100264644 isoform X1 [Vitis 
vinifera]
 emb|CBI36655.3| unnamed protein product [Vitis vinifera]
Length=1000

 Score =   213 bits (543),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 134/184 (73%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ PAC ++C  CP+LR+RSRQPVKRYKKLLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGNLCFFCPSLRARSRQPVKRYKKLLADIFPRSQDAEPNERKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KN  RIPKI   LE+RCYK+LR+GH     V+  +Y +LL  CKEQM  +A +LL +V
Sbjct  61   ASKNALRIPKITDYLEQRCYKDLRNGHFGSAKVVLCIYRKLLSSCKEQMPFYASSLLGMV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + D ++ +GC T   FI SQ+DGTY +N+E L+ K+C LA+E GE+++   LR
Sbjct  121  RILLEQTRHDEMRILGCSTLVDFINSQMDGTYMFNLEGLIPKLCQLAQEPGEDERALSLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>ref|XP_009355500.1| PREDICTED: uncharacterized protein LOC103946512 [Pyrus x bretschneideri]
 ref|XP_009355501.1| PREDICTED: uncharacterized protein LOC103946512 [Pyrus x bretschneideri]
Length=1036

 Score =   213 bits (542),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 135/183 (74%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR++ PAC S+C  CPALR+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEY 
Sbjct  6    GVISRQVLPACGSLCFFCPALRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYV  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            AKNP RIPKI   LE+RCYKELR+ + +   ++  +YN+LL  CKEQM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITTYLEQRCYKELRNENFRSAKIVMCIYNKLLISCKEQMPLFASSLLSIMH  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD  + D ++ IGC T   F+ +Q DGTYT+N+E  + K+C +A+E GE+++   LR+
Sbjct  126  TLLDQTRQDEMQIIGCQTLFNFVNNQTDGTYTFNLEGFIPKLCQIAQEPGEDERASNLRS  185

Query  631  SSL  639
            ++L
Sbjct  186  AAL  188



>ref|XP_011078902.1| PREDICTED: uncharacterized protein LOC105162543 [Sesamum indicum]
Length=1009

 Score =   213 bits (541),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 132/183 (72%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR++ PAC S+C  CPALR RSRQPVKRYKKL++DIFPKS D   N RKI KLCEYA
Sbjct  7    GVISRQVLPACGSLCFFCPALRERSRQPVKRYKKLISDIFPKSLDEEPNDRKIGKLCEYA  66

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            AKNP RIPKIA  LE+RCYKELR+ + + V V+  +Y + L  CKEQM  FA +LL ++ 
Sbjct  67   AKNPLRIPKIANSLEQRCYKELRNENFRAVKVVMCIYRKFLSACKEQMPLFANSLLTIIN  126

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD    D +  IGC +   F+ +Q DGTY +N+E L+ K+C LA+E G++++   LRA
Sbjct  127  TLLDQTSQDEMLVIGCHSVFDFVNNQNDGTYMFNLEGLIPKLCQLAQEPGDDERAENLRA  186

Query  631  SSL  639
            ++L
Sbjct  187  AAL  189



>ref|XP_009626575.1| PREDICTED: protein EFR3 homolog B-like [Nicotiana tomentosiformis]
Length=204

 Score =   198 bits (504),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 130/184 (71%), Gaps = 1/184 (1%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG+ S ++ PAC+ +C+CCPA+R+RSRQPVKRYKKL++D FP+SPDG  N R I KLCEY
Sbjct  1    MGI-SHRIMPACDQLCVCCPAMRTRSRQPVKRYKKLISDSFPRSPDGEPNDRMINKLCEY  59

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKI   LE+RCY+ELR+ +   V V+  +Y +LL  CK+QM  FA + L+++
Sbjct  60   ASKNPLRIPKITSVLEQRCYRELRNENIGSVKVVMCIYRKLLTSCKQQMPLFAGSFLSII  119

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D ++ +GC     FI +Q D TY +N E L+ K+C LA+E GE+++   LR
Sbjct  120  HILLDQTRHDEMRIVGCQALFDFIINQRDSTYMFNFEGLIPKICLLAQEMGEDERVLKLR  179

Query  628  ASSL  639
             + L
Sbjct  180  CAGL  183



>dbj|BAK01387.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1055

 Score =   213 bits (541),  Expect = 8e-60, Method: Composition-based stats.
 Identities = 98/184 (53%), Positives = 132/184 (72%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+ PAC ++C  CP LR+RSRQPVKRYKK+LA+IFP++PD   N R+I KLCEY
Sbjct  1    MGVISRKVLPACGALCYFCPGLRARSRQPVKRYKKILAEIFPRTPDEEPNERRIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP R+PKI   LE+R YKELR+       V+  +Y  LL  CKEQM  FA +LL++V
Sbjct  61   AAKNPLRVPKITVYLEQRIYKELRTEQYGFAKVVMLIYRRLLVSCKEQMPLFASSLLSIV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D ++ IGC T   F  +QVDGTY +N+E LV ++C LA+E GE+++   LR
Sbjct  121  HTLLDQKRQDDMRIIGCETLFDFAVNQVDGTYQFNLEGLVPRLCELAQEAGEDERATSLR  180

Query  628  ASSL  639
            A++L
Sbjct  181  AAAL  184



>ref|XP_006443048.1| hypothetical protein CICLE_v100186802mg, partial [Citrus clementina]
 gb|ESR56288.1| hypothetical protein CICLE_v100186802mg, partial [Citrus clementina]
Length=190

 Score =   197 bits (502),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 130/184 (71%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ P C ++C  CP++R+RSRQPVKRYKK+LADIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVLPVCGNLCFFCPSMRARSRQPVKRYKKMLADIFPRNQDAEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKI   LE+RCYK+LR+ +   V V+  +Y + L  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITTLLEQRCYKDLRNENFGSVKVVVCIYKKFLSSCKEQMPLFASSLLGII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + + ++ +GC T   FI SQ D TY +N+E L+ K+C LA+E G +++   LR
Sbjct  121  RTLLEQTRQEEMQILGCGTLVNFIDSQTDSTYMFNLEGLIPKLCQLAQEMGNDERALRLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>ref|XP_010241226.1| PREDICTED: uncharacterized protein LOC104585894 isoform X1 [Nelumbo 
nucifera]
Length=1005

 Score =   212 bits (540),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 133/184 (72%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+ P C S+C  CPALR+RSRQPVKRYKKL+A+IFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPVCGSLCFFCPALRARSRQPVKRYKKLIAEIFPRSQDEEPNDRKISKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKI   LE+RCYKELR+    L  V+  +Y +LL  CK+QM  FA +LL+++
Sbjct  61   ASKNPMRIPKITSTLEQRCYKELRNEQFWLAKVVMCIYRKLLISCKDQMPLFASSLLSII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D ++ IGC T   F+ +Q DGTY +N+E ++ K+C L++E G++++   LR
Sbjct  121  NILLDQTRQDEIRIIGCQTLFDFVNNQTDGTYMFNLEGMIPKLCMLSQEVGQDERAEQLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>ref|XP_009391228.1| PREDICTED: uncharacterized protein LOC103977445 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391229.1| PREDICTED: uncharacterized protein LOC103977445 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391230.1| PREDICTED: uncharacterized protein LOC103977445 [Musa acuminata 
subsp. malaccensis]
Length=1033

 Score =   212 bits (540),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 131/184 (71%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR + PACES+CI CP+LR+RSRQPVKRYKKLLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRSIMPACESLCIFCPSLRTRSRQPVKRYKKLLADIFPRSQDEEPNDRKISKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
             ++NP RIPKI   LE++ YKELR  H   V V+  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   VSRNPLRIPKITSYLEQKFYKELRLEHFGTVKVVLCIYRKLLVSCKEQMPLFASSLLTII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D +  IGC T   F+  Q+DGTY +N+E L+ K+C LA+E GE+++   +R
Sbjct  121  CTLLDQRRQDEMCIIGCHTIFDFVICQIDGTYMFNLEGLIPKLCELAQEMGEDERANDMR  180

Query  628  ASSL  639
            A+ L
Sbjct  181  AAGL  184



>ref|XP_008231409.1| PREDICTED: uncharacterized protein LOC103330592 [Prunus mume]
Length=1053

 Score =   212 bits (540),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 136/184 (74%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++FP CES+C  CPALR+RSR PVKRYKKLLA+IFP+SPD   N RKI KLCEY
Sbjct  1    MGVISRQVFPVCESLCFFCPALRARSRHPVKRYKKLLAEIFPRSPDEEPNDRKISKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+K P RIPKI   LE+RCYK+LR+ +   V V+  +Y +LL  CKEQM  FA ++L++V
Sbjct  61   ASKTPLRIPKITTTLEQRCYKDLRTENFHSVKVVMCIYRKLLVSCKEQMPLFASSVLSIV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD ++ D ++ +GC T  +F+ +Q DGTY +N++ ++ K+C LA+E  E+  ++ LR
Sbjct  121  QILLDQSRHDEIRILGCQTLFEFVNNQKDGTYMFNLDGMIPKLCLLAQEMREDGSEKHLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>ref|XP_010257180.1| PREDICTED: uncharacterized protein LOC104597386 isoform X2 [Nelumbo 
nucifera]
Length=1010

 Score =   212 bits (539),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 133/184 (72%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+ P C+ +C  CP++R+RSRQPVKRYKKL+ADIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPICDGLCFLCPSMRTRSRQPVKRYKKLIADIFPRSQDEEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKIA  LE+RCYKELR+   +L  V+  +Y +LL  CK+QM  FA +LL+++
Sbjct  61   ASKNPLRIPKIANSLEQRCYKELRNEQFRLAKVVMCIYRKLLISCKDQMPLFASSLLSII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  +   ++ IGC T   F+ SQ+DGTY +N+E L+ K+C  A+E G+++    LR
Sbjct  121  NTLLDQTRQYEMRVIGCQTLFDFVNSQMDGTYMFNLEGLIPKICQTAQEIGDDEGTCQLR  180

Query  628  ASSL  639
            A+ L
Sbjct  181  AAGL  184



>ref|XP_007218911.1| hypothetical protein PRUPE_ppa000649mg [Prunus persica]
 gb|EMJ20110.1| hypothetical protein PRUPE_ppa000649mg [Prunus persica]
Length=1052

 Score =   212 bits (539),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 136/184 (74%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++FP CES+C  CPALR+RSR PVKRYKKLLA+IFP+SPD   N RKI KLCEY
Sbjct  1    MGVISRQVFPVCESLCFFCPALRARSRHPVKRYKKLLAEIFPRSPDEEPNDRKISKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+K P RIPKI   LE+RCYK+LR+ +   V V+  +Y +LL  CKEQM  FA ++L++V
Sbjct  61   ASKTPLRIPKITTTLEQRCYKDLRTENFHSVKVVMCIYRKLLVSCKEQMPLFASSVLSIV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD ++ D ++ +GC T  +F+ +Q DGTY +N++ ++ K+C LA+E  E+  ++ LR
Sbjct  121  QILLDQSRHDDIRILGCQTLFEFVNNQKDGTYMFNLDGMIPKLCLLAQEMREDGSEKHLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>ref|XP_010257179.1| PREDICTED: uncharacterized protein LOC104597386 isoform X1 [Nelumbo 
nucifera]
Length=1026

 Score =   212 bits (539),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 133/184 (72%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+ P C+ +C  CP++R+RSRQPVKRYKKL+ADIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPICDGLCFLCPSMRTRSRQPVKRYKKLIADIFPRSQDEEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKIA  LE+RCYKELR+   +L  V+  +Y +LL  CK+QM  FA +LL+++
Sbjct  61   ASKNPLRIPKIANSLEQRCYKELRNEQFRLAKVVMCIYRKLLISCKDQMPLFASSLLSII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  +   ++ IGC T   F+ SQ+DGTY +N+E L+ K+C  A+E G+++    LR
Sbjct  121  NTLLDQTRQYEMRVIGCQTLFDFVNSQMDGTYMFNLEGLIPKICQTAQEIGDDEGTCQLR  180

Query  628  ASSL  639
            A+ L
Sbjct  181  AAGL  184



>gb|EAY92960.1| hypothetical protein OsI_14753 [Oryza sativa Indica Group]
Length=279

 Score =   200 bits (508),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 123/175 (70%), Gaps = 0/175 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+ PAC S+C  CP LR+RSRQPVKRYK +LA+IFPK+ D   N R+I KLCEY
Sbjct  1    MGVISRKVLPACGSLCYFCPGLRARSRQPVKRYKSILAEIFPKTQDEEPNERRIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
             ++NP R+PKI   LE+R YKELRS       V+  +Y  LL  CKEQM  FA +LL++V
Sbjct  61   CSRNPLRVPKITVSLEQRIYKELRSEQYGFAKVVMLIYRRLLVSCKEQMPLFASSLLSIV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQ  612
              +LD  + D ++ IGC T   F  +QVDGTY +N+E LV ++C L++E GE++Q
Sbjct  121  HTLLDQKRQDDMRIIGCETLFDFAVNQVDGTYQFNLEGLVPRLCELSQEVGEDEQ  175



>ref|XP_007203221.1| hypothetical protein PRUPE_ppa000725mg [Prunus persica]
 gb|EMJ04420.1| hypothetical protein PRUPE_ppa000725mg [Prunus persica]
Length=1021

 Score =   211 bits (538),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 134/183 (73%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G+LSR++ PAC  +C  CPALR+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GILSRQVLPACGGLCFFCPALRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYA  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            AKNP RIPKI   LE+RCYKELR+ + +   ++  +YN+LL  CKEQM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITNFLEQRCYKELRNENFRSTKIVMCIYNKLLISCKEQMRLFASSLLSIMH  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD  + D ++ IGC T   F+ +Q DGTY +N+E  + K+C +A+E GE+++   LR+
Sbjct  126  TLLDQTRQDEMQIIGCQTLFNFVNNQKDGTYMFNLEGFIPKLCQIAQEPGEDERANNLRS  185

Query  631  SSL  639
            ++L
Sbjct  186  AAL  188



>gb|EPS68493.1| hypothetical protein M569_06272 [Genlisea aurea]
Length=1007

 Score =   211 bits (537),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 130/183 (71%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR++ PACES+C  CP LR+RSRQPVKRYKKL+ADIFP+S D   N RKI KLCEYA
Sbjct  6    GVISRQILPACESLCFFCPGLRTRSRQPVKRYKKLIADIFPRSQDEEPNYRKIEKLCEYA  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            +KNP RIPKI   LE+RCYKELR  + + V ++  +Y +LL  CKEQM  FA +LL+++ 
Sbjct  66   SKNPMRIPKIESSLEQRCYKELRVENIRSVKIVMSIYKKLLFTCKEQMPLFANSLLSIIY  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD    D +   GC T   F+ +Q D TY +N+E L+ K+C +A+E G++D+   +RA
Sbjct  126  VLLDQTNHDEMLISGCQTLFDFVNNQNDSTYMFNLEGLIPKLCQIAQEVGDDDRGENIRA  185

Query  631  SSL  639
            + L
Sbjct  186  AGL  188



>ref|XP_004304390.1| PREDICTED: uncharacterized protein LOC101298629 [Fragaria vesca 
subsp. vesca]
Length=1028

 Score =   211 bits (536),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 134/183 (73%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR++ PAC S+C  CP LR+RSRQPVKRYKKL+ADIFPK+ +   N RKI KLCEYA
Sbjct  6    GVVSRQVLPACGSLCFFCPGLRARSRQPVKRYKKLIADIFPKNQEEGPNDRKIGKLCEYA  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            +KNP RIPKI   LE+RCYKELR+ + +   ++  +Y +LL  CKEQM  FA +LL+++ 
Sbjct  66   SKNPLRIPKITTSLEQRCYKELRNENFRSTKIVMCIYKKLLITCKEQMPLFASSLLSIMH  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD  + D ++ IGC T   F+ +QVDGTY +N+E  + K+C +A+E GE+++   LR+
Sbjct  126  TLLDQTRQDEMQIIGCQTLFDFVNNQVDGTYMFNLEGFIPKLCQIAQEPGEDERANNLRS  185

Query  631  SSL  639
            ++L
Sbjct  186  AAL  188



>ref|XP_010523667.1| PREDICTED: protein EFR3 homolog isoform X1 [Tarenaya hassleriana]
Length=1028

 Score =   211 bits (536),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 130/184 (71%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR +FP CES+C  CPALR+RSR PVKRYKKLL+DIFP+SPD   N RKI KLCEY
Sbjct  1    MGVVSRTVFPVCESLCCFCPALRARSRHPVKRYKKLLSDIFPRSPDEQPNDRKISKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKN  RIPKI + LE+RCY++LR      V ++  +Y +LL  CKEQM+ FA + L ++
Sbjct  61   AAKNSLRIPKITRSLEQRCYRDLRMEQFHSVKIVMCIYKKLLVSCKEQMSLFASSYLGLI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D ++ +GC     F+ +Q DGT+ +N++ L+  +C LA E GEE++ R LR
Sbjct  121  HILLDQTRHDEIRILGCEALYDFVNNQTDGTHMFNLDGLIPNICPLAHEMGEEERPRNLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>ref|XP_010523668.1| PREDICTED: protein EFR3 homolog isoform X2 [Tarenaya hassleriana]
Length=1019

 Score =   210 bits (535),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 130/184 (71%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR +FP CES+C  CPALR+RSR PVKRYKKLL+DIFP+SPD   N RKI KLCEY
Sbjct  1    MGVVSRTVFPVCESLCCFCPALRARSRHPVKRYKKLLSDIFPRSPDEQPNDRKISKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKN  RIPKI + LE+RCY++LR      V ++  +Y +LL  CKEQM+ FA + L ++
Sbjct  61   AAKNSLRIPKITRSLEQRCYRDLRMEQFHSVKIVMCIYKKLLVSCKEQMSLFASSYLGLI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D ++ +GC     F+ +Q DGT+ +N++ L+  +C LA E GEE++ R LR
Sbjct  121  HILLDQTRHDEIRILGCEALYDFVNNQTDGTHMFNLDGLIPNICPLAHEMGEEERPRNLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>ref|XP_006421414.1| hypothetical protein CICLE_v10006843mg [Citrus clementina]
 gb|ESR34654.1| hypothetical protein CICLE_v10006843mg [Citrus clementina]
Length=1027

 Score =   211 bits (536),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 131/183 (72%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SRK+ PAC  +C  CPA+R+RSRQPVKRYKKL++DIFP++ D   N RKI KLCEYA
Sbjct  6    GVISRKVLPACGRLCFFCPAMRARSRQPVKRYKKLISDIFPRNQDEGPNDRKIGKLCEYA  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
             KNP RIPKI   LE+RCYKELR+ + +   ++  +Y +LL  CKEQM  FA +LL ++ 
Sbjct  66   NKNPLRIPKITTSLEQRCYKELRNENFQFAKIVMCIYRKLLISCKEQMPLFASSLLTIIH  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD  + D ++ IGC+T   F+ +Q DGTY +N+E  + K+C LA+E GE ++ R +R+
Sbjct  126  TLLDQTRQDEIQIIGCMTLFDFVNNQKDGTYMFNLECFIPKLCQLAQEVGENERARSIRS  185

Query  631  SSL  639
            + L
Sbjct  186  AGL  188



>ref|XP_002322714.1| cyclin-related family protein [Populus trichocarpa]
 gb|EEF04475.1| cyclin-related family protein [Populus trichocarpa]
Length=1020

 Score =   209 bits (533),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 131/183 (72%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            GL+SR++ PAC S+C  CPA+R+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GLVSRQVMPACGSLCFFCPAMRARSRQPVKRYKKLMADIFPRNQEEGPNDRKIGKLCEYA  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            AKNP RIPKI   LE+RCYKELR  + +   ++  +Y +LL  CKEQM  FA +LL ++ 
Sbjct  66   AKNPLRIPKITCSLEQRCYKELRIENFQSAKIVMCIYRKLLVTCKEQMTLFASSLLGIIN  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD  + D ++ IGC T   F+ +Q DGTY +N+E  + K+C  A+E GE+++ + LRA
Sbjct  126  TLLDQTRQDDIQVIGCETLFDFVNNQKDGTYMFNLEGFIPKLCQFAQEEGEDERAKSLRA  185

Query  631  SSL  639
            + L
Sbjct  186  AGL  188



>ref|XP_002975992.1| hypothetical protein SELMODRAFT_443103 [Selaginella moellendorffii]
 gb|EFJ22897.1| hypothetical protein SELMODRAFT_443103 [Selaginella moellendorffii]
Length=950

 Score =   209 bits (531),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 130/184 (71%), Gaps = 1/184 (1%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ P C  +C+CCP LR+RSRQPVKRYKKLL+D+FPKS     N RKI KL +Y
Sbjct  1    MGIISRRVLPLCGHLCVCCPGLRARSRQPVKRYKKLLSDLFPKSQAEQPNDRKISKLTDY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A KNPFRIPKIAK LE R YKELR  H   V VI   + +L   CK+QM   AV+ LN++
Sbjct  61   AVKNPFRIPKIAKNLELRGYKELRHEHHGSVRVIMRTFFKLFSTCKDQMPLLAVSALNMI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + D ++ +GC+T  +FIY QVD TY +N+++ + K C+LARETG E ++  LR
Sbjct  121  HVLLE-QQNDEMRVLGCVTVVEFIYQQVDTTYMHNLDSFIPKFCALARETGPEPKRSILR  179

Query  628  ASSL  639
            A+ L
Sbjct  180  AAGL  183



>ref|XP_002968494.1| hypothetical protein SELMODRAFT_90004 [Selaginella moellendorffii]
 gb|EFJ30748.1| hypothetical protein SELMODRAFT_90004 [Selaginella moellendorffii]
Length=875

 Score =   208 bits (530),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 130/184 (71%), Gaps = 1/184 (1%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ P C  +C+CCP LR+RSRQPVKRYKKLL+D+FPKS     N RKI KL +Y
Sbjct  1    MGIISRRVLPLCGHLCVCCPGLRARSRQPVKRYKKLLSDLFPKSQAEQPNDRKISKLTDY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A KNPFRIPKIAK LE R YKELR  H   V VI   + +L   CK+QM   AV+ LN++
Sbjct  61   AVKNPFRIPKIAKNLELRGYKELRHEHYGSVRVIMRTFFKLFSTCKDQMPLLAVSALNMI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + D ++ +GC+T  +FIY QVD TY +N+++ + K C+LARETG E ++  LR
Sbjct  121  HVLLE-QQNDEMRVLGCVTVVEFIYQQVDTTYMHNLDSFIPKFCALARETGPEPKRSILR  179

Query  628  ASSL  639
            A+ L
Sbjct  180  AAGL  183



>ref|XP_009379628.1| PREDICTED: uncharacterized protein LOC103968023 isoform X2 [Pyrus 
x bretschneideri]
Length=1036

 Score =   209 bits (533),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 133/183 (73%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR++ PAC S+C  CPALR+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEY 
Sbjct  6    GVISRQVLPACGSLCFFCPALRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYV  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            AKNP RIPKI   LE+RCYKELR+ + +   ++  +YN+LL  CKEQM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITTYLEQRCYKELRNENFRSAKIVMCIYNKLLISCKEQMPLFASSLLSIMH  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD  + D ++ IGC T   F+ +Q+DGTY +N+E  + K C +A+E GE++    LR+
Sbjct  126  TLLDQTRQDEMQIIGCQTLFNFVNNQMDGTYMFNLEGFIPKFCQIAQEPGEDEGASNLRS  185

Query  631  SSL  639
            ++L
Sbjct  186  AAL  188



>ref|XP_009379627.1| PREDICTED: uncharacterized protein LOC103968023 isoform X1 [Pyrus 
x bretschneideri]
Length=1040

 Score =   209 bits (533),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 133/183 (73%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR++ PAC S+C  CPALR+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEY 
Sbjct  6    GVISRQVLPACGSLCFFCPALRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYV  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            AKNP RIPKI   LE+RCYKELR+ + +   ++  +YN+LL  CKEQM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITTYLEQRCYKELRNENFRSAKIVMCIYNKLLISCKEQMPLFASSLLSIMH  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD  + D ++ IGC T   F+ +Q+DGTY +N+E  + K C +A+E GE++    LR+
Sbjct  126  TLLDQTRQDEMQIIGCQTLFNFVNNQMDGTYMFNLEGFIPKFCQIAQEPGEDEGASNLRS  185

Query  631  SSL  639
            ++L
Sbjct  186  AAL  188



>gb|KEH23652.1| cyclin-like protein [Medicago truncatula]
Length=990

 Score =   209 bits (531),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 131/183 (72%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR++ PAC S+C CCP+LR+RSRQPVKRYKKL+ADIFP++ +   N RKI KLC+Y 
Sbjct  6    GVVSRQVLPACGSLCFCCPSLRTRSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCDYV  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            AKNP RIPKI   LE+RCYKELR+ +     ++  +Y + L  CKEQM  FA ++L+++ 
Sbjct  66   AKNPLRIPKIVTALEQRCYKELRNENIHSTRIVMCIYKKFLSSCKEQMPLFASSILSIIQ  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD  + D ++ IGC     F+ +QVDGTY +N+E ++ K+C L +ETGE++  R  R+
Sbjct  126  ALLDQTRQDEMRVIGCNILFDFVNNQVDGTYLFNLEGVIPKLCQLTQETGEDESARIRRS  185

Query  631  SSL  639
            + L
Sbjct  186  AGL  188



>ref|XP_004308677.1| PREDICTED: uncharacterized protein LOC101307642 [Fragaria vesca 
subsp. vesca]
Length=1047

 Score =   209 bits (532),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 133/184 (72%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MGL+ R++FP CES+C  CPALR+RSR PVKRYKKLLA+IFP+SPD   N RKI KLCEY
Sbjct  1    MGLIQRQVFPVCESLCFFCPALRARSRHPVKRYKKLLAEIFPRSPDEEPNDRKISKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+K P RIPKI   LE+RCYK+LR+ +   V V+  VY +LL  CK+QM  FA +LL +V
Sbjct  61   ASKTPLRIPKITTTLEQRCYKDLRTENFHSVKVVMCVYRKLLISCKDQMPLFASSLLTIV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD ++ D ++ +GC T  +F+ +Q DGTY +N+++++ K+C +A+E  E+     +R
Sbjct  121  QILLDQSRHDEMRILGCQTLFEFVNNQKDGTYMFNLDSMIPKLCQIAQEMREDGTAMKVR  180

Query  628  ASSL  639
            A+ L
Sbjct  181  AAGL  184



>ref|XP_010653791.1| PREDICTED: uncharacterized protein LOC100255472 isoform X2 [Vitis 
vinifera]
Length=993

 Score =   208 bits (530),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 132/183 (72%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SRK+ PAC ++C  CPA+R RSRQP+KRYKKL++DIFP++ D   N RKI KLCEYA
Sbjct  6    GVISRKVLPACGNLCFLCPAMRPRSRQPLKRYKKLISDIFPRAQDEEPNDRKIGKLCEYA  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            AKNP RIPKI   LE+RCYKELRS + +   V+  +Y + L  CKEQM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITNSLEQRCYKELRSENFRSAKVVMCIYRKFLVSCKEQMPLFASSLLSIIH  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD A+ D ++ IGC T   F+ +Q DGTY  N+E  + K+C LA+E GE+++ + LR+
Sbjct  126  TLLDQARQDEMQIIGCQTLFDFVNNQRDGTYMCNLEGFIPKLCQLAQEVGEDERAQHLRS  185

Query  631  SSL  639
            + L
Sbjct  186  AGL  188



>ref|XP_011075240.1| PREDICTED: uncharacterized protein LOC105159750 isoform X2 [Sesamum 
indicum]
Length=1011

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 132/183 (72%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR++ PAC S+C  CPALRSRSRQPVKRYKKL++DIFP+S +   N RKI KLCEYA
Sbjct  6    GVISRQVLPACGSLCFFCPALRSRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGKLCEYA  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            AKNP RIPKIA  LE+RCYKELR+ + + V ++  +Y ++L  CKEQM  FA +++ ++ 
Sbjct  66   AKNPMRIPKIATSLEQRCYKELRNENFRSVKIVMCIYRKMLSSCKEQMPLFANSVMTIIQ  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD A  D +  IGC +   F+ +Q D TY +N+E  + K+C LA+E GE+++   LRA
Sbjct  126  TLLDQANQDEMLIIGCESLFDFVNNQNDATYMFNLEGFITKLCQLAQEVGEDERAEHLRA  185

Query  631  SSL  639
            + L
Sbjct  186  AGL  188



>ref|XP_011075238.1| PREDICTED: uncharacterized protein LOC105159750 isoform X1 [Sesamum 
indicum]
 ref|XP_011075239.1| PREDICTED: uncharacterized protein LOC105159750 isoform X1 [Sesamum 
indicum]
Length=1012

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 132/183 (72%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR++ PAC S+C  CPALRSRSRQPVKRYKKL++DIFP+S +   N RKI KLCEYA
Sbjct  6    GVISRQVLPACGSLCFFCPALRSRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGKLCEYA  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            AKNP RIPKIA  LE+RCYKELR+ + + V ++  +Y ++L  CKEQM  FA +++ ++ 
Sbjct  66   AKNPMRIPKIATSLEQRCYKELRNENFRSVKIVMCIYRKMLSSCKEQMPLFANSVMTIIQ  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD A  D +  IGC +   F+ +Q D TY +N+E  + K+C LA+E GE+++   LRA
Sbjct  126  TLLDQANQDEMLIIGCESLFDFVNNQNDATYMFNLEGFITKLCQLAQEVGEDERAEHLRA  185

Query  631  SSL  639
            + L
Sbjct  186  AGL  188



>ref|XP_002277870.1| PREDICTED: uncharacterized protein LOC100255472 isoform X1 [Vitis 
vinifera]
Length=1017

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 132/183 (72%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SRK+ PAC ++C  CPA+R RSRQP+KRYKKL++DIFP++ D   N RKI KLCEYA
Sbjct  6    GVISRKVLPACGNLCFLCPAMRPRSRQPLKRYKKLISDIFPRAQDEEPNDRKIGKLCEYA  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            AKNP RIPKI   LE+RCYKELRS + +   V+  +Y + L  CKEQM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITNSLEQRCYKELRSENFRSAKVVMCIYRKFLVSCKEQMPLFASSLLSIIH  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD A+ D ++ IGC T   F+ +Q DGTY  N+E  + K+C LA+E GE+++ + LR+
Sbjct  126  TLLDQARQDEMQIIGCQTLFDFVNNQRDGTYMCNLEGFIPKLCQLAQEVGEDERAQHLRS  185

Query  631  SSL  639
            + L
Sbjct  186  AGL  188



>ref|XP_008443197.1| PREDICTED: uncharacterized protein LOC103486854 isoform X1 [Cucumis 
melo]
 ref|XP_008443199.1| PREDICTED: uncharacterized protein LOC103486854 isoform X1 [Cucumis 
melo]
 ref|XP_008443200.1| PREDICTED: uncharacterized protein LOC103486854 isoform X1 [Cucumis 
melo]
 ref|XP_008443201.1| PREDICTED: uncharacterized protein LOC103486854 isoform X1 [Cucumis 
melo]
Length=1003

 Score =   208 bits (530),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 132/183 (72%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR++ P C S+C  CPALR+RSRQPVKRYKKL+ADIFP++P+   N RKI KLCEYA
Sbjct  9    GVISRQVLPVCGSLCFFCPALRARSRQPVKRYKKLIADIFPRNPEEGPNDRKIGKLCEYA  68

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
             KNP RIPKI   LE+RCYKELR+ + + V V+  +Y +LL  CKEQM  FA +L++++ 
Sbjct  69   GKNPLRIPKITTSLEQRCYKELRNENFQAVKVVMSIYRKLLVSCKEQMPLFASSLISIMQ  128

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             ++D  +   ++ IGC T   F+ SQ DGTY +N+E  + K+C +A+++G+++    LR+
Sbjct  129  TLMDQTRQKEMQIIGCQTLFSFVNSQSDGTYMFNLEAFIPKLCQIAQDSGDDEGAENLRS  188

Query  631  SSL  639
            + L
Sbjct  189  AGL  191



>gb|KCW90195.1| hypothetical protein EUGRSUZ_A02368 [Eucalyptus grandis]
Length=1010

 Score =   208 bits (529),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 132/183 (72%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR++ P C S+C  CPA+R+RSRQPVKRYKKL++DIFPK+ D   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCFFCPAMRARSRQPVKRYKKLISDIFPKNQDEEPNDRKIGKLCEYA  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            AKNP RIPKI   LE+RCYKELR+ + +   ++  +Y +LL  CK+QM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITSTLEQRCYKELRTENFRSAKIVMCIYRKLLVSCKDQMPLFASSLLSIIS  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD  + D ++ IGC     F+ +Q DGTY +N+E  + K+C LA+E G++++ + LRA
Sbjct  126  TLLDQTRQDEMQLIGCQNLFDFVNNQGDGTYMFNLEGFIPKLCQLAQELGQDERAQHLRA  185

Query  631  SSL  639
            + L
Sbjct  186  AGL  188



>ref|XP_011033323.1| PREDICTED: uncharacterized protein LOC105131844 isoform X1 [Populus 
euphratica]
Length=1018

 Score =   208 bits (529),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 130/183 (71%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            GL+SR++ PAC S+C  CPA+R+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GLVSRQVMPACGSLCFFCPAMRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYA  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            AKNP RIPKI   LE+RCYKELR  + +   ++  +Y +LL  CKE M  FA +LL ++ 
Sbjct  66   AKNPLRIPKITCSLEQRCYKELRIENFQSAKIVMCIYRKLLVTCKEHMTLFASSLLGIIN  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD  + D ++ IGC T   F+ +Q DGTY +N+E  + K+C  A+E GE+++ + LRA
Sbjct  126  TLLDQTRQDDIQVIGCETLFDFVNNQKDGTYMFNLEGFIPKLCQFAQEEGEDERAKSLRA  185

Query  631  SSL  639
            + L
Sbjct  186  AGL  188



>ref|XP_010057214.1| PREDICTED: uncharacterized protein LOC104445096 isoform X1 [Eucalyptus 
grandis]
Length=1045

 Score =   208 bits (529),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 132/183 (72%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR++ P C S+C  CPA+R+RSRQPVKRYKKL++DIFPK+ D   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCFFCPAMRARSRQPVKRYKKLISDIFPKNQDEEPNDRKIGKLCEYA  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            AKNP RIPKI   LE+RCYKELR+ + +   ++  +Y +LL  CK+QM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITSTLEQRCYKELRTENFRSAKIVMCIYRKLLVSCKDQMPLFASSLLSIIS  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD  + D ++ IGC     F+ +Q DGTY +N+E  + K+C LA+E G++++ + LRA
Sbjct  126  TLLDQTRQDEMQLIGCQNLFDFVNNQGDGTYMFNLEGFIPKLCQLAQELGQDERAQHLRA  185

Query  631  SSL  639
            + L
Sbjct  186  AGL  188



>ref|XP_006489936.1| PREDICTED: uncharacterized protein LOC102624456 [Citrus sinensis]
Length=1039

 Score =   208 bits (529),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 131/183 (72%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SRK+ PAC  +C  CPA+R+RSRQPVKRYKKL++DIFP++ D   N RKI KLCEYA
Sbjct  6    GVISRKVLPACGRLCFFCPAMRARSRQPVKRYKKLISDIFPRNQDEGPNDRKIGKLCEYA  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
             KNP RIPKI   LE+RCYKELR+ + +   ++  +Y +LL  CKEQM  FA +LL ++ 
Sbjct  66   NKNPLRIPKITTSLEQRCYKELRNENFQSAKIVMCIYRKLLISCKEQMPLFASSLLTIIH  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD  + D ++ IGC+T   F+ +Q DGTY +N+E  + K+C L++E GE ++ R +R+
Sbjct  126  TLLDQTRQDEIQIIGCMTLFDFVNNQKDGTYMFNLECFIPKLCQLSQEVGENERARSIRS  185

Query  631  SSL  639
            + L
Sbjct  186  AGL  188



>ref|XP_010057221.1| PREDICTED: uncharacterized protein LOC104445096 isoform X2 [Eucalyptus 
grandis]
Length=1036

 Score =   208 bits (529),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 132/183 (72%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR++ P C S+C  CPA+R+RSRQPVKRYKKL++DIFPK+ D   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCFFCPAMRARSRQPVKRYKKLISDIFPKNQDEEPNDRKIGKLCEYA  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            AKNP RIPKI   LE+RCYKELR+ + +   ++  +Y +LL  CK+QM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITSTLEQRCYKELRTENFRSAKIVMCIYRKLLVSCKDQMPLFASSLLSIIS  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD  + D ++ IGC     F+ +Q DGTY +N+E  + K+C LA+E G++++ + LRA
Sbjct  126  TLLDQTRQDEMQLIGCQNLFDFVNNQGDGTYMFNLEGFIPKLCQLAQELGQDERAQHLRA  185

Query  631  SSL  639
            + L
Sbjct  186  AGL  188



>ref|XP_011033324.1| PREDICTED: protein EFR3 homolog B-like isoform X2 [Populus euphratica]
Length=1010

 Score =   207 bits (528),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 130/183 (71%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            GL+SR++ PAC S+C  CPA+R+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GLVSRQVMPACGSLCFFCPAMRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYA  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            AKNP RIPKI   LE+RCYKELR  + +   ++  +Y +LL  CKE M  FA +LL ++ 
Sbjct  66   AKNPLRIPKITCSLEQRCYKELRIENFQSAKIVMCIYRKLLVTCKEHMTLFASSLLGIIN  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD  + D ++ IGC T   F+ +Q DGTY +N+E  + K+C  A+E GE+++ + LRA
Sbjct  126  TLLDQTRQDDIQVIGCETLFDFVNNQKDGTYMFNLEGFIPKLCQFAQEEGEDERAKSLRA  185

Query  631  SSL  639
            + L
Sbjct  186  AGL  188



>ref|XP_010241507.1| PREDICTED: uncharacterized protein LOC104586087 isoform X2 [Nelumbo 
nucifera]
Length=997

 Score =   207 bits (527),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 133/184 (72%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ P C ++C  CP++R+RSRQPVKRYKKLL+DIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPVCGNLCFFCPSMRARSRQPVKRYKKLLSDIFPRSQDAEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKI K LE+RCYK+LR+ H   V V+  +Y +LL  CK+QM  FA ++L +V
Sbjct  61   ASKNPLRIPKITKYLEQRCYKDLRNEHFGSVKVVLCIYRKLLSSCKDQMPLFASSILCIV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+ ++ D ++ +GC T   FI SQ D TY +N+E L+ K+C LA+E G+ ++   +R
Sbjct  121  RTLLEQSRQDEMRILGCQTLVDFINSQTDSTYMFNLEGLIPKLCELAQEFGDSERTLSVR  180

Query  628  ASSL  639
            A+ L
Sbjct  181  AAGL  184



>ref|NP_197607.5| uncharacterized protein [Arabidopsis thaliana]
 gb|AED92929.1| uncharacterized protein AT5G21080 [Arabidopsis thaliana]
Length=1025

 Score =   207 bits (528),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 124/184 (67%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR +FP CES+C  CPALR+RSR PVKRYK LLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRTVFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSQDEQPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKI   LE+RCYKELR      V ++  +Y +LL  C EQM  FA + L ++
Sbjct  61   AAKNPLRIPKITTSLEQRCYKELRMEQFHSVKIVMSIYKKLLVSCNEQMLLFASSYLGLI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D ++ +GC     F+ SQ +GTY +N++ L+ K+C LA E GEED    L 
Sbjct  121  HILLDQTRYDEMRILGCEALYDFVTSQAEGTYMFNLDGLIPKICPLAHELGEEDSTTNLC  180

Query  628  ASSL  639
            A+ L
Sbjct  181  AAGL  184



>ref|XP_010241506.1| PREDICTED: uncharacterized protein LOC104586087 isoform X1 [Nelumbo 
nucifera]
Length=998

 Score =   207 bits (527),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 133/184 (72%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ P C ++C  CP++R+RSRQPVKRYKKLL+DIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPVCGNLCFFCPSMRARSRQPVKRYKKLLSDIFPRSQDAEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKI K LE+RCYK+LR+ H   V V+  +Y +LL  CK+QM  FA ++L +V
Sbjct  61   ASKNPLRIPKITKYLEQRCYKDLRNEHFGSVKVVLCIYRKLLSSCKDQMPLFASSILCIV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+ ++ D ++ +GC T   FI SQ D TY +N+E L+ K+C LA+E G+ ++   +R
Sbjct  121  RTLLEQSRQDEMRILGCQTLVDFINSQTDSTYMFNLEGLIPKLCELAQEFGDSERTLSVR  180

Query  628  ASSL  639
            A+ L
Sbjct  181  AAGL  184



>ref|XP_007033975.1| ARM repeat superfamily protein isoform 5 [Theobroma cacao]
 gb|EOY04901.1| ARM repeat superfamily protein isoform 5 [Theobroma cacao]
Length=984

 Score =   207 bits (526),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 133/184 (72%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ P C ++C  CP++R+RSRQPVKRYKKLLADIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPVCGNLCFFCPSMRARSRQPVKRYKKLLADIFPRNQDAEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A +NP RIPKI   LE+RCYK+LR+ +   V V+  +Y +LL  CKEQ+  FA +LL ++
Sbjct  61   ALRNPLRIPKITGQLEQRCYKDLRNENFGSVKVVLCIYRKLLSACKEQIPLFASSLLGII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + D ++ +GC    +FI SQVDGTY +N+E L+ K+C LA+E G++D+   LR
Sbjct  121  RTLLEQTRQDEMQILGCNALVEFINSQVDGTYMFNLEGLIPKLCQLAQEDGDDDRALRLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>ref|XP_007033971.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007033972.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007033973.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007033974.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY04897.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY04898.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY04899.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY04900.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
Length=985

 Score =   207 bits (526),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 133/184 (72%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ P C ++C  CP++R+RSRQPVKRYKKLLADIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPVCGNLCFFCPSMRARSRQPVKRYKKLLADIFPRNQDAEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A +NP RIPKI   LE+RCYK+LR+ +   V V+  +Y +LL  CKEQ+  FA +LL ++
Sbjct  61   ALRNPLRIPKITGQLEQRCYKDLRNENFGSVKVVLCIYRKLLSACKEQIPLFASSLLGII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + D ++ +GC    +FI SQVDGTY +N+E L+ K+C LA+E G++D+   LR
Sbjct  121  RTLLEQTRQDEMQILGCNALVEFINSQVDGTYMFNLEGLIPKLCQLAQEDGDDDRALRLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>ref|XP_006286974.1| hypothetical protein CARUB_v10000121mg [Capsella rubella]
 gb|EOA19872.1| hypothetical protein CARUB_v10000121mg [Capsella rubella]
Length=1026

 Score =   207 bits (527),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 126/184 (68%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR +FP CES+C  CPALR+RSR PVKRYK LLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRTVFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSQDEQPNDRKISKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKI   LE+RCYKELR      V ++  +Y +LL  C EQM+ FA + L ++
Sbjct  61   AAKNPLRIPKITTSLEQRCYKELRMEQFHSVKIVMSIYKKLLVSCNEQMSLFASSYLGLI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D ++ +GC     F+ SQ +GTY +N++ L+ K+C LA E GEE++   L 
Sbjct  121  HILLDQTRYDEMRILGCEALYDFVTSQAEGTYMFNLDGLIPKICPLAHELGEEERTTNLC  180

Query  628  ASSL  639
            A+ L
Sbjct  181  AAGL  184



>ref|XP_010069300.1| PREDICTED: protein EFR3 homolog B isoform X1 [Eucalyptus grandis]
 ref|XP_010069301.1| PREDICTED: protein EFR3 homolog B isoform X1 [Eucalyptus grandis]
 gb|KCW57603.1| hypothetical protein EUGRSUZ_H00374 [Eucalyptus grandis]
 gb|KCW57604.1| hypothetical protein EUGRSUZ_H00374 [Eucalyptus grandis]
 gb|KCW57605.1| hypothetical protein EUGRSUZ_H00374 [Eucalyptus grandis]
Length=995

 Score =   207 bits (526),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 135/184 (73%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ P C ++C  CP++R+RSRQPVKRYKKLLA+IFPK+ +   N RKI KLCEY
Sbjct  1    MGVVSRRVVPVCGNLCFMCPSMRARSRQPVKRYKKLLANIFPKNQEAEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A KNP RIPKI   LEERCYK+LR+ +   V V+  +Y +LL  CKEQM+ FA +LL +V
Sbjct  61   ALKNPLRIPKITNYLEERCYKDLRNENYGSVKVVLCIYRKLLSSCKEQMSLFAGSLLGIV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + D ++ +GC+T  +F+ +QVDGTY +N+E L+ K+C +A E G++++   LR
Sbjct  121  RTLLEQTQQDELRILGCMTLVEFMNNQVDGTYMFNLEGLIPKLCQMAEEVGDDERILPLR  180

Query  628  ASSL  639
            +S +
Sbjct  181  SSGM  184



>gb|KGN59399.1| hypothetical protein Csa_3G816120 [Cucumis sativus]
Length=870

 Score =   206 bits (523),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 128/173 (74%), Gaps = 0/173 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR++ P C S+C  CPALR+RSRQPVKRYKKL+ADIFP++P+   N RKI KLCEYA
Sbjct  9    GVISRQVLPVCGSLCFFCPALRARSRQPVKRYKKLIADIFPRNPEEGPNDRKIGKLCEYA  68

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            AKNP RIPKI   LE+RCYKELR+ + + V V+  +Y +LL  CKEQM  FA +L++++ 
Sbjct  69   AKNPLRIPKITTSLEQRCYKELRNENFQAVKVVMSIYRKLLVSCKEQMPLFASSLISIMQ  128

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEED  609
             ++D  +   ++ IGC T   F+ SQ DGTY +N+E  + K+C +A+++G+++
Sbjct  129  TLMDQTRQKEMQIIGCQTLFSFVNSQSDGTYMFNLEAFIPKLCQIAQDSGDDE  181



>ref|XP_010493228.1| PREDICTED: uncharacterized protein LOC104770495 [Camelina sativa]
Length=1024

 Score =   207 bits (526),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 126/184 (68%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR +FP CES+C  CPALR+RSR PVKRYK LLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRTMFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSQDEQPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKI   LE+RCYKELR      V ++  +Y +LL  C EQM+ FA + L ++
Sbjct  61   AAKNPLRIPKITTSLEQRCYKELRMEQFHSVKIVMSIYKKLLVSCNEQMSLFASSYLGLI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D ++ +GC     F+ SQ +GTY +N++ L+ K+C LA E GEE++   + 
Sbjct  121  HILLDQTRYDEMRMLGCEALYDFVTSQTEGTYMFNLDGLIPKICPLAHELGEEERTTNMC  180

Query  628  ASSL  639
            A+ L
Sbjct  181  AAGL  184



>ref|XP_010420957.1| PREDICTED: uncharacterized protein LOC104706460 [Camelina sativa]
Length=1024

 Score =   207 bits (526),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 126/184 (68%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR +FP CES+C  CPALR+RSR PVKRYK LLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRTMFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSQDEQPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKI   LE+RCYKELR      V ++  +Y +LL  C EQM+ FA + L ++
Sbjct  61   AAKNPLRIPKITTSLEQRCYKELRMEQFHSVKIVMSIYKKLLVSCNEQMSLFASSYLGLI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D ++ +GC     F+ SQ +GTY +N++ L+ K+C LA E GEE++   + 
Sbjct  121  HILLDQTRYDEMRMLGCEALYDFVTSQTEGTYMFNLDGLIPKICPLAHELGEEERTTNMC  180

Query  628  ASSL  639
            A+ L
Sbjct  181  AAGL  184



>ref|XP_006657548.1| PREDICTED: uncharacterized protein LOC102712271 [Oryza brachyantha]
Length=1071

 Score =   207 bits (526),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 96/184 (52%), Positives = 130/184 (71%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+ PAC S+C  CPALR+RSRQPVKRYK +LA+IFPK+ D   N R+I KLCEY
Sbjct  1    MGVISRKVLPACGSLCYFCPALRARSRQPVKRYKTILAEIFPKTQDEEPNERRIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
             ++NP R+PKI   LE+R YKELR+       V+  +Y  LL  CKEQM  FA +LL++V
Sbjct  61   CSRNPLRVPKITVFLEQRIYKELRTEQYGFAKVVMLIYRRLLVSCKEQMPLFASSLLSIV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D ++ IGC T   F  +QVDGTY +N+E LV ++C LA+E GE+++   LR
Sbjct  121  HTLLDQKRQDDMRIIGCETLFDFAVNQVDGTYQFNLEGLVPRLCELAQEVGEDEKTITLR  180

Query  628  ASSL  639
            A++L
Sbjct  181  AAAL  184



>ref|XP_006597228.1| PREDICTED: uncharacterized protein LOC100811354 isoform X1 [Glycine 
max]
 ref|XP_006597229.1| PREDICTED: uncharacterized protein LOC100811354 isoform X2 [Glycine 
max]
Length=967

 Score =   206 bits (524),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 131/184 (71%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ P C ++C+ CP+LR+RSRQPVKRYKK +ADIFP++     N RKI KLCEY
Sbjct  1    MGVMSRRVVPVCGNLCVFCPSLRARSRQPVKRYKKFIADIFPRNQAAEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKI   LE+RCYK+LR+ +   V V+  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITDNLEQRCYKDLRNENYGSVKVVLCIYRKLLSTCKEQMPLFANSLLGII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + D ++ +GC T  +FI SQ DGTY +N+E  + K+C LA+E G+ +Q   LR
Sbjct  121  RTLLEQTRADEMQILGCNTLVEFIDSQTDGTYMFNLEGFIPKLCQLAQEVGDNEQALLLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>ref|XP_003605757.1| EFR3-like protein [Medicago truncatula]
 gb|AES87954.1| cyclin-like protein [Medicago truncatula]
Length=1028

 Score =   206 bits (525),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 133/184 (72%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            M ++SR ++P C S+C  CPALR RSR P+KRYKKLLADIFP++P+   N RKI KLCEY
Sbjct  1    MSVISRNIWPVCGSLCCFCPALRERSRHPIKRYKKLLADIFPRTPEEEPNDRKISKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP R+PKI   LE+RCYKELR+ + + V V+  +Y +LL  C++QM  FA +LL+++
Sbjct  61   ASKNPLRVPKITSYLEQRCYKELRTENYQAVKVVICIYRKLLVSCRDQMPLFASSLLSII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD ++ D V+ +GC T   F+ +Q DGTY +N+++ + K+C LA++ G++ +   LR
Sbjct  121  QILLDQSRQDEVQILGCQTLFDFVNNQRDGTYMFNLDSFILKLCHLAQQVGDDGKVEHLR  180

Query  628  ASSL  639
            AS L
Sbjct  181  ASGL  184



>gb|EMS53000.1| Protein EFR3-like protein B [Triticum urartu]
Length=1041

 Score =   206 bits (525),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 128/184 (70%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+ PAC ++C  CP LR+RSRQPVKRYKK+LA+IFP++ D   N R+I KLCEY
Sbjct  1    MGVISRKVLPACGALCYFCPGLRARSRQPVKRYKKILAEIFPRTQDEEPNERRIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP R+PKI   LE+R YKELR+       V+  +Y  LL  CKEQM   A +LL++V
Sbjct  61   AAKNPLRVPKITVYLEQRIYKELRAEQYGFAKVVMLIYRRLLVSCKEQMPLLASSLLSIV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D ++ I C T   F  +QVDGTY +N+E LV ++C LA+E GE+++   LR
Sbjct  121  HTLLDQKRQDDMRIIACETLFDFAVNQVDGTYQFNLEGLVPRLCELAQEAGEDERATSLR  180

Query  628  ASSL  639
            A+ L
Sbjct  181  AAGL  184



>gb|KCW57602.1| hypothetical protein EUGRSUZ_H00374 [Eucalyptus grandis]
Length=1017

 Score =   206 bits (525),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 135/184 (73%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ P C ++C  CP++R+RSRQPVKRYKKLLA+IFPK+ +   N RKI KLCEY
Sbjct  1    MGVVSRRVVPVCGNLCFMCPSMRARSRQPVKRYKKLLANIFPKNQEAEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A KNP RIPKI   LEERCYK+LR+ +   V V+  +Y +LL  CKEQM+ FA +LL +V
Sbjct  61   ALKNPLRIPKITNYLEERCYKDLRNENYGSVKVVLCIYRKLLSSCKEQMSLFAGSLLGIV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + D ++ +GC+T  +F+ +QVDGTY +N+E L+ K+C +A E G++++   LR
Sbjct  121  RTLLEQTQQDELRILGCMTLVEFMNNQVDGTYMFNLEGLIPKLCQMAEEVGDDERILPLR  180

Query  628  ASSL  639
            +S +
Sbjct  181  SSGM  184



>ref|XP_004166917.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101224192, 
partial [Cucumis sativus]
Length=986

 Score =   206 bits (524),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 128/173 (74%), Gaps = 0/173 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR++ P C S+C  CPALR+RSRQPVKRYKKL+ADIFP++P+   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCFFCPALRARSRQPVKRYKKLIADIFPRNPEEGPNDRKIGKLCEYA  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            AKNP RIPKI   LE+RCYKELR+ + + V V+  +Y +LL  CKEQM  FA +L++++ 
Sbjct  66   AKNPLRIPKITTSLEQRCYKELRNENFQAVKVVMSIYRKLLVSCKEQMPLFASSLISIMQ  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEED  609
             ++D  +   ++ IGC T   F+ SQ DGTY +N+E  + K+C +A+++G+++
Sbjct  126  TLMDQTRQKEMQIIGCQTLFSFVNSQSDGTYMFNLEAFIPKLCQIAQDSGDDE  178



>ref|XP_011048039.1| PREDICTED: uncharacterized protein LOC105142218 [Populus euphratica]
Length=1022

 Score =   206 bits (524),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 131/183 (72%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR++ PAC S+C  CPA+R+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GVISRQVMPACGSLCFFCPAMRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYA  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            AKNP RIPKI   LE+RCYKELR  + +   ++  +Y +LL  CKEQM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITSSLEQRCYKELRIENFQSAKIVMCIYRKLLITCKEQMPLFASSLLSIIS  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD  + D ++ IGC T   F+ +Q DGT+ +N+E  + K+C   +E G+++ ++ LRA
Sbjct  126  TLLDQTRQDDIQVIGCETLFDFVNNQNDGTFMFNLEGFIPKLCQFTQEEGKDESEKSLRA  185

Query  631  SSL  639
            + L
Sbjct  186  AGL  188



>ref|XP_002874031.1| hypothetical protein ARALYDRAFT_489019 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50290.1| hypothetical protein ARALYDRAFT_489019 [Arabidopsis lyrata subsp. 
lyrata]
Length=1027

 Score =   206 bits (524),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 126/184 (68%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR +FP CES+C  CPALR+RSR PVKRYK LLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRTVFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSQDEQPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKI   LE+RCYKELR      V ++  +Y +LL  C EQM+ FA + L ++
Sbjct  61   AAKNPLRIPKITTYLEQRCYKELRMEQFHSVKIVMSIYKKLLVSCNEQMSLFASSYLGLI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D ++ +GC     F+ +Q +GTY +N++ L+ K+C LA E GEED+   L 
Sbjct  121  HILLDQNRYDEMRILGCEALYDFVTNQAEGTYMFNLDGLIPKICPLAHELGEEDRTTNLC  180

Query  628  ASSL  639
            A+ L
Sbjct  181  AAGL  184



>ref|XP_004136762.1| PREDICTED: uncharacterized protein LOC101210251 [Cucumis sativus]
Length=1002

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 128/173 (74%), Gaps = 0/173 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR++ P C S+C  CPALR+RSRQPVKRYKKL+ADIFP++P+   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCFFCPALRARSRQPVKRYKKLIADIFPRNPEEGPNDRKIGKLCEYA  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            AKNP RIPKI   LE+RCYKELR+ + + V V+  +Y +LL  CKEQM  FA +L++++ 
Sbjct  66   AKNPLRIPKITTSLEQRCYKELRNENFQAVKVVMSIYRKLLVSCKEQMPLFASSLISIMQ  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEED  609
             ++D  +   ++ IGC T   F+ SQ DGTY +N+E  + K+C +A+++G+++
Sbjct  126  TLMDQTRQKEMQIIGCQTLFSFVNSQSDGTYMFNLEAFIPKLCQIAQDSGDDE  178



>emb|CDP18636.1| unnamed protein product [Coffea canephora]
Length=1027

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 132/183 (72%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR++ PAC S+C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI KLCEYA
Sbjct  6    GVISRQVLPACGSLCFFCPAMRARSRQPVKRYKKLISDIFPRSQEEEPNERKISKLCEYA  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            AKNP RIPKI   LE+RCYKE+R+ + + V ++  +Y +LL  CKEQM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITTSLEQRCYKEIRNENFRSVKIVMSIYRKLLISCKEQMPLFANSLLSIIH  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +L+  + D +   GC +   F+ +Q DGTY +N+E  + K+C  A+E G++++ + LRA
Sbjct  126  TLLEQTRQDDILITGCQSLFDFVNNQKDGTYMFNLEGFIPKLCQFAQEVGDDERAKHLRA  185

Query  631  SSL  639
            + L
Sbjct  186  AGL  188



>ref|XP_004493505.1| PREDICTED: uncharacterized protein LOC101511203 isoform X2 [Cicer 
arietinum]
Length=1012

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 134/183 (73%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR++ PAC S+C  CPALR+RSRQPVKRYKKL+A+IFP++ +   N RKI KLC+YA
Sbjct  7    GVVSRQVLPACGSLCFFCPALRARSRQPVKRYKKLIAEIFPRNQEEGLNDRKIGKLCDYA  66

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            AKNP RIPKI   LE+RCYKELR+ + +   ++  +Y + L  CKEQM  FA +LL+++ 
Sbjct  67   AKNPLRIPKIVNALEQRCYKELRNENFRSTRIVMCIYKKFLSSCKEQMPLFASSLLSIIH  126

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD  + D ++ IGC     F+ +QVDG+Y +++E ++ K+C LA+ETGE+++ R  R+
Sbjct  127  TLLDQTRQDEMRVIGCNILFDFVNNQVDGSYLFSLEGVIPKLCQLAQETGEDERARTRRS  186

Query  631  SSL  639
            + L
Sbjct  187  AGL  189



>ref|XP_004493504.1| PREDICTED: uncharacterized protein LOC101511203 isoform X1 [Cicer 
arietinum]
Length=1013

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 134/183 (73%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR++ PAC S+C  CPALR+RSRQPVKRYKKL+A+IFP++ +   N RKI KLC+YA
Sbjct  7    GVVSRQVLPACGSLCFFCPALRARSRQPVKRYKKLIAEIFPRNQEEGLNDRKIGKLCDYA  66

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            AKNP RIPKI   LE+RCYKELR+ + +   ++  +Y + L  CKEQM  FA +LL+++ 
Sbjct  67   AKNPLRIPKIVNALEQRCYKELRNENFRSTRIVMCIYKKFLSSCKEQMPLFASSLLSIIH  126

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD  + D ++ IGC     F+ +QVDG+Y +++E ++ K+C LA+ETGE+++ R  R+
Sbjct  127  TLLDQTRQDEMRVIGCNILFDFVNNQVDGSYLFSLEGVIPKLCQLAQETGEDERARTRRS  186

Query  631  SSL  639
            + L
Sbjct  187  AGL  189



>emb|CDY09095.1| BnaA02g05210D [Brassica napus]
Length=996

 Score =   205 bits (521),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 123/175 (70%), Gaps = 0/175 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG ++R +FP CES+C  CPALR+RSR PVKRYK+LLADIFP+SPD   N RKI KLCEY
Sbjct  1    MGAVARTVFPVCESLCCFCPALRARSRHPVKRYKQLLADIFPRSPDEQPNDRKISKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKI   LE+RCYKELR      V  +  +Y +LL  C EQM+ FA + L ++
Sbjct  61   AAKNPLRIPKITTYLEQRCYKELRLEQFHSVKTVMCIYKKLLVACNEQMSLFASSYLGLI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQ  612
              +LD ++ D ++ +GC     F+ SQ +GTY +N++ L+ K+C LA E GEE++
Sbjct  121  HILLDQSRHDEMRVLGCEAIYDFVTSQTEGTYMFNLDGLIPKICPLAHELGEEER  175



>ref|XP_009124331.1| PREDICTED: uncharacterized protein LOC103849280 [Brassica rapa]
Length=1024

 Score =   205 bits (521),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 123/175 (70%), Gaps = 0/175 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG ++R +FP CES+C  CPALR+RSR PVKRYK+LLADIFP+SPD   N RKI KLCEY
Sbjct  1    MGAVARTVFPVCESLCCFCPALRARSRHPVKRYKQLLADIFPRSPDEQPNDRKISKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKI   LE+RCYKELR      V  +  +Y +LL  C EQM+ FA + L ++
Sbjct  61   AAKNPLRIPKITTYLEQRCYKELRLEQFHSVKTVMCIYKKLLVACNEQMSLFASSYLGLI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQ  612
              +LD ++ D ++ +GC     F+ SQ +GTY +N++ L+ K+C LA E GEE++
Sbjct  121  HILLDQSRHDEMRVLGCEAIYDFVTSQTEGTYMFNLDGLIPKICPLAHELGEEER  175



>ref|XP_009789125.1| PREDICTED: protein EFR3 homolog B isoform X4 [Nicotiana sylvestris]
Length=973

 Score =   204 bits (520),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 133/188 (71%), Gaps = 0/188 (0%)
 Frame = +1

Query  76   LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  255
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  256  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  435
            LCEYAAKNPFRIPKI K LEERCYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  436  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK  615
            L+++  +LD ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA++ GEE+  
Sbjct  121  LSIIQTLLDQSRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEENA  180

Query  616  RCLRASSL  639
            + LR   L
Sbjct  181  KHLRTVGL  188



>ref|XP_002529611.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32756.1| conserved hypothetical protein [Ricinus communis]
Length=985

 Score =   204 bits (520),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 134/183 (73%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR++ PAC S+C  CPA+R+RSRQP+KRYKKL+A+IFP++PD   N R I +LCEYA
Sbjct  6    GVVSRQVLPACGSLCFFCPAMRARSRQPIKRYKKLIANIFPRNPDDGPNDRMIGRLCEYA  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            AKNP RIPKI   LE+RCYKELR+ + +   ++  +Y +LL  C+EQM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITNSLEQRCYKELRNENFQSAKIVMCIYRKLLISCREQMPLFASSLLSIMH  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD  + D ++ +GC T   F+ +Q DGTY +N++  + K+C  A+E G++++ + LRA
Sbjct  126  TLLDQTRQDELQIVGCETLFDFVTNQKDGTYLFNLDGFIPKLCQSAQEVGDDERAKNLRA  185

Query  631  SSL  639
            ++L
Sbjct  186  AAL  188



>gb|EMT11310.1| hypothetical protein F775_16040 [Aegilops tauschii]
Length=1041

 Score =   205 bits (521),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 126/184 (68%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+ P C ++C  CP LR+RSRQPVKRYKK+LA+IFP+S D   N R+I KLCEY
Sbjct  1    MGVISRKVLPVCGALCYFCPGLRARSRQPVKRYKKILAEIFPRSQDEEPNERRIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP R+PKI   LE+R YKELR+       V+  +Y  LL  CKEQM   A +LL++V
Sbjct  61   AAKNPLRVPKITVYLEQRIYKELRAEQYGFAKVVMLIYRRLLVSCKEQMPLLASSLLSIV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D ++ I C T   F  +QVDGTY +N+E LV ++C LA+E GE+ +   LR
Sbjct  121  HTLLDQKRQDDMRIIACETLFDFAVNQVDGTYQFNLEGLVPRLCELAQEAGEDQRATSLR  180

Query  628  ASSL  639
            A+ L
Sbjct  181  AAGL  184



>ref|XP_009789120.1| PREDICTED: protein EFR3 homolog B isoform X1 [Nicotiana sylvestris]
 ref|XP_009789121.1| PREDICTED: protein EFR3 homolog B isoform X1 [Nicotiana sylvestris]
Length=1012

 Score =   204 bits (520),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 133/188 (71%), Gaps = 0/188 (0%)
 Frame = +1

Query  76   LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  255
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  256  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  435
            LCEYAAKNPFRIPKI K LEERCYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  436  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK  615
            L+++  +LD ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA++ GEE+  
Sbjct  121  LSIIQTLLDQSRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEENA  180

Query  616  RCLRASSL  639
            + LR   L
Sbjct  181  KHLRTVGL  188



>ref|XP_009789122.1| PREDICTED: protein EFR3 homolog B isoform X2 [Nicotiana sylvestris]
Length=1010

 Score =   204 bits (520),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 133/188 (71%), Gaps = 0/188 (0%)
 Frame = +1

Query  76   LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  255
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  256  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  435
            LCEYAAKNPFRIPKI K LEERCYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  436  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK  615
            L+++  +LD ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA++ GEE+  
Sbjct  121  LSIIQTLLDQSRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEENA  180

Query  616  RCLRASSL  639
            + LR   L
Sbjct  181  KHLRTVGL  188



>ref|XP_009789124.1| PREDICTED: protein EFR3 homolog B isoform X3 [Nicotiana sylvestris]
Length=1008

 Score =   204 bits (520),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 133/188 (71%), Gaps = 0/188 (0%)
 Frame = +1

Query  76   LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  255
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  256  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  435
            LCEYAAKNPFRIPKI K LEERCYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  436  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK  615
            L+++  +LD ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA++ GEE+  
Sbjct  121  LSIIQTLLDQSRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEENA  180

Query  616  RCLRASSL  639
            + LR   L
Sbjct  181  KHLRTVGL  188



>gb|KDO47318.1| hypothetical protein CISIN_1g001882mg [Citrus sinensis]
Length=979

 Score =   204 bits (519),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 131/184 (71%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ P C ++C  CP++R+RSRQPVKRYKK+LADIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVLPVCGNLCFFCPSMRARSRQPVKRYKKMLADIFPRNQDAEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKI   LE+RCYK+LR+ +   V V+  +Y + L  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITTLLEQRCYKDLRNENFGSVKVVVCIYKKFLSSCKEQMPLFASSLLGII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + + ++ +GC T   FI SQ DGTY +N+E L+ K+C LA+E G +++   LR
Sbjct  121  RTLLEQTRQEEMQILGCGTLVNFIDSQTDGTYMFNLEGLIPKLCQLAQEMGNDERALRLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>ref|XP_003540587.1| PREDICTED: uncharacterized protein LOC100816475 [Glycine max]
Length=1037

 Score =   204 bits (520),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 132/184 (72%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            M ++SR ++P C S+C  CPALR RSR P+KRYKKLLADIFP++PD   N R I KLCEY
Sbjct  1    MSVISRNIWPVCGSLCCFCPALRERSRHPIKRYKKLLADIFPRTPDEEPNERMISKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP R+PKI   LE+RCY+ELR+ + + V V+  +Y +LL  CK+QM  FA +LL+++
Sbjct  61   ASKNPLRVPKITSYLEQRCYRELRTENYQSVKVVICIYRKLLISCKDQMPLFASSLLSII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D V+ +GC T   F+ +Q DGTY +N++  + K+C+LA+E G++ + + LR
Sbjct  121  QILLDQPRQDEVQILGCQTLFDFVNNQRDGTYMFNLDGFILKLCNLAQEMGDDAKVQLLR  180

Query  628  ASSL  639
            A+ L
Sbjct  181  AAGL  184



>gb|KDO47319.1| hypothetical protein CISIN_1g001882mg [Citrus sinensis]
Length=985

 Score =   204 bits (518),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 131/184 (71%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ P C ++C  CP++R+RSRQPVKRYKK+LADIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVLPVCGNLCFFCPSMRARSRQPVKRYKKMLADIFPRNQDAEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKI   LE+RCYK+LR+ +   V V+  +Y + L  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITTLLEQRCYKDLRNENFGSVKVVVCIYKKFLSSCKEQMPLFASSLLGII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + + ++ +GC T   FI SQ DGTY +N+E L+ K+C LA+E G +++   LR
Sbjct  121  RTLLEQTRQEEMQILGCGTLVNFIDSQTDGTYMFNLEGLIPKLCQLAQEMGNDERALRLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>ref|XP_010907685.1| PREDICTED: uncharacterized protein LOC105034293 isoform X5 [Elaeis 
guineensis]
Length=930

 Score =   203 bits (517),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 124/171 (73%), Gaps = 0/171 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ PAC ++C  CP+LR+RSR PVKRYKKLLA+IFP+S DG  N R I KLCEY
Sbjct  1    MGVMSRRVLPACANLCCFCPSLRARSRLPVKRYKKLLANIFPQSLDGEPNDRMISKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP R+PKI KCLE+R YKELR+ H+ L   +  +Y +LL  CKEQM  FA +LL +V
Sbjct  61   ASKNPMRMPKITKCLEQRFYKELRNEHSCLAKAVPCIYRKLLASCKEQMPLFATSLLGIV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETG  600
              +LD  + D ++ +GCL    F+ SQVD TY +N+E ++ K+C L +E G
Sbjct  121  RTLLDQTQEDDMRILGCLMLVDFLNSQVDSTYMFNVEGIIPKLCHLGQEAG  171



>gb|KDO47320.1| hypothetical protein CISIN_1g001882mg [Citrus sinensis]
 gb|KDO47321.1| hypothetical protein CISIN_1g001882mg [Citrus sinensis]
 gb|KDO47322.1| hypothetical protein CISIN_1g001882mg [Citrus sinensis]
Length=1000

 Score =   204 bits (519),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 131/184 (71%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ P C ++C  CP++R+RSRQPVKRYKK+LADIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVLPVCGNLCFFCPSMRARSRQPVKRYKKMLADIFPRNQDAEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKI   LE+RCYK+LR+ +   V V+  +Y + L  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITTLLEQRCYKDLRNENFGSVKVVVCIYKKFLSSCKEQMPLFASSLLGII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + + ++ +GC T   FI SQ DGTY +N+E L+ K+C LA+E G +++   LR
Sbjct  121  RTLLEQTRQEEMQILGCGTLVNFIDSQTDGTYMFNLEGLIPKLCQLAQEMGNDERALRLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>ref|XP_007028783.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY09285.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=706

 Score =   202 bits (513),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 132/178 (74%), Gaps = 0/178 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR++ PAC S+C  CPA+R+RSRQPVKRYKKL+A+IFP++ +  AN RKI KLC+YA
Sbjct  6    GVISRQVLPACGSLCFFCPAMRARSRQPVKRYKKLIAEIFPRNQEEGANDRKIGKLCDYA  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            +KNP RIPKI+  LE+RCYKELR+ + +   ++  +Y +LL  CKEQM  FA +LL+++ 
Sbjct  66   SKNPLRIPKISNSLEQRCYKELRNENFQSAKIVMCIYRKLLVSCKEQMTLFASSLLSIIQ  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCL  624
             +LD  + D ++ +GC T   F+ +Q DGT+ +N+E  + K+C LA+E GE +++R L
Sbjct  126  TLLDQTRQDEMRIMGCQTLFDFVNNQKDGTFMFNLEGFIPKLCQLAQEIGEGERERKL  183



>gb|EYU27043.1| hypothetical protein MIMGU_mgv1a000818mg [Erythranthe guttata]
Length=974

 Score =   204 bits (518),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 126/180 (70%), Gaps = 2/180 (1%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG +S+++ P C+S+CICCPA+R RSR PVKRYKKLLADIFP++     N R+I KLCEY
Sbjct  1    MGAMSKRMMPFCDSLCICCPAMRPRSRHPVKRYKKLLADIFPRNMGDEPNDRQISKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
             +KNP R+PKI   LEERCY+ELR+ +   V VI  +Y +L+  C++QM  FA + LNV+
Sbjct  61   VSKNPLRVPKITSLLEERCYRELRNANVNRVKVIMCIYRKLIISCQQQMPLFAGSFLNVI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D ++ IGC     FI +Q DGTY +N+E L+ K+C LA+E G  D +R LR
Sbjct  121  NTLLDQTRNDEMRIIGCQALFDFINNQRDGTYMFNLEGLIPKLCLLAQEMG--DDERILR  178



>gb|KFK26320.1| hypothetical protein AALP_AA8G232400 [Arabis alpina]
Length=1061

 Score =   204 bits (519),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 126/184 (68%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR +FP CES+C  CPALR+RSR PVKRYK LLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRTVFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSVDEQPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKI   LE+RCY+ELR      V ++  +Y +LL  C EQM+ FA + L ++
Sbjct  61   AAKNPLRIPKITTSLEQRCYRELRMEQFHSVKIVMCIYKKLLVACNEQMSLFASSYLGLI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D ++ +GC     F+ +Q +GTY +N++ L+ K+C LA E GEED+   L 
Sbjct  121  HILLDQTRHDEMRILGCEALYDFVTNQAEGTYMFNLDGLIPKICPLAHELGEEDRTTNLC  180

Query  628  ASSL  639
            A+ L
Sbjct  181  AAGL  184



>ref|XP_007225374.1| hypothetical protein PRUPE_ppa000810mg [Prunus persica]
 gb|EMJ26573.1| hypothetical protein PRUPE_ppa000810mg [Prunus persica]
Length=997

 Score =   203 bits (517),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 131/184 (71%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ PAC ++C  CP++R+RSRQPVKRYKKLL DIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRIVPACGNLCFFCPSMRARSRQPVKRYKKLLTDIFPRNQDAEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A KNP RIPKI   LE+RCYK+LR+ H   V V+  +Y +LL  CKEQM  FA +LL +V
Sbjct  61   ALKNPLRIPKITDSLEQRCYKDLRNEHFGSVKVVLCIYRKLLSSCKEQMPLFASSLLGIV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + D ++ +GC T   FI SQ+D T+ +++E L+ K+C +A+E G+ ++   LR
Sbjct  121  RILLEQNRHDEMRILGCNTLVDFINSQIDSTHMFSLEGLIPKLCQMAQEVGDNERALRLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>ref|XP_008222533.1| PREDICTED: uncharacterized protein LOC103322398 [Prunus mume]
Length=997

 Score =   203 bits (517),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 131/184 (71%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ PAC ++C  CP++R+RSRQPVKRYKKLL DIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRIVPACGNLCFFCPSMRARSRQPVKRYKKLLTDIFPRNQDAEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A KNP RIPKI   LE+RCYK+LR+ H   V V+  +Y +LL  CKEQM  FA +LL +V
Sbjct  61   ALKNPLRIPKITGSLEQRCYKDLRNEHFGSVKVVLCIYRKLLSSCKEQMPLFASSLLGIV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + D ++ +GC T   FI SQ+D T+ +++E L+ K+C +A+E G+ ++   LR
Sbjct  121  RILLEQNRHDEMRILGCNTLVDFINSQIDSTHMFSLEGLIPKLCQMAQEVGDNERALRLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>ref|XP_010907684.1| PREDICTED: uncharacterized protein LOC105034293 isoform X4 [Elaeis 
guineensis]
Length=979

 Score =   203 bits (517),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 124/171 (73%), Gaps = 0/171 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ PAC ++C  CP+LR+RSR PVKRYKKLLA+IFP+S DG  N R I KLCEY
Sbjct  1    MGVMSRRVLPACANLCCFCPSLRARSRLPVKRYKKLLANIFPQSLDGEPNDRMISKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP R+PKI KCLE+R YKELR+ H+ L   +  +Y +LL  CKEQM  FA +LL +V
Sbjct  61   ASKNPMRMPKITKCLEQRFYKELRNEHSCLAKAVPCIYRKLLASCKEQMPLFATSLLGIV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETG  600
              +LD  + D ++ +GCL    F+ SQVD TY +N+E ++ K+C L +E G
Sbjct  121  RTLLDQTQEDDMRILGCLMLVDFLNSQVDSTYMFNVEGIIPKLCHLGQEAG  171



>ref|XP_010907683.1| PREDICTED: uncharacterized protein LOC105034293 isoform X3 [Elaeis 
guineensis]
Length=1011

 Score =   203 bits (517),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 124/171 (73%), Gaps = 0/171 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ PAC ++C  CP+LR+RSR PVKRYKKLLA+IFP+S DG  N R I KLCEY
Sbjct  1    MGVMSRRVLPACANLCCFCPSLRARSRLPVKRYKKLLANIFPQSLDGEPNDRMISKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP R+PKI KCLE+R YKELR+ H+ L   +  +Y +LL  CKEQM  FA +LL +V
Sbjct  61   ASKNPMRMPKITKCLEQRFYKELRNEHSCLAKAVPCIYRKLLASCKEQMPLFATSLLGIV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETG  600
              +LD  + D ++ +GCL    F+ SQVD TY +N+E ++ K+C L +E G
Sbjct  121  RTLLDQTQEDDMRILGCLMLVDFLNSQVDSTYMFNVEGIIPKLCHLGQEAG  171



>ref|XP_010907681.1| PREDICTED: uncharacterized protein LOC105034293 isoform X1 [Elaeis 
guineensis]
Length=1023

 Score =   203 bits (517),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 124/171 (73%), Gaps = 0/171 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ PAC ++C  CP+LR+RSR PVKRYKKLLA+IFP+S DG  N R I KLCEY
Sbjct  1    MGVMSRRVLPACANLCCFCPSLRARSRLPVKRYKKLLANIFPQSLDGEPNDRMISKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP R+PKI KCLE+R YKELR+ H+ L   +  +Y +LL  CKEQM  FA +LL +V
Sbjct  61   ASKNPMRMPKITKCLEQRFYKELRNEHSCLAKAVPCIYRKLLASCKEQMPLFATSLLGIV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETG  600
              +LD  + D ++ +GCL    F+ SQVD TY +N+E ++ K+C L +E G
Sbjct  121  RTLLDQTQEDDMRILGCLMLVDFLNSQVDSTYMFNVEGIIPKLCHLGQEAG  171



>ref|XP_010907682.1| PREDICTED: uncharacterized protein LOC105034293 isoform X2 [Elaeis 
guineensis]
Length=1021

 Score =   203 bits (517),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 124/171 (73%), Gaps = 0/171 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ PAC ++C  CP+LR+RSR PVKRYKKLLA+IFP+S DG  N R I KLCEY
Sbjct  1    MGVMSRRVLPACANLCCFCPSLRARSRLPVKRYKKLLANIFPQSLDGEPNDRMISKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP R+PKI KCLE+R YKELR+ H+ L   +  +Y +LL  CKEQM  FA +LL +V
Sbjct  61   ASKNPMRMPKITKCLEQRFYKELRNEHSCLAKAVPCIYRKLLASCKEQMPLFATSLLGIV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETG  600
              +LD  + D ++ +GCL    F+ SQVD TY +N+E ++ K+C L +E G
Sbjct  121  RTLLDQTQEDDMRILGCLMLVDFLNSQVDSTYMFNVEGIIPKLCHLGQEAG  171



>ref|XP_007131432.1| hypothetical protein PHAVU_011G013000g [Phaseolus vulgaris]
 gb|ESW03426.1| hypothetical protein PHAVU_011G013000g [Phaseolus vulgaris]
Length=1037

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 132/185 (71%), Gaps = 1/185 (1%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            M ++SR ++P C S+C  CPALR RSR P+KRYKK LADIFP++P    N R I KLCEY
Sbjct  1    MSVISRNIWPVCGSLCCFCPALRERSRHPIKRYKKFLADIFPRTPGEEPNERMIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AA+NP R+PKI   LE+RCY+ELR+ + + V V+  +Y +LL  CK+QM  FA +LL ++
Sbjct  61   AARNPLRVPKITSYLEQRCYRELRTENYQSVKVVILIYRKLLISCKDQMPLFASSLLGII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK-RCL  624
              +LD ++ D V+ +GC T   F+ +Q DGTY +N++  + K+C+LA+ETG++D K + L
Sbjct  121  QILLDQSRHDEVQILGCQTLFDFVNNQKDGTYMFNLDAFIVKLCNLAQETGDDDFKIQQL  180

Query  625  RASSL  639
            RA+ L
Sbjct  181  RAAGL  185



>ref|XP_009789840.1| PREDICTED: protein EFR3 homolog B-like isoform X2 [Nicotiana 
sylvestris]
Length=1028

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 130/184 (71%), Gaps = 1/184 (1%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG+ S ++ PAC+ +C+CCPA+R+RSRQPVKRYKKL++D FP+SPDG  N R I KLCEY
Sbjct  1    MGI-SHRIMPACDQLCVCCPAMRTRSRQPVKRYKKLISDSFPRSPDGEPNDRMINKLCEY  59

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKI   LE+RCY+ELR+ +   V V+  +Y +LL  CK+QM  FA + L+++
Sbjct  60   ASKNPLRIPKITSVLEQRCYRELRNENIGSVKVVMCIYRKLLTSCKQQMPLFAGSFLSII  119

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D ++ +GC     FI +Q D TY +N E L+ K+C LA+E GE+++   LR
Sbjct  120  HILLDQTRHDEMRIVGCQALFDFIINQRDSTYMFNFEGLIPKICLLAQEMGEDERVLKLR  179

Query  628  ASSL  639
             + L
Sbjct  180  CAGL  183



>ref|XP_010666756.1| PREDICTED: uncharacterized protein LOC104883885 [Beta vulgaris 
subsp. vulgaris]
Length=1011

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 129/183 (70%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR++ PAC S+C  CP LR+RSRQPVKRYKKL+ADIFPK+ D   N R I KLCEYA
Sbjct  6    GVISRQVLPACGSLCFFCPGLRARSRQPVKRYKKLIADIFPKTQDEGPNDRMIGKLCEYA  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            A+NP R+PKI   LE+RCYKELR+ +   V ++  +Y  LL  CK+QM  FA +L++++ 
Sbjct  66   ARNPLRVPKITNNLEQRCYKELRNQNFNAVKIVMSIYRRLLVSCKDQMPLFASSLVSIMH  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD    D ++ IGC     F+ +Q DGT+ +N+E+ + K+C LA+E GE+++   LRA
Sbjct  126  ILLDQTGQDELRVIGCQALFVFVNNQKDGTFIFNLEDFIPKLCLLAQEVGEDERGFRLRA  185

Query  631  SSL  639
            + L
Sbjct  186  AGL  188



>ref|XP_009789839.1| PREDICTED: protein EFR3 homolog B-like isoform X1 [Nicotiana 
sylvestris]
Length=1029

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 130/184 (71%), Gaps = 1/184 (1%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG+ S ++ PAC+ +C+CCPA+R+RSRQPVKRYKKL++D FP+SPDG  N R I KLCEY
Sbjct  1    MGI-SHRIMPACDQLCVCCPAMRTRSRQPVKRYKKLISDSFPRSPDGEPNDRMINKLCEY  59

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKI   LE+RCY+ELR+ +   V V+  +Y +LL  CK+QM  FA + L+++
Sbjct  60   ASKNPLRIPKITSVLEQRCYRELRNENIGSVKVVMCIYRKLLTSCKQQMPLFAGSFLSII  119

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D ++ +GC     FI +Q D TY +N E L+ K+C LA+E GE+++   LR
Sbjct  120  HILLDQTRHDEMRIVGCQALFDFIINQRDSTYMFNFEGLIPKICLLAQEMGEDERVLKLR  179

Query  628  ASSL  639
             + L
Sbjct  180  CAGL  183



>ref|XP_006400678.1| hypothetical protein EUTSA_v10012553mg [Eutrema salsugineum]
 gb|ESQ42131.1| hypothetical protein EUTSA_v10012553mg [Eutrema salsugineum]
Length=1020

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 125/179 (70%), Gaps = 0/179 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR +FP CES+C  CPALR+RSR PVKRYK LLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRTVFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSLDEQPNDRKISKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKI   LE+RCY+ELR+     V ++  +Y +LL  C EQM+ FA + L ++
Sbjct  61   AAKNPLRIPKITTSLEQRCYRELRTEQFHSVKIVMCIYKKLLVSCNEQMSLFASSYLGLI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCL  624
              +LD ++ D ++ +GC     F+ +Q +GTY +N++ L+ K+C LA E GEE++   L
Sbjct  121  HILLDQSRHDEMRVLGCEALYDFVTNQTEGTYMFNLDALIPKICPLAHELGEEERTTNL  179



>ref|XP_009610957.1| PREDICTED: protein EFR3 homolog B isoform X5 [Nicotiana tomentosiformis]
Length=975

 Score =   202 bits (514),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 132/188 (70%), Gaps = 0/188 (0%)
 Frame = +1

Query  76   LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  255
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  256  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  435
            LCEYAAKNPFRIPKI K LEERCYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  436  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK  615
            L+++  +LD ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA++ GEE+  
Sbjct  121  LSIIQTLLDQSRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEESA  180

Query  616  RCLRASSL  639
            + L    L
Sbjct  181  KHLHTVGL  188



>ref|XP_002308951.2| cyclin-related family protein [Populus trichocarpa]
 gb|EEE92474.2| cyclin-related family protein [Populus trichocarpa]
Length=901

 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 131/183 (72%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR++ PAC S+C  CPA+R+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GVISRQVMPACGSLCFFCPAMRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYA  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            AKNP RIPKI   LE+RCYKELR  + +   ++  +Y +LL  CKEQM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITSSLEQRCYKELRIENFQSAKIVMCIYRKLLITCKEQMPLFASSLLSIIS  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD  + D ++ IGC T   F+ +Q DGT+ +N+E  + K+C   +E G++++++ L A
Sbjct  126  TLLDQTRQDDIQVIGCETLFDFVNNQNDGTFMFNLEGFIPKLCQFTQEEGKDEREKSLCA  185

Query  631  SSL  639
            + L
Sbjct  186  AGL  188



>ref|XP_004229640.1| PREDICTED: protein EFR3 homolog B-like [Solanum lycopersicum]
Length=1018

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 131/184 (71%), Gaps = 1/184 (1%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG+ S ++ PAC+ +C+CCPA+R+RSRQPVKRYKKL++D FP+SPDG  N R I KLCEY
Sbjct  1    MGI-SHQIMPACDQLCVCCPAMRTRSRQPVKRYKKLISDSFPRSPDGEPNERMINKLCEY  59

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKI   LE+RCY+ELR+ +   V V+  +Y +LL  CK+QM  FA + L+++
Sbjct  60   ASKNPLRIPKITTVLEQRCYRELRNENLGSVKVVMCIYRKLLTSCKQQMPLFAGSFLSII  119

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D ++T+GC     FI +Q D TY +N E L+ K+C LA+E GE+++   +R
Sbjct  120  HILLDQMRHDEMRTVGCQALFDFIINQRDSTYMFNFEGLIPKICLLAQEMGEDERVIKMR  179

Query  628  ASSL  639
             + L
Sbjct  180  CAGL  183



>ref|XP_006345431.1| PREDICTED: uncharacterized protein LOC102584593 [Solanum tuberosum]
Length=1017

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 131/184 (71%), Gaps = 1/184 (1%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG+ S ++ PAC+ +C+CCPA+R+RSRQPVKRYKKL++D FP+SPDG  N R I KLCEY
Sbjct  1    MGI-SHQIMPACDQLCVCCPAMRTRSRQPVKRYKKLISDSFPRSPDGEPNERMINKLCEY  59

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKI   LE+RCY+ELR+ +   V V+  +Y +LL  CK+QM  FA + L+++
Sbjct  60   ASKNPLRIPKITTVLEQRCYRELRNENLGSVKVVMCIYRKLLTSCKQQMPLFAGSFLSII  119

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D ++T+GC     FI +Q D TY +N E L+ K+C LA+E GE+++   +R
Sbjct  120  HILLDQMRHDEMRTVGCQALFDFIINQRDSTYMFNFEGLIPKICLLAQEMGEDERVIKMR  179

Query  628  ASSL  639
             + L
Sbjct  180  CAGL  183



>ref|XP_010319193.1| PREDICTED: protein EFR3 homolog B isoform X3 [Solanum lycopersicum]
Length=973

 Score =   202 bits (513),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 133/188 (71%), Gaps = 0/188 (0%)
 Frame = +1

Query  76   LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  255
            + G  G++SR++ PAC S+C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVMSRQVLPACGSLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  256  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  435
            LCEYAAKNPFRIPKI K LEE+CYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEEKCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  436  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK  615
            L+V+  +LD ++ + +  +GC +   F+ +Q DGTY ++++  + K+C LA++ GEE+  
Sbjct  121  LSVLQTLLDQSRENDMLIVGCESLFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEESA  180

Query  616  RCLRASSL  639
              LR   L
Sbjct  181  IKLRTVGL  188



>ref|NP_001059150.1| Os07g0205900 [Oryza sativa Japonica Group]
 dbj|BAC83231.1| cyclin-like protein [Oryza sativa Japonica Group]
 dbj|BAF21064.1| Os07g0205900 [Oryza sativa Japonica Group]
 dbj|BAG91832.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66774.1| hypothetical protein OsJ_23500 [Oryza sativa Japonica Group]
Length=1066

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 123/175 (70%), Gaps = 0/175 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+ PAC S+C  CP LR+RSRQPVKRYK +LA+IFPK+ D   N R+I KLCEY
Sbjct  1    MGVISRKVLPACGSLCYFCPGLRARSRQPVKRYKSILAEIFPKTQDEEPNERRIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
             ++NP R+PKI   LE+R YKELRS       V+  +Y  LL  CKEQM  FA +LL++V
Sbjct  61   CSRNPLRVPKITVSLEQRIYKELRSEQYGFAKVVMLIYRRLLVSCKEQMPLFASSLLSIV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQ  612
              +LD  + D ++ IGC T   F  +QVDGTY +N+E LV ++C L++E GE++Q
Sbjct  121  HTLLDQKRQDDMRIIGCETLFDFAVNQVDGTYQFNLEGLVPRLCELSQEVGEDEQ  175



>gb|EEC81712.1| hypothetical protein OsI_25322 [Oryza sativa Indica Group]
Length=1066

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 123/175 (70%), Gaps = 0/175 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+ PAC S+C  CP LR+RSRQPVKRYK +LA+IFPK+ D   N R+I KLCEY
Sbjct  1    MGVISRKVLPACGSLCYFCPGLRARSRQPVKRYKSILAEIFPKTQDEEPNERRIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
             ++NP R+PKI   LE+R YKELRS       V+  +Y  LL  CKEQM  FA +LL++V
Sbjct  61   CSRNPLRVPKITVSLEQRIYKELRSEQYGFAKVVMLIYRRLLVSCKEQMPLFASSLLSIV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQ  612
              +LD  + D ++ IGC T   F  +QVDGTY +N+E LV ++C L++E GE++Q
Sbjct  121  HTLLDQKRQDDMRIIGCETLFDFAVNQVDGTYQFNLEGLVPRLCELSQEVGEDEQ  175



>gb|KJB71806.1| hypothetical protein B456_011G143200 [Gossypium raimondii]
Length=778

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 132/184 (72%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ PAC ++C  CP++R+RSRQPVKRYKKLLA+IFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGNLCFFCPSMRARSRQPVKRYKKLLAEIFPRNQDAEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A++NP RIPKI   LE+RC+K+LR+ +   V  +  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ASRNPLRIPKITSNLEQRCFKDLRNENFGCVKAVLCIYRKLLSSCKEQMPLFASSLLGII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + D ++ +GC     FI SQ+DGT+ + +E L+ K+C LA+E G++D+   LR
Sbjct  121  RALLEQNRQDEMRILGCNALVDFINSQMDGTHMFQLEGLIPKLCQLAQEYGDDDRALHLR  180

Query  628  ASSL  639
            +S L
Sbjct  181  SSGL  184



>ref|XP_009610919.1| PREDICTED: protein EFR3 homolog B isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009610926.1| PREDICTED: protein EFR3 homolog B isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009610931.1| PREDICTED: protein EFR3 homolog B isoform X1 [Nicotiana tomentosiformis]
Length=1014

 Score =   202 bits (514),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 132/188 (70%), Gaps = 0/188 (0%)
 Frame = +1

Query  76   LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  255
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  256  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  435
            LCEYAAKNPFRIPKI K LEERCYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  436  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK  615
            L+++  +LD ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA++ GEE+  
Sbjct  121  LSIIQTLLDQSRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEESA  180

Query  616  RCLRASSL  639
            + L    L
Sbjct  181  KHLHTVGL  188



>ref|XP_009610937.1| PREDICTED: protein EFR3 homolog B isoform X2 [Nicotiana tomentosiformis]
Length=1012

 Score =   202 bits (514),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 132/188 (70%), Gaps = 0/188 (0%)
 Frame = +1

Query  76   LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  255
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  256  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  435
            LCEYAAKNPFRIPKI K LEERCYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  436  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK  615
            L+++  +LD ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA++ GEE+  
Sbjct  121  LSIIQTLLDQSRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEESA  180

Query  616  RCLRASSL  639
            + L    L
Sbjct  181  KHLHTVGL  188



>ref|XP_009610943.1| PREDICTED: protein EFR3 homolog B isoform X3 [Nicotiana tomentosiformis]
Length=1010

 Score =   202 bits (514),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 132/188 (70%), Gaps = 0/188 (0%)
 Frame = +1

Query  76   LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  255
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  256  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  435
            LCEYAAKNPFRIPKI K LEERCYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  436  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK  615
            L+++  +LD ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA++ GEE+  
Sbjct  121  LSIIQTLLDQSRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEESA  180

Query  616  RCLRASSL  639
            + L    L
Sbjct  181  KHLHTVGL  188



>ref|XP_006587694.1| PREDICTED: uncharacterized protein LOC100808352 [Glycine max]
Length=1036

 Score =   202 bits (514),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 131/184 (71%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            M ++SR ++P C S+C  CPALR RSR P+KRYKK LADIFP++PD   N R I KLCEY
Sbjct  1    MSVISRNIWPVCGSLCCFCPALRERSRHPIKRYKKFLADIFPRTPDEEPNERMIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP R+PKI   LE+RCY+ELR+ + + V V+  +Y +LL  CK+QM  FA +LL+++
Sbjct  61   ASKNPLRVPKITSYLEQRCYRELRTENYQSVKVVICIYRKLLISCKDQMPLFASSLLSII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D V+ +GC T   F+ +Q DGTY +N++  + K+C+LA+E G++ + + LR
Sbjct  121  QILLDQPRHDEVQILGCQTLFDFVNNQRDGTYMFNLDGFILKLCNLAQEMGDDAKVQHLR  180

Query  628  ASSL  639
            A+ L
Sbjct  181  AAGL  184



>ref|XP_006350206.1| PREDICTED: protein EFR3 homolog B-like isoform X3 [Solanum tuberosum]
Length=969

 Score =   202 bits (513),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 132/184 (72%), Gaps = 0/184 (0%)
 Frame = +1

Query  76   LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  255
            + G  G++SR++ PAC S+C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVMSRQVLPACGSLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  256  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  435
            LCEYAAKNPFRIPKI K LEE+CYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEEKCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  436  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK  615
            L+V+  +LD ++ + +  +GC +   F+ +Q DGTY ++++  + K+C LA++ GEE+  
Sbjct  121  LSVLQTLLDQSRENDMLIVGCESLFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEESA  180

Query  616  RCLR  627
              LR
Sbjct  181  INLR  184



>ref|XP_009610949.1| PREDICTED: protein EFR3 homolog B isoform X4 [Nicotiana tomentosiformis]
Length=1008

 Score =   202 bits (514),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 132/188 (70%), Gaps = 0/188 (0%)
 Frame = +1

Query  76   LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  255
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  256  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  435
            LCEYAAKNPFRIPKI K LEERCYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  436  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK  615
            L+++  +LD ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA++ GEE+  
Sbjct  121  LSIIQTLLDQSRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEESA  180

Query  616  RCLRASSL  639
            + L    L
Sbjct  181  KHLHTVGL  188



>ref|XP_007028781.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY09283.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=1023

 Score =   202 bits (514),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 132/178 (74%), Gaps = 0/178 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR++ PAC S+C  CPA+R+RSRQPVKRYKKL+A+IFP++ +  AN RKI KLC+YA
Sbjct  6    GVISRQVLPACGSLCFFCPAMRARSRQPVKRYKKLIAEIFPRNQEEGANDRKIGKLCDYA  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            +KNP RIPKI+  LE+RCYKELR+ + +   ++  +Y +LL  CKEQM  FA +LL+++ 
Sbjct  66   SKNPLRIPKISNSLEQRCYKELRNENFQSAKIVMCIYRKLLVSCKEQMTLFASSLLSIIQ  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCL  624
             +LD  + D ++ +GC T   F+ +Q DGT+ +N+E  + K+C LA+E GE +++R L
Sbjct  126  TLLDQTRQDEMRIMGCQTLFDFVNNQKDGTFMFNLEGFIPKLCQLAQEIGEGERERKL  183



>ref|XP_006648006.1| PREDICTED: protein EFR3 homolog B-like isoform X1 [Oryza brachyantha]
Length=997

 Score =   202 bits (513),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 131/184 (71%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ PACE +C  CP+LR+RSR PVKRYKKLL++IFPKS D   N RKI KLCEY
Sbjct  3    MGVVSREVLPACERLCFLCPSLRTRSRHPVKRYKKLLSEIFPKSQDEEPNDRKIGKLCEY  62

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
             ++NP R+PKI   LE++ YKELR+ H   V V+  +Y +++C C+EQ+  FA +LLN++
Sbjct  63   ISRNPLRVPKITVYLEQKFYKELRAEHFGSVKVVMAIYRKVICSCQEQLPLFANSLLNII  122

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + D ++TI C T   F+ +QVD TY +N+E+ + K+C LA+E GE ++   + 
Sbjct  123  EALLEQNRHDDLRTIACQTLFYFVNNQVDSTYMFNLESQIPKLCHLAQEIGENEKTSIVH  182

Query  628  ASSL  639
            A+ L
Sbjct  183  AAGL  186



>ref|XP_010319191.1| PREDICTED: protein EFR3 homolog B isoform X1 [Solanum lycopersicum]
 ref|XP_010319192.1| PREDICTED: protein EFR3 homolog B isoform X1 [Solanum lycopersicum]
Length=1012

 Score =   202 bits (513),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 133/188 (71%), Gaps = 0/188 (0%)
 Frame = +1

Query  76   LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  255
            + G  G++SR++ PAC S+C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVMSRQVLPACGSLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  256  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  435
            LCEYAAKNPFRIPKI K LEE+CYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEEKCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  436  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK  615
            L+V+  +LD ++ + +  +GC +   F+ +Q DGTY ++++  + K+C LA++ GEE+  
Sbjct  121  LSVLQTLLDQSRENDMLIVGCESLFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEESA  180

Query  616  RCLRASSL  639
              LR   L
Sbjct  181  IKLRTVGL  188



>ref|XP_004236620.1| PREDICTED: protein EFR3 homolog B isoform X2 [Solanum lycopersicum]
Length=1008

 Score =   202 bits (513),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 133/188 (71%), Gaps = 0/188 (0%)
 Frame = +1

Query  76   LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  255
            + G  G++SR++ PAC S+C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVMSRQVLPACGSLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  256  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  435
            LCEYAAKNPFRIPKI K LEE+CYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEEKCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  436  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK  615
            L+V+  +LD ++ + +  +GC +   F+ +Q DGTY ++++  + K+C LA++ GEE+  
Sbjct  121  LSVLQTLLDQSRENDMLIVGCESLFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEESA  180

Query  616  RCLRASSL  639
              LR   L
Sbjct  181  IKLRTVGL  188



>ref|XP_006350204.1| PREDICTED: protein EFR3 homolog B-like isoform X1 [Solanum tuberosum]
Length=1008

 Score =   202 bits (513),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 132/184 (72%), Gaps = 0/184 (0%)
 Frame = +1

Query  76   LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  255
            + G  G++SR++ PAC S+C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVMSRQVLPACGSLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  256  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  435
            LCEYAAKNPFRIPKI K LEE+CYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEEKCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  436  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK  615
            L+V+  +LD ++ + +  +GC +   F+ +Q DGTY ++++  + K+C LA++ GEE+  
Sbjct  121  LSVLQTLLDQSRENDMLIVGCESLFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEESA  180

Query  616  RCLR  627
              LR
Sbjct  181  INLR  184



>ref|XP_006595061.1| PREDICTED: uncharacterized protein LOC100806860 isoform X2 [Glycine 
max]
 ref|XP_003542058.2| PREDICTED: uncharacterized protein LOC100806860 isoform X1 [Glycine 
max]
Length=965

 Score =   201 bits (512),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 129/184 (70%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ P C ++C+ CP+LR+RSRQPVKRYKK +ADIFP++     N RKI KLCEY
Sbjct  1    MGVMSRRVVPVCGNLCVFCPSLRARSRQPVKRYKKFIADIFPRNQVAEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKI   LE+RCYK+LR+ +   V V+  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITDNLEQRCYKDLRNENFGSVKVVLCIYRKLLSTCKEQMPLFANSLLGII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + D ++ +GC T  +FI  Q DGTY +N+E  + K+C LA+E G  +Q   LR
Sbjct  121  RTLLEQTRADEMQILGCNTLVEFIDCQTDGTYMFNLEGFIPKLCQLAQEVGNNEQALLLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>ref|XP_010930207.1| PREDICTED: uncharacterized protein LOC105051451 [Elaeis guineensis]
Length=1016

 Score =   202 bits (513),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 129/184 (70%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ PAC ++C  CP++R+RSRQPVKRYKKL+AD FPK+P+G  N R I KLCEY
Sbjct  1    MGMVSRQVLPACGNLCFLCPSMRARSRQPVKRYKKLIADSFPKTPEGEPNNRMIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A KNP RIPKI +CLE++ YK LR+ H  L  V+  +Y  LL  CKEQM  FA +LL+V+
Sbjct  61   ACKNPMRIPKITECLEQKFYKALRNEHFSLAKVVPCIYRTLLASCKEQMPLFAPSLLSVI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              + D  + D ++ +GC T   F+ SQ D T+ +N+E L+ K+C L +E G +++   LR
Sbjct  121  RTLFDQTRQDDMRILGCHTVVDFLNSQKDSTFMFNLEGLIPKLCQLGQELGGDERGLRLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>ref|XP_010546486.1| PREDICTED: uncharacterized protein LOC104818426 isoform X2 [Tarenaya 
hassleriana]
Length=1025

 Score =   202 bits (513),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 128/183 (70%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR+L PAC  +CI CPALR+RSRQPVKRYKKL+A+IFP++     N RKI KLCEYA
Sbjct  6    GVISRQLLPACGDLCIFCPALRARSRQPVKRYKKLIAEIFPRNQAEGPNDRKIGKLCEYA  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            AKNP R+PKI+  LE+R YKELR+ + +   ++  +Y +LL  CKEQM  FA  LL  + 
Sbjct  66   AKNPLRMPKISNSLEQRFYKELRNENFQSAKIVMCIYRKLLVTCKEQMTLFASGLLRAIQ  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD ++ D ++  GC T  +F+ +Q D +Y  N+E  + K+C LARE G+ D+ R LRA
Sbjct  126  ALLDQSQQDDMQITGCQTLFEFVNNQKDSSYINNLEGFIPKLCQLAREVGDNDRSRNLRA  185

Query  631  SSL  639
            + L
Sbjct  186  AGL  188



>ref|XP_004951914.1| PREDICTED: uncharacterized protein LOC101783143 isoform X1 [Setaria 
italica]
Length=1032

 Score =   202 bits (513),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 131/191 (69%), Gaps = 1/191 (1%)
 Frame = +1

Query  70   LSLQGKM-GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRK  246
            + L G + G++SRK+ PAC  +C  CP+LR RSRQPVKRYKK++ADIFP S +   N R+
Sbjct  1    MGLNGAVSGMVSRKVLPACGGLCYLCPSLRPRSRQPVKRYKKIIADIFPSSQEDEPNERR  60

Query  247  IMKLCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFA  426
            I KLCEY A+NP R+PKI   LE+RCYKELRS H     V+  +Y  LL  CKEQ+   A
Sbjct  61   IGKLCEYVARNPQRVPKITDYLEQRCYKELRSEHYGYAKVVVLIYRRLLVSCKEQIPLLA  120

Query  427  VNLLNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEE  606
             +LL+++  +LD ++ D ++ IGC     F+ +QVDGTY +N+E LV ++C L++   E+
Sbjct  121  SSLLSIIQTLLDQSRQDDMRIIGCEALFDFVVTQVDGTYQFNLEELVPRLCKLSQVVRED  180

Query  607  DQKRCLRASSL  639
            ++   LRA++L
Sbjct  181  EKANALRAAAL  191



>ref|XP_006478683.1| PREDICTED: uncharacterized protein LOC102614635 isoform X1 [Citrus 
sinensis]
 ref|XP_006478684.1| PREDICTED: uncharacterized protein LOC102614635 isoform X2 [Citrus 
sinensis]
 ref|XP_006478685.1| PREDICTED: uncharacterized protein LOC102614635 isoform X3 [Citrus 
sinensis]
Length=1000

 Score =   201 bits (512),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 130/184 (71%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ P C ++C  CP++R+RSRQPVKRYKK+LADIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVLPVCGNLCFFCPSMRARSRQPVKRYKKMLADIFPRNQDAEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKI   LE+RCYK+LR+ +   V V+  +Y + L  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITTLLEQRCYKDLRNENFGSVKVVVCIYKKFLSSCKEQMPLFASSLLGII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + + ++ +GC T   FI SQ D TY +N+E L+ K+C LA+E G +++   LR
Sbjct  121  RTLLEQTRQEEMQILGCGTLVNFIDSQTDSTYMFNLEGLIPKLCQLAQEMGNDERALRLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>ref|XP_007162229.1| hypothetical protein PHAVU_001G134800g [Phaseolus vulgaris]
 gb|ESW34223.1| hypothetical protein PHAVU_001G134800g [Phaseolus vulgaris]
Length=978

 Score =   201 bits (511),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 135/183 (74%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR++ P C ++C  CP+LR+RSRQPVKRYKKL+ADIFP++ +  AN R+I KLC+YA
Sbjct  7    GVISRQVLPVCGNLCFFCPSLRARSRQPVKRYKKLIADIFPRNQEDGANDRQIGKLCDYA  66

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            A+NP RIPKI + LE+RCY+ELR+ + +   ++  +Y + L  CKEQM  FA +LL+++ 
Sbjct  67   ARNPLRIPKIMQALEQRCYRELRNENIRSAKIVMCIYKKFLFSCKEQMPLFANSLLSIIH  126

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD ++ D ++ IGC     F+ +Q DG+Y +N+E ++ K+C LA+ETG++++ R  R+
Sbjct  127  TLLDQSRQDEMRIIGCQILFDFVNNQSDGSYLFNLEAVIPKLCQLAQETGDDERARMSRS  186

Query  631  SSL  639
            + L
Sbjct  187  TGL  189



>ref|XP_002517810.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44617.1| conserved hypothetical protein [Ricinus communis]
Length=1025

 Score =   201 bits (512),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 130/186 (70%), Gaps = 2/186 (1%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSA--NGRKIMKLC  261
            M ++S ++ PAC+S+C  CPALR+RSRQP+KRYKKLLADIFP++P G    N RKI KLC
Sbjct  1    MSVISTQVMPACDSLCFFCPALRTRSRQPIKRYKKLLADIFPRAPVGEEQLNDRKIGKLC  60

Query  262  EYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLN  441
            EYAAKNP RIPKI   LE+RCYK+LRS   + V ++  +Y +LL  CKEQM  FA +LL+
Sbjct  61   EYAAKNPLRIPKITSSLEQRCYKDLRSEQFQSVKIVMCIYRKLLISCKEQMPLFASSLLS  120

Query  442  VVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRC  621
            ++  +LD  + D ++ +GC     F+ +Q DGTY +N++ L+ K+C + +  GEE +   
Sbjct  121  IIHILLDQTRHDDIRILGCQVLFDFVNNQRDGTYVFNLDGLIPKLCIIVQVIGEEGRVEQ  180

Query  622  LRASSL  639
            LR + L
Sbjct  181  LRTAGL  186



>ref|XP_010555004.1| PREDICTED: uncharacterized protein LOC104824606 [Tarenaya hassleriana]
Length=1042

 Score =   201 bits (512),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 131/195 (67%), Gaps = 12/195 (6%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPD------------GSA  234
            G+LSR++ P C S+C+ CPALR+RSRQPVKRYKKL+ADIFP++ +            G+ 
Sbjct  6    GVLSRQVLPVCGSLCVFCPALRARSRQPVKRYKKLIADIFPRNQEQLGVSLPMRKSFGNG  65

Query  235  NGRKIMKLCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQM  414
               KI KLC+YAAKNP R+PKI+  LE+RCYKELR+ + +   ++  +Y +LL  CKEQM
Sbjct  66   AKWKIGKLCDYAAKNPLRMPKISNSLEQRCYKELRNENFQSAKIVMCIYRKLLVTCKEQM  125

Query  415  ACFAVNLLNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARE  594
              FA  LL  V  +LD  + D ++ IGC T   F+ +Q DG+Y  N+E  + K+C LARE
Sbjct  126  TLFASGLLRAVQALLDQTRQDEMQIIGCQTLFDFVNNQKDGSYINNLEGFIPKLCQLARE  185

Query  595  TGEEDQKRCLRASSL  639
             G++D+ R LRA+ L
Sbjct  186  VGDDDRSRNLRAAGL  200



>ref|XP_007162228.1| hypothetical protein PHAVU_001G134800g [Phaseolus vulgaris]
 gb|ESW34222.1| hypothetical protein PHAVU_001G134800g [Phaseolus vulgaris]
Length=1021

 Score =   201 bits (511),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 135/183 (74%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR++ P C ++C  CP+LR+RSRQPVKRYKKL+ADIFP++ +  AN R+I KLC+YA
Sbjct  7    GVISRQVLPVCGNLCFFCPSLRARSRQPVKRYKKLIADIFPRNQEDGANDRQIGKLCDYA  66

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            A+NP RIPKI + LE+RCY+ELR+ + +   ++  +Y + L  CKEQM  FA +LL+++ 
Sbjct  67   ARNPLRIPKIMQALEQRCYRELRNENIRSAKIVMCIYKKFLFSCKEQMPLFANSLLSIIH  126

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD ++ D ++ IGC     F+ +Q DG+Y +N+E ++ K+C LA+ETG++++ R  R+
Sbjct  127  TLLDQSRQDEMRIIGCQILFDFVNNQSDGSYLFNLEAVIPKLCQLAQETGDDERARMSRS  186

Query  631  SSL  639
            + L
Sbjct  187  TGL  189



>gb|KEH39475.1| cyclin-like protein [Medicago truncatula]
Length=949

 Score =   201 bits (510),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 131/184 (71%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ PAC ++CI CP+LR+RSRQPVKRYKKL+A+I P++     N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGNLCIFCPSLRARSRQPVKRYKKLIAEILPRNKVAELNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKI + LE+RCYK+LR+     V VI  +Y +LL  C+EQ+  FA +LL ++
Sbjct  61   ASKNPLRIPKITENLEQRCYKDLRNESFGSVKVILCIYRKLLSSCREQIPLFASSLLGII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + D V+ +GC T   FI  Q DGTY +N+E  + K+C LA+E G++++   LR
Sbjct  121  RTLLEQTRADEVRILGCNTLVDFIIFQTDGTYMFNLEGFIPKLCQLAQEVGDDERALLLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>ref|XP_009363645.1| PREDICTED: uncharacterized protein LOC103953608 [Pyrus x bretschneideri]
 ref|XP_009363646.1| PREDICTED: uncharacterized protein LOC103953608 [Pyrus x bretschneideri]
Length=997

 Score =   201 bits (511),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 128/184 (70%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ PAC ++C  CP++R+RSRQPVKRYKKLL DI P++ D   N RKI KLC+Y
Sbjct  1    MGVMSRRIVPACGNLCFFCPSMRARSRQPVKRYKKLLTDILPRNQDAEPNDRKIGKLCDY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A KNP RIPKI   LE+RCYK+LR+ H   V V+  +Y +LL  CKEQM  FA +LL +V
Sbjct  61   AMKNPLRIPKITDSLEQRCYKDLRNEHFGSVKVVLCIYRKLLSSCKEQMPLFASSLLGIV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + D ++ +GC T   FI SQ D T+ +++E L+ KVC +A E G+ ++   LR
Sbjct  121  RILLEQTRHDEMRILGCNTLVDFIQSQTDSTHMFSLEGLIPKVCQMAEEVGDNERALRLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>gb|KJB71809.1| hypothetical protein B456_011G143200 [Gossypium raimondii]
Length=926

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 132/184 (72%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ PAC ++C  CP++R+RSRQPVKRYKKLLA+IFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGNLCFFCPSMRARSRQPVKRYKKLLAEIFPRNQDAEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A++NP RIPKI   LE+RC+K+LR+ +   V  +  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ASRNPLRIPKITSNLEQRCFKDLRNENFGCVKAVLCIYRKLLSSCKEQMPLFASSLLGII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + D ++ +GC     FI SQ+DGT+ + +E L+ K+C LA+E G++D+   LR
Sbjct  121  RALLEQNRQDEMRILGCNALVDFINSQMDGTHMFQLEGLIPKLCQLAQEYGDDDRALHLR  180

Query  628  ASSL  639
            +S L
Sbjct  181  SSGL  184



>gb|KJB49179.1| hypothetical protein B456_008G105100 [Gossypium raimondii]
Length=906

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 124/184 (67%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR + P C S+C  CPAL +RSR PVKRYKK LADIFP+SPD   N R I KLCEY
Sbjct  1    MGMISRGVMPVCGSLCFFCPALSTRSRHPVKRYKKFLADIFPRSPDEQPNERMIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKI   LE++ YK+LR+     V VI  VY +L+  CKEQM  FA + L ++
Sbjct  61   ASKNPLRIPKITSALEQKFYKDLRTEQFHSVKVIMLVYKKLIISCKEQMPLFASSFLTII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D  + +GC   + F+ +Q DGTY +N++ L+ K+C LA+E GE+ +   LR
Sbjct  121  QVLLDQTRMDDTRVLGCQALSVFVNNQRDGTYMFNLDGLIPKLCLLAQEMGEDGRVHHLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>ref|XP_003597513.1| EFR3-like protein [Medicago truncatula]
 gb|AES67764.1| cyclin-like protein [Medicago truncatula]
Length=969

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 131/184 (71%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ PAC ++CI CP+LR+RSRQPVKRYKKL+A+I P++     N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGNLCIFCPSLRARSRQPVKRYKKLIAEILPRNKVAELNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKI + LE+RCYK+LR+     V VI  +Y +LL  C+EQ+  FA +LL ++
Sbjct  61   ASKNPLRIPKITENLEQRCYKDLRNESFGSVKVILCIYRKLLSSCREQIPLFASSLLGII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + D V+ +GC T   FI  Q DGTY +N+E  + K+C LA+E G++++   LR
Sbjct  121  RTLLEQTRADEVRILGCNTLVDFIIFQTDGTYMFNLEGFIPKLCQLAQEVGDDERALLLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>gb|EPS68833.1| hypothetical protein M569_05934, partial [Genlisea aurea]
Length=579

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 130/186 (70%), Gaps = 0/186 (0%)
 Frame = +1

Query  82   GKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLC  261
            G+MG +S+++ P C+S+C+CCPAL  RSR PVKRYK+LLAD+FP++ +   N RK+ KLC
Sbjct  42   GEMGAMSKQMMPVCDSLCVCCPALLPRSRHPVKRYKRLLADVFPRNMEEEPNDRKVSKLC  101

Query  262  EYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLN  441
            EYA+KNP R+PKI   LEERCY+E+R+ +   V V+  +Y +L+  C+ QM  FA + L+
Sbjct  102  EYASKNPLRVPKITSLLEERCYREVRNENLGRVKVVMYIYRKLIISCQRQMPLFAGSFLS  161

Query  442  VVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRC  621
            ++  +LD AK D ++ IGC     FI +Q D TY +N+E L+ K+CSLA+  G +++   
Sbjct  162  IINVLLDQAKHDNMRIIGCQALFDFINNQGDSTYMFNLEGLIPKLCSLAQVIGNDEKMLQ  221

Query  622  LRASSL  639
            LR + L
Sbjct  222  LRCAGL  227



>gb|KHN11694.1| Protein EFR3 like B [Glycine soja]
Length=1010

 Score =   201 bits (510),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 131/184 (71%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            M ++SR ++P C S+C  CPAL+ RSR P+KRYKK LADIFP++PD   N R I KLCEY
Sbjct  1    MSVISRNIWPVCGSLCCFCPALQERSRHPIKRYKKFLADIFPRTPDEEPNERMIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP R+PKI   LE+RCY+ELR+ + + V V+  +Y +LL  CK+QM  FA +LL+++
Sbjct  61   ASKNPLRVPKITSYLEQRCYRELRTENYQSVKVVICIYRKLLISCKDQMPLFASSLLSII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D V+ +GC T   F+ +Q DGTY +N++  + K+C+LA+E G++ + + LR
Sbjct  121  QILLDQPRHDEVQILGCQTLFDFVNNQRDGTYMFNLDGFILKLCNLAQEMGDDAKVQHLR  180

Query  628  ASSL  639
            A+ L
Sbjct  181  AAGL  184



>gb|KJB71808.1| hypothetical protein B456_011G143200 [Gossypium raimondii]
Length=975

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 132/184 (72%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ PAC ++C  CP++R+RSRQPVKRYKKLLA+IFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGNLCFFCPSMRARSRQPVKRYKKLLAEIFPRNQDAEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A++NP RIPKI   LE+RC+K+LR+ +   V  +  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ASRNPLRIPKITSNLEQRCFKDLRNENFGCVKAVLCIYRKLLSSCKEQMPLFASSLLGII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + D ++ +GC     FI SQ+DGT+ + +E L+ K+C LA+E G++D+   LR
Sbjct  121  RALLEQNRQDEMRILGCNALVDFINSQMDGTHMFQLEGLIPKLCQLAQEYGDDDRALHLR  180

Query  628  ASSL  639
            +S L
Sbjct  181  SSGL  184



>ref|XP_001767624.1| predicted protein [Physcomitrella patens]
 gb|EDQ67583.1| predicted protein [Physcomitrella patens]
Length=790

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 122/176 (69%), Gaps = 0/176 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MGL+SR++ P C SMC+CCPALR+RSRQPVKRY  LLADI+PKS D + N RKI KL EY
Sbjct  1    MGLISRRVLPICGSMCVCCPALRARSRQPVKRYNMLLADIYPKSQDEAPNDRKIGKLVEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKIA  LE++ YKEL++ H   V  +   +++L   C+++M+ FA N LN++
Sbjct  61   AAKNPLRIPKIAGALEQKGYKELKADHFGTVTTVMRAFSKLFIDCRDEMSLFANNALNLI  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK  615
              +LD      ++ +GCLT   FI  Q D TY  N++ L   +C+LARE G++ ++
Sbjct  121  KVLLDQVAHGNMRIVGCLTLVDFIRVQTDATYMRNLDGLTLPLCALAREQGDDKKQ  176



>gb|KJB71804.1| hypothetical protein B456_011G143200 [Gossypium raimondii]
 gb|KJB71805.1| hypothetical protein B456_011G143200 [Gossypium raimondii]
 gb|KJB71807.1| hypothetical protein B456_011G143200 [Gossypium raimondii]
 gb|KJB71810.1| hypothetical protein B456_011G143200 [Gossypium raimondii]
 gb|KJB71811.1| hypothetical protein B456_011G143200 [Gossypium raimondii]
Length=974

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 132/184 (72%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ PAC ++C  CP++R+RSRQPVKRYKKLLA+IFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGNLCFFCPSMRARSRQPVKRYKKLLAEIFPRNQDAEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A++NP RIPKI   LE+RC+K+LR+ +   V  +  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ASRNPLRIPKITSNLEQRCFKDLRNENFGCVKAVLCIYRKLLSSCKEQMPLFASSLLGII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + D ++ +GC     FI SQ+DGT+ + +E L+ K+C LA+E G++D+   LR
Sbjct  121  RALLEQNRQDEMRILGCNALVDFINSQMDGTHMFQLEGLIPKLCQLAQEYGDDDRALHLR  180

Query  628  ASSL  639
            +S L
Sbjct  181  SSGL  184



>gb|KHG10450.1| Protein EFR3 [Gossypium arboreum]
Length=955

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 124/184 (67%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR + P C S+C  CPAL +RSR PVKRYKK LADIFP+SPD   N R I KLCEY
Sbjct  1    MGMISRGVMPVCGSLCFFCPALSTRSRHPVKRYKKFLADIFPRSPDEQPNERMIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKI   LE++ YK+LR+     V VI  VY +L+  CKEQM  FA + L ++
Sbjct  61   ASKNPLRIPKITSALEQKFYKDLRTEQFHSVKVIMLVYKKLIISCKEQMPLFASSFLTII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D  + +GC   + F+ +Q DGTY +N++ L+ K+C LA+E GE+ +   LR
Sbjct  121  QVLLDQTRMDDTRVLGCQALSVFVNNQRDGTYMFNLDGLIPKLCLLAQEMGEDGRVHHLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>ref|XP_006648302.1| PREDICTED: uncharacterized protein LOC102704216 [Oryza brachyantha]
Length=1039

 Score =   201 bits (510),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 126/183 (69%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SRK+ PAC  +C  CP LR+RSRQPVKRYKK+LADIFP + +   N R+I KLCEY 
Sbjct  12   GVVSRKVLPACGGLCYLCPGLRARSRQPVKRYKKILADIFPATQEEEPNVRRIGKLCEYV  71

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            AKNP R+PKI   LE+RCYKELR+     V V+  +Y +LL  CK+QM   A ++L+++ 
Sbjct  72   AKNPHRVPKITAYLEQRCYKELRNEQYGFVKVVVLIYRKLLVSCKDQMPLLASSVLSIIS  131

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD  + D ++ IGC T   F  SQVDGTY +N+E LV ++C LA+    E++   LR+
Sbjct  132  TLLDQTRRDDLRIIGCETLFDFTVSQVDGTYQFNLEELVPRICELAQIVKIEEKDNTLRS  191

Query  631  SSL  639
            S+L
Sbjct  192  SAL  194



>ref|NP_001048304.1| Os02g0780500 [Oryza sativa Japonica Group]
 dbj|BAD19529.1| cyclin-like protein [Oryza sativa Japonica Group]
 dbj|BAF10218.1| Os02g0780500 [Oryza sativa Japonica Group]
 dbj|BAH00340.1| unnamed protein product [Oryza sativa Japonica Group]
Length=997

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 131/184 (71%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ PACE +C  CP+LR+RSR PVKRYKKLL++IFPKS D   N RKI KLCEY
Sbjct  3    MGVVSREVLPACERLCFLCPSLRTRSRHPVKRYKKLLSEIFPKSQDEEPNDRKIGKLCEY  62

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
             ++NP R+PKI   LE++ YKELR  H   V V+  +Y +++C C+EQ+  FA +LLN+V
Sbjct  63   ISRNPLRVPKITVYLEQKFYKELRVEHFGSVKVVMAIYRKVICSCQEQLPLFANSLLNIV  122

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + D ++TI C T   F+ +QVD TY +N+E+ + K+C LA+E GE+++   + 
Sbjct  123  EALLEQNRQDDLRTIACRTLFYFVNNQVDSTYMFNLESQIPKLCQLAQEMGEKEKISIVH  182

Query  628  ASSL  639
            A+ L
Sbjct  183  AAGL  186



>ref|XP_003520520.1| PREDICTED: uncharacterized protein LOC100817296 isoform X1 [Glycine 
max]
Length=1014

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 132/183 (72%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR++ PAC S+C  CP+LR+RSRQPVKRYKKL+A IFP++ +   N R I KLC+YA
Sbjct  6    GVISRQVLPACGSLCFFCPSLRARSRQPVKRYKKLIAVIFPRNKEEGPNDRNIGKLCDYA  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            A+NP RIPKI + LE+RCYKELR+ +     ++  +Y + +  CKEQM  FA +LL+++ 
Sbjct  66   ARNPLRIPKIVQALEQRCYKELRNENFHSTKIVMCIYKKFMFSCKEQMPLFASSLLSIIH  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD ++ D ++ IGC     F+ +Q+DG+Y +N+E ++ K+C LA+ETGE++  R  R+
Sbjct  126  TLLDQSRLDEMRIIGCQILFDFVNNQIDGSYLFNLEGIIPKLCQLAQETGEDESARNSRS  185

Query  631  SSL  639
            + L
Sbjct  186  AGL  188



>ref|XP_006576825.1| PREDICTED: uncharacterized protein LOC100817296 isoform X2 [Glycine 
max]
Length=1016

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 132/183 (72%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR++ PAC S+C  CP+LR+RSRQPVKRYKKL+A IFP++ +   N R I KLC+YA
Sbjct  6    GVISRQVLPACGSLCFFCPSLRARSRQPVKRYKKLIAVIFPRNKEEGPNDRNIGKLCDYA  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            A+NP RIPKI + LE+RCYKELR+ +     ++  +Y + +  CKEQM  FA +LL+++ 
Sbjct  66   ARNPLRIPKIVQALEQRCYKELRNENFHSTKIVMCIYKKFMFSCKEQMPLFASSLLSIIH  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD ++ D ++ IGC     F+ +Q+DG+Y +N+E ++ K+C LA+ETGE++  R  R+
Sbjct  126  TLLDQSRLDEMRIIGCQILFDFVNNQIDGSYLFNLEGIIPKLCQLAQETGEDESARNSRS  185

Query  631  SSL  639
            + L
Sbjct  186  AGL  188



>gb|KHN30101.1| Protein EFR3 like B [Glycine soja]
Length=967

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 128/184 (70%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ P C ++C+ CP+LR+RSRQPVKRYKK +ADIFP++     N RK  KLCEY
Sbjct  1    MGVMSRRVVPVCGNLCVFCPSLRARSRQPVKRYKKFIADIFPRNQVAEPNDRKFGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKI   LE+RCYK+LR+ +   V V+  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITDNLEQRCYKDLRNENFGSVKVVLCIYRKLLSTCKEQMPLFANSLLGII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + D ++ +GC T  +FI  Q DGTY +N+E  + K+C LA+E G  +Q   LR
Sbjct  121  RTLLEQTRADEMQILGCNTLVEFIDCQTDGTYMFNLEGFIPKLCQLAQEVGNNEQALLLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>gb|KJB49180.1| hypothetical protein B456_008G105100 [Gossypium raimondii]
 gb|KJB49181.1| hypothetical protein B456_008G105100 [Gossypium raimondii]
Length=996

 Score =   199 bits (507),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 124/184 (67%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR + P C S+C  CPAL +RSR PVKRYKK LADIFP+SPD   N R I KLCEY
Sbjct  1    MGMISRGVMPVCGSLCFFCPALSTRSRHPVKRYKKFLADIFPRSPDEQPNERMIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKI   LE++ YK+LR+     V VI  VY +L+  CKEQM  FA + L ++
Sbjct  61   ASKNPLRIPKITSALEQKFYKDLRTEQFHSVKVIMLVYKKLIISCKEQMPLFASSFLTII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D  + +GC   + F+ +Q DGTY +N++ L+ K+C LA+E GE+ +   LR
Sbjct  121  QVLLDQTRMDDTRVLGCQALSVFVNNQRDGTYMFNLDGLIPKLCLLAQEMGEDGRVHHLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>gb|KJB37960.1| hypothetical protein B456_006G228200 [Gossypium raimondii]
Length=778

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 129/184 (70%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ P C ++C  CP+LR+RSRQPVKRYKKLL+DIFP++ +   N RKI KLCEY
Sbjct  1    MGVMSRRVLPVCGNLCFFCPSLRARSRQPVKRYKKLLSDIFPRNQEPVPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKI   LE+RC+K LR+     V VI  VY +LL  CKEQMA FA +LL ++
Sbjct  61   AAKNPLRIPKITSNLEQRCFKGLRNEKFGCVKVILCVYTKLLSTCKEQMALFASSLLGII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + D +  IGC    +F+ SQ+D T+ + +E L+ K+C LA E G++D+   LR
Sbjct  121  QTLLEQTRLDEMLIIGCDALAEFVNSQMDSTHMFQLEGLIPKLCQLAEEDGDDDRALRLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>gb|KJB49178.1| hypothetical protein B456_008G105100 [Gossypium raimondii]
Length=1035

 Score =   199 bits (507),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 124/184 (67%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR + P C S+C  CPAL +RSR PVKRYKK LADIFP+SPD   N R I KLCEY
Sbjct  1    MGMISRGVMPVCGSLCFFCPALSTRSRHPVKRYKKFLADIFPRSPDEQPNERMIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP RIPKI   LE++ YK+LR+     V VI  VY +L+  CKEQM  FA + L ++
Sbjct  61   ASKNPLRIPKITSALEQKFYKDLRTEQFHSVKVIMLVYKKLIISCKEQMPLFASSFLTII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D  + +GC   + F+ +Q DGTY +N++ L+ K+C LA+E GE+ +   LR
Sbjct  121  QVLLDQTRMDDTRVLGCQALSVFVNNQRDGTYMFNLDGLIPKLCLLAQEMGEDGRVHHLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>ref|XP_006293443.1| hypothetical protein CARUB_v10022560mg [Capsella rubella]
 gb|EOA26341.1| hypothetical protein CARUB_v10022560mg [Capsella rubella]
Length=1027

 Score =   199 bits (506),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 126/183 (69%), Gaps = 0/183 (0%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  270
            G++SR++ P C S+CI CPALR+RSRQPVKRYKKL+ADIFP++ D   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCILCPALRARSRQPVKRYKKLIADIFPRNQDEGPNDRKIGKLCEYA  65

Query  271  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  450
            AKN  R+PKI+  LE+RCYKELR+ +  L  +   +Y  LL  CKEQM  F+   L  V 
Sbjct  66   AKNAVRMPKISDSLEQRCYKELRNENFHLAKIAMCIYRRLLVTCKEQMPLFSSGFLRTVQ  125

Query  451  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  630
             +LD  + D ++ IGC +  +F+ +Q DG+  +N+E  + K+C L  E G++D+ R LRA
Sbjct  126  ALLDQTRQDEMQIIGCQSLFEFVNNQKDGSSLFNLEGFLPKLCQLGLEGGDDDRLRSLRA  185

Query  631  SSL  639
            + L
Sbjct  186  AGL  188



>ref|XP_010546363.1| PREDICTED: uncharacterized protein LOC104818426 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010546433.1| PREDICTED: uncharacterized protein LOC104818426 isoform X1 [Tarenaya 
hassleriana]
Length=1026

 Score =   199 bits (506),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 128/184 (70%), Gaps = 1/184 (1%)
 Frame = +1

Query  91   GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSA-NGRKIMKLCEY  267
            G++SR+L PAC  +CI CPALR+RSRQPVKRYKKL+A+IFP++      N RKI KLCEY
Sbjct  6    GVISRQLLPACGDLCIFCPALRARSRQPVKRYKKLIAEIFPRNQQAEGPNDRKIGKLCEY  65

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP R+PKI+  LE+R YKELR+ + +   ++  +Y +LL  CKEQM  FA  LL  +
Sbjct  66   AAKNPLRMPKISNSLEQRFYKELRNENFQSAKIVMCIYRKLLVTCKEQMTLFASGLLRAI  125

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD ++ D ++  GC T  +F+ +Q D +Y  N+E  + K+C LARE G+ D+ R LR
Sbjct  126  QALLDQSQQDDMQITGCQTLFEFVNNQKDSSYINNLEGFIPKLCQLAREVGDNDRSRNLR  185

Query  628  ASSL  639
            A+ L
Sbjct  186  AAGL  189



>ref|XP_011087843.1| PREDICTED: uncharacterized protein LOC105169196 [Sesamum indicum]
Length=1011

 Score =   199 bits (505),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 130/184 (71%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++S+++ P C+S+CICCP +R RSR PVKRYKKLLADI+PK+ +   N RKI KLCEY
Sbjct  1    MGVMSKRMMPVCDSLCICCPGMRPRSRHPVKRYKKLLADIYPKNMEEEPNDRKISKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A+KNP R+PKI   LEERCY+ELR+ +   V V+  +Y +L+  C++QM  FA + L+++
Sbjct  61   ASKNPLRVPKITSLLEERCYRELRNENINCVKVVMCIYRKLVVSCQQQMPLFAGSFLSII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D ++ IGC     FI +Q DGTY +N+E L+ K+C +A+E G +++   LR
Sbjct  121  HILLDQTRHDEMRIIGCHALFDFINNQRDGTYMFNLEGLIPKLCLIAQEMGNDERMLRLR  180

Query  628  ASSL  639
             + L
Sbjct  181  CAGL  184



>gb|KJB37959.1| hypothetical protein B456_006G228200 [Gossypium raimondii]
Length=963

 Score =   198 bits (503),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 129/184 (70%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ P C ++C  CP+LR+RSRQPVKRYKKLL+DIFP++ +   N RKI KLCEY
Sbjct  1    MGVMSRRVLPVCGNLCFFCPSLRARSRQPVKRYKKLLSDIFPRNQEPVPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            AAKNP RIPKI   LE+RC+K LR+     V VI  VY +LL  CKEQMA FA +LL ++
Sbjct  61   AAKNPLRIPKITSNLEQRCFKGLRNEKFGCVKVILCVYTKLLSTCKEQMALFASSLLGII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + D +  IGC    +F+ SQ+D T+ + +E L+ K+C LA E G++D+   LR
Sbjct  121  QTLLEQTRLDEMLIIGCDALAEFVNSQMDSTHMFQLEGLIPKLCQLAEEDGDDDRALRLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>ref|XP_002277709.2| PREDICTED: uncharacterized protein LOC100265428 [Vitis vinifera]
Length=1012

 Score =   198 bits (504),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 131/184 (71%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SRK+ P C S+C  CP++RSRSRQPVKRYKKLLA+IFP+S +   N RKI KLCEY
Sbjct  1    MGIISRKVMPVCGSLCFFCPSMRSRSRQPVKRYKKLLAEIFPRSREEEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A++NP RIPKI   LE+RCYKELR+     V V+  +Y +LL  CKEQM  FA +LL+++
Sbjct  61   ASRNPLRIPKITTYLEQRCYKELRTERFHHVKVVMCIYRKLLISCKEQMPLFAGSLLSII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D ++ IGC     F+ +Q D TY +N++ L+ K+C +A+E G++++ + L 
Sbjct  121  HILLDQTRQDELRIIGCQALFDFVNNQGDSTYMFNLDGLIPKLCLVAQEMGDDERVQQLH  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>ref|XP_004506319.1| PREDICTED: uncharacterized protein LOC101489771 [Cicer arietinum]
Length=1032

 Score =   199 bits (505),  Expect = 8e-55, Method: Composition-based stats.
 Identities = 89/184 (48%), Positives = 131/184 (71%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            M ++SR ++P C S+C  CPALR RSR P+KRYKKLLA+IFP++ +   N RKI KLCEY
Sbjct  1    MSVISRNIWPVCGSLCCFCPALRERSRHPIKRYKKLLAEIFPRTQEEEPNDRKISKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A++NP R+PKI   LE+RCY+ELRS + + V V+  +Y +LL  C++QM  FA +LL+++
Sbjct  61   ASRNPLRVPKITSYLEQRCYRELRSENYQAVKVVICIYRKLLVSCRDQMPLFASSLLSII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD  + D V+ +GC T   F+ +Q DGTY +N++  + K+C LA++ GE+ + + LR
Sbjct  121  QILLDQTRHDEVQILGCQTLFDFVNNQRDGTYMFNLDMFILKLCQLAQQMGEDAKIQHLR  180

Query  628  ASSL  639
            AS L
Sbjct  181  ASGL  184



>ref|XP_010672158.1| PREDICTED: uncharacterized protein LOC104888784 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1002

 Score =   198 bits (504),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 128/184 (70%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ P C S+CI CP+LR+RSRQPVKRYKKLLADIFP++ +   N RKI KLCEY
Sbjct  1    MGVMSRRVLPVCGSICIFCPSLRARSRQPVKRYKKLLADIFPRNQEIEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
             +KNP R+PKI + LE+R YK+LR+ +     V+  VY + L  CKEQM  FA +LL ++
Sbjct  61   VSKNPLRVPKITEYLEQRFYKDLRNENVGSAKVVLCVYRKFLSSCKEQMPLFACSLLGII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD    + ++ +GC     F+  QV  TY +NIE LV K+C LA+E G++D+  CLR
Sbjct  121  RTLLDQTSREEMQILGCNALVDFLNIQVGSTYIFNIEGLVPKLCQLAQEVGDDDRFLCLR  180

Query  628  ASSL  639
            A+ L
Sbjct  181  AAGL  184



>ref|XP_004486920.1| PREDICTED: uncharacterized protein LOC101509978 isoform X1 [Cicer 
arietinum]
Length=944

 Score =   197 bits (502),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 130/184 (71%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ PAC ++C+ CP+LR+RSRQPVKRYKKL+A++ P++     N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGNLCVFCPSLRARSRQPVKRYKKLIAEVLPRNQVTELNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A +NP RIPKI + LE+RCYK+LR+     V VI  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ANRNPLRIPKITENLEQRCYKDLRNETFGSVKVILCIYRKLLSSCKEQMPLFASSLLGII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + D V+ +GC T   F+  Q DGTY +N+E  + K+C LA+E G++++   LR
Sbjct  121  RTLLEQTRADEVQILGCNTLVDFVNFQTDGTYMFNLEGFIPKLCELAQEVGDDERALLLR  180

Query  628  ASSL  639
            ++ L
Sbjct  181  SAGL  184



>ref|XP_009118564.1| PREDICTED: protein EFR3 homolog [Brassica rapa]
Length=933

 Score =   197 bits (502),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 135/184 (73%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ PAC ++C  CP+LR+RSR PVKRYKK+LA+IFP++ +  AN RKI KLCEY
Sbjct  1    MGVMSRRVLPACGNLCFFCPSLRARSRHPVKRYKKMLAEIFPRNQEAEANDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A++NP RIPKI + LE++CYKELR+G+   V V+  +Y +LL  CKEQM  F+ +LL+VV
Sbjct  61   ASRNPLRIPKITEYLEQKCYKELRNGNIGSVKVVLCIYKKLLSSCKEQMPLFSCSLLSVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + + V+ +GC T   FI  Q + ++ +N+E L+ K+C LA+E G++++   LR
Sbjct  121  RTLLEQTRDEEVQILGCNTLVDFISLQTENSHMFNLEGLIPKLCQLAQEMGDDERSLRLR  180

Query  628  ASSL  639
            ++ +
Sbjct  181  SAGM  184



>ref|XP_010672159.1| PREDICTED: uncharacterized protein LOC104888784 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1001

 Score =   198 bits (504),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 128/184 (70%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ P C S+CI CP+LR+RSRQPVKRYKKLLADIFP++ +   N RKI KLCEY
Sbjct  1    MGVMSRRVLPVCGSICIFCPSLRARSRQPVKRYKKLLADIFPRNQEIEPNDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
             +KNP R+PKI + LE+R YK+LR+ +     V+  VY + L  CKEQM  FA +LL ++
Sbjct  61   VSKNPLRVPKITEYLEQRFYKDLRNENVGSAKVVLCVYRKFLSSCKEQMPLFACSLLGII  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +LD    + ++ +GC     F+  QV  TY +NIE LV K+C LA+E G++D+  CLR
Sbjct  121  RTLLDQTSREEMQILGCNALVDFLNIQVGSTYIFNIEGLVPKLCQLAQEVGDDDRFLCLR  180

Query  628  ASSL  639
            A+ L
Sbjct  181  AAGL  184



>emb|CDY06190.1| BnaA09g50130D [Brassica napus]
Length=936

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 135/184 (73%), Gaps = 0/184 (0%)
 Frame = +1

Query  88   MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  267
            MG++SR++ PAC ++C  CP+LR+RSR PVKRYKK+LA+IFP++ +  AN RKI KLCEY
Sbjct  1    MGVMSRRVLPACGNLCFFCPSLRARSRHPVKRYKKMLAEIFPRNQEAEANDRKIGKLCEY  60

Query  268  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  447
            A++NP RIPKI + LE++CYKELR+G+   V V+  +Y +LL  CKEQM  F+ +LL+VV
Sbjct  61   ASRNPLRIPKITEYLEQKCYKELRNGNIGSVKVVLCIYKKLLSSCKEQMPLFSCSLLSVV  120

Query  448  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  627
              +L+  + + V+ +GC T   FI  Q + ++ +N+E L+ K+C LA+E G++++   LR
Sbjct  121  RTLLEQTRDEEVQILGCNTLVDFISLQTENSHMFNLEGLIPKLCQLAQEMGDDERSLRLR  180

Query  628  ASSL  639
            ++ +
Sbjct  181  SAGM  184



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750