BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS027F08

Length=561
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006451102.1|  hypothetical protein CICLE_v100107081mg            214   1e-66   
ref|XP_009627506.1|  PREDICTED: leucine-rich repeat extensin-like...    218   6e-64   Nicotiana tomentosiformis
ref|XP_004252054.1|  PREDICTED: leucine-rich repeat extensin-like...    220   7e-64   Solanum lycopersicum
ref|XP_006366874.1|  PREDICTED: leucine-rich repeat extensin-like...    219   2e-63   Solanum tuberosum [potatoes]
ref|XP_009760538.1|  PREDICTED: leucine-rich repeat extensin-like...    219   3e-63   Nicotiana sylvestris
ref|XP_006353562.1|  PREDICTED: leucine-rich repeat extensin-like...    218   4e-63   Solanum tuberosum [potatoes]
emb|CDP03355.1|  unnamed protein product                                218   5e-63   Coffea canephora [robusta coffee]
ref|XP_009627507.1|  PREDICTED: leucine-rich repeat extensin-like...    215   6e-63   Nicotiana tomentosiformis
ref|XP_011078360.1|  PREDICTED: leucine-rich repeat extensin-like...    213   7e-63   Sesamum indicum [beniseed]
ref|XP_004173680.1|  PREDICTED: leucine-rich repeat extensin-like...    211   1e-62   
gb|KDP32304.1|  hypothetical protein JCGZ_13229                         215   6e-62   Jatropha curcas
ref|NP_189091.1|  leucine-rich repeat extensin-like protein 4           211   7e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010050506.1|  PREDICTED: leucine-rich repeat extensin-like...    208   1e-61   Eucalyptus grandis [rose gum]
emb|CDX93014.1|  BnaA03g37360D                                          209   1e-61   
ref|XP_006476103.1|  PREDICTED: leucine-rich repeat extensin-like...    213   3e-61   
ref|XP_008361263.1|  PREDICTED: leucine-rich repeat extensin-like...    201   6e-61   
ref|XP_004139428.1|  PREDICTED: leucine-rich repeat extensin-like...    210   7e-61   
gb|KJB06894.1|  hypothetical protein B456_001G004000                    209   7e-61   Gossypium raimondii
ref|XP_007013226.1|  Leucine-rich repeat family protein                 212   8e-61   
ref|XP_002885650.1|  predicted protein                                  207   9e-61   
gb|KJB54162.1|  hypothetical protein B456_009G023700                    208   1e-60   Gossypium raimondii
gb|KJB06895.1|  hypothetical protein B456_001G004000                    207   1e-60   Gossypium raimondii
ref|XP_008458246.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    210   2e-60   
ref|XP_010088853.1|  Leucine-rich repeat extensin-like protein 4        211   3e-60   Morus notabilis
emb|CDX94809.1|  BnaC03g43790D                                          207   3e-60   
ref|XP_006371912.1|  hypothetical protein POPTR_0018s06150g             206   4e-60   
gb|KGN60627.1|  hypothetical protein Csa_2G004760                       210   4e-60   Cucumis sativus [cucumbers]
ref|XP_010527189.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    209   6e-60   Tarenaya hassleriana [spider flower]
gb|KJB06897.1|  hypothetical protein B456_001G004000                    207   8e-60   Gossypium raimondii
ref|XP_010532845.1|  PREDICTED: leucine-rich repeat extensin-like...    207   2e-59   Tarenaya hassleriana [spider flower]
ref|XP_004287084.1|  PREDICTED: leucine-rich repeat extensin-like...    208   2e-59   Fragaria vesca subsp. vesca
gb|KJB54163.1|  hypothetical protein B456_009G023700                    207   3e-59   Gossypium raimondii
ref|XP_009132101.1|  PREDICTED: leucine-rich repeat extensin-like...    207   4e-59   Brassica rapa
ref|XP_010488556.1|  PREDICTED: leucine-rich repeat extensin-like...    202   4e-59   
ref|XP_009135898.1|  PREDICTED: leucine-rich repeat extensin-like...    208   4e-59   Brassica rapa
gb|KJB06896.1|  hypothetical protein B456_001G004000                    206   6e-59   Gossypium raimondii
ref|XP_004148723.1|  PREDICTED: leucine-rich repeat extensin-like...    207   6e-59   
ref|XP_006414071.1|  hypothetical protein EUTSA_v10024510mg             207   6e-59   
gb|KGN65364.1|  hypothetical protein Csa_1G383520                       207   7e-59   Cucumis sativus [cucumbers]
ref|XP_004170319.1|  PREDICTED: leucine-rich repeat extensin-like...    207   8e-59   
ref|XP_008463374.1|  PREDICTED: leucine-rich repeat extensin-like...    207   8e-59   Cucumis melo [Oriental melon]
ref|XP_002281292.2|  PREDICTED: leucine-rich repeat extensin-like...    206   2e-58   Vitis vinifera
ref|XP_011043443.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    204   2e-58   Populus euphratica
ref|XP_006389464.1|  hypothetical protein POPTR_0024s00730g             201   1e-57   Populus trichocarpa [western balsam poplar]
ref|XP_010513507.1|  PREDICTED: leucine-rich repeat extensin-like...    202   2e-57   
ref|XP_008242638.1|  PREDICTED: leucine-rich repeat extensin-like...    201   4e-57   Prunus mume [ume]
ref|XP_004512961.1|  PREDICTED: leucine-rich repeat extensin-like...    201   1e-56   Cicer arietinum [garbanzo]
ref|XP_006285388.1|  hypothetical protein CARUB_v10006785mg             201   1e-56   Capsella rubella
ref|XP_008344101.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    197   2e-56   
gb|KEH27082.1|  LRR extensin-like protein                               200   3e-56   Medicago truncatula
ref|NP_193602.4|  leucine-rich repeat extensin-like protein 5           200   3e-56   Arabidopsis thaliana [mouse-ear cress]
emb|CAB37452.1|  extensin-like protein                                  200   3e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003620502.1|  Extensin-like protein                              200   3e-56   
ref|XP_010688564.1|  PREDICTED: leucine-rich repeat extensin-like...    197   3e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010254179.1|  PREDICTED: leucine-rich repeat extensin-like...    199   5e-56   
ref|XP_009336917.1|  PREDICTED: leucine-rich repeat extensin-like...    199   6e-56   
ref|XP_010434500.1|  PREDICTED: leucine-rich repeat extensin-like...    199   7e-56   
ref|XP_010434501.1|  PREDICTED: leucine-rich repeat extensin-like...    198   9e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010439825.1|  PREDICTED: leucine-rich repeat extensin-like...    198   2e-55   
ref|XP_010449482.1|  PREDICTED: leucine-rich repeat extensin-like...    197   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_002867981.1|  hypothetical protein ARALYDRAFT_492992             196   3e-55   
ref|XP_006389336.1|  hypothetical protein POPTR_0028s00200g             193   3e-55   
ref|XP_008365636.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    191   2e-54   
ref|XP_006414930.1|  hypothetical protein EUTSA_v100275740mg            189   2e-54   
ref|XP_007152809.1|  hypothetical protein PHAVU_004G161500g             193   5e-54   Phaseolus vulgaris [French bean]
ref|XP_006282938.1|  hypothetical protein CARUB_v100074500mg            187   3e-53   
ref|NP_193070.1|  leucine-rich repeat extensin-like protein 3           191   4e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010925532.1|  PREDICTED: leucine-rich repeat extensin-like...    188   5e-53   
ref|XP_002863246.1|  hypothetical protein ARALYDRAFT_497051             188   6e-53   
ref|XP_008793507.1|  PREDICTED: leucine-rich repeat extensin-like...    189   1e-52   Phoenix dactylifera
ref|XP_008786172.1|  PREDICTED: leucine-rich repeat extensin-like...    188   2e-52   
ref|XP_010249819.1|  PREDICTED: leucine-rich repeat extensin-like...    188   3e-52   Nelumbo nucifera [Indian lotus]
gb|EPS61338.1|  hypothetical protein M569_13456                         182   4e-52   Genlisea aurea
ref|XP_006300268.1|  hypothetical protein CARUB_v100163570mg            184   6e-52   
gb|KFK36221.1|  hypothetical protein AALP_AA4G093700                    188   6e-52   Arabis alpina [alpine rockcress]
ref|XP_010450227.1|  PREDICTED: leucine-rich repeat extensin-like...    187   8e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010450229.1|  PREDICTED: leucine-rich repeat extensin-like...    187   1e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010450228.1|  PREDICTED: leucine-rich repeat extensin-like...    187   1e-51   
ref|XP_010440602.1|  PREDICTED: leucine-rich repeat extensin-like...    186   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_003532491.1|  PREDICTED: leucine-rich repeat extensin-like...    186   3e-51   Glycine max [soybeans]
ref|XP_003524389.2|  PREDICTED: leucine-rich repeat extensin-like...    184   3e-51   
gb|KHN21547.1|  Leucine-rich repeat extensin-like protein 5             184   5e-51   Glycine soja [wild soybean]
ref|XP_010435287.1|  PREDICTED: leucine-rich repeat extensin-like...    184   7e-51   Camelina sativa [gold-of-pleasure]
ref|XP_006450582.1|  hypothetical protein CICLE_v10010264mg             181   1e-50   Citrus clementina [clementine]
ref|XP_009352479.1|  PREDICTED: leucine-rich repeat extensin-like...    181   2e-50   Pyrus x bretschneideri [bai li]
ref|XP_007160348.1|  hypothetical protein PHAVU_002G314200g             181   8e-50   Phaseolus vulgaris [French bean]
gb|KDO79655.1|  hypothetical protein CISIN_1g041736mg                   179   9e-50   Citrus sinensis [apfelsine]
ref|XP_007013716.1|  Leucine-rich repeat family protein                 180   1e-49   
ref|XP_006476177.1|  PREDICTED: leucine-rich repeat extensin-like...    178   1e-49   Citrus sinensis [apfelsine]
ref|XP_009408826.1|  PREDICTED: leucine-rich repeat extensin-like...    179   1e-49   
ref|XP_009403414.1|  PREDICTED: leucine-rich repeat extensin-like...    179   2e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009377376.1|  PREDICTED: leucine-rich repeat extensin-like...    177   2e-48   
ref|XP_010049719.1|  PREDICTED: leucine-rich repeat extensin-like...    176   4e-48   Eucalyptus grandis [rose gum]
ref|XP_008378297.1|  PREDICTED: leucine-rich repeat extensin-like...    175   6e-48   
ref|XP_009381253.1|  PREDICTED: leucine-rich repeat extensin-like...    174   7e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008347715.1|  PREDICTED: leucine-rich repeat extensin-like...    171   1e-47   
ref|XP_008357497.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    171   2e-46   
emb|CDY42885.1|  BnaC08g46890D                                          167   3e-46   Brassica napus [oilseed rape]
ref|XP_009348443.1|  PREDICTED: leucine-rich repeat extensin-like...    171   5e-46   Pyrus x bretschneideri [bai li]
ref|XP_008337109.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    166   2e-45   
gb|KFK28537.1|  hypothetical protein AALP_AA7G009800                    169   3e-45   Arabis alpina [alpine rockcress]
ref|XP_010925096.1|  PREDICTED: leucine-rich repeat extensin-like...    162   7e-44   
ref|XP_010926371.1|  PREDICTED: leucine-rich repeat extensin-like...    164   1e-43   Elaeis guineensis
ref|XP_008219840.1|  PREDICTED: leucine-rich repeat extensin-like...    162   2e-43   Prunus mume [ume]
ref|XP_007227690.1|  hypothetical protein PRUPE_ppa1027218m2g           159   6e-43   
ref|XP_006842252.1|  hypothetical protein AMTR_s00078p00197410          161   4e-42   
ref|XP_004292960.1|  PREDICTED: leucine-rich repeat extensin-like...    158   6e-42   Fragaria vesca subsp. vesca
ref|XP_011026539.1|  PREDICTED: leucine-rich repeat extensin-like...    155   5e-41   Populus euphratica
ref|XP_011026538.1|  PREDICTED: leucine-rich repeat extensin-like...    155   1e-40   Populus euphratica
gb|KJB27056.1|  hypothetical protein B456_004G274900                    152   3e-40   Gossypium raimondii
ref|XP_004512856.1|  PREDICTED: leucine-rich repeat extensin-like...    153   5e-40   Cicer arietinum [garbanzo]
ref|XP_002324259.1|  hypothetical protein POPTR_0018s01010g             152   8e-40   
ref|XP_008366033.1|  PREDICTED: LOW QUALITY PROTEIN: pollen-speci...    153   3e-39   
ref|XP_008776836.1|  PREDICTED: leucine-rich repeat extensin-like...    150   6e-39   
ref|XP_011019702.1|  PREDICTED: leucine-rich repeat extensin-like...    149   8e-39   Populus euphratica
ref|XP_011019700.1|  PREDICTED: leucine-rich repeat extensin-like...    149   9e-39   Populus euphratica
ref|XP_008458675.1|  PREDICTED: pollen-specific leucine-rich repe...    150   1e-38   Cucumis melo [Oriental melon]
ref|XP_011019699.1|  PREDICTED: leucine-rich repeat extensin-like...    149   1e-38   Populus euphratica
ref|XP_008458676.1|  PREDICTED: pollen-specific leucine-rich repe...    147   4e-38   
ref|XP_009613983.1|  PREDICTED: leucine-rich repeat extensin-like...    147   4e-38   Nicotiana tomentosiformis
ref|XP_010251965.1|  PREDICTED: leucine-rich repeat extensin-like...    148   5e-38   
ref|XP_010107567.1|  Leucine-rich repeat extensin-like protein 2        148   1e-37   Morus notabilis
ref|XP_004173261.1|  PREDICTED: pollen-specific leucine-rich repe...    145   1e-37   
ref|XP_008225431.1|  PREDICTED: pollen-specific leucine-rich repe...    148   2e-37   
tpg|DAA58808.1|  TPA: leucine-rich repeat (LRR) family protein          145   3e-37   
ref|XP_008458201.1|  PREDICTED: LOW QUALITY PROTEIN: pollen-speci...    145   3e-37   
gb|KDP27758.1|  hypothetical protein JCGZ_19787                         146   4e-37   Jatropha curcas
ref|XP_007017392.1|  Leucine-rich repeat family protein                 146   6e-37   
ref|XP_006848210.1|  hypothetical protein AMTR_s00029p00242610          139   7e-37   
ref|XP_004173016.1|  PREDICTED: pollen-specific leucine-rich repe...    140   8e-37   
gb|KGN45680.1|  hypothetical protein Csa_6G006180                       144   8e-37   Cucumis sativus [cucumbers]
ref|XP_002455880.1|  hypothetical protein SORBIDRAFT_03g026730          144   8e-37   Sorghum bicolor [broomcorn]
ref|XP_003629650.1|  Receptor-like protein kinase                       144   9e-37   
ref|XP_003630813.1|  Extensin-like protein                              145   1e-36   Medicago truncatula
gb|KGN45681.1|  hypothetical protein Csa_6G006190                       145   1e-36   Cucumis sativus [cucumbers]
ref|XP_011081863.1|  PREDICTED: leucine-rich repeat extensin-like...    143   1e-36   Sesamum indicum [beniseed]
gb|KJB74831.1|  hypothetical protein B456_012G009700                    143   1e-36   Gossypium raimondii
ref|XP_011019927.1|  PREDICTED: leucine-rich repeat extensin-like...    145   1e-36   Populus euphratica
gb|KJB74832.1|  hypothetical protein B456_012G009700                    144   2e-36   Gossypium raimondii
ref|XP_004138582.1|  PREDICTED: pollen-specific leucine-rich repe...    143   2e-36   
sp|O48809.1|LRX2_ARATH  RecName: Full=Leucine-rich repeat extensi...    144   3e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006372265.1|  hypothetical protein POPTR_0018s14790g             141   3e-36   
ref|XP_009798822.1|  PREDICTED: leucine-rich repeat extensin-like...    142   3e-36   Nicotiana sylvestris
ref|NP_176434.1|  leucine-rich repeat extensin-like protein 2           144   5e-36   
ref|XP_007014601.1|  Leucine-rich repeat/extensin 2                     143   5e-36   
gb|KJB79255.1|  hypothetical protein B456_013G040300                    141   6e-36   Gossypium raimondii
ref|XP_004138583.1|  PREDICTED: pollen-specific leucine-rich repe...    141   6e-36   
ref|XP_006406541.1|  hypothetical protein EUTSA_v10022433mg             139   6e-36   
ref|XP_010466040.1|  PREDICTED: pollen-specific leucine-rich repe...    144   7e-36   Camelina sativa [gold-of-pleasure]
gb|EYU25784.1|  hypothetical protein MIMGU_mgv1a026389mg                139   8e-36   Erythranthe guttata [common monkey flower]
emb|CDY12948.1|  BnaA09g13260D                                          142   9e-36   Brassica napus [oilseed rape]
ref|XP_002888025.1|  hypothetical protein ARALYDRAFT_475099             142   1e-35   
ref|XP_009113078.1|  PREDICTED: leucine-rich repeat extensin-like...    142   1e-35   
ref|XP_009113077.1|  PREDICTED: leucine-rich repeat extensin-like...    142   1e-35   Brassica rapa
ref|XP_002885290.1|  hypothetical protein ARALYDRAFT_479420             142   1e-35   
ref|XP_010655031.1|  PREDICTED: leucine-rich repeat extensin-like...    142   2e-35   
ref|XP_009118117.1|  PREDICTED: leucine-rich repeat extensin-like...    140   2e-35   Brassica rapa
emb|CDO97126.1|  unnamed protein product                                140   2e-35   Coffea canephora [robusta coffee]
ref|XP_010520859.1|  PREDICTED: leucine-rich repeat extensin-like...    139   2e-35   Tarenaya hassleriana [spider flower]
emb|CDY19550.1|  BnaC09g13530D                                          141   2e-35   Brassica napus [oilseed rape]
emb|CDY26536.1|  BnaA09g47410D                                          140   2e-35   Brassica napus [oilseed rape]
ref|XP_010473463.1|  PREDICTED: leucine-rich repeat extensin-like...    140   3e-35   
ref|XP_010251729.1|  PREDICTED: pollen-specific leucine-rich repe...    140   3e-35   
ref|XP_002519151.1|  protein binding protein, putative                  141   3e-35   Ricinus communis
ref|XP_010473462.1|  PREDICTED: leucine-rich repeat extensin-like...    140   4e-35   Camelina sativa [gold-of-pleasure]
ref|XP_011018198.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    139   4e-35   Populus euphratica
ref|XP_006838987.1|  hypothetical protein AMTR_s00002p00271610          139   4e-35   
emb|CDY15964.1|  BnaC08g41590D                                          139   4e-35   Brassica napus [oilseed rape]
ref|XP_002514492.1|  LRX2, putative                                     140   5e-35   Ricinus communis
ref|XP_010431693.1|  PREDICTED: leucine-rich repeat extensin-like...    140   5e-35   
ref|XP_006384469.1|  hypothetical protein POPTR_0004s153601g            138   6e-35   
ref|XP_004151743.1|  PREDICTED: pollen-specific leucine-rich repe...    133   6e-35   
ref|XP_011005677.1|  PREDICTED: pollen-specific leucine-rich repe...    140   7e-35   Populus euphratica
ref|XP_010507380.1|  PREDICTED: pollen-specific leucine-rich repe...    140   8e-35   Camelina sativa [gold-of-pleasure]
ref|XP_011001177.1|  PREDICTED: pollen-specific leucine-rich repe...    140   8e-35   Populus euphratica
ref|XP_010507385.1|  PREDICTED: pollen-specific leucine-rich repe...    140   9e-35   
ref|XP_010533784.1|  PREDICTED: leucine-rich repeat extensin-like...    140   9e-35   Tarenaya hassleriana [spider flower]
ref|XP_011460368.1|  PREDICTED: pollen-specific leucine-rich repe...    137   9e-35   Fragaria vesca subsp. vesca
ref|XP_010533785.1|  PREDICTED: leucine-rich repeat extensin-like...    140   1e-34   Tarenaya hassleriana [spider flower]
ref|XP_010064140.1|  PREDICTED: pollen-specific leucine-rich repe...    138   1e-34   Eucalyptus grandis [rose gum]
ref|XP_006394807.1|  hypothetical protein EUTSA_v10004209mg             137   1e-34   Eutrema salsugineum [saltwater cress]
gb|KFK27830.1|  hypothetical protein AALP_AA8G435400                    137   1e-34   Arabis alpina [alpine rockcress]
gb|KJB47441.1|  hypothetical protein B456_008G026700                    138   1e-34   Gossypium raimondii
ref|XP_006417273.1|  hypothetical protein EUTSA_v10006975mg             139   1e-34   Eutrema salsugineum [saltwater cress]
ref|XP_006480071.1|  PREDICTED: pollen-specific leucine-rich repe...    140   1e-34   Citrus sinensis [apfelsine]
ref|XP_010479383.1|  PREDICTED: pollen-specific leucine-rich repe...    139   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_009622388.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    136   2e-34   Nicotiana tomentosiformis
ref|XP_010461787.1|  PREDICTED: pollen-specific leucine-rich repe...    139   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_008225416.1|  PREDICTED: pollen-specific leucine-rich repe...    139   2e-34   
ref|XP_006361150.1|  PREDICTED: leucine-rich repeat extensin-like...    136   2e-34   Solanum tuberosum [potatoes]
ref|XP_010664614.1|  PREDICTED: pollen-specific leucine-rich repe...    136   3e-34   Vitis vinifera
ref|XP_007042323.1|  Leucine-rich repeat family protein                 138   3e-34   
ref|XP_010256147.1|  PREDICTED: leucine-rich repeat extensin-like...    135   3e-34   Nelumbo nucifera [Indian lotus]
emb|CDY53352.1|  BnaA06g38270D                                          137   4e-34   Brassica napus [oilseed rape]
ref|XP_010040127.1|  PREDICTED: leucine-rich repeat extensin-like...    135   4e-34   Eucalyptus grandis [rose gum]
emb|CDY16503.1|  BnaA08g02640D                                          137   4e-34   Brassica napus [oilseed rape]
emb|CDY18563.1|  BnaA01g26320D                                          137   5e-34   Brassica napus [oilseed rape]
ref|XP_010418239.1|  PREDICTED: leucine-rich repeat extensin-like...    137   5e-34   Camelina sativa [gold-of-pleasure]
ref|XP_004242113.1|  PREDICTED: leucine-rich repeat extensin-like...    135   5e-34   Solanum lycopersicum
ref|XP_009773829.1|  PREDICTED: leucine-rich repeat extensin-like...    134   5e-34   Nicotiana sylvestris
ref|XP_010104364.1|  Pollen-specific leucine-rich repeat extensin...    138   5e-34   
ref|NP_001043463.1|  Os01g0594300                                       135   6e-34   
emb|CBI28097.3|  unnamed protein product                                130   6e-34   Vitis vinifera
dbj|BAB91812.1|  extensin precursor-like                                135   7e-34   Oryza sativa Japonica Group [Japonica rice]
ref|NP_172668.1|  leucine-rich repeat extensin-like protein 1           137   7e-34   Arabidopsis thaliana [mouse-ear cress]
emb|CDX95474.1|  BnaC01g33660D                                          137   7e-34   
ref|XP_002516600.1|  serine-threonine protein kinase, plant-type,...    135   8e-34   Ricinus communis
ref|XP_002889910.1|  hypothetical protein ARALYDRAFT_312231             135   8e-34   
ref|XP_006851043.1|  hypothetical protein AMTR_s00025p00231840          129   1e-33   
ref|NP_175372.1|  Leucine-rich repeat family protein                    137   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010500490.1|  PREDICTED: pollen-specific leucine-rich repe...    137   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_009119384.1|  PREDICTED: pollen-specific leucine-rich repe...    137   1e-33   Brassica rapa
ref|XP_006289956.1|  hypothetical protein CARUB_v10003584mg             134   2e-33   Capsella rubella
ref|XP_006304470.1|  hypothetical protein CARUB_v10011166mg             136   2e-33   Capsella rubella
gb|EYU28282.1|  hypothetical protein MIMGU_mgv1a024954mg                128   2e-33   Erythranthe guttata [common monkey flower]
ref|XP_006391867.1|  hypothetical protein EUTSA_v10023291mg             136   2e-33   
emb|CDY54073.1|  BnaA07g36350D                                          135   2e-33   Brassica napus [oilseed rape]
ref|XP_010424321.1|  PREDICTED: leucine-rich repeat extensin-like...    133   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010476158.1|  PREDICTED: leucine-rich repeat extensin-like...    135   2e-33   
ref|XP_010647882.1|  PREDICTED: pollen-specific leucine-rich repe...    135   2e-33   Vitis vinifera
gb|AAM13864.1|  unknown protein                                         135   3e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006473926.1|  PREDICTED: leucine-rich repeat extensin-like...    135   3e-33   Citrus sinensis [apfelsine]
ref|XP_007200697.1|  hypothetical protein PRUPE_ppa000722m2g            134   3e-33   
ref|XP_006300262.1|  hypothetical protein CARUB_v100151920mg            134   3e-33   
emb|CBI32495.3|  unnamed protein product                                135   3e-33   Vitis vinifera
ref|XP_006453735.1|  hypothetical protein CICLE_v10010678mg             135   3e-33   
ref|XP_002279192.1|  PREDICTED: leucine-rich repeat extensin-like...    132   4e-33   Vitis vinifera
ref|XP_010454895.1|  PREDICTED: leucine-rich repeat extensin-like...    132   4e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010458626.1|  PREDICTED: leucine-rich repeat extensin-like...    135   4e-33   Camelina sativa [gold-of-pleasure]
ref|XP_002872172.1|  leucine-rich repeat family protein                 132   5e-33   
ref|XP_010493816.1|  PREDICTED: leucine-rich repeat extensin-like...    132   7e-33   Camelina sativa [gold-of-pleasure]
ref|XP_003523588.1|  PREDICTED: pollen-specific leucine-rich repe...    132   7e-33   
ref|NP_179188.1|  pollen-specific leucine-rich repeat extensin-li...    134   8e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006360809.1|  PREDICTED: leucine-rich repeat extensin-like...    131   8e-33   
ref|XP_006409498.1|  hypothetical protein EUTSA_v10023190mg             132   9e-33   
gb|AGT16383.1|  hypothetical protein SHCRBa_052_I12_F_230               133   1e-32   Saccharum hybrid cultivar R570
ref|XP_006494306.1|  PREDICTED: pollen-specific leucine-rich repe...    135   1e-32   Citrus sinensis [apfelsine]
ref|XP_006375015.1|  hypothetical protein POPTR_0014s03600g             132   1e-32   
ref|NP_197937.1|  leucine-rich repeat extensin-like protein 7           131   1e-32   Arabidopsis thaliana [mouse-ear cress]
emb|CDY02276.1|  BnaA03g38910D                                          132   1e-32   
gb|ABA99464.2|  extensin-like domain containing protein, putative...    132   1e-32   Oryza sativa Japonica Group [Japonica rice]
emb|CDY31235.1|  BnaC08g15300D                                          134   1e-32   Brassica napus [oilseed rape]
ref|XP_007225572.1|  hypothetical protein PRUPE_ppa019759m1g            132   1e-32   
ref|XP_002875655.1|  hypothetical protein ARALYDRAFT_347509             131   1e-32   
gb|KJB14547.1|  hypothetical protein B456_002G130500                    132   1e-32   Gossypium raimondii
ref|XP_008224557.1|  PREDICTED: leucine-rich repeat extensin-like...    133   1e-32   Prunus mume [ume]
gb|KEH40754.1|  pollen-specific LRR extensin-like protein               132   2e-32   Medicago truncatula
ref|XP_002308630.2|  hypothetical protein POPTR_0006s26190g             131   2e-32   
ref|NP_001066960.1|  Os12g0542200                                       133   2e-32   
ref|XP_002885986.1|  predicted protein                                  133   2e-32   
gb|EEE53361.1|  hypothetical protein OsJ_36396                          132   2e-32   Oryza sativa Japonica Group [Japonica rice]
gb|KDP40220.1|  hypothetical protein JCGZ_02218                         129   3e-32   Jatropha curcas
ref|XP_004290381.1|  PREDICTED: pollen-specific leucine-rich repe...    131   3e-32   Fragaria vesca subsp. vesca
ref|XP_007214112.1|  hypothetical protein PRUPE_ppa017121mg             133   3e-32   
ref|XP_006342607.1|  PREDICTED: pollen-specific leucine-rich repe...    132   3e-32   Solanum tuberosum [potatoes]
ref|XP_006303848.1|  hypothetical protein CARUB_v10012584mg             133   3e-32   Capsella rubella
ref|XP_010999749.1|  PREDICTED: pollen-specific leucine-rich repe...    133   4e-32   Populus euphratica
gb|EYU21900.1|  hypothetical protein MIMGU_mgv1a006829mg                130   4e-32   Erythranthe guttata [common monkey flower]
ref|XP_006480069.1|  PREDICTED: pollen-specific leucine-rich repe...    132   4e-32   
ref|XP_006489595.1|  PREDICTED: leucine-rich repeat extensin-like...    129   4e-32   Citrus sinensis [apfelsine]
ref|XP_009136284.1|  PREDICTED: pollen-specific leucine-rich repe...    132   4e-32   
ref|XP_006582471.1|  PREDICTED: pollen-specific leucine-rich repe...    130   4e-32   
gb|KDO52192.1|  hypothetical protein CISIN_1g035831mg                   130   4e-32   Citrus sinensis [apfelsine]
emb|CDX69018.1|  BnaC01g04350D                                          131   5e-32   
emb|CDY53036.1|  BnaC03g73850D                                          133   5e-32   Brassica napus [oilseed rape]
ref|XP_002451219.1|  hypothetical protein SORBIDRAFT_05g025950          132   5e-32   
ref|XP_006420010.1|  hypothetical protein CICLE_v10005037mg             129   6e-32   Citrus clementina [clementine]
ref|XP_009108764.1|  PREDICTED: pollen-specific leucine-rich repe...    131   6e-32   Brassica rapa
emb|CDY51948.1|  BnaA08g11700D                                          131   6e-32   Brassica napus [oilseed rape]
gb|EYU24926.1|  hypothetical protein MIMGU_mgv1a006719mg                129   6e-32   Erythranthe guttata [common monkey flower]
ref|XP_006379216.1|  hypothetical protein POPTR_0009s11130g             132   7e-32   
gb|KDO74484.1|  hypothetical protein CISIN_1g045950mg                   129   8e-32   Citrus sinensis [apfelsine]
ref|XP_007136648.1|  hypothetical protein PHAVU_009G062000g             130   9e-32   Phaseolus vulgaris [French bean]
ref|NP_188532.2|  pollen-specific leucine-rich repeat extensin-li...    132   9e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010669462.1|  PREDICTED: leucine-rich repeat extensin-like...    132   9e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006300291.1|  hypothetical protein CARUB_v100136950mg            128   9e-32   
gb|KFK39231.1|  hypothetical protein AALP_AA3G216900                    131   1e-31   Arabis alpina [alpine rockcress]
emb|CDY51859.1|  BnaC03g77110D                                          130   1e-31   Brassica napus [oilseed rape]
ref|XP_009417528.1|  PREDICTED: leucine-rich repeat extensin-like...    130   1e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002443305.1|  hypothetical protein SORBIDRAFT_08g017290          129   1e-31   
ref|XP_004501605.1|  PREDICTED: pollen-specific leucine-rich repe...    131   2e-31   
ref|XP_009350755.1|  PREDICTED: pollen-specific leucine-rich repe...    130   2e-31   
ref|XP_008458674.1|  PREDICTED: pollen-specific leucine-rich repe...    126   2e-31   
ref|XP_009801066.1|  PREDICTED: pollen-specific leucine-rich repe...    128   2e-31   
ref|XP_004498175.1|  PREDICTED: pollen-specific leucine-rich repe...    130   2e-31   
gb|KEH43815.1|  LRR amino-terminal domain protein                       124   2e-31   
emb|CDY21028.1|  BnaA08g24970D                                          130   2e-31   
ref|XP_004247590.1|  PREDICTED: leucine-rich repeat extensin-like...    127   2e-31   
emb|CDP14813.1|  unnamed protein product                                127   2e-31   
ref|XP_008371522.1|  PREDICTED: pollen-specific leucine-rich repe...    128   2e-31   
gb|KFK40046.1|  hypothetical protein AALP_AA3G322800                    130   2e-31   
emb|CDY64248.1|  BnaCnng43540D                                          130   2e-31   
ref|XP_011030760.1|  PREDICTED: pollen-specific leucine-rich repe...    129   3e-31   
gb|EPS72402.1|  hypothetical protein M569_02357                         127   3e-31   
gb|KHN22289.1|  Pollen-specific leucine-rich repeat extensin-like...    130   3e-31   
ref|XP_009345516.1|  PREDICTED: pollen-specific leucine-rich repe...    129   3e-31   
gb|KJB79256.1|  hypothetical protein B456_013G040400                    127   3e-31   
ref|XP_010096273.1|  Pollen-specific leucine-rich repeat extensin...    130   4e-31   
emb|CDX89681.1|  BnaC03g45950D                                          129   4e-31   
ref|XP_008677910.1|  PREDICTED: pollen-specific leucine-rich repe...    130   5e-31   
gb|AAD55980.2|AF159297_1  extensin-like protein                         130   5e-31   
gb|KFK30023.1|  hypothetical protein AALP_AA7G207900                    128   6e-31   
emb|CDP14269.1|  unnamed protein product                                129   7e-31   
ref|XP_011078162.1|  PREDICTED: leucine-rich repeat extensin-like...    128   8e-31   
ref|XP_011093910.1|  PREDICTED: leucine-rich repeat extensin-like...    129   8e-31   
ref|XP_009385321.1|  PREDICTED: pollen-specific leucine-rich repe...    127   8e-31   
ref|XP_010487832.1|  PREDICTED: pollen-specific leucine-rich repe...    129   9e-31   
ref|XP_009151086.1|  PREDICTED: leucine-rich repeat extensin-like...    126   9e-31   
ref|XP_010530870.1|  PREDICTED: pollen-specific leucine-rich repe...    127   9e-31   
ref|XP_010251730.1|  PREDICTED: pollen-specific leucine-rich repe...    127   9e-31   
ref|XP_009599187.1|  PREDICTED: pollen-specific leucine-rich repe...    127   1e-30   
ref|XP_010035772.1|  PREDICTED: leucine-rich repeat extensin-like...    125   1e-30   
emb|CDX88190.1|  BnaA06g27810D                                          125   1e-30   
ref|XP_009110677.1|  PREDICTED: leucine-rich repeat extensin-like...    128   1e-30   
gb|KHN04530.1|  Pollen-specific leucine-rich repeat extensin-like...    128   1e-30   
ref|XP_009136040.1|  PREDICTED: pollen-specific leucine-rich repe...    129   1e-30   
gb|KJB77687.1|  hypothetical protein B456_012G150700                    126   1e-30   
ref|XP_008361641.1|  PREDICTED: pollen-specific leucine-rich repe...    129   1e-30   
ref|XP_011030644.1|  PREDICTED: leucine-rich repeat extensin-like...    125   2e-30   
gb|EPS58069.1|  hypothetical protein M569_16746                         124   2e-30   
ref|XP_010467332.1|  PREDICTED: pollen-specific leucine-rich repe...    127   2e-30   
ref|XP_010423784.1|  PREDICTED: pollen-specific leucine-rich repe...    129   2e-30   
ref|XP_004964077.1|  PREDICTED: pollen-specific leucine-rich repe...    128   2e-30   
ref|XP_002867142.1|  hypothetical protein ARALYDRAFT_491276             127   2e-30   
ref|XP_010527734.1|  PREDICTED: pollen-specific leucine-rich repe...    128   2e-30   
emb|CDO99097.1|  unnamed protein product                                125   2e-30   
gb|KJB72347.1|  hypothetical protein B456_011G172700                    124   2e-30   
gb|AGT16299.1|  hypothetical protein SHCRBa_026_P08_R_80                127   2e-30   
gb|AGT17388.1|  hypothetical protein SHCRBa_176_L06_F_110               126   3e-30   
ref|XP_008663867.1|  PREDICTED: pollen-specific leucine-rich repe...    127   3e-30   
ref|XP_004979883.1|  PREDICTED: pollen-specific leucine-rich repe...    128   3e-30   
ref|XP_010932003.1|  PREDICTED: pollen-specific leucine-rich repe...    127   3e-30   
ref|XP_010489184.1|  PREDICTED: pollen-specific leucine-rich repe...    127   3e-30   
gb|AAD55979.1|AF159296_1  extensin-like protein                         126   4e-30   
ref|XP_009419628.1|  PREDICTED: pollen-specific leucine-rich repe...    126   4e-30   
ref|XP_004230831.1|  PREDICTED: pollen-specific leucine-rich repe...    126   4e-30   
gb|KFK36007.1|  hypothetical protein AALP_AA4G065700                    127   4e-30   
ref|XP_006346494.1|  PREDICTED: pollen-specific leucine-rich repe...    126   5e-30   
ref|XP_009402787.1|  PREDICTED: pollen-specific leucine-rich repe...    127   5e-30   
ref|XP_002517083.1|  serine-threonine protein kinase, plant-type,...    123   5e-30   
ref|NP_001130107.1|  uncharacterized protein LOC100191200 precursor     123   6e-30   
ref|XP_010525682.1|  PREDICTED: pollen-specific leucine-rich repe...    126   7e-30   
ref|XP_006393251.1|  hypothetical protein EUTSA_v10012214mg             126   7e-30   
emb|CAA84230.1|  extensin-like protein                                  127   8e-30   
gb|EEE52502.1|  hypothetical protein OsJ_34704                          127   8e-30   
ref|XP_008670898.1|  PREDICTED: pollen-specific leucine-rich repe...    127   8e-30   
gb|EAY81724.1|  hypothetical protein OsI_36898                          126   8e-30   
ref|XP_009342422.1|  PREDICTED: pollen-specific leucine-rich repe...    126   8e-30   
dbj|BAJ98253.1|  predicted protein                                      123   8e-30   
ref|XP_009389012.1|  PREDICTED: leucine-rich repeat extensin-like...    123   8e-30   
ref|XP_008775577.1|  PREDICTED: LOW QUALITY PROTEIN: pollen-speci...    125   9e-30   
ref|NP_001152233.1|  systemin receptor SR160 precursor                  123   9e-30   
tpg|DAA51888.1|  TPA: leucine-rich repeat (LRR) family protein          123   9e-30   
ref|XP_009107296.1|  PREDICTED: pollen-specific leucine-rich repe...    125   1e-29   
ref|NP_001068397.2|  Os11g0657400                                       126   1e-29   
gb|ABA95172.1|  transposon protein, putative, unclassified              126   1e-29   
ref|XP_002314669.2|  hypothetical protein POPTR_0010s09310g             122   1e-29   
ref|XP_009616761.1|  PREDICTED: pollen-specific leucine-rich repe...    124   1e-29   
ref|XP_002314670.2|  hypothetical protein POPTR_0010s09320g             122   2e-29   
gb|AID60115.1|  leucine-rich repeat (LRR) family protein                124   2e-29   
ref|XP_007143301.1|  hypothetical protein PHAVU_007G060800g             122   2e-29   
ref|XP_009118084.1|  PREDICTED: pollen-specific leucine-rich repe...    124   2e-29   
ref|XP_006584319.1|  PREDICTED: pollen-specific leucine-rich repe...    124   2e-29   
ref|XP_010259122.1|  PREDICTED: leucine-rich repeat extensin-like...    122   2e-29   
gb|EPS67208.1|  hypothetical protein M569_07569                         120   2e-29   
gb|KDP43798.1|  hypothetical protein JCGZ_23006                         125   2e-29   
ref|XP_007034837.1|  Leucine-rich repeat (LRR) family protein, pu...    121   3e-29   
ref|XP_009112175.1|  PREDICTED: pollen-specific leucine-rich repe...    124   3e-29   
ref|XP_011091034.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    121   3e-29   
ref|XP_004496690.1|  PREDICTED: leucine-rich repeat extensin-like...    121   3e-29   
gb|AFW56506.1|  leucine-rich repeat (LRR) family protein                124   3e-29   
ref|XP_010914722.1|  PREDICTED: pollen-specific leucine-rich repe...    124   3e-29   
ref|XP_002463746.1|  hypothetical protein SORBIDRAFT_01g005300          121   4e-29   
ref|XP_008802123.1|  PREDICTED: pollen-specific leucine-rich repe...    122   4e-29   
gb|KEH43816.1|  LRR/extensin 2                                          121   4e-29   
ref|XP_003566833.2|  PREDICTED: leucine-rich repeat extensin-like...    122   4e-29   
ref|XP_002517082.1|  serine-threonine protein kinase, plant-type,...    120   5e-29   
gb|AGT16233.1|  hypothetical protein SHCRBa_161_O13_R_110               124   5e-29   
ref|XP_008438627.1|  PREDICTED: leucine-rich repeat extensin-like...    120   5e-29   
ref|XP_009408506.1|  PREDICTED: leucine-rich repeat extensin-like...    120   6e-29   
ref|XP_011030645.1|  PREDICTED: leucine-rich repeat extensin-like...    120   6e-29   
ref|XP_009351868.1|  PREDICTED: pollen-specific leucine-rich repe...    123   6e-29   
gb|KHN37158.1|  Pollen-specific leucine-rich repeat extensin-like...    123   7e-29   
gb|KHN01115.1|  Pollen-specific leucine-rich repeat extensin-like...    120   7e-29   
ref|XP_010695983.1|  PREDICTED: leucine-rich repeat extensin-like...    120   7e-29   
ref|XP_003526272.1|  PREDICTED: leucine-rich repeat extensin-like...    120   7e-29   
ref|XP_009800281.1|  PREDICTED: pollen-specific leucine-rich repe...    122   8e-29   
ref|XP_008224262.1|  PREDICTED: leucine-rich repeat extensin-like...    120   8e-29   
ref|XP_010252148.1|  PREDICTED: leucine-rich repeat extensin-like...    123   9e-29   
ref|XP_004982365.1|  PREDICTED: leucine-rich repeat extensin-like...    120   9e-29   
ref|XP_008800833.1|  PREDICTED: pollen-specific leucine-rich repe...    122   1e-28   
ref|XP_010447991.1|  PREDICTED: pollen-specific leucine-rich repe...    120   1e-28   
ref|XP_008665106.1|  PREDICTED: leucine-rich repeat extensin-like...    120   1e-28   
ref|XP_006412291.1|  hypothetical protein EUTSA_v100245901mg            122   1e-28   
emb|CDY10673.1|  BnaA05g16890D                                          120   1e-28   
ref|XP_009775306.1|  PREDICTED: pollen-specific leucine-rich repe...    122   1e-28   
ref|NP_188919.1|  leucine-rich repeat extensin-like protein 6           120   1e-28   
gb|KEH30699.1|  LRR/extensin                                            120   1e-28   
ref|XP_008342893.1|  PREDICTED: leucine-rich repeat extensin-like...    120   1e-28   
ref|XP_009145262.1|  PREDICTED: leucine-rich repeat extensin-like...    120   1e-28   
emb|CDY49265.1|  BnaA03g50780D                                          121   1e-28   
emb|CDY49264.1|  BnaA03g50770D                                          121   2e-28   
ref|XP_009336235.1|  PREDICTED: leucine-rich repeat extensin-like...    119   2e-28   
emb|CDX83065.1|  BnaA01g20650D                                          120   2e-28   
ref|XP_003557501.1|  PREDICTED: leucine-rich repeat extensin-like...    119   2e-28   
ref|XP_004297998.1|  PREDICTED: leucine-rich repeat extensin-like...    122   2e-28   
ref|XP_010689048.1|  PREDICTED: leucine-rich repeat extensin-like...    119   2e-28   
emb|CDX80525.1|  BnaC07g29190D                                          119   2e-28   
gb|KFK40601.1|  hypothetical protein AALP_AA2G016700                    122   2e-28   
ref|XP_006651620.1|  PREDICTED: leucine-rich repeat extensin-like...    119   2e-28   
ref|XP_002862780.1|  hypothetical protein ARALYDRAFT_920276             119   2e-28   
ref|XP_007198810.1|  hypothetical protein PRUPE_ppa026805mg             119   2e-28   
ref|XP_006299744.1|  hypothetical protein CARUB_v10015937mg             119   3e-28   
ref|XP_002464196.1|  hypothetical protein SORBIDRAFT_01g013940          119   3e-28   
ref|XP_008229070.1|  PREDICTED: leucine-rich repeat extensin-like...    119   3e-28   
ref|XP_006286011.1|  hypothetical protein CARUB_v10007539mg             119   3e-28   
ref|NP_001050725.1|  Os03g0637600                                       119   3e-28   
ref|XP_002885524.1|  hypothetical protein ARALYDRAFT_898761             119   3e-28   
ref|XP_010466571.1|  PREDICTED: leucine-rich repeat extensin-like...    119   3e-28   
ref|XP_003602966.1|  Serine/threonine protein kinase BRI1-like pr...    121   3e-28   
ref|XP_007043626.1|  Leucine-rich repeat family protein                 119   3e-28   
ref|XP_010488313.1|  PREDICTED: leucine-rich repeat extensin-like...    119   3e-28   
gb|EAY91133.1|  hypothetical protein OsI_12740                          118   3e-28   
gb|EMT22007.1|  hypothetical protein F775_31106                         118   3e-28   
gb|AAG23713.1|  extensin-like protein                                   113   4e-28   
ref|XP_010438472.1|  PREDICTED: pollen-specific leucine-rich repe...    118   4e-28   
ref|XP_010690992.1|  PREDICTED: pollen-specific leucine-rich repe...    120   4e-28   
ref|XP_003562088.1|  PREDICTED: leucine-rich repeat extensin-like...    118   4e-28   
ref|XP_010694037.1|  PREDICTED: leucine-rich repeat extensin-like...    119   4e-28   
ref|XP_008236716.1|  PREDICTED: pollen-specific leucine-rich repe...    122   4e-28   
ref|NP_195123.1|  pollen-specific leucine-rich repeat extensin-li...    120   4e-28   
ref|XP_009606354.1|  PREDICTED: pollen-specific leucine-rich repe...    120   4e-28   
dbj|BAK06060.1|  predicted protein                                      120   5e-28   
ref|XP_010437693.1|  PREDICTED: pollen-specific leucine-rich repe...    120   5e-28   
gb|KFK39565.1|  hypothetical protein AALP_AA3G260700                    117   6e-28   
ref|XP_003540926.1|  PREDICTED: leucine-rich repeat extensin-like...    118   6e-28   
gb|EEE60089.1|  hypothetical protein OsJ_12940                          117   7e-28   
ref|XP_010437692.1|  PREDICTED: pollen-specific leucine-rich repe...    120   8e-28   
ref|XP_008798454.1|  PREDICTED: leucine-rich repeat extensin-like...    117   8e-28   
ref|XP_009376329.1|  PREDICTED: leucine-rich repeat extensin-like...    120   9e-28   
gb|KHN28116.1|  Leucine-rich repeat extensin-like protein 3             117   9e-28   
ref|XP_006406127.1|  hypothetical protein EUTSA_v10022219mg             117   9e-28   
ref|XP_004134434.1|  PREDICTED: leucine-rich repeat extensin-like...    117   9e-28   
ref|XP_010433232.1|  PREDICTED: pollen-specific leucine-rich repe...    117   1e-27   
ref|XP_006285576.1|  hypothetical protein CARUB_v10007020mg             119   1e-27   
ref|XP_006663645.1|  PREDICTED: pollen-specific leucine-rich repe...    120   1e-27   
gb|KGN56949.1|  hypothetical protein Csa_3G146350                       117   1e-27   
ref|XP_003575453.1|  PREDICTED: pollen-specific leucine-rich repe...    119   2e-27   
gb|EAY92168.1|  hypothetical protein OsI_13881                          116   2e-27   
ref|NP_194567.1|  leucine-rich repeat (LRR) family protein              116   2e-27   
ref|XP_010437689.1|  PREDICTED: pollen-specific leucine-rich repe...    119   2e-27   
ref|NP_001051547.1|  Os03g0795300                                       116   2e-27   
ref|XP_008380620.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    119   2e-27   
ref|XP_010092426.1|  Leucine-rich repeat extensin-like protein 6        116   2e-27   
ref|XP_009138254.1|  PREDICTED: pollen-specific leucine-rich repe...    119   2e-27   
ref|XP_010437688.1|  PREDICTED: pollen-specific leucine-rich repe...    119   2e-27   
ref|XP_009371969.1|  PREDICTED: leucine-rich repeat extensin-like...    116   3e-27   
ref|XP_006489442.1|  PREDICTED: leucine-rich repeat extensin-like...    116   3e-27   
ref|XP_006420005.1|  hypothetical protein CICLE_v10004988mg             116   3e-27   
ref|XP_010447169.1|  PREDICTED: pollen-specific leucine-rich repe...    118   3e-27   
ref|XP_009351253.1|  PREDICTED: pollen-specific leucine-rich repe...    119   3e-27   
ref|XP_010511710.1|  PREDICTED: leucine-rich repeat extensin-like...    116   3e-27   
ref|XP_010554947.1|  PREDICTED: leucine-rich repeat extensin-like...    115   3e-27   
ref|XP_006469927.1|  PREDICTED: pollen-specific leucine-rich repe...    116   3e-27   
gb|KDO42769.1|  hypothetical protein CISIN_1g036320mg                   116   3e-27   
ref|XP_006447273.1|  hypothetical protein CICLE_v10018109mg             116   3e-27   
gb|EMT04692.1|  hypothetical protein F775_21578                         115   3e-27   
ref|XP_004981448.1|  PREDICTED: leucine-rich repeat extensin-like...    115   3e-27   
ref|XP_010921838.1|  PREDICTED: pollen-specific leucine-rich repe...    116   4e-27   
gb|EMS66895.1|  Leucine-rich repeat extensin-like protein 6             115   4e-27   
ref|XP_003556064.1|  PREDICTED: leucine-rich repeat extensin-like...    115   4e-27   
emb|CDY72552.1|  BnaCnng78240D                                          115   5e-27   
emb|CDY18974.1|  BnaC01g20940D                                          115   5e-27   
ref|XP_004303132.1|  PREDICTED: leucine-rich repeat extensin-like...    115   5e-27   
ref|XP_006351117.1|  PREDICTED: leucine-rich repeat extensin-like...    117   6e-27   
ref|XP_006356596.1|  PREDICTED: pollen-specific leucine-rich repe...    117   7e-27   
gb|EPS67596.1|  hypothetical protein M569_07180                         115   7e-27   
ref|XP_010927122.1|  PREDICTED: leucine-rich repeat extensin-like...    117   8e-27   
gb|KDP24107.1|  hypothetical protein JCGZ_25764                         115   8e-27   
emb|CDY49661.1|  BnaC09g41390D                                          114   8e-27   
ref|XP_010432489.1|  PREDICTED: pollen-specific leucine-rich repe...    117   1e-26   
ref|XP_008796915.1|  PREDICTED: leucine-rich repeat extensin-like...    116   1e-26   
ref|XP_002310403.2|  hypothetical protein POPTR_0007s01000g             114   1e-26   
emb|CDM81891.1|  unnamed protein product                                115   1e-26   
ref|XP_006412962.1|  hypothetical protein EUTSA_v10027136mg             114   1e-26   
ref|XP_004296668.1|  PREDICTED: leucine-rich repeat extensin-like...    114   2e-26   
ref|XP_004249854.1|  PREDICTED: leucine-rich repeat extensin-like...    116   2e-26   
ref|XP_009405471.1|  PREDICTED: pollen-specific leucine-rich repe...    114   2e-26   
ref|XP_010091486.1|  hypothetical protein L484_010328                   114   2e-26   
emb|CDP07600.1|  unnamed protein product                                115   2e-26   
ref|XP_009383792.1|  PREDICTED: pollen-specific leucine-rich repe...    116   2e-26   
ref|XP_004248904.1|  PREDICTED: pollen-specific leucine-rich repe...    115   2e-26   
gb|EYU41450.1|  hypothetical protein MIMGU_mgv1a002668mg                115   3e-26   
ref|XP_009608702.1|  PREDICTED: leucine-rich repeat extensin-like...    115   3e-26   
ref|XP_008391000.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    113   3e-26   
dbj|BAK04234.1|  predicted protein                                      115   3e-26   
ref|XP_004243365.1|  PREDICTED: leucine-rich repeat extensin-like...    113   3e-26   
dbj|BAF48663.1|  leucine-rich repeat/extensin                           115   4e-26   
ref|XP_006367488.1|  PREDICTED: leucine-rich repeat extensin-like...    112   5e-26   
gb|KJB77340.1|  hypothetical protein B456_012G132500                    110   5e-26   



>ref|XP_006451102.1| hypothetical protein CICLE_v100107081mg, partial [Citrus clementina]
 gb|ESR64342.1| hypothetical protein CICLE_v100107081mg, partial [Citrus clementina]
Length=190

 Score =   214 bits (544),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            +G L+D+E HYI++RQLLYYRDEFGDRGE VTVDPSL FEN RIRNAYIALQAWKQAI+S
Sbjct  7    HGGLTDAEAHYIRQRQLLYYRDEFGDRGENVTVDPSLVFENPRIRNAYIALQAWKQAILS  66

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T+DWVGS VC+YTGVFCAPAPDN +IRTVA IDLNH DIAGYLPEELGLL DL +
Sbjct  67   DPYNLTADWVGSAVCSYTGVFCAPAPDNKRIRTVAGIDLNHGDIAGYLPEELGLLTDLAL  126

Query  555  FH  560
            FH
Sbjct  127  FH  128



>ref|XP_009627506.1| PREDICTED: leucine-rich repeat extensin-like protein 4 isoform 
X1 [Nicotiana tomentosiformis]
Length=605

 Score =   218 bits (556),  Expect = 6e-64, Method: Composition-based stats.
 Identities = 96/122 (79%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            +GPL+D E  YI+ RQLLYYRDEFGDRGE V++DPS  FEN RI+NAYIALQAWKQAIIS
Sbjct  40   SGPLTDFEAQYIKHRQLLYYRDEFGDRGENVSIDPSFVFENSRIKNAYIALQAWKQAIIS  99

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T++WVG +VCNYTG+FCAPA DNPKIRTVA IDLNH DIAGYLPEELGLL DLG+
Sbjct  100  DPFNLTANWVGPNVCNYTGIFCAPALDNPKIRTVAGIDLNHGDIAGYLPEELGLLVDLGI  159

Query  555  FH  560
            FH
Sbjct  160  FH  161



>ref|XP_004252054.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Solanum 
lycopersicum]
Length=727

 Score =   220 bits (561),  Expect = 7e-64, Method: Composition-based stats.
 Identities = 98/123 (80%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  192  DNGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAII  371
            +NGPL+DSE  +I+ RQLLYYRDEFGDRGE V +DPS+ FENDRI+NAYIALQAWKQAII
Sbjct  37   ENGPLTDSEAQFIKHRQLLYYRDEFGDRGENVKIDPSMVFENDRIKNAYIALQAWKQAII  96

Query  372  SDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLG  551
            SDP N T +WVG +VC+YTGVFCAPA DNPKIRTVA IDLNH DIAGYLPEELGLL DLG
Sbjct  97   SDPFNITMNWVGPNVCSYTGVFCAPALDNPKIRTVAGIDLNHGDIAGYLPEELGLLTDLG  156

Query  552  VFH  560
            +FH
Sbjct  157  IFH  159



>ref|XP_006366874.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Solanum 
tuberosum]
Length=716

 Score =   219 bits (558),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 97/123 (79%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  192  DNGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAII  371
            +NGPL+DSE  +I+ RQLLYYRDEFGDRGE V +DPS+ FENDRI+NAYIALQAWKQAII
Sbjct  36   ENGPLTDSEAQFIKHRQLLYYRDEFGDRGENVKIDPSMVFENDRIKNAYIALQAWKQAII  95

Query  372  SDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLG  551
            SDP N T +WVG +VC+YTG+FCAPA DNPKIRTVA IDLNH DIAGYLPEELGLL DLG
Sbjct  96   SDPFNITLNWVGPNVCSYTGIFCAPALDNPKIRTVAGIDLNHGDIAGYLPEELGLLTDLG  155

Query  552  VFH  560
            +FH
Sbjct  156  IFH  158



>ref|XP_009760538.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Nicotiana 
sylvestris]
Length=740

 Score =   219 bits (557),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 97/123 (79%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  192  DNGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAII  371
            ++GPL+D E  YI+ RQLLYYRDEFGDRGE+VT+DPS  FEN+RI+NAYIALQAWKQAII
Sbjct  39   ESGPLTDFEAQYIKHRQLLYYRDEFGDRGEKVTIDPSFIFENNRIKNAYIALQAWKQAII  98

Query  372  SDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLG  551
            SDP N T +WVG +VCNYTG+FCAPA DNPKIRTVA IDLNH DIAGYLPEELGLL DLG
Sbjct  99   SDPFNLTENWVGPNVCNYTGIFCAPALDNPKIRTVAGIDLNHGDIAGYLPEELGLLVDLG  158

Query  552  VFH  560
            +FH
Sbjct  159  IFH  161



>ref|XP_006353562.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like, 
partial [Solanum tuberosum]
Length=670

 Score =   218 bits (554),  Expect = 4e-63, Method: Composition-based stats.
 Identities = 97/123 (79%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  192  DNGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAII  371
            +NGPL+DSE  +I+ RQLLYYRDEFGDRGE V +DPS+ FENDRI+NAYIALQAWKQAII
Sbjct  2    ENGPLTDSEAQFIKHRQLLYYRDEFGDRGENVKIDPSMVFENDRIKNAYIALQAWKQAII  61

Query  372  SDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLG  551
            SDP N T +WVG +VC+YTG+FCAPA DNPKIRTVA IDLNH DIAGYLPEELGLL DLG
Sbjct  62   SDPFNITLNWVGPNVCSYTGIFCAPALDNPKIRTVAGIDLNHGDIAGYLPEELGLLTDLG  121

Query  552  VFH  560
            +FH
Sbjct  122  IFH  124



>emb|CDP03355.1| unnamed protein product [Coffea canephora]
Length=782

 Score =   218 bits (556),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            +GPL+D+E HYI++RQLL YRDEFGDRGE VTVDP+LTFEN R+RNAYIALQAWK+AI+S
Sbjct  35   HGPLTDAEAHYIRQRQLLSYRDEFGDRGELVTVDPTLTFENPRLRNAYIALQAWKEAILS  94

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T DWVGSDVC YTGVFCAPAPDNPKIRTVA IDLNH DIAGYLP ELGLL DLG+
Sbjct  95   DPSNFTGDWVGSDVCKYTGVFCAPAPDNPKIRTVAGIDLNHADIAGYLPAELGLLTDLGL  154

Query  555  FH  560
            FH
Sbjct  155  FH  156



>ref|XP_009627507.1| PREDICTED: leucine-rich repeat extensin-like protein 4 isoform 
X2 [Nicotiana tomentosiformis]
Length=555

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +3

Query  198  GPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            GPL+D E  YI+ RQLLYYRDEFGDRGE V++DPS  FEN RI+NAYIALQAWKQAIISD
Sbjct  41   GPLTDFEAQYIKHRQLLYYRDEFGDRGENVSIDPSFVFENSRIKNAYIALQAWKQAIISD  100

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P N T++WVG +VCNYTG+FCAPA DNPKIRTVA IDLNH DIAGYLPEELGLL DLG+F
Sbjct  101  PFNLTANWVGPNVCNYTGIFCAPALDNPKIRTVAGIDLNHGDIAGYLPEELGLLVDLGIF  160

Query  558  H  560
            H
Sbjct  161  H  161



>ref|XP_011078360.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Sesamum 
indicum]
Length=494

 Score =   213 bits (542),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  192  DNGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAII  371
            + GPL+++EV YI++RQLLYY DEFGDRGE VTVDPSL FEN R+R+AY+ALQAWK+AI+
Sbjct  43   NGGPLTEAEVFYIKKRQLLYYLDEFGDRGENVTVDPSLVFENPRLRSAYVALQAWKKAIL  102

Query  372  SDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLG  551
            SDP N T DWVGSDVCNYTGVFCAPA DNP IRTVA IDLNH DIAGYLPEELGLL DLG
Sbjct  103  SDPHNLTVDWVGSDVCNYTGVFCAPALDNPSIRTVAGIDLNHGDIAGYLPEELGLLTDLG  162

Query  552  VFH  560
            +FH
Sbjct  163  LFH  165



>ref|XP_004173680.1| PREDICTED: leucine-rich repeat extensin-like protein 5-like, 
partial [Cucumis sativus]
Length=451

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  383
            L+D+E HYI++RQLLYYRDEFGDRGE V VDP L FENDRIRNAYIALQAWKQAI+SDP 
Sbjct  47   LTDAEAHYIRQRQLLYYRDEFGDRGEEVVVDPKLVFENDRIRNAYIALQAWKQAILSDPL  106

Query  384  NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            N T +WVGSDVC+Y GVFCAPAPDN  IRTVA IDLNH DIAGYLPEELGLL DL +FH
Sbjct  107  NLTKNWVGSDVCHYKGVFCAPAPDNSSIRTVAGIDLNHGDIAGYLPEELGLLVDLALFH  165



>gb|KDP32304.1| hypothetical protein JCGZ_13229 [Jatropha curcas]
Length=713

 Score =   215 bits (547),  Expect = 6e-62, Method: Composition-based stats.
 Identities = 97/122 (80%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            NG LSD+E  YI++RQLLYYRDE+GDRGE+VTVDPSL FEN R++NAYIALQAWKQAI+S
Sbjct  34   NGRLSDAEAMYIKKRQLLYYRDEYGDRGEKVTVDPSLVFENPRLKNAYIALQAWKQAILS  93

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP+N TSDWVG +VC+YTGVFCAPAPDN  IRTVA IDLNH DIAGYLPEELGLL DL +
Sbjct  94   DPQNLTSDWVGPNVCDYTGVFCAPAPDNKTIRTVAGIDLNHGDIAGYLPEELGLLVDLAL  153

Query  555  FH  560
            FH
Sbjct  154  FH  155



>ref|NP_189091.1| leucine-rich repeat extensin-like protein 4 [Arabidopsis thaliana]
 sp|Q9LHF1.1|LRX4_ARATH RecName: Full=Leucine-rich repeat extensin-like protein 4; Short=AtLRX4; 
Short=LRR/EXTENSIN4; AltName: Full=Cell wall hydroxyproline-rich 
glycoprotein; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB01951.1| extensin-like protein [Arabidopsis thaliana]
 gb|AEE76902.1| leucine-rich repeat extensin-like protein 4 [Arabidopsis thaliana]
Length=494

 Score =   211 bits (536),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            N PLSD+EV +IQRRQLLYYRDEFGDRGE VTVDPSL FEN R+R+AYIALQAWKQAI+S
Sbjct  31   NAPLSDTEVRFIQRRQLLYYRDEFGDRGENVTVDPSLIFENPRLRSAYIALQAWKQAILS  90

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T +W+GS+VCNYTGVFC+ A DN KIRTVA IDLNH DIAGYLPEELGLL DL +
Sbjct  91   DPNNITVNWIGSNVCNYTGVFCSKALDNRKIRTVAGIDLNHADIAGYLPEELGLLTDLAL  150

Query  555  FH  560
            FH
Sbjct  151  FH  152



>ref|XP_010050506.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Eucalyptus 
grandis]
Length=425

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +3

Query  210  DSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNT  389
            D+E  YI++RQLLYYRDEFGDRGE V+VDPSL FEN RIR+AYIALQAWK+AI+SDP+N 
Sbjct  47   DAEAMYIKQRQLLYYRDEFGDRGENVSVDPSLKFENPRIRSAYIALQAWKEAILSDPKNY  106

Query  390  TSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            T+DWVGSDVCNYTGV+CAPA D+PKIRTVA IDLNH DIAGYLPEELGLLADL +FH
Sbjct  107  TADWVGSDVCNYTGVYCAPAIDDPKIRTVAGIDLNHGDIAGYLPEELGLLADLALFH  163



>emb|CDX93014.1| BnaA03g37360D [Brassica napus]
Length=456

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            N PL+D+EV +IQRRQLLYYRDEFGDRGE VTVDPSL FEN R+R+AYIALQAWKQAI+S
Sbjct  30   NAPLTDNEVRFIQRRQLLYYRDEFGDRGENVTVDPSLVFENPRLRSAYIALQAWKQAILS  89

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T +W+GS+VC YTGVFC+ APDN +IRTVA IDLNH DIAGYLPEELGLL DL +
Sbjct  90   DPNNITLNWIGSNVCTYTGVFCSRAPDNRRIRTVAGIDLNHADIAGYLPEELGLLTDLAL  149

Query  555  FH  560
            FH
Sbjct  150  FH  151



>ref|XP_006476103.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Citrus 
sinensis]
Length=700

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            +G L+D+E HYI++RQLLYYRDEFGDRGE VTVDPSL F N RIRNAYIALQAWKQAI+S
Sbjct  41   HGGLTDAEAHYIRQRQLLYYRDEFGDRGENVTVDPSLVFANPRIRNAYIALQAWKQAILS  100

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T+DWVGS VC+YTGVFCAPAPDN +IRTVA IDLNH DIAGYLPEELGLL DL +
Sbjct  101  DPYNLTADWVGSAVCSYTGVFCAPAPDNKRIRTVAGIDLNHGDIAGYLPEELGLLTDLAL  160

Query  555  FH  560
            FH
Sbjct  161  FH  162



>ref|XP_008361263.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Malus 
domestica]
Length=260

 Score =   201 bits (512),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            +GPLSD E  YI+ RQLLYYRDEFGDRGE VTVDPSL FENDR+RNAYIALQA KQAI+S
Sbjct  46   HGPLSDEEALYIKHRQLLYYRDEFGDRGEHVTVDPSLVFENDRLRNAYIALQALKQAILS  105

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T +WVGS+ C YTGVFC  A DN  IRTVA IDLNH DIAGYLPEELGLL DL +
Sbjct  106  DPFNITGNWVGSNXCKYTGVFCTKALDNRTIRTVAGIDLNHGDIAGYLPEELGLLTDLAL  165

Query  555  FH  560
            FH
Sbjct  166  FH  167



>ref|XP_004139428.1| PREDICTED: leucine-rich repeat extensin-like protein 4-like [Cucumis 
sativus]
Length=608

 Score =   210 bits (535),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  383
            L+D+E HYI++RQLLYYRDEFGDRGE V VDP L FENDRIRNAYIALQAWKQAI+SDP 
Sbjct  47   LTDAEAHYIRQRQLLYYRDEFGDRGEEVVVDPKLVFENDRIRNAYIALQAWKQAILSDPL  106

Query  384  NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            N T +WVGSDVC+Y GVFCAPAPDN  IRTVA IDLNH DIAGYLPEELGLL DL +FH
Sbjct  107  NLTKNWVGSDVCHYKGVFCAPAPDNSSIRTVAGIDLNHGDIAGYLPEELGLLVDLALFH  165



>gb|KJB06894.1| hypothetical protein B456_001G004000 [Gossypium raimondii]
Length=568

 Score =   209 bits (533),  Expect = 7e-61, Method: Composition-based stats.
 Identities = 94/122 (77%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            +G L+D EV YI++RQLLYYRDEFGDRGE VTVDPSL FEN R+RNAYIALQAWK+AI+S
Sbjct  40   HGGLTDKEVSYIKQRQLLYYRDEFGDRGENVTVDPSLVFENPRLRNAYIALQAWKKAILS  99

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T+DWVGS+VC+YTGV+CAPA DN +I+TVA IDLNH DIAGYLPEELGLL DL +
Sbjct  100  DPFNLTADWVGSEVCDYTGVYCAPALDNKRIKTVAGIDLNHGDIAGYLPEELGLLTDLAL  159

Query  555  FH  560
            FH
Sbjct  160  FH  161



>ref|XP_007013226.1| Leucine-rich repeat family protein [Theobroma cacao]
 gb|EOY30845.1| Leucine-rich repeat family protein [Theobroma cacao]
Length=740

 Score =   212 bits (540),  Expect = 8e-61, Method: Composition-based stats.
 Identities = 98/122 (80%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            +G L+D EV YI++RQLLYYRDEFGDRGERVTVDPSL FEN R+RNAYIALQAWKQAI+S
Sbjct  36   HGGLTDQEVLYIKQRQLLYYRDEFGDRGERVTVDPSLVFENPRLRNAYIALQAWKQAILS  95

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T +WVGS+VCNYTGVFCA APDN KI+TVA IDLNH DIAGYLPEELGLL DL +
Sbjct  96   DPFNLTGNWVGSEVCNYTGVFCAAAPDNKKIKTVAGIDLNHGDIAGYLPEELGLLTDLAL  155

Query  555  FH  560
            FH
Sbjct  156  FH  157



>ref|XP_002885650.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61909.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=492

 Score =   207 bits (528),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            N  LSD+EV +IQRRQLLYYRDEFGDRGE+VTVDPSL FEN R+R+AYIALQAWKQAI+S
Sbjct  31   NARLSDTEVRFIQRRQLLYYRDEFGDRGEKVTVDPSLIFENPRLRSAYIALQAWKQAILS  90

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T +W+GS+VCNYTGVFC+ A DN KIRTVA IDLNH DIAGYLPEELGLL DL +
Sbjct  91   DPNNITVNWIGSNVCNYTGVFCSRALDNRKIRTVAGIDLNHADIAGYLPEELGLLTDLAL  150

Query  555  FH  560
            FH
Sbjct  151  FH  152



>gb|KJB54162.1| hypothetical protein B456_009G023700 [Gossypium raimondii]
Length=532

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            +G L+D EV YI++RQLLYYRDEFGDRGE+VTVDPSL FEN R RNAYIALQAWKQAI+S
Sbjct  35   HGGLTDKEVSYIKQRQLLYYRDEFGDRGEKVTVDPSLVFENPRQRNAYIALQAWKQAILS  94

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T +WVGS VC+YTGV+CAPAPDN +I+TVA IDLNH DIAGYLPEELGLL DL +
Sbjct  95   DPFNLTGNWVGSSVCDYTGVYCAPAPDNKRIKTVAGIDLNHGDIAGYLPEELGLLTDLAL  154

Query  555  FH  560
            FH
Sbjct  155  FH  156



>gb|KJB06895.1| hypothetical protein B456_001G004000 [Gossypium raimondii]
Length=499

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            +G L+D EV YI++RQLLYYRDEFGDRGE VTVDPSL FEN R+RNAYIALQAWK+AI+S
Sbjct  40   HGGLTDKEVSYIKQRQLLYYRDEFGDRGENVTVDPSLVFENPRLRNAYIALQAWKKAILS  99

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T+DWVGS+VC+YTGV+CAPA DN +I+TVA IDLNH DIAGYLPEELGLL DL +
Sbjct  100  DPFNLTADWVGSEVCDYTGVYCAPALDNKRIKTVAGIDLNHGDIAGYLPEELGLLTDLAL  159

Query  555  FH  560
            FH
Sbjct  160  FH  161



>ref|XP_008458246.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 4 [Cucumis melo]
Length=666

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  383
            L+D+E HYI++RQLLYYRDEFGDRGE V VDP L FENDRIRNAYIALQAWKQAI+SDP 
Sbjct  47   LTDAEAHYIRQRQLLYYRDEFGDRGEEVVVDPKLVFENDRIRNAYIALQAWKQAILSDPL  106

Query  384  NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            N T +WVGSDVC+Y GVFCAPAPDN  IRTVA IDLNH DIAGYLPEELGLL DL +FH
Sbjct  107  NLTKNWVGSDVCHYKGVFCAPAPDNSSIRTVAGIDLNHGDIAGYLPEELGLLVDLALFH  165



>ref|XP_010088853.1| Leucine-rich repeat extensin-like protein 4 [Morus notabilis]
 gb|EXB37050.1| Leucine-rich repeat extensin-like protein 4 [Morus notabilis]
Length=777

 Score =   211 bits (536),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            +G LS+ E  YI++RQLLYYRDEFGDRGE VTVDPSLTFENDRIR+AYIALQAWK AI+S
Sbjct  50   HGRLSNDEKLYIKQRQLLYYRDEFGDRGENVTVDPSLTFENDRIRSAYIALQAWKNAILS  109

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T+DWVGS+VC YTGVFCAPA DNPKIRTVA IDLNH DIAGYLPEELGLL DL +
Sbjct  110  DPNNLTTDWVGSNVCKYTGVFCAPALDNPKIRTVAGIDLNHGDIAGYLPEELGLLVDLAL  169

Query  555  FH  560
            FH
Sbjct  170  FH  171



>emb|CDX94809.1| BnaC03g43790D [Brassica napus]
Length=530

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            N PL+D+EV +IQRRQLLYYRDEFGDRGE V+VDPSL FEN R+R+AYIALQAWKQAI+S
Sbjct  28   NAPLTDNEVRFIQRRQLLYYRDEFGDRGENVSVDPSLVFENPRLRSAYIALQAWKQAILS  87

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T +W+GS+VC+YTGVFC+ APDN +IRTVA IDLNH DIAGYLPEELGLL DL +
Sbjct  88   DPNNITLNWIGSNVCSYTGVFCSRAPDNRRIRTVAGIDLNHADIAGYLPEELGLLTDLAL  147

Query  555  FH  560
            FH
Sbjct  148  FH  149



>ref|XP_006371912.1| hypothetical protein POPTR_0018s06150g [Populus trichocarpa]
 gb|ERP49709.1| hypothetical protein POPTR_0018s06150g [Populus trichocarpa]
Length=509

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +3

Query  198  GPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            G LSD++  YI++RQLLYY+DEFGDRGERVTVDPSL F N R+RNAYIALQAWKQAI SD
Sbjct  38   GGLSDADAMYIKKRQLLYYKDEFGDRGERVTVDPSLVFPNPRLRNAYIALQAWKQAIFSD  97

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P N T++WVGS VCNY GVFCAPAPDN  IRTVA IDLNH DIAGYLPEELGLL D+ +F
Sbjct  98   PLNLTANWVGSQVCNYEGVFCAPAPDNKTIRTVAGIDLNHGDIAGYLPEELGLLVDIALF  157

Query  558  H  560
            H
Sbjct  158  H  158



>gb|KGN60627.1| hypothetical protein Csa_2G004760 [Cucumis sativus]
Length=765

 Score =   210 bits (535),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  383
            L+D+E HYI++RQLLYYRDEFGDRGE V VDP L FENDRIRNAYIALQAWKQAI+SDP 
Sbjct  47   LTDAEAHYIRQRQLLYYRDEFGDRGEEVVVDPKLVFENDRIRNAYIALQAWKQAILSDPL  106

Query  384  NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            N T +WVGSDVC+Y GVFCAPAPDN  IRTVA IDLNH DIAGYLPEELGLL DL +FH
Sbjct  107  NLTKNWVGSDVCHYKGVFCAPAPDNSSIRTVAGIDLNHGDIAGYLPEELGLLVDLALFH  165



>ref|XP_010527189.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 4 [Tarenaya hassleriana]
Length=694

 Score =   209 bits (532),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            +G LSD EV  I+ RQLLYYRDEFGDRGE VTVDPSL FEN R+R+AY+ALQAWKQAI+S
Sbjct  37   HGRLSDHEVKVIRHRQLLYYRDEFGDRGENVTVDPSLVFENPRLRSAYVALQAWKQAILS  96

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T  WVGS+VCNYTGVFCAPAPDNP+IRTVA IDLNH DIAGYLPEELGLL DL +
Sbjct  97   DPFNFTETWVGSNVCNYTGVFCAPAPDNPQIRTVAGIDLNHADIAGYLPEELGLLTDLAL  156

Query  555  FH  560
            FH
Sbjct  157  FH  158



>gb|KJB06897.1| hypothetical protein B456_001G004000 [Gossypium raimondii]
Length=591

 Score =   207 bits (527),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            +G L+D EV YI++RQLLYYRDEFGDRGE VTVDPSL FEN R+RNAYIALQAWK+AI+S
Sbjct  40   HGGLTDKEVSYIKQRQLLYYRDEFGDRGENVTVDPSLVFENPRLRNAYIALQAWKKAILS  99

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T+DWVGS+VC+YTGV+CAPA DN +I+TVA IDLNH DIAGYLPEELGLL DL +
Sbjct  100  DPFNLTADWVGSEVCDYTGVYCAPALDNKRIKTVAGIDLNHGDIAGYLPEELGLLTDLAL  159

Query  555  FH  560
            FH
Sbjct  160  FH  161



>ref|XP_010532845.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Tarenaya 
hassleriana]
Length=648

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = +3

Query  198  GPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            G LSD EV +I++RQLLYYRDEFGDRGE VTVDPSL FEN R+R+AYIALQAWKQAI+SD
Sbjct  44   GRLSDHEVKFIRQRQLLYYRDEFGDRGENVTVDPSLVFENPRLRSAYIALQAWKQAILSD  103

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P N T+ WVGS+VCNYTGVFC+PAPDN +IRTVA IDLNH DIAGYLPEELGLL DL +F
Sbjct  104  PFNFTASWVGSNVCNYTGVFCSPAPDNHRIRTVAGIDLNHADIAGYLPEELGLLTDLALF  163

Query  558  H  560
            H
Sbjct  164  H  164



>ref|XP_004287084.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Fragaria 
vesca subsp. vesca]
Length=715

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            +G L+D+E HYI++RQLLYYRDEFGDRGE V VDPSL FEN R+RNAYIALQAWK+AI+S
Sbjct  33   HGSLTDAEAHYIKQRQLLYYRDEFGDRGEVVKVDPSLVFENPRLRNAYIALQAWKKAILS  92

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T DWVGSDVC+YTGVFCAPA DN  IRTVA IDLNH DIAGYLPEELGLL DL +
Sbjct  93   DPFNLTGDWVGSDVCSYTGVFCAPALDNSSIRTVAGIDLNHGDIAGYLPEELGLLTDLAL  152

Query  555  FH  560
            FH
Sbjct  153  FH  154



>gb|KJB54163.1| hypothetical protein B456_009G023700 [Gossypium raimondii]
Length=727

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            +G L+D EV YI++RQLLYYRDEFGDRGE+VTVDPSL FEN R RNAYIALQAWKQAI+S
Sbjct  35   HGGLTDKEVSYIKQRQLLYYRDEFGDRGEKVTVDPSLVFENPRQRNAYIALQAWKQAILS  94

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T +WVGS VC+YTGV+CAPAPDN +I+TVA IDLNH DIAGYLPEELGLL DL +
Sbjct  95   DPFNLTGNWVGSSVCDYTGVYCAPAPDNKRIKTVAGIDLNHGDIAGYLPEELGLLTDLAL  154

Query  555  FH  560
            FH
Sbjct  155  FH  156



>ref|XP_009132101.1| PREDICTED: leucine-rich repeat extensin-like protein 5 [Brassica 
rapa]
Length=749

 Score =   207 bits (528),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            N  LSD EVH I++RQLLYYRD+FGDRGE V VDPSL FEN R+R+AY+ALQAWKQAI+S
Sbjct  35   NSDLSDKEVHLIRQRQLLYYRDDFGDRGENVVVDPSLVFENPRLRSAYVALQAWKQAILS  94

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T++W+GSDVC+YTGV+CAPAPDNP+IRTVA IDLNH DIAGYLP+ELGLL DL +
Sbjct  95   DPNNFTTNWIGSDVCSYTGVYCAPAPDNPRIRTVAGIDLNHADIAGYLPQELGLLTDLAL  154

Query  555  FH  560
            FH
Sbjct  155  FH  156



>ref|XP_010488556.1| PREDICTED: leucine-rich repeat extensin-like protein 4, partial 
[Camelina sativa]
Length=444

 Score =   202 bits (514),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            N  LS +EV +IQRRQLLYYRDEFGDRGE VTVDPSL FEN R+R+AYIALQAWKQAI+S
Sbjct  33   NASLSYNEVRFIQRRQLLYYRDEFGDRGENVTVDPSLVFENPRLRSAYIALQAWKQAILS  92

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T DW+GS+VC+YTGVFC+ A DN +IRTVA IDLNH DIAGYLPEELGLL DL +
Sbjct  93   DPNNITLDWIGSNVCSYTGVFCSRALDNRRIRTVAGIDLNHADIAGYLPEELGLLTDLAL  152

Query  555  FH  560
            FH
Sbjct  153  FH  154



>ref|XP_009135898.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Brassica 
rapa]
Length=909

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            N PL+D+EV +IQRRQLLYYRDEFGDRGE VTVDPSL FEN R+R+AYIALQAWKQAI+S
Sbjct  27   NAPLTDNEVRFIQRRQLLYYRDEFGDRGENVTVDPSLVFENPRLRSAYIALQAWKQAILS  86

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T +W+GS+VC YTGVFC+ APDN +IRTVA IDLNH DIAGYLPEELGLL DL +
Sbjct  87   DPNNITLNWIGSNVCTYTGVFCSRAPDNRRIRTVAGIDLNHADIAGYLPEELGLLTDLAL  146

Query  555  FH  560
            FH
Sbjct  147  FH  148



>gb|KJB06896.1| hypothetical protein B456_001G004000 [Gossypium raimondii]
Length=690

 Score =   206 bits (525),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            +G L+D EV YI++RQLLYYRDEFGDRGE VTVDPSL FEN R+RNAYIALQAWK+AI+S
Sbjct  40   HGGLTDKEVSYIKQRQLLYYRDEFGDRGENVTVDPSLVFENPRLRNAYIALQAWKKAILS  99

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T+DWVGS+VC+YTGV+CAPA DN +I+TVA IDLNH DIAGYLPEELGLL DL +
Sbjct  100  DPFNLTADWVGSEVCDYTGVYCAPALDNKRIKTVAGIDLNHGDIAGYLPEELGLLTDLAL  159

Query  555  FH  560
            FH
Sbjct  160  FH  161



>ref|XP_004148723.1| PREDICTED: leucine-rich repeat extensin-like protein 4-like, 
partial [Cucumis sativus]
Length=740

 Score =   207 bits (526),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            +G LSD+E  +I+ RQLLYYRDEFGDRGE VTVDPSL FENDRIRNAYIALQAWK AI+S
Sbjct  13   HGSLSDAEALFIRHRQLLYYRDEFGDRGELVTVDPSLVFENDRIRNAYIALQAWKLAILS  72

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T++WVGS+VCNY GVFCAP+ DNPKIRTVA IDLNH DIAGYLPEELGLL DL +
Sbjct  73   DPLNQTANWVGSNVCNYFGVFCAPSLDNPKIRTVAGIDLNHGDIAGYLPEELGLLTDLAL  132

Query  555  FH  560
            FH
Sbjct  133  FH  134



>ref|XP_006414071.1| hypothetical protein EUTSA_v10024510mg [Eutrema salsugineum]
 gb|ESQ55524.1| hypothetical protein EUTSA_v10024510mg [Eutrema salsugineum]
Length=739

 Score =   207 bits (526),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            NG LSD EV  I++RQLLYYRDEFGDRGE V VDPSL FEN R+RNAYIALQAWKQAI+S
Sbjct  40   NGDLSDKEVRLIRQRQLLYYRDEFGDRGENVVVDPSLVFENPRLRNAYIALQAWKQAILS  99

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T++W+GSDVC+YTGV+CAPAPDN +IRTVA IDLNH DIAGYLP+ELGLL DL +
Sbjct  100  DPNNFTTNWIGSDVCSYTGVYCAPAPDNRRIRTVAGIDLNHADIAGYLPQELGLLTDLAL  159

Query  555  FH  560
            FH
Sbjct  160  FH  161



>gb|KGN65364.1| hypothetical protein Csa_1G383520 [Cucumis sativus]
Length=775

 Score =   207 bits (526),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            +G LSD+E  +I+ RQLLYYRDEFGDRGE VTVDPSL FENDRIRNAYIALQAWK AI+S
Sbjct  23   HGSLSDAEALFIRHRQLLYYRDEFGDRGELVTVDPSLVFENDRIRNAYIALQAWKLAILS  82

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T++WVGS+VCNY GVFCAP+ DNPKIRTVA IDLNH DIAGYLPEELGLL DL +
Sbjct  83   DPLNQTANWVGSNVCNYFGVFCAPSLDNPKIRTVAGIDLNHGDIAGYLPEELGLLTDLAL  142

Query  555  FH  560
            FH
Sbjct  143  FH  144



>ref|XP_004170319.1| PREDICTED: leucine-rich repeat extensin-like protein 4-like [Cucumis 
sativus]
Length=785

 Score =   207 bits (526),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            +G LSD+E  +I+ RQLLYYRDEFGDRGE VTVDPSL FENDRIRNAYIALQAWK AI+S
Sbjct  23   HGSLSDAEALFIRHRQLLYYRDEFGDRGELVTVDPSLVFENDRIRNAYIALQAWKLAILS  82

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T++WVGS+VCNY GVFCAP+ DNPKIRTVA IDLNH DIAGYLPEELGLL DL +
Sbjct  83   DPLNQTANWVGSNVCNYFGVFCAPSLDNPKIRTVAGIDLNHGDIAGYLPEELGLLTDLAL  142

Query  555  FH  560
            FH
Sbjct  143  FH  144



>ref|XP_008463374.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Cucumis 
melo]
Length=771

 Score =   207 bits (526),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +3

Query  198  GPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            G LSD+E  +I+ RQLLYYRDEFGDRGE VTVDPSL FENDRIRNAYIALQAWK AI+SD
Sbjct  25   GTLSDAEALFIRHRQLLYYRDEFGDRGELVTVDPSLVFENDRIRNAYIALQAWKLAILSD  84

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P N T++WVGS+VCNY GVFCAP+ DNPKIRTVA IDLNH DIAGYLPEELGLL DL +F
Sbjct  85   PLNQTANWVGSNVCNYFGVFCAPSLDNPKIRTVAGIDLNHGDIAGYLPEELGLLTDLALF  144

Query  558  H  560
            H
Sbjct  145  H  145



>ref|XP_002281292.2| PREDICTED: leucine-rich repeat extensin-like protein 4 [Vitis 
vinifera]
Length=752

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            +G L+D+EV YI+RRQLLYYRDEFGDRGE VTVDPSL FEN R RNAYIALQAWKQAI+S
Sbjct  35   HGHLTDAEVMYIKRRQLLYYRDEFGDRGEDVTVDPSLVFENPRQRNAYIALQAWKQAILS  94

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T +WVGS+VCNYTGV+CA APDN  IRTVA IDLNH DIAGYLPEELGLL DL +
Sbjct  95   DPLNLTLNWVGSNVCNYTGVYCAQAPDNSSIRTVAGIDLNHGDIAGYLPEELGLLTDLAL  154

Query  555  FH  560
            FH
Sbjct  155  FH  156



>ref|XP_011043443.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 4 [Populus euphratica]
Length=661

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +3

Query  198  GPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            G LSD++  YI++RQLLYY+DEFGDRGERVTVDPSL F N R+RNAYIALQAWKQAI SD
Sbjct  38   GGLSDADAMYIKKRQLLYYKDEFGDRGERVTVDPSLVFPNPRLRNAYIALQAWKQAIFSD  97

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P N T++WVGS VCNY GVFCAPAPDN  I TVA IDLNH DIAGYLPEELGLL DL +F
Sbjct  98   PLNLTANWVGSQVCNYEGVFCAPAPDNKTILTVAGIDLNHGDIAGYLPEELGLLVDLALF  157

Query  558  H  560
            H
Sbjct  158  H  158



>ref|XP_006389464.1| hypothetical protein POPTR_0024s00730g [Populus trichocarpa]
 gb|ERP48378.1| hypothetical protein POPTR_0024s00730g [Populus trichocarpa]
Length=569

 Score =   201 bits (511),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 92/121 (76%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +3

Query  198  GPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            G LSD+E  YI +RQLLYY+DEFGDRGERVTVDPSL FEN R++NAY+ALQAWKQAI SD
Sbjct  39   GGLSDAEAMYINKRQLLYYKDEFGDRGERVTVDPSLVFENPRLKNAYMALQAWKQAIFSD  98

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P N T++WVGS VCNY GVFC+ APDN  IRTVA IDLNH DIAGYLPEELG L DL +F
Sbjct  99   PLNLTANWVGSQVCNYEGVFCSRAPDNKTIRTVAGIDLNHGDIAGYLPEELGFLVDLALF  158

Query  558  H  560
            H
Sbjct  159  H  159



>ref|XP_010513507.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Camelina 
sativa]
Length=719

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            N PLS +EV +IQRRQLLYYRDEFGDRGE VTVDPSL FEN R+R+AYIALQAWKQAI+S
Sbjct  28   NAPLSYNEVRFIQRRQLLYYRDEFGDRGENVTVDPSLVFENPRLRSAYIALQAWKQAILS  87

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T DW+GS+VC+YTGVFC+ A DN +IRTVA IDLNH DIAGYLPEELGLL D+ +
Sbjct  88   DPNNITLDWIGSNVCSYTGVFCSRALDNRRIRTVAGIDLNHADIAGYLPEELGLLTDVAL  147

Query  555  FH  560
            FH
Sbjct  148  FH  149



>ref|XP_008242638.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Prunus 
mume]
Length=667

 Score =   201 bits (511),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            +G LS +E  YI++RQLLYYRDEFGDRGE VTVDPSL FEN RIRNAYIALQAWKQAI+S
Sbjct  42   HGALSHAEALYIKQRQLLYYRDEFGDRGELVTVDPSLVFENQRIRNAYIALQAWKQAILS  101

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T +WVGS+VC+YTGVFC  A DN  IRTVA IDLNH DIAGYLPEELGLLADL +
Sbjct  102  DPLNLTGNWVGSNVCSYTGVFCTKALDNSSIRTVAGIDLNHGDIAGYLPEELGLLADLAL  161

Query  555  FH  560
            FH
Sbjct  162  FH  163



>ref|XP_004512961.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Cicer 
arietinum]
Length=745

 Score =   201 bits (510),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 90/122 (74%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            +G L+++E  YI+ RQLLYYRD+F DRGE VTVDP+L F+N+RI+NAY+ALQAWK AI+S
Sbjct  39   DGSLTENEAMYIKHRQLLYYRDQFCDRGENVTVDPNLVFQNNRIKNAYVALQAWKHAILS  98

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DPRN T DWVGS+VCNYT V+CAPA DNPKI+TVA IDLNH DIAGYLPEELGLL DL +
Sbjct  99   DPRNCTVDWVGSNVCNYTNVYCAPALDNPKIQTVAGIDLNHCDIAGYLPEELGLLTDLAL  158

Query  555  FH  560
            FH
Sbjct  159  FH  160



>ref|XP_006285388.1| hypothetical protein CARUB_v10006785mg [Capsella rubella]
 gb|EOA18286.1| hypothetical protein CARUB_v10006785mg [Capsella rubella]
Length=747

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +3

Query  192  DNGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAII  371
            +N  LSD+EV  I +RQLLYYRDEFGDRGE V VDPSL FEN R+RNAY+ALQAWKQAI+
Sbjct  32   NNNDLSDNEVRLIAQRQLLYYRDEFGDRGENVVVDPSLVFENPRLRNAYVALQAWKQAIL  91

Query  372  SDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLG  551
            SDP N T++W+GSDVC+YTGVFCAPA DN +IRTVA IDLNH DIAGYLP+ELGLL DL 
Sbjct  92   SDPNNFTTNWIGSDVCSYTGVFCAPALDNRRIRTVAGIDLNHADIAGYLPQELGLLTDLA  151

Query  552  VFH  560
            +FH
Sbjct  152  LFH  154



>ref|XP_008344101.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 4, partial [Malus domestica]
Length=526

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            +G LSD E  YI+ RQLLYYRDEFGDRGE VTV PSL FENDR+RNAYIALQA KQAI+S
Sbjct  47   HGALSDEEALYIKNRQLLYYRDEFGDRGELVTVXPSLVFENDRLRNAYIALQALKQAILS  106

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T +WVGS+VC YTGVFC  A DN  IRTVA IDLNH DIAGYLPEELGLL DL +
Sbjct  107  DPLNITGNWVGSNVCKYTGVFCTKALDNSTIRTVAGIDLNHGDIAGYLPEELGLLTDLAL  166

Query  555  FH  560
            FH
Sbjct  167  FH  168



>gb|KEH27082.1| LRR extensin-like protein [Medicago truncatula]
Length=835

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +3

Query  192  DNGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAII  371
            D   L+++E  YI+ RQLLYYRDEF DRGE VTVDP+L F N+RI+NAY+ALQA+KQAI+
Sbjct  34   DGSHLTEAETQYIKHRQLLYYRDEFNDRGENVTVDPTLVFSNNRIKNAYVALQAFKQAIL  93

Query  372  SDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLG  551
            SDPRN T DWVGSDVC+YT VFCAPA DNPKI TVA IDLNH DIAGYLPEELGLL DL 
Sbjct  94   SDPRNCTVDWVGSDVCSYTNVFCAPALDNPKINTVAGIDLNHCDIAGYLPEELGLLTDLA  153

Query  552  VFH  560
            +FH
Sbjct  154  LFH  156



>ref|NP_193602.4| leucine-rich repeat extensin-like protein 5 [Arabidopsis thaliana]
 sp|Q9SN46.2|LRX5_ARATH RecName: Full=Leucine-rich repeat extensin-like protein 5; Short=AtLRX5; 
Short=LRR/EXTENSIN5; AltName: Full=Cell wall hydroxyproline-rich 
glycoprotein; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE84074.1| leucine-rich repeat extensin-like protein 5 [Arabidopsis thaliana]
Length=857

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            NG LSD+EV  I +RQLLY+RDEFGDRGE V VDPSL FEN R+RNAYIALQAWKQAI+S
Sbjct  35   NGDLSDNEVRLITQRQLLYFRDEFGDRGENVDVDPSLVFENPRLRNAYIALQAWKQAILS  94

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T++W+GSDVC+YTGV+CAPA DN +IRTVA IDLNH DIAGYLP+ELGLL DL +
Sbjct  95   DPNNFTTNWIGSDVCSYTGVYCAPALDNRRIRTVAGIDLNHADIAGYLPQELGLLTDLAL  154

Query  555  FH  560
            FH
Sbjct  155  FH  156



>emb|CAB37452.1| extensin-like protein [Arabidopsis thaliana]
 emb|CAB78869.1| extensin-like protein [Arabidopsis thaliana]
Length=839

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            NG LSD+EV  I +RQLLY+RDEFGDRGE V VDPSL FEN R+RNAYIALQAWKQAI+S
Sbjct  35   NGDLSDNEVRLITQRQLLYFRDEFGDRGENVDVDPSLVFENPRLRNAYIALQAWKQAILS  94

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T++W+GSDVC+YTGV+CAPA DN +IRTVA IDLNH DIAGYLP+ELGLL DL +
Sbjct  95   DPNNFTTNWIGSDVCSYTGVYCAPALDNRRIRTVAGIDLNHADIAGYLPQELGLLTDLAL  154

Query  555  FH  560
            FH
Sbjct  155  FH  156



>ref|XP_003620502.1| Extensin-like protein [Medicago truncatula]
Length=838

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +3

Query  192  DNGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAII  371
            D   L+++E  YI+ RQLLYYRDEF DRGE VTVDP+L F N+RI+NAY+ALQA+KQAI+
Sbjct  34   DGSHLTEAETQYIKHRQLLYYRDEFNDRGENVTVDPTLVFSNNRIKNAYVALQAFKQAIL  93

Query  372  SDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLG  551
            SDPRN T DWVGSDVC+YT VFCAPA DNPKI TVA IDLNH DIAGYLPEELGLL DL 
Sbjct  94   SDPRNCTVDWVGSDVCSYTNVFCAPALDNPKINTVAGIDLNHCDIAGYLPEELGLLTDLA  153

Query  552  VFH  560
            +FH
Sbjct  154  LFH  156



>ref|XP_010688564.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Beta 
vulgaris subsp. vulgaris]
Length=607

 Score =   197 bits (502),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            NG LSD+EV YI++RQLLYY+DEFGDRGERV + P+L F N ++R+AYIALQAWKQAI+S
Sbjct  35   NGKLSDAEVSYIRKRQLLYYKDEFGDRGERVRIPPNLQFLNPKLRDAYIALQAWKQAILS  94

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T +WVGSDVC+YTGVFCAP+PDN  + TVA IDLNH DIAGYLPEELGLL DL +
Sbjct  95   DPYNYTVNWVGSDVCHYTGVFCAPSPDNSSVLTVAGIDLNHADIAGYLPEELGLLRDLAL  154

Query  555  FH  560
            FH
Sbjct  155  FH  156



>ref|XP_010254179.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Nelumbo 
nucifera]
Length=764

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            NG L+D+E  YIQ+RQLLYYRDEF DRGE V VDPSL FEN R +NAYIALQAWKQAIIS
Sbjct  43   NGGLTDAEARYIQQRQLLYYRDEFCDRGEHVRVDPSLVFENPRQKNAYIALQAWKQAIIS  102

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N TS+WVGS+VCNYTGVFC  A D+P I+TVA IDLNH DIAGYLPEELGLL D+ +
Sbjct  103  DPLNLTSNWVGSNVCNYTGVFCTSALDDPSIKTVAGIDLNHGDIAGYLPEELGLLTDIAL  162

Query  555  FH  560
            FH
Sbjct  163  FH  164



>ref|XP_009336917.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Pyrus 
x bretschneideri]
Length=750

 Score =   199 bits (505),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            +G LSD E  YI+ RQLLYYRDEFGDRGE VTVDPSL FENDR+RNAYIALQA KQAI+S
Sbjct  47   HGALSDEEALYIKNRQLLYYRDEFGDRGELVTVDPSLVFENDRLRNAYIALQALKQAILS  106

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T +WVGS+VCNYTGVFC  A DN  IRTVA IDLNH DIAGYLPEELGLL DL +
Sbjct  107  DPLNITGNWVGSNVCNYTGVFCTKALDNRTIRTVAGIDLNHGDIAGYLPEELGLLTDLAL  166

Query  555  FH  560
            FH
Sbjct  167  FH  168



>ref|XP_010434500.1| PREDICTED: leucine-rich repeat extensin-like protein 5 isoform 
X1 [Camelina sativa]
Length=780

 Score =   199 bits (505),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            NG LSD+EV  I +RQLLYYRD+FGDRGE V VDP+L FEN R+RNAY+ALQAWKQAI+S
Sbjct  37   NGNLSDNEVRLITKRQLLYYRDDFGDRGENVVVDPTLVFENPRLRNAYVALQAWKQAILS  96

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T++W+GS+VC+YTGVFCAPA DN +IRTVA IDLNH DIAGYLP+ELGLL DL +
Sbjct  97   DPNNFTTNWIGSNVCSYTGVFCAPALDNRRIRTVAGIDLNHVDIAGYLPQELGLLTDLAL  156

Query  555  FH  560
            FH
Sbjct  157  FH  158



>ref|XP_010434501.1| PREDICTED: leucine-rich repeat extensin-like protein 5 isoform 
X2 [Camelina sativa]
Length=768

 Score =   198 bits (504),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            NG LSD+EV  I +RQLLYYRD+FGDRGE V VDP+L FEN R+RNAY+ALQAWKQAI+S
Sbjct  37   NGNLSDNEVRLITKRQLLYYRDDFGDRGENVVVDPTLVFENPRLRNAYVALQAWKQAILS  96

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T++W+GS+VC+YTGVFCAPA DN +IRTVA IDLNH DIAGYLP+ELGLL DL +
Sbjct  97   DPNNFTTNWIGSNVCSYTGVFCAPALDNRRIRTVAGIDLNHVDIAGYLPQELGLLTDLAL  156

Query  555  FH  560
            FH
Sbjct  157  FH  158



>ref|XP_010439825.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Camelina 
sativa]
Length=862

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  383
            LSD+EV  I +RQLLYYRDEFGDRGE V VDP+L FEN R+RNAY+ALQAWKQAI+SDP 
Sbjct  41   LSDNEVRLITKRQLLYYRDEFGDRGENVVVDPTLVFENPRLRNAYVALQAWKQAILSDPN  100

Query  384  NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            N T++W+GS+VC+YTGVFCAPA DN +IRTVA IDLNH DIAGYLP+ELGLL DL +FH
Sbjct  101  NFTTNWIGSNVCSYTGVFCAPALDNRRIRTVAGIDLNHADIAGYLPQELGLLTDLALFH  159



>ref|XP_010449482.1| PREDICTED: leucine-rich repeat extensin-like protein 5 [Camelina 
sativa]
Length=825

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  383
            LSD+EV  I +RQLLYYRDEFGDRGE V VDP+L FEN R+RNAY+ALQAWKQAI+SDP 
Sbjct  45   LSDNEVRLITKRQLLYYRDEFGDRGENVVVDPTLVFENPRLRNAYVALQAWKQAILSDPN  104

Query  384  NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            N T++W+GS+VC YTGVFCAPA DN +IRTVA IDLNH DIAGYLP+ELGLL DL +FH
Sbjct  105  NFTTNWIGSNVCGYTGVFCAPALDNRRIRTVAGIDLNHADIAGYLPQELGLLTDLALFH  163



>ref|XP_002867981.1| hypothetical protein ARALYDRAFT_492992 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44240.1| hypothetical protein ARALYDRAFT_492992 [Arabidopsis lyrata subsp. 
lyrata]
Length=738

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            NG LSD++V  I +RQLLY+RDE GDRGE V VDPSL FEN R+RNAYIALQAWKQAI+S
Sbjct  36   NGDLSDNQVRLITQRQLLYFRDELGDRGENVVVDPSLVFENPRLRNAYIALQAWKQAILS  95

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T++W+GSDVC+YTGV+CAPA DN +IRTVA IDLNH DIAGYLP+ELGLL DL +
Sbjct  96   DPNNFTTNWIGSDVCSYTGVYCAPALDNRRIRTVAGIDLNHADIAGYLPQELGLLTDLAL  155

Query  555  FH  560
            FH
Sbjct  156  FH  157



>ref|XP_006389336.1| hypothetical protein POPTR_0028s00200g, partial [Populus trichocarpa]
 gb|ERP48250.1| hypothetical protein POPTR_0028s00200g, partial [Populus trichocarpa]
Length=500

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +3

Query  225  YIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWV  404
            YI +RQLLYY+DEFGDRGERVTVDPSL FEN R++NAY+ALQAWKQAI SDP N T++WV
Sbjct  2    YIDKRQLLYYKDEFGDRGERVTVDPSLVFENPRLKNAYMALQAWKQAIFSDPLNLTANWV  61

Query  405  GSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            GS VCNY GVFC+ APDN  IRTVA IDLNH DIAGYLPEELG L DL +FH
Sbjct  62   GSQVCNYEGVFCSRAPDNKTIRTVAGIDLNHGDIAGYLPEELGFLVDLALFH  113



>ref|XP_008365636.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 4 [Malus domestica]
Length=505

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            +GPLSD E  YI+ RQLLYY DEFGDRGE VT+DPSL FENDR+RNAYIALQA KQAI+S
Sbjct  92   HGPLSDEEALYIKHRQLLYYHDEFGDRGEHVTIDPSLVFENDRLRNAYIALQALKQAILS  151

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T +WVGS+VC YT VF   A DN  IRTVA IDLNH DIAGYLPEELGLL DL +
Sbjct  152  DPFNITGNWVGSNVCKYTXVFXTKALDNRTIRTVAGIDLNHGDIAGYLPEELGLLTDLAL  211

Query  555  FH  560
            FH
Sbjct  212  FH  213



>ref|XP_006414930.1| hypothetical protein EUTSA_v100275740mg, partial [Eutrema salsugineum]
 gb|ESQ56383.1| hypothetical protein EUTSA_v100275740mg, partial [Eutrema salsugineum]
Length=400

 Score =   189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 4/117 (3%)
 Frame = +3

Query  210  DSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNT  389
            D+EV +IQRRQLL    EF +RGE+VTVDPSL+FEN R+RNAYIALQAWKQAI+SDP N 
Sbjct  31   DNEVRHIQRRQLL----EFAERGEKVTVDPSLSFENPRLRNAYIALQAWKQAILSDPFNF  86

Query  390  TSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            T++W+GS+VCNYTGVFC+PA DN +IRTVA IDLNH DIAGYLPEELGLL+DL +FH
Sbjct  87   TANWIGSNVCNYTGVFCSPALDNRRIRTVAGIDLNHADIAGYLPEELGLLSDLALFH  143



>ref|XP_007152809.1| hypothetical protein PHAVU_004G161500g [Phaseolus vulgaris]
 gb|ESW24803.1| hypothetical protein PHAVU_004G161500g [Phaseolus vulgaris]
Length=725

 Score =   193 bits (490),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            NGPL+D+E  YI++RQLLYY+DEFGDRGE+VTVDPS  FEN+R+RNAYIALQAWK AI+S
Sbjct  36   NGPLTDAEASYIKQRQLLYYKDEFGDRGEKVTVDPSFRFENNRLRNAYIALQAWKHAILS  95

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEE  527
            DP+N T DWVG +VCNYT VFCAPA DNPKI TVA IDLNH DIAGYLPEE
Sbjct  96   DPKNLTLDWVGPNVCNYTSVFCAPALDNPKINTVAGIDLNHGDIAGYLPEE  146



>ref|XP_006282938.1| hypothetical protein CARUB_v100074500mg, partial [Capsella rubella]
 gb|EOA15836.1| hypothetical protein CARUB_v100074500mg, partial [Capsella rubella]
Length=488

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 101/121 (83%), Gaps = 4/121 (3%)
 Frame = +3

Query  198  GPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            G LSD+EV +IQRRQLL    EF +R  ++TVDPSL FEN R+RNAYIALQAWKQAI+SD
Sbjct  23   GALSDNEVRHIQRRQLL----EFAERSVKITVDPSLVFENPRLRNAYIALQAWKQAILSD  78

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P   TS+W+GS+VCNYTGVFC+PA DN KIRTVA IDLNH DIAGYLPEELGLL DL +F
Sbjct  79   PNKFTSNWIGSNVCNYTGVFCSPALDNRKIRTVAGIDLNHADIAGYLPEELGLLTDLALF  138

Query  558  H  560
            H
Sbjct  139  H  139



>ref|NP_193070.1| leucine-rich repeat extensin-like protein 3 [Arabidopsis thaliana]
 sp|Q9T0K5.1|LRX3_ARATH RecName: Full=Leucine-rich repeat extensin-like protein 3; Short=AtLRX3; 
Short=LRR/EXTENSIN3; AltName: Full=Cell wall hydroxyproline-rich 
glycoprotein; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB40769.1| extensin-like protein [Arabidopsis thaliana]
 emb|CAB78376.1| extensin-like protein [Arabidopsis thaliana]
 gb|AEE83265.1| leucine-rich repeat extensin-like protein 3 [Arabidopsis thaliana]
Length=760

 Score =   191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 104/123 (85%), Gaps = 4/123 (3%)
 Frame = +3

Query  192  DNGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAII  371
            D G LSD+EV +IQRRQLL    EF +R  ++TVDPSL FEN R+RNAYIALQAWKQAI+
Sbjct  26   DGGVLSDNEVRHIQRRQLL----EFAERSVKITVDPSLNFENPRLRNAYIALQAWKQAIL  81

Query  372  SDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLG  551
            SDP N TS+W+GS+VCNYTGVFC+PA DN KIRTVA IDLNH DIAGYLPEELGLL+DL 
Sbjct  82   SDPNNFTSNWIGSNVCNYTGVFCSPALDNRKIRTVAGIDLNHADIAGYLPEELGLLSDLA  141

Query  552  VFH  560
            +FH
Sbjct  142  LFH  144



>ref|XP_010925532.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Elaeis 
guineensis]
Length=523

 Score =   188 bits (477),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  383
            L+D+E   I++RQLLYYRDEFGDRGE VTVDPSL F N  +R+AYIALQAWK AIISDP 
Sbjct  32   LTDAEAGLIRQRQLLYYRDEFGDRGESVTVDPSLNFPNSHLRDAYIALQAWKLAIISDPL  91

Query  384  NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            N T++WVGSDVC+YTGVFCAP P +P +  VA IDLNH DIAGYLPEELGLL DL +FH
Sbjct  92   NLTANWVGSDVCSYTGVFCAPLPSDPHLIVVAGIDLNHGDIAGYLPEELGLLTDLALFH  150



>ref|XP_002863246.1| hypothetical protein ARALYDRAFT_497051 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39505.1| hypothetical protein ARALYDRAFT_497051 [Arabidopsis lyrata subsp. 
lyrata]
Length=561

 Score =   188 bits (478),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 103/121 (85%), Gaps = 4/121 (3%)
 Frame = +3

Query  198  GPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            G LSD+EV +IQRRQLL    EF +R  ++TVDPSL FEN R+RNAYIALQAWKQAI+SD
Sbjct  25   GVLSDNEVRHIQRRQLL----EFAERSVKITVDPSLIFENPRLRNAYIALQAWKQAILSD  80

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P N TS+W+GS+VCNYTGVFC+PA DN KIRTVA IDLNH DIAGYLPEELGLL+DL +F
Sbjct  81   PNNFTSNWIGSNVCNYTGVFCSPALDNRKIRTVAGIDLNHADIAGYLPEELGLLSDLALF  140

Query  558  H  560
            H
Sbjct  141  H  141



>ref|XP_008793507.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Phoenix 
dactylifera]
Length=643

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  383
            L+D+E  +I++RQLLYYRDEFGDRGE  TVDPSL+F N  +R+AYIALQAWK AIISDP 
Sbjct  32   LTDAEAGFIRQRQLLYYRDEFGDRGENGTVDPSLSFSNSHLRDAYIALQAWKLAIISDPL  91

Query  384  NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            N TS+WVGS+VCNYTGV+CAP P +P I  VA IDLNH DIAGYLPEELGLL DL +FH
Sbjct  92   NLTSNWVGSNVCNYTGVYCAPLPSDPHITVVAGIDLNHGDIAGYLPEELGLLTDLALFH  150



>ref|XP_008786172.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Phoenix 
dactylifera]
Length=678

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  383
            L+D+E  +I++RQLLYYRDEFGDRGE VTVDPSL F N  +R+AYIALQAWK AIISDP 
Sbjct  32   LTDAEAGFIRQRQLLYYRDEFGDRGEYVTVDPSLNFPNSHLRDAYIALQAWKLAIISDPL  91

Query  384  NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            N T++WVGS+VCNYTGV+CAP P +P +  VA IDLNH DIAGYLPEELGLL DL +FH
Sbjct  92   NLTANWVGSNVCNYTGVYCAPLPSDPHLTVVAGIDLNHGDIAGYLPEELGLLTDLALFH  150



>ref|XP_010249819.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Nelumbo 
nucifera]
Length=701

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 102/124 (82%), Gaps = 1/124 (1%)
 Frame = +3

Query  192  DNGPLSDSEVHYIQRRQLLYYRDEFGDRGER-VTVDPSLTFENDRIRNAYIALQAWKQAI  368
            +NG L+D E  YI++RQLLYYRDEF DRGE  V +DPSL FEN R+RNAYIALQAWK+A+
Sbjct  30   NNGGLTDIEARYIRQRQLLYYRDEFYDRGEHYVKLDPSLVFENPRLRNAYIALQAWKKAM  89

Query  369  ISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADL  548
            ISDP N T +WVG DVCNYTGVFCA A D+  IRTVA IDLNH DIAGYLPEE+GLL D+
Sbjct  90   ISDPLNLTGNWVGFDVCNYTGVFCANALDDRSIRTVAGIDLNHGDIAGYLPEEIGLLVDI  149

Query  549  GVFH  560
             +FH
Sbjct  150  ALFH  153



>gb|EPS61338.1| hypothetical protein M569_13456, partial [Genlisea aurea]
Length=387

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 98/112 (88%), Gaps = 1/112 (1%)
 Frame = +3

Query  228  IQRRQLLYYRDEFGDRGERVTVD-PSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWV  404
            ++ R+LLYY DEFGDRGE V+VD  SL FENDR+R+AYIALQAWK+AI+SDP N T+DWV
Sbjct  1    VKERRLLYYLDEFGDRGEDVSVDEASLVFENDRLRSAYIALQAWKEAILSDPYNLTADWV  60

Query  405  GSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            GSDVC YTGVFCA A D+P++RTVA IDLNH DIAGYLPEELGLL DLG+FH
Sbjct  61   GSDVCGYTGVFCAQAIDDPEVRTVAGIDLNHGDIAGYLPEELGLLVDLGLFH  112



>ref|XP_006300268.1| hypothetical protein CARUB_v100163570mg, partial [Capsella rubella]
 gb|EOA33166.1| hypothetical protein CARUB_v100163570mg, partial [Capsella rubella]
Length=457

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 100/122 (82%), Gaps = 4/122 (3%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            N PLS +EV +IQRRQLL    EF DRGE VTVDPSL FEN R+R+AYIALQAWKQAI+S
Sbjct  37   NAPLSVNEVRFIQRRQLL----EFADRGENVTVDPSLVFENPRLRSAYIALQAWKQAILS  92

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N T +W+GS+VC+YTGVFC+ A DN +IRTVA IDLNH DIAGYLP ELGLL DL +
Sbjct  93   DPNNITLNWIGSNVCSYTGVFCSRALDNRRIRTVAGIDLNHGDIAGYLPLELGLLTDLAL  152

Query  555  FH  560
            FH
Sbjct  153  FH  154



>gb|KFK36221.1| hypothetical protein AALP_AA4G093700 [Arabis alpina]
Length=844

 Score =   188 bits (477),  Expect = 6e-52, Method: Composition-based stats.
 Identities = 89/121 (74%), Positives = 103/121 (85%), Gaps = 4/121 (3%)
 Frame = +3

Query  198  GPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            G LSD+EV +IQRRQLL    EF +R  ++TVDPSL FEN R+RNAYIALQAWKQAI+SD
Sbjct  29   GVLSDNEVRHIQRRQLL----EFAERSVKITVDPSLVFENPRLRNAYIALQAWKQAILSD  84

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P N TS+W+GS+VCNYTGVFC+P+ DN KIRTVA IDLNH DIAGYLPEELGLL+DL +F
Sbjct  85   PFNFTSNWIGSNVCNYTGVFCSPSLDNRKIRTVAGIDLNHADIAGYLPEELGLLSDLALF  144

Query  558  H  560
            H
Sbjct  145  H  145



>ref|XP_010450227.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X1 [Camelina sativa]
Length=688

 Score =   187 bits (474),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 4/121 (3%)
 Frame = +3

Query  198  GPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            G LSD+EV +IQRRQLL    EF +R   +TVDPSL FEN R+RNAYIALQAWKQAI+SD
Sbjct  25   GALSDNEVRHIQRRQLL----EFAERSVNITVDPSLVFENPRLRNAYIALQAWKQAILSD  80

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P N TS+W+GS+VCNYTGVFC+P+ DN KIRTVA IDLNH DIAGYLPEELGLL+DL +F
Sbjct  81   PNNFTSNWIGSNVCNYTGVFCSPSLDNRKIRTVAGIDLNHADIAGYLPEELGLLSDLALF  140

Query  558  H  560
            H
Sbjct  141  H  141



>ref|XP_010450229.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X3 [Camelina sativa]
Length=733

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 4/121 (3%)
 Frame = +3

Query  198  GPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            G LSD+EV +IQRRQLL    EF +R   +TVDPSL FEN R+RNAYIALQAWKQAI+SD
Sbjct  25   GALSDNEVRHIQRRQLL----EFAERSVNITVDPSLVFENPRLRNAYIALQAWKQAILSD  80

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P N TS+W+GS+VCNYTGVFC+P+ DN KIRTVA IDLNH DIAGYLPEELGLL+DL +F
Sbjct  81   PNNFTSNWIGSNVCNYTGVFCSPSLDNRKIRTVAGIDLNHADIAGYLPEELGLLSDLALF  140

Query  558  H  560
            H
Sbjct  141  H  141



>ref|XP_010450228.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X2 [Camelina sativa]
Length=725

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 4/121 (3%)
 Frame = +3

Query  198  GPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            G LSD+EV +IQRRQLL    EF +R   +TVDPSL FEN R+RNAYIALQAWKQAI+SD
Sbjct  25   GALSDNEVRHIQRRQLL----EFAERSVNITVDPSLVFENPRLRNAYIALQAWKQAILSD  80

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P N TS+W+GS+VCNYTGVFC+P+ DN KIRTVA IDLNH DIAGYLPEELGLL+DL +F
Sbjct  81   PNNFTSNWIGSNVCNYTGVFCSPSLDNRKIRTVAGIDLNHADIAGYLPEELGLLSDLALF  140

Query  558  H  560
            H
Sbjct  141  H  141



>ref|XP_010440602.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Camelina 
sativa]
Length=720

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 103/121 (85%), Gaps = 4/121 (3%)
 Frame = +3

Query  198  GPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            G LSD+EV +IQRRQLL    EF +R  ++TVDPSL FEN R+RNAY+ALQAWKQAI+SD
Sbjct  26   GALSDNEVRHIQRRQLL----EFAERSVKITVDPSLVFENPRLRNAYVALQAWKQAILSD  81

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P N TS+W+GS+VCNYTGVFC+P+ +N KIRTVA IDLNH DIAGYLPEELGLL+DL +F
Sbjct  82   PNNFTSNWIGSNVCNYTGVFCSPSLNNRKIRTVAGIDLNHADIAGYLPEELGLLSDLALF  141

Query  558  H  560
            H
Sbjct  142  H  142



>ref|XP_003532491.1| PREDICTED: leucine-rich repeat extensin-like protein 5-like [Glycine 
max]
Length=735

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  383
            LSD+E  Y+++RQLLYYRDEFGDRGE V VDPSL FENDR+RNAYIALQAWKQAI+SDPR
Sbjct  34   LSDAEAMYVKQRQLLYYRDEFGDRGENVIVDPSLAFENDRLRNAYIALQAWKQAILSDPR  93

Query  384  NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGY  515
            N T+DWVGSDVC+YTGV+CAPA D PKIRTVA IDLNH DIAGY
Sbjct  94   NQTADWVGSDVCSYTGVYCAPALDIPKIRTVAGIDLNHCDIAGY  137



>ref|XP_003524389.2| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Glycine 
max]
Length=597

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +3

Query  246  LYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNY  425
            L   DEFGDRGE VTVDPSL F+NDR+RNAYIALQAWKQAI+SDPRN T+DWVGS VC+Y
Sbjct  24   LALSDEFGDRGENVTVDPSLVFQNDRLRNAYIALQAWKQAILSDPRNQTTDWVGSQVCSY  83

Query  426  TGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            TGV+CAPA DNP IRTVA IDLNH DIAGYLP+ELGLL DL +FH
Sbjct  84   TGVYCAPALDNPNIRTVAGIDLNHGDIAGYLPQELGLLVDLALFH  128



>gb|KHN21547.1| Leucine-rich repeat extensin-like protein 5 [Glycine soja]
Length=588

 Score =   184 bits (466),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +3

Query  246  LYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNY  425
            L   DEFGDRGE VTVDPSL F+NDR+RNAYIALQAWKQAI+SDPRN T+DWVGS VC+Y
Sbjct  24   LALSDEFGDRGENVTVDPSLVFQNDRLRNAYIALQAWKQAILSDPRNQTTDWVGSQVCSY  83

Query  426  TGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            TGV+CAPA DNP IRTVA IDLNH DIAGYLP+ELGLL DL +FH
Sbjct  84   TGVYCAPALDNPNIRTVAGIDLNHGDIAGYLPQELGLLVDLALFH  128



>ref|XP_010435287.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Camelina 
sativa]
Length=738

 Score =   184 bits (467),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 102/121 (84%), Gaps = 4/121 (3%)
 Frame = +3

Query  198  GPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            G LSD+EV +IQRRQLL    EF +R  ++TVD SL FEN R+RNAYIALQAWKQAI+SD
Sbjct  26   GALSDNEVRHIQRRQLL----EFAERSVKITVDHSLVFENPRLRNAYIALQAWKQAILSD  81

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P N TS+W+GS+VCNYTGVFC+P+ DN KIRTVA IDLNH DIAGYLPEELGLL+DL +F
Sbjct  82   PNNFTSNWIGSNVCNYTGVFCSPSLDNRKIRTVAGIDLNHADIAGYLPEELGLLSDLALF  141

Query  558  H  560
            H
Sbjct  142  H  142



>ref|XP_006450582.1| hypothetical protein CICLE_v10010264mg [Citrus clementina]
 gb|ESR63822.1| hypothetical protein CICLE_v10010264mg [Citrus clementina]
Length=503

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = +3

Query  192  DNGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAII  371
            +NG   ++E  +I++RQLLYYR+ +G RGE   + PS  FEN RIR+AYIALQAWK+AII
Sbjct  30   NNGVFLEAEAAFIKQRQLLYYRNRYGGRGEFGRIPPSFKFENSRIRSAYIALQAWKKAII  89

Query  372  SDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLG  551
            SDP N TS+WVG  VCNYTGVFCA A DN  IRTVA IDLNH DIAGYLPEELGLLAD+ 
Sbjct  90   SDPWNLTSNWVGCYVCNYTGVFCAQALDNHSIRTVAGIDLNHGDIAGYLPEELGLLADIA  149

Query  552  VFH  560
            +FH
Sbjct  150  LFH  152



>ref|XP_009352479.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Pyrus 
x bretschneideri]
Length=521

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            +G LSD E  YI+ RQLLYYRDEFGDRGE VTVDPSL FENDR+RNAYIALQA KQAI+S
Sbjct  42   HGLLSDEEALYIKHRQLLYYRDEFGDRGEHVTVDPSLVFENDRLRNAYIALQALKQAILS  101

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEE  527
            DP N T +WVGS+VC YTGVFC  A DN  IRTVA IDLNH DIAGYLPEE
Sbjct  102  DPFNITGNWVGSNVCKYTGVFCTKALDNRTIRTVAGIDLNHGDIAGYLPEE  152



>ref|XP_007160348.1| hypothetical protein PHAVU_002G314200g [Phaseolus vulgaris]
 gb|ESW32342.1| hypothetical protein PHAVU_002G314200g [Phaseolus vulgaris]
Length=740

 Score =   181 bits (460),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +3

Query  237  RQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDV  416
            R +L YRDEFGDRGE V+VDPSL F+N+R+R+AYIALQAWK AI+SDP+N T+DWVGS V
Sbjct  34   RHVLSYRDEFGDRGENVSVDPSLVFQNNRLRDAYIALQAWKLAILSDPQNQTTDWVGSQV  93

Query  417  CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            C YTGV+CAPA DNP I+TVA IDLNH DIAGYLPEELGLL DL +FH
Sbjct  94   CTYTGVYCAPALDNPSIQTVAGIDLNHRDIAGYLPEELGLLVDLALFH  141



>gb|KDO79655.1| hypothetical protein CISIN_1g041736mg [Citrus sinensis]
Length=500

 Score =   179 bits (453),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = +3

Query  192  DNGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAII  371
            +NG   ++E  +I++RQLLYYR+ +G RGE   + PS  FEN RIR+AYIALQAWK+AII
Sbjct  30   NNGVFLEAEAAFIKQRQLLYYRNRYGGRGEFGRIPPSFKFENSRIRSAYIALQAWKKAII  89

Query  372  SDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLG  551
            SDP N TS+WVG  VCNYTGVFCA A DN  IRTVA IDLNH DIA YLPEELGLLAD+ 
Sbjct  90   SDPWNLTSNWVGCYVCNYTGVFCAQALDNHSIRTVAGIDLNHGDIASYLPEELGLLADIA  149

Query  552  VFH  560
            +FH
Sbjct  150  LFH  152



>ref|XP_007013716.1| Leucine-rich repeat family protein [Theobroma cacao]
 gb|EOY31335.1| Leucine-rich repeat family protein [Theobroma cacao]
Length=614

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  383
            L+DS+  +I++RQL+YYR++FG  G+  +V   LTF+N R+R+AY+ALQAWKQAIISDP 
Sbjct  35   LTDSQASFIKQRQLIYYREQFGSGGKFDSVPSQLTFDNSRLRSAYVALQAWKQAIISDPL  94

Query  384  NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            N TS+WVGSDVCNYTGVFC+PA D+P I+TVA IDLNH D+AGYLPEELGLL D+ +FH
Sbjct  95   NLTSNWVGSDVCNYTGVFCSPALDDPSIQTVAGIDLNHGDLAGYLPEELGLLTDIALFH  153



>ref|XP_006476177.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Citrus 
sinensis]
Length=514

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = +3

Query  192  DNGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAII  371
            +NG   ++E  +I++RQLLYYR+ +G RGE   + PS  FEN RIR+AYIALQAWK+AII
Sbjct  30   NNGVFLEAEAAFIKQRQLLYYRNRYGGRGEFGRIPPSFKFENSRIRSAYIALQAWKKAII  89

Query  372  SDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLG  551
            SDP N TS+WVG  VCNYTGVFCA A DN  IRTVA IDLNH DIA YLPEELGLLAD+ 
Sbjct  90   SDPWNLTSNWVGCYVCNYTGVFCAQALDNHSIRTVAGIDLNHGDIASYLPEELGLLADIA  149

Query  552  VFH  560
            +FH
Sbjct  150  LFH  152



>ref|XP_009408826.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Musa 
acuminata subsp. malaccensis]
Length=553

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  383
            L+D+E  +I+RRQLLYY DE+GDRGERV+VDPS  F N R+R+AY+ALQAWK+AI+SDP 
Sbjct  34   LTDAEAGFIRRRQLLYYLDEYGDRGERVSVDPSFRFPNPRLRDAYVALQAWKKAILSDPH  93

Query  384  NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            N T  WVG +VC+Y GVFCAP P N  +  VA IDLNH DIAGYLPEELGLL DL +FH
Sbjct  94   NFTGSWVGPNVCSYYGVFCAPLPCNRSLTVVAGIDLNHADIAGYLPEELGLLTDLALFH  152



>ref|XP_009403414.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Musa 
acuminata subsp. malaccensis]
Length=557

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  383
            L+D+E   I+RRQLLYY DE+GDRGERV+VDPS  F N R+R+AY+ALQAWKQAI+SDP+
Sbjct  36   LTDAEAGLIRRRQLLYYLDEYGDRGERVSVDPSFHFPNPRLRDAYVALQAWKQAILSDPQ  95

Query  384  NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            N T +WVG +VC Y GV+CAP P N  +  VA IDLNH DIAGYLPEELGLL DL +FH
Sbjct  96   NFTGNWVGPNVCTYRGVYCAPLPCNSSLNVVAGIDLNHADIAGYLPEELGLLTDLALFH  154



>ref|XP_009377376.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Pyrus 
x bretschneideri]
Length=679

 Score =   177 bits (449),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 84/124 (68%), Positives = 98/124 (79%), Gaps = 3/124 (2%)
 Frame = +3

Query  195  NGPLSDS--EVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAI  368
            N  L DS    HY QR QLLYY D+ G RGE VTV  SL FEN R+R+AYIALQAWKQA+
Sbjct  34   NAGLRDSLRTSHYKQR-QLLYYIDQDGSRGETVTVPASLVFENSRLRSAYIALQAWKQAM  92

Query  369  ISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADL  548
            +SDP +  S+WVGSDVC YTGVFCA APD+P ++TVA IDLNH DIAG+LPEELGLL+D+
Sbjct  93   VSDPLDQISNWVGSDVCKYTGVFCAQAPDDPSVQTVAGIDLNHADIAGFLPEELGLLSDI  152

Query  549  GVFH  560
             +FH
Sbjct  153  ALFH  156



>ref|XP_010049719.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Eucalyptus 
grandis]
Length=732

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +3

Query  231  QRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGS  410
            + R LL+Y DEFGDRG +VTVDPS +FEN R+RNAY+ALQA KQAI+SDP N T++WVG 
Sbjct  37   EHRLLLHYLDEFGDRGLQVTVDPSASFENPRLRNAYVALQALKQAILSDPNNFTANWVGP  96

Query  411  DVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            DVC+Y+ V+C+PAPD+P +RTVA +DLNH DIAGYLPEELGLLADL +FH
Sbjct  97   DVCSYSNVYCSPAPDDPSVRTVAGVDLNHGDIAGYLPEELGLLADLALFH  146



>ref|XP_008378297.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Malus 
domestica]
Length=577

 Score =   175 bits (443),  Expect = 6e-48, Method: Composition-based stats.
 Identities = 83/124 (67%), Positives = 97/124 (78%), Gaps = 3/124 (2%)
 Frame = +3

Query  195  NGPLSDS--EVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAI  368
            N  L DS    HY QR QLL Y D+ G RGE VTV   L FEN R+R+AYIALQAWKQA+
Sbjct  34   NAGLRDSLRTSHYKQR-QLLXYIDQDGSRGETVTVPDXLVFENSRLRSAYIALQAWKQAM  92

Query  369  ISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADL  548
            +SDPR+  S+WVGSDVC YTGVFCA APD+P ++TVA IDLNH DIAG+LPEELGLL+D+
Sbjct  93   VSDPRDQISNWVGSDVCKYTGVFCAQAPDDPSVQTVAGIDLNHADIAGFLPEELGLLSDI  152

Query  549  GVFH  560
             +FH
Sbjct  153  ALFH  156



>ref|XP_009381253.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Musa 
acuminata subsp. malaccensis]
Length=546

 Score =   174 bits (442),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  383
            L+D+E   I+RRQLLYY DE+GDRGERVTVDPS  F N  +R AY+ALQAWKQAI+SDP 
Sbjct  36   LTDAEAGLIRRRQLLYYLDEYGDRGERVTVDPSFHFANPGLRAAYVALQAWKQAILSDPH  95

Query  384  NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            N T +WVG DVC+Y GV+CA  P N  +  VA IDLNH DIAGYLPEELGLL DL +FH
Sbjct  96   NFTGNWVGPDVCHYYGVYCASLPCNGSLTVVAGIDLNHGDIAGYLPEELGLLTDLALFH  154



>ref|XP_008347715.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Malus 
domestica]
Length=403

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 98/124 (79%), Gaps = 3/124 (2%)
 Frame = +3

Query  195  NGPLSDS--EVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAI  368
            N  L DS    HY QR QLL Y D+ G RGE VTV  +L FEN R+R+AYIALQAWKQA+
Sbjct  34   NAGLRDSLRTSHYKQR-QLLXYIDQDGSRGETVTVPDALVFENSRLRSAYIALQAWKQAM  92

Query  369  ISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADL  548
            +SDPR+  S+WVGSDVC YTGVFCA APD+P ++TVA IDLNH DIAG+LPEELGLL+D+
Sbjct  93   VSDPRDQISNWVGSDVCKYTGVFCAQAPDDPSVQTVAGIDLNHADIAGFLPEELGLLSDI  152

Query  549  GVFH  560
             +FH
Sbjct  153  ALFH  156



>ref|XP_008357497.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 3, partial [Malus domestica]
Length=557

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 97/124 (78%), Gaps = 3/124 (2%)
 Frame = +3

Query  195  NGPLSDS--EVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAI  368
            N  L DS    HY QR QLL Y D+ G RGE VTV   L FEN R+R+AYIALQAWKQA+
Sbjct  34   NAGLRDSLRTSHYKQR-QLLXYIDQDGSRGETVTVPDXLVFENSRLRSAYIALQAWKQAM  92

Query  369  ISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADL  548
            +SDPR+  S+WVGSDVC YTGVFCA APD+P ++TVA IDLNH DIAG+LPEELGLL+D+
Sbjct  93   VSDPRDQISNWVGSDVCKYTGVFCAQAPDDPSVQTVAGIDLNHADIAGFLPEELGLLSDI  152

Query  549  GVFH  560
             +FH
Sbjct  153  ALFH  156



>emb|CDY42885.1| BnaC08g46890D [Brassica napus]
Length=407

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 92/112 (82%), Gaps = 4/112 (4%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            +G LSDSEV +IQRRQLL    EF +R + V VDPSL FEN R+RNAYIALQAWKQAI S
Sbjct  25   HGTLSDSEVRHIQRRQLL----EFAERSQNVIVDPSLVFENPRLRNAYIALQAWKQAIFS  80

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEEL  530
            DP N T++W+GS+VCNYTGVFC+PA DN +I TVA I+LNH DIAGYLPEEL
Sbjct  81   DPFNFTANWIGSNVCNYTGVFCSPALDNRRIPTVAGINLNHADIAGYLPEEL  132



>ref|XP_009348443.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Pyrus 
x bretschneideri]
Length=745

 Score =   171 bits (432),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 82/124 (66%), Positives = 96/124 (77%), Gaps = 3/124 (2%)
 Frame = +3

Query  195  NGPLSDSE--VHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAI  368
            N  L DS   +HY QR QLLYY D  G RG  VT   SL FEN R+R+AY ALQAWK+A+
Sbjct  34   NAGLRDSSHTLHYKQR-QLLYYTDHHGSRGVTVTAAGSLVFENPRLRSAYTALQAWKRAM  92

Query  369  ISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADL  548
            +SDPR+ TS+WVGSDVC YTGVFCA APD+P ++TVA IDLNH DIAG+LPEELGLL D+
Sbjct  93   VSDPRDQTSNWVGSDVCKYTGVFCAQAPDDPSVQTVAGIDLNHADIAGFLPEELGLLLDI  152

Query  549  GVFH  560
             +FH
Sbjct  153  ALFH  156



>ref|XP_008337109.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 3 [Malus domestica]
Length=480

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 92/118 (78%), Gaps = 1/118 (1%)
 Frame = +3

Query  207  SDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRN  386
            S   +HY QR QLLYY D  G RG  VT   SL FEN R+R+AY ALQAWK+A++SDP +
Sbjct  40   SSHTLHYKQR-QLLYYTDHHGSRGVTVTAAGSLVFENPRLRSAYTALQAWKRAMVSDPWD  98

Query  387  TTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
             TS+WVGSDVC YTGVFCA APD+P ++TVA IDLNH DIAG+LPEELGLL D+ +FH
Sbjct  99   QTSNWVGSDVCKYTGVFCAQAPDDPSVQTVAGIDLNHADIAGFLPEELGLLLDIALFH  156



>gb|KFK28537.1| hypothetical protein AALP_AA7G009800 [Arabis alpina]
Length=738

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 94/118 (80%), Gaps = 4/118 (3%)
 Frame = +3

Query  207  SDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRN  386
            SD EV  I +RQLL    +F DR E V VDPSL FEN R+RNAYIALQAWKQAI+SDP N
Sbjct  24   SDKEVRLIGQRQLL----QFHDRSENVVVDPSLVFENPRLRNAYIALQAWKQAILSDPNN  79

Query  387  TTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
             T++W GS+VC+YTGV+C+PA DN +IRTVA IDLNH DIAGYLP +LGLL DL +FH
Sbjct  80   FTTNWFGSNVCSYTGVYCSPALDNNRIRTVAGIDLNHADIAGYLPRDLGLLTDLALFH  137



>ref|XP_010925096.1| PREDICTED: leucine-rich repeat extensin-like protein 4, partial 
[Elaeis guineensis]
Length=441

 Score =   162 bits (409),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  383
            L+D+E  YI+RRQLL YRD+ G RGE VTVDP+  F N R+RNAYIALQAWK AI SDP 
Sbjct  34   LTDAEAGYIRRRQLLTYRDQLGGRGENVTVDPTFVFPNPRLRNAYIALQAWKLAIFSDPL  93

Query  384  NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEE  527
            N T++WVG DVCNYT V+CAP P +P +  VA IDLNH DIAGYLP+E
Sbjct  94   NLTANWVGPDVCNYTSVYCAPLPSDPHLTVVAGIDLNHGDIAGYLPDE  141



>ref|XP_010926371.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Elaeis 
guineensis]
Length=791

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  383
            L+D+E   I++RQLLYYRDEFGDRGE VTVDPSL F N  +R+AYIALQAWK AIISDP 
Sbjct  32   LTDAEAGLIRQRQLLYYRDEFGDRGESVTVDPSLNFPNSHLRDAYIALQAWKLAIISDPL  91

Query  384  NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            N T++WVGSDVC+YTGVFCAP P +P +  VA IDLNH  IAG LPE+LGLL DLG+FH
Sbjct  92   NLTANWVGSDVCSYTGVFCAPLPSDPHLIVVAGIDLNHARIAGTLPEDLGLLTDLGLFH  150



>ref|XP_008219840.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Prunus 
mume]
Length=559

 Score =   162 bits (411),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 73/122 (60%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            N  L + ++ +I +RQLL+Y D+ G RGE V V  SL F N R+R+AY+ALQAWKQA++S
Sbjct  29   NAGLRELKLSHINQRQLLFYTDQDGSRGELVAVPSSLVFHNPRLRSAYVALQAWKQAMLS  88

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP   TS+WVGS++C+YTGVFC+ A D+P + TVA IDLNH  IAGYLPEELGLL+D+ +
Sbjct  89   DPLGETSNWVGSNICSYTGVFCSRALDDPSVETVAGIDLNHGGIAGYLPEELGLLSDIAL  148

Query  555  FH  560
            FH
Sbjct  149  FH  150



>ref|XP_007227690.1| hypothetical protein PRUPE_ppa1027218m2g, partial [Prunus persica]
 gb|EMJ28889.1| hypothetical protein PRUPE_ppa1027218m2g, partial [Prunus persica]
Length=413

 Score =   159 bits (401),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = +3

Query  210  DSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNT  389
            +SE    + RQLL+Y D+ G RGE V V  SL F N R+R+AY+ALQAWKQA++SDP   
Sbjct  5    ESEPSQKKTRQLLFYTDQDGSRGELVAVPSSLVFHNPRLRSAYVALQAWKQAMLSDPLGQ  64

Query  390  TSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            TS+WVGS+VC+YTGVFC+ A D+P + TVA IDLNH  IAGYLPEELGLL+D+ +FH
Sbjct  65   TSNWVGSNVCSYTGVFCSRALDDPSVETVAGIDLNHGGIAGYLPEELGLLSDIALFH  121



>ref|XP_006842252.1| hypothetical protein AMTR_s00078p00197410 [Amborella trichopoda]
 gb|ERN03927.1| hypothetical protein AMTR_s00078p00197410 [Amborella trichopoda]
Length=874

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  383
            L+ +E   I+ RQLLYY D +GDRGE V VDPS  FEN R+R AYIALQAWK AIISDP 
Sbjct  76   LTFAEASSIKHRQLLYYIDRYGDRGESVFVDPSFEFENSRLREAYIALQAWKMAIISDPM  135

Query  384  NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            N T +W+G  VCNYTGVFC+ + D   +  VA IDLNH DIAGYLP+ELG L DL + H
Sbjct  136  NITGNWIGPIVCNYTGVFCSKSLDGLNLTVVAGIDLNHSDIAGYLPDELGKLTDLALLH  194



>ref|XP_004292960.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Fragaria 
vesca subsp. vesca]
Length=524

 Score =   158 bits (399),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 90/113 (80%), Gaps = 1/113 (1%)
 Frame = +3

Query  225  YIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQ-AIISDPRNTTSDW  401
            +I++RQLL+Y+D    RGE VTV PSL F N RIR AYIALQAWKQ A++SDP   T++W
Sbjct  39   HIKQRQLLHYKDNNCSRGETVTVPPSLVFPNPRIRTAYIALQAWKQIAMLSDPLGYTANW  98

Query  402  VGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            VGS+VCNYTGVFCA A D+P I TVA IDLNH DIAGYLP ELG L+D+ +FH
Sbjct  99   VGSNVCNYTGVFCAQALDDPTIETVAGIDLNHADIAGYLPVELGHLSDITLFH  151



>ref|XP_011026539.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X2 [Populus euphratica]
Length=502

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 86/109 (79%), Gaps = 0/109 (0%)
 Frame = +3

Query  234  RRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSD  413
            +RQLLYYR+E     E + + P L F+N R+R+AYIALQAWKQAIISDP N TS+W G D
Sbjct  53   QRQLLYYREELDVEDEYLMLPPCLKFDNPRLRSAYIALQAWKQAIISDPLNLTSNWAGPD  112

Query  414  VCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            VCNYTGVFCA A DN  I+TVA IDLNH D+AG+L EELGLLAD+ +FH
Sbjct  113  VCNYTGVFCATALDNSSIQTVAGIDLNHGDMAGHLVEELGLLADIALFH  161



>ref|XP_011026538.1| PREDICTED: leucine-rich repeat extensin-like protein 4 isoform 
X1 [Populus euphratica]
Length=614

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 86/109 (79%), Gaps = 0/109 (0%)
 Frame = +3

Query  234  RRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSD  413
            +RQLLYYR+E     E + + P L F+N R+R+AYIALQAWKQAIISDP N TS+W G D
Sbjct  53   QRQLLYYREELDVEDEYLMLPPCLKFDNPRLRSAYIALQAWKQAIISDPLNLTSNWAGPD  112

Query  414  VCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            VCNYTGVFCA A DN  I+TVA IDLNH D+AG+L EELGLLAD+ +FH
Sbjct  113  VCNYTGVFCATALDNSSIQTVAGIDLNHGDMAGHLVEELGLLADIALFH  161



>gb|KJB27056.1| hypothetical protein B456_004G274900 [Gossypium raimondii]
Length=462

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 87/112 (78%), Gaps = 2/112 (2%)
 Frame = +3

Query  231  QRRQLLYYRDEFGDRGERVTVDPS--LTFENDRIRNAYIALQAWKQAIISDPRNTTSDWV  404
             RR++ YY  EF    +  +V PS  LTF+N R++ AYIALQAWKQAIISDP N TSDWV
Sbjct  31   NRRRVFYYGGEFKSGADFDSVLPSSSLTFDNPRLKTAYIALQAWKQAIISDPLNLTSDWV  90

Query  405  GSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            GS+VCNYTGVFC+PA D+P I TVA IDLNH DI+G LPEELGLL D+ +FH
Sbjct  91   GSNVCNYTGVFCSPALDDPAIITVAGIDLNHGDISGTLPEELGLLNDIALFH  142



>ref|XP_004512856.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Cicer 
arietinum]
Length=642

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +3

Query  294  DPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRT  473
            DPSL FEN+RIRNAYIA QAWKQAI+SDP+N T++WVGS+VC+YTGV+CA A DNP IRT
Sbjct  39   DPSLVFENNRIRNAYIAFQAWKQAILSDPQNFTTNWVGSNVCSYTGVYCAQALDNPNIRT  98

Query  474  VASIDLNHDDIAGYLPEELGLLADLGVFH  560
            VA IDLNH DIAGYLP+ELGLL DL +FH
Sbjct  99   VAGIDLNHADIAGYLPDELGLLVDLALFH  127



>ref|XP_002324259.1| hypothetical protein POPTR_0018s01010g [Populus trichocarpa]
 gb|EEF02824.1| hypothetical protein POPTR_0018s01010g [Populus trichocarpa]
Length=496

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = +3

Query  231  QRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGS  410
             +RQLLYYR+E     E + + P L F+N R+R+AYIALQAWKQAIISDP N TS+W G 
Sbjct  44   NQRQLLYYREELDVEDEYLMLPPCLKFDNPRLRSAYIALQAWKQAIISDPLNLTSNWAGP  103

Query  411  DVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            DVCNYTGVFCA A D+  I+TVA IDLNH D+AG+L EELGLL D+ +FH
Sbjct  104  DVCNYTGVFCATALDDSSIQTVAGIDLNHGDMAGHLVEELGLLTDIALFH  153



>ref|XP_008366033.1| PREDICTED: LOW QUALITY PROTEIN: pollen-specific leucine-rich 
repeat extensin-like protein 3 [Malus domestica]
Length=922

 Score =   153 bits (387),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 73/120 (61%), Positives = 91/120 (76%), Gaps = 1/120 (1%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGER-VTVDPSLTFENDRIRNAYIALQAWKQAIISDP  380
            L+D+EV  I RRQLL++ +    R E+   V+ ++TF + R+R AYIALQAWK+AI SDP
Sbjct  151  LTDAEVSSITRRQLLHFHEGDDQRDEKEYEVELNVTFPHTRLRRAYIALQAWKKAIYSDP  210

Query  381  RNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
              TT +WVG DVC YTGVFCAPA D+PKI  VA ID+NH DIAGYLP ELGLL+D+ +FH
Sbjct  211  LKTTENWVGGDVCAYTGVFCAPALDDPKIEVVAGIDINHADIAGYLPVELGLLSDIALFH  270



>ref|XP_008776836.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Phoenix 
dactylifera]
 ref|XP_008779029.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Phoenix 
dactylifera]
Length=640

 Score =   150 bits (379),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 88/118 (75%), Gaps = 7/118 (6%)
 Frame = +3

Query  210  DSEVHYIQRR-QLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRN  386
            D+   YI+RR QLL YR      GE V VDP+  F N R+R+AYIALQAWK AIISDP N
Sbjct  30   DAAAGYIRRRRQLLTYR------GENVAVDPTFAFPNLRLRDAYIALQAWKLAIISDPLN  83

Query  387  TTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
             T++WVG +VCNYTGV+C P P +P +  VA +DLNH D+AGYLP+ELGLL+DL +FH
Sbjct  84   LTANWVGPNVCNYTGVYCGPLPSDPHLTVVAGVDLNHGDVAGYLPDELGLLSDLALFH  141



>ref|XP_011019702.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X4 [Populus euphratica]
Length=469

 Score =   149 bits (375),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 89/122 (73%), Gaps = 1/122 (1%)
 Frame = +3

Query  198  GPLSDSEVHYIQ-RRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            GP     +H  Q +R LL+YR+E     E + +   L F+N R+R+AYIALQAWK AIIS
Sbjct  32   GPRDSQTIHIKQSQRHLLHYREELDIEDEYLMLPACLKFDNPRLRSAYIALQAWKLAIIS  91

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N TS+WVGSDVC+YTGVFCA + DN  I+TVA IDLNH D+AG+L EELGLL D+ +
Sbjct  92   DPLNLTSNWVGSDVCSYTGVFCATSLDNSSIQTVAGIDLNHGDMAGHLVEELGLLTDIAL  151

Query  555  FH  560
            FH
Sbjct  152  FH  153



>ref|XP_011019700.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X2 [Populus euphratica]
 ref|XP_011019701.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X3 [Populus euphratica]
Length=482

 Score =   149 bits (375),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 89/122 (73%), Gaps = 1/122 (1%)
 Frame = +3

Query  198  GPLSDSEVHYIQ-RRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            GP     +H  Q +R LL+YR+E     E + +   L F+N R+R+AYIALQAWK AIIS
Sbjct  32   GPRDSQTIHIKQSQRHLLHYREELDIEDEYLMLPACLKFDNPRLRSAYIALQAWKLAIIS  91

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N TS+WVGSDVC+YTGVFCA + DN  I+TVA IDLNH D+AG+L EELGLL D+ +
Sbjct  92   DPLNLTSNWVGSDVCSYTGVFCATSLDNSSIQTVAGIDLNHGDMAGHLVEELGLLTDIAL  151

Query  555  FH  560
            FH
Sbjct  152  FH  153



>ref|XP_008458675.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Cucumis melo]
Length=677

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 91/121 (75%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYR--DEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            +S++E  Y+ RRQLL  +  DE  D   +  +D + TF N+R++ AY+ALQAWK AI SD
Sbjct  44   ISEAEASYLTRRQLLALKEHDELPDD-FKYQLDIADTFPNERLKMAYVALQAWKLAIYSD  102

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P+N T++WVG+DVC+YTGVFCAPA DNP I  VA IDLNH DIAGYLP ELGLL DL +F
Sbjct  103  PQNMTANWVGADVCSYTGVFCAPALDNPNIEVVAGIDLNHGDIAGYLPPELGLLTDLALF  162

Query  558  H  560
            H
Sbjct  163  H  163



>ref|XP_011019699.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X1 [Populus euphratica]
Length=492

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 89/122 (73%), Gaps = 1/122 (1%)
 Frame = +3

Query  198  GPLSDSEVHYIQ-RRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            GP     +H  Q +R LL+YR+E     E + +   L F+N R+R+AYIALQAWK AIIS
Sbjct  32   GPRDSQTIHIKQSQRHLLHYREELDIEDEYLMLPACLKFDNPRLRSAYIALQAWKLAIIS  91

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV  554
            DP N TS+WVGSDVC+YTGVFCA + DN  I+TVA IDLNH D+AG+L EELGLL D+ +
Sbjct  92   DPLNLTSNWVGSDVCSYTGVFCATSLDNSSIQTVAGIDLNHGDMAGHLVEELGLLTDIAL  151

Query  555  FH  560
            FH
Sbjct  152  FH  153



>ref|XP_008458676.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3, partial [Cucumis melo]
Length=568

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 90/121 (74%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYR--DEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            +S+ E  Y+ RRQLL  +  DE  +   +  +D + TF N+R++ AY+ALQAWK AI SD
Sbjct  27   ISEVEASYLTRRQLLTLKQHDELPND-FKYKLDIADTFPNERLKMAYVALQAWKLAIYSD  85

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P+N T++WVG+DVC+YTGVFCAPA DNP I  VA IDLNH DIAGYLP ELGLL DL +F
Sbjct  86   PQNMTANWVGADVCSYTGVFCAPALDNPNIEVVAGIDLNHGDIAGYLPPELGLLTDLALF  145

Query  558  H  560
            H
Sbjct  146  H  146



>ref|XP_009613983.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Nicotiana 
tomentosiformis]
Length=533

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 86/115 (75%), Gaps = 6/115 (5%)
 Frame = +3

Query  216  EVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTS  395
            ++ Y  RR+LL Y       G+ + ++PSL FEN R++NAYIALQAWK+AI+SDP N T+
Sbjct  46   DIEYTNRRKLLSYN------GDILAINPSLNFENFRLKNAYIALQAWKEAILSDPHNITA  99

Query  396  DWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            +W+GS+VCNYTGVFC P+ D P   TVA ID+NH DIAG LP ELGLL D+ +FH
Sbjct  100  NWIGSNVCNYTGVFCWPSLDEPSELTVAGIDINHGDIAGTLPHELGLLYDIALFH  154



>ref|XP_010251965.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Nelumbo 
nucifera]
Length=734

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 90/121 (74%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGE--RVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            LS++EV +I  RQLL    E GD  E     VD +LTF N R+R AYIALQAWK+AI+SD
Sbjct  25   LSEAEVSFIAHRQLLSL-PENGDLPENYEYQVDVNLTFPNARLRRAYIALQAWKEAIVSD  83

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P   T+ WVG+DVC+Y GVFCAPAPD+PK   VA +DLN+ D+AG+LP ELGL++DL +F
Sbjct  84   PHKITTSWVGADVCDYKGVFCAPAPDDPKSTVVAGVDLNNADLAGFLPVELGLMSDLALF  143

Query  558  H  560
            H
Sbjct  144  H  144



>ref|XP_010107567.1| Leucine-rich repeat extensin-like protein 2 [Morus notabilis]
 gb|EXC16249.1| Leucine-rich repeat extensin-like protein 2 [Morus notabilis]
Length=789

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +3

Query  270  DRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPA  449
            D  + V VDP+L FEN R+R AYIALQAWKQAI SDP N T++W G+DVC+Y+GVFCAP 
Sbjct  32   DENDVVRVDPTLNFENPRLRRAYIALQAWKQAIFSDPLNFTANWNGADVCSYSGVFCAPF  91

Query  450  PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            P NPK+R V+ +DLNH DIAGYLP ELGLL+DL +FH
Sbjct  92   PANPKLRVVSGVDLNHADIAGYLPPELGLLSDLALFH  128



>ref|XP_004173261.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1-like, partial [Cucumis sativus]
Length=487

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 90/120 (75%), Gaps = 1/120 (1%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGE-RVTVDPSLTFENDRIRNAYIALQAWKQAIISDP  380
            LS++E  Y+ RRQLL  +  +    + +  +D + TF N+R++ AY ALQAWK A+ SDP
Sbjct  44   LSEAEASYLTRRQLLTLKKHYELPDDFQYELDIADTFPNERLKKAYRALQAWKLAVYSDP  103

Query  381  RNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            +N T++WVG+DVC+YTGVFCAPA D+PKI  VA IDLNH DIAG+LP ELGLL DL +FH
Sbjct  104  QNMTANWVGADVCSYTGVFCAPALDDPKIEVVAGIDLNHGDIAGHLPPELGLLTDLALFH  163



>ref|XP_008225431.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Prunus mume]
Length=934

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 91/120 (76%), Gaps = 1/120 (1%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGE-RVTVDPSLTFENDRIRNAYIALQAWKQAIISDP  380
            L+D+E  ++  RQLL++   +  RG+    V+ +L F + R+R+AY+ALQAWK+AI SDP
Sbjct  23   LTDAEASFVAHRQLLHFHASYDLRGDHEYEVELNLKFPHPRLRSAYVALQAWKKAIYSDP  82

Query  381  RNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
              TT +WVG++VC YTGVFCAPA D+P++  VA ID+NH DIAGYLP ELG+L+D+ VFH
Sbjct  83   LKTTENWVGANVCAYTGVFCAPALDDPQLEVVAGIDINHADIAGYLPVELGMLSDIAVFH  142



>tpg|DAA58808.1| TPA: leucine-rich repeat (LRR) family protein, partial [Zea mays]
Length=555

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 86/119 (72%), Gaps = 0/119 (0%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  383
            LS S+  +I+RRQLL Y       G  V VDPS  F N R+R+AY+ALQAW++AI+SDP 
Sbjct  35   LSASDAAHIRRRQLLQYHGGGAGNGSGVVVDPSYAFPNPRLRDAYVALQAWRRAILSDPH  94

Query  384  NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            N T  W G DVC Y GV+CAP+P +P +  VAS+DLNH D+AG+LPEELGLLADL V H
Sbjct  95   NVTGSWTGPDVCAYAGVYCAPSPQDPDLTVVASVDLNHADLAGHLPEELGLLADLAVLH  153



>ref|XP_008458201.1| PREDICTED: LOW QUALITY PROTEIN: pollen-specific leucine-rich 
repeat extensin-like protein 3 [Cucumis melo]
Length=636

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 90/125 (72%), Gaps = 11/125 (9%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYR------DEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQA  365
            +S++E  Y+ RRQLL  +      D+F     +  +D   TF N+R++ AY+ALQAWK A
Sbjct  31   ISEAEASYLTRRQLLALKAHGELPDDF-----KYELDIPDTFPNERLKKAYVALQAWKLA  85

Query  366  IISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLAD  545
            + SDP+N T++WVG+DVC+Y GVFCAPA D+PKI  VA IDLNH DIAGYLP ELGLL D
Sbjct  86   VYSDPQNMTANWVGADVCSYIGVFCAPALDDPKIEVVAGIDLNHGDIAGYLPPELGLLTD  145

Query  546  LGVFH  560
            L +FH
Sbjct  146  LALFH  150



>gb|KDP27758.1| hypothetical protein JCGZ_19787 [Jatropha curcas]
Length=732

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = +3

Query  270  DRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPA  449
            D    + VDP+  F+N R+R AYIALQAWKQAI SDP N T++W G DVC+Y GVFCAP 
Sbjct  27   DEPLAIHVDPTFKFDNPRLRQAYIALQAWKQAIYSDPFNFTANWNGPDVCSYLGVFCAPF  86

Query  450  PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            P NPKIR VA IDLNH DIAGYLP ELGLL DL +FH
Sbjct  87   PKNPKIRVVAGIDLNHADIAGYLPPELGLLTDLALFH  123



>ref|XP_007017392.1| Leucine-rich repeat family protein [Theobroma cacao]
 gb|EOY14617.1| Leucine-rich repeat family protein [Theobroma cacao]
Length=911

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 85/121 (70%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGE--RVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            LSDSEV +I RRQLL    E GD        V+ +LTFEN R+R AYIALQA K AI SD
Sbjct  32   LSDSEVAFIARRQLLTL-PENGDLPHDYEYNVELNLTFENSRLRRAYIALQALKHAIYSD  90

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P  TT +W G  VCNY GVFCAPA D+PK+  VA IDLNH DIAGYLP ELGLL DL +F
Sbjct  91   PLKTTQNWKGPKVCNYKGVFCAPAVDDPKLMVVAGIDLNHADIAGYLPVELGLLTDLALF  150

Query  558  H  560
            H
Sbjct  151  H  151



>ref|XP_006848210.1| hypothetical protein AMTR_s00029p00242610 [Amborella trichopoda]
 gb|ERN09791.1| hypothetical protein AMTR_s00029p00242610 [Amborella trichopoda]
Length=258

 Score =   139 bits (351),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 86/121 (71%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRD--EFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            ++D+E  +I  RQLL+ R+  +  D  E   VD +LTF N R+R AYIAL  WK+AI SD
Sbjct  25   VTDTEARFIAGRQLLHLREGEDLPDDLE-FHVDTNLTFPNPRLRRAYIALHTWKEAIFSD  83

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P N TS+W G+DVC+Y GVFCAPA D+P I  VA IDLNH DIAGYLP E+GLL DL + 
Sbjct  84   PYNVTSNWEGADVCSYKGVFCAPALDDPSIDVVAGIDLNHADIAGYLPPEIGLLTDLALL  143

Query  558  H  560
            H
Sbjct  144  H  144



>ref|XP_004173016.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1-like, partial [Cucumis sativus]
Length=294

 Score =   140 bits (353),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 88/121 (73%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYR--DEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            +S +EV YI +RQLL  +  D+  D   +  +D   TF N+R++ AY+ALQAWK A+ SD
Sbjct  33   VSQAEVSYITQRQLLTLKEHDQLPDDF-KYELDIPDTFPNERLKKAYVALQAWKLAVYSD  91

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P+N T +WVG++VC+Y GVFCAPA D+PKI  VA IDLN  DIAGYLP ELGLL DL +F
Sbjct  92   PKNMTVNWVGANVCSYNGVFCAPALDDPKIEVVAGIDLNDGDIAGYLPPELGLLTDLALF  151

Query  558  H  560
            H
Sbjct  152  H  152



>gb|KGN45680.1| hypothetical protein Csa_6G006180 [Cucumis sativus]
Length=617

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 91/120 (76%), Gaps = 1/120 (1%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGE-RVTVDPSLTFENDRIRNAYIALQAWKQAIISDP  380
            LS++E  Y+ RR+LL  ++ +    + +  +D + TF N+R++ AY ALQAWK A+ SDP
Sbjct  31   LSEAEASYLTRRRLLTLKNHYELPDDFQYELDIADTFPNERLKKAYRALQAWKLAVYSDP  90

Query  381  RNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            +N T++WVG+DVC+YTGVFCAPA D+PKI  VA IDLNH DIAG+LP ELGLL DL +FH
Sbjct  91   QNMTANWVGADVCSYTGVFCAPALDDPKIEVVAGIDLNHGDIAGHLPPELGLLTDLALFH  150



>ref|XP_002455880.1| hypothetical protein SORBIDRAFT_03g026730 [Sorghum bicolor]
 gb|EES01000.1| hypothetical protein SORBIDRAFT_03g026730 [Sorghum bicolor]
Length=613

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 86/121 (71%), Gaps = 0/121 (0%)
 Frame = +3

Query  198  GPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            G LS S+  +I+RRQLL Y ++ G     V VD S  F N R+R+AY+ALQAWK+AI+SD
Sbjct  35   GGLSASDAAHIRRRQLLQYHNDDGSDDGGVVVDASYAFPNPRLRDAYVALQAWKRAILSD  94

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P N T  W G DVC Y GV+CAP+P +P +  VAS+DLNH D+AG+LPE LG LADL V 
Sbjct  95   PYNVTGSWSGPDVCAYGGVYCAPSPQDPGLTVVASVDLNHADLAGHLPEALGRLADLAVL  154

Query  558  H  560
            H
Sbjct  155  H  155



>ref|XP_003629650.1| Receptor-like protein kinase [Medicago truncatula]
Length=661

 Score =   144 bits (364),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +3

Query  294  DPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRT  473
            +PSL FEN+RI+NAYIALQA KQAI+SDP N T++WVGS+VC+YTG++CA A DNP IRT
Sbjct  29   NPSLVFENNRIQNAYIALQALKQAILSDPLNFTTNWVGSNVCSYTGIYCAQALDNPNIRT  88

Query  474  VASIDLNHDDIAGYLPEELGLLADLGVFH  560
            VA IDLNH DIAGYLP+ELGLL DL +FH
Sbjct  89   VAGIDLNHADIAGYLPDELGLLTDLALFH  117



>ref|XP_003630813.1| Extensin-like protein [Medicago truncatula]
 gb|AET05289.1| LRR extensin-like protein [Medicago truncatula]
Length=712

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +3

Query  294  DPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRT  473
            +PSL FEN+RI+NAYIALQA KQAI+SDP N T++WVGS+VC+YTG++CA A DNP IRT
Sbjct  29   NPSLVFENNRIQNAYIALQALKQAILSDPLNFTTNWVGSNVCSYTGIYCAQALDNPNIRT  88

Query  474  VASIDLNHDDIAGYLPEELGLLADLGVFH  560
            VA IDLNH DIAGYLP+ELGLL DL +FH
Sbjct  89   VAGIDLNHADIAGYLPDELGLLTDLALFH  117



>gb|KGN45681.1| hypothetical protein Csa_6G006190 [Cucumis sativus]
Length=761

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 90/121 (74%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYR--DEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            LS++E  Y+ RRQLL  +  DE      +  +D   TF N+R++ AY+ALQAWK A+ SD
Sbjct  31   LSEAEASYLTRRQLLTLKNYDEL-PLDFQYELDIPDTFPNERLKKAYVALQAWKLAVYSD  89

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P+N T++WVG+DVC+YTGVFCAPA D+PKI  VA IDLNH DIAG+LP ELGLL DL +F
Sbjct  90   PQNMTANWVGADVCSYTGVFCAPALDDPKIEVVAGIDLNHGDIAGHLPPELGLLTDLALF  149

Query  558  H  560
            H
Sbjct  150  H  150



>ref|XP_011081863.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Sesamum 
indicum]
Length=525

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 85/119 (71%), Gaps = 6/119 (5%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  383
            +S++   + Q R+LL Y       G+ +  +PS  FEN R+ NAYIALQAWK+ I+SDP+
Sbjct  38   VSEAADDFHQHRRLLSYN------GDPLATEPSHKFENPRLENAYIALQAWKETILSDPK  91

Query  384  NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            N T++WVG DVCNY GVFC PAPDN   RTVA ID+NH DIAG LP ELGLL DL +FH
Sbjct  92   NMTTNWVGPDVCNYKGVFCWPAPDNTCERTVAGIDINHADIAGSLPHELGLLFDLALFH  150



>gb|KJB74831.1| hypothetical protein B456_012G009700 [Gossypium raimondii]
Length=602

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +3

Query  291  VDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIR  470
            VDP+L FEN R+R AYIALQAWK AI SDP N T++W GSDVC+Y G++CAP+P NPKIR
Sbjct  31   VDPNLRFENPRLREAYIALQAWKSAIFSDPFNFTANWNGSDVCSYMGIYCAPSPSNPKIR  90

Query  471  TVASIDLNHDDIAGYLPEELGLLADLGVFH  560
             VA IDLNH DIAGYLP ELG L DL +FH
Sbjct  91   VVAGIDLNHADIAGYLPPELGRLTDLALFH  120



>ref|XP_011019927.1| PREDICTED: leucine-rich repeat extensin-like protein 2 [Populus 
euphratica]
Length=773

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +3

Query  270  DRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPA  449
            D    + V+P+L FEN RIR AYIALQ+WKQAI SDP N T++W GSDVC+Y G+FCAP+
Sbjct  36   DEDHDIDVNPNLKFENPRIRRAYIALQSWKQAIHSDPFNFTANWKGSDVCSYMGIFCAPS  95

Query  450  PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            P N K+R VA IDLNH DIAGYLP ELGLL DL +FH
Sbjct  96   PQNKKVRVVAGIDLNHADIAGYLPTELGLLTDLALFH  132



>gb|KJB74832.1| hypothetical protein B456_012G009700 [Gossypium raimondii]
Length=709

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +3

Query  291  VDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIR  470
            VDP+L FEN R+R AYIALQAWK AI SDP N T++W GSDVC+Y G++CAP+P NPKIR
Sbjct  31   VDPNLRFENPRLREAYIALQAWKSAIFSDPFNFTANWNGSDVCSYMGIYCAPSPSNPKIR  90

Query  471  TVASIDLNHDDIAGYLPEELGLLADLGVFH  560
             VA IDLNH DIAGYLP ELG L DL +FH
Sbjct  91   VVAGIDLNHADIAGYLPPELGRLTDLALFH  120



>ref|XP_004138582.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1-like [Cucumis sativus]
Length=613

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 89/121 (74%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYR--DEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            LS++E  Y+ RRQLL  +  DE      +  +D   TF N+R++ AY ALQAWK A+ SD
Sbjct  31   LSEAEASYLTRRQLLTLKNYDEL-PLDFQYELDIPDTFPNERLKKAYRALQAWKLAVYSD  89

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P+N T++WVG+DVC+YTGVFCAPA D+PKI  VA IDLNH DIAG+LP ELGLL DL +F
Sbjct  90   PQNMTANWVGADVCSYTGVFCAPALDDPKIEVVAGIDLNHGDIAGHLPPELGLLTDLALF  149

Query  558  H  560
            H
Sbjct  150  H  150



>sp|O48809.1|LRX2_ARATH RecName: Full=Leucine-rich repeat extensin-like protein 2; Short=AtLRX2; 
Short=LRR/EXTENSIN2; AltName: Full=Cell wall hydroxyproline-rich 
glycoprotein; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD43602.1|AC005698_1 T3P18.1 [Arabidopsis thaliana]
 gb|AAF70841.1|AC003113_8 F24O1.18 [Arabidopsis thaliana]
Length=786

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +3

Query  285  VTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPK  464
            + VDPSL FEN  +R AYIALQ+WKQAI SDP N T++W GSDVC+Y G+FCAP+P +PK
Sbjct  40   IKVDPSLKFENPSLRQAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGIFCAPSPSSPK  99

Query  465  IRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
             R VA IDLNH D+AGYLP ELGLL DL +FH
Sbjct  100  TRVVAGIDLNHADMAGYLPRELGLLTDLALFH  131



>ref|XP_006372265.1| hypothetical protein POPTR_0018s14790g [Populus trichocarpa]
 gb|ERP50062.1| hypothetical protein POPTR_0018s14790g [Populus trichocarpa]
Length=461

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +3

Query  285  VTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPK  464
            + VD +L FEN RIR AYIALQ+WKQAI SDP N T++W GSDVC+Y GVFCAP+P N K
Sbjct  35   INVDSTLKFENPRIRRAYIALQSWKQAIFSDPFNFTANWNGSDVCSYMGVFCAPSPKNKK  94

Query  465  IRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            IR VA IDLNH DIAGYLP ELGL+ DL + H
Sbjct  95   IRVVAGIDLNHADIAGYLPTELGLIIDLALLH  126



>ref|XP_009798822.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Nicotiana 
sylvestris]
Length=540

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 83/114 (73%), Gaps = 6/114 (5%)
 Frame = +3

Query  219  VHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSD  398
            + Y  RR+LL Y       G+ + ++PSL F N R++NAYIALQAWK+A +SDP N T++
Sbjct  47   IEYTNRRKLLSYN------GDILAINPSLNFGNLRLKNAYIALQAWKEATLSDPHNITAN  100

Query  399  WVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            W+GS+VCNYTGVFC P+ D P   TVA ID+NH DIAG LP ELGLL D+ +FH
Sbjct  101  WIGSNVCNYTGVFCWPSLDEPSELTVAGIDINHGDIAGTLPHELGLLYDIALFH  154



>ref|NP_176434.1| leucine-rich repeat extensin-like protein 2 [Arabidopsis thaliana]
 gb|AEE33968.1| leucine-rich repeat/extensin 2 [Arabidopsis thaliana]
Length=826

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +3

Query  285  VTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPK  464
            + VDPSL FEN  +R AYIALQ+WKQAI SDP N T++W GSDVC+Y G+FCAP+P +PK
Sbjct  80   IKVDPSLKFENPSLRQAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGIFCAPSPSSPK  139

Query  465  IRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
             R VA IDLNH D+AGYLP ELGLL DL +FH
Sbjct  140  TRVVAGIDLNHADMAGYLPRELGLLTDLALFH  171



>ref|XP_007014601.1| Leucine-rich repeat/extensin 2 [Theobroma cacao]
 gb|EOY32220.1| Leucine-rich repeat/extensin 2 [Theobroma cacao]
Length=748

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +3

Query  285  VTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPK  464
            V VDP+L FEN R+R AYIALQAWK AI SDP N T++W G DVC+Y G++CAP+P NPK
Sbjct  36   VVVDPNLRFENPRLREAYIALQAWKSAIFSDPFNFTANWDGPDVCSYMGIYCAPSPSNPK  95

Query  465  IRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            IR VA IDLNH DIAGYLP ELG L DL +FH
Sbjct  96   IRVVAGIDLNHADIAGYLPPELGRLTDLALFH  127



>gb|KJB79255.1| hypothetical protein B456_013G040300 [Gossypium raimondii]
Length=511

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 87/121 (72%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRD--EFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            L+D E  YI RRQLL  R+  +  D G   TV  +  FEN+R+R A+IALQAWK+A+ SD
Sbjct  30   LTDVEQSYITRRQLLALRENGKLPD-GYEYTVKTTEKFENERLRRAFIALQAWKKAMYSD  88

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P+N TS+W G +VC+Y GV+C  A D+PK++ VA IDLNH DIAGYLP ELGLL D+ + 
Sbjct  89   PKNITSNWFGPNVCDYKGVYCVRAMDDPKLKVVAGIDLNHADIAGYLPVELGLLTDVALI  148

Query  558  H  560
            H
Sbjct  149  H  149



>ref|XP_004138583.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 4-like, partial [Cucumis sativus]
Length=517

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 88/121 (73%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYR--DEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            +S +EV YI +RQLL  +  D+  D   +  +D   TF N+R++ AY+ALQAWK A+ SD
Sbjct  7    VSQAEVSYITQRQLLTLKEHDQLPDDF-KYELDIPDTFPNERLKKAYVALQAWKLAVYSD  65

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P+N T +WVG++VC+Y GVFCAPA D+PKI  VA IDLN  DIAGYLP ELGLL DL +F
Sbjct  66   PKNMTVNWVGANVCSYNGVFCAPALDDPKIEVVAGIDLNDGDIAGYLPPELGLLTDLALF  125

Query  558  H  560
            H
Sbjct  126  H  126



>ref|XP_006406541.1| hypothetical protein EUTSA_v10022433mg, partial [Eutrema salsugineum]
 gb|ESQ47994.1| hypothetical protein EUTSA_v10022433mg, partial [Eutrema salsugineum]
Length=351

 Score =   139 bits (350),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 85/121 (70%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGE--RVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            L+D E  ++ RRQLL   +  GD  +     VD  L F N+R++ AYIALQAWK+A+ SD
Sbjct  31   LTDEEASFLTRRQLLALSEN-GDLPDDMEYEVDLDLNFANNRLKRAYIALQAWKKAVYSD  89

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P NTT++W G +VC+Y GVFCAPA D+  I  VA IDLNH DIAGYLP ELGLL D+ +F
Sbjct  90   PFNTTANWFGPNVCSYKGVFCAPALDDQSIMVVAGIDLNHADIAGYLPPELGLLTDVALF  149

Query  558  H  560
            H
Sbjct  150  H  150



>ref|XP_010466040.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Camelina sativa]
Length=920

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 87/121 (72%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGE--RVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            L+D E  ++ RRQLL    E GD  +     VD  L F+N+R++ AYIALQAWK+AI SD
Sbjct  31   LTDEEASFLTRRQLLALS-ENGDLPDDMEYEVDLDLKFDNNRLKRAYIALQAWKKAIYSD  89

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P NT ++WVG +VC+Y GVFCAPA D+P +  VA IDLNH DIAGYLP ELGLL D+ +F
Sbjct  90   PFNTAANWVGPNVCSYKGVFCAPALDDPSVMVVAGIDLNHADIAGYLPPELGLLTDVALF  149

Query  558  H  560
            H
Sbjct  150  H  150



>gb|EYU25784.1| hypothetical protein MIMGU_mgv1a026389mg, partial [Erythranthe 
guttata]
Length=390

 Score =   139 bits (351),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +3

Query  303  LTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVAS  482
            L+FEN  +R AYIALQAWKQ+I SDP N TSDW GSDVC+Y GVFCAPA  NP ++ VA 
Sbjct  41   LSFENPNLRQAYIALQAWKQSIFSDPFNFTSDWTGSDVCSYGGVFCAPATTNPSVKVVAG  100

Query  483  IDLNHDDIAGYLPEELGLLADLGVFH  560
            IDLNH DIAG+LPEELGLL DL +FH
Sbjct  101  IDLNHADIAGFLPEELGLLTDLALFH  126



>emb|CDY12948.1| BnaA09g13260D [Brassica napus]
Length=714

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  279  ERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDN  458
            + + VDPSL FEN  +R AYIALQ+WKQAI SDP N T++W GSDVC+Y GV+CAP+P  
Sbjct  36   DNIKVDPSLKFENPSLRQAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGVYCAPSPSR  95

Query  459  PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            PK R VA IDLNH D+AGYLP ELGLL DL +FH
Sbjct  96   PKTRVVAGIDLNHADMAGYLPPELGLLTDLALFH  129



>ref|XP_002888025.1| hypothetical protein ARALYDRAFT_475099 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64284.1| hypothetical protein ARALYDRAFT_475099 [Arabidopsis lyrata subsp. 
lyrata]
Length=713

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +3

Query  291  VDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIR  470
            VDPSL FEN  +R AYIALQ+WKQAI SDP N T++W GSDVC+Y G+FC+P+P +PK R
Sbjct  15   VDPSLKFENPSLRQAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGIFCSPSPSSPKTR  74

Query  471  TVASIDLNHDDIAGYLPEELGLLADLGVFH  560
             VA IDLNH D+AGYLP ELGLL DL +FH
Sbjct  75   VVAGIDLNHADMAGYLPRELGLLTDLALFH  104



>ref|XP_009113078.1| PREDICTED: leucine-rich repeat extensin-like protein 2 isoform 
X2 [Brassica rapa]
 ref|XP_009113079.1| PREDICTED: leucine-rich repeat extensin-like protein 2 isoform 
X3 [Brassica rapa]
Length=723

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  279  ERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDN  458
            + + VDPSL FEN  +R AYIALQ+WKQAI SDP N T++W GSDVC+Y GV+CAP+P  
Sbjct  36   DNIKVDPSLKFENPSLRQAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGVYCAPSPSR  95

Query  459  PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            PK R VA IDLNH D+AGYLP ELGLL DL +FH
Sbjct  96   PKTRVVAGIDLNHADMAGYLPPELGLLTDLALFH  129



>ref|XP_009113077.1| PREDICTED: leucine-rich repeat extensin-like protein 2 isoform 
X1 [Brassica rapa]
Length=737

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  279  ERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDN  458
            + + VDPSL FEN  +R AYIALQ+WKQAI SDP N T++W GSDVC+Y GV+CAP+P  
Sbjct  36   DNIKVDPSLKFENPSLRQAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGVYCAPSPSR  95

Query  459  PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            PK R VA IDLNH D+AGYLP ELGLL DL +FH
Sbjct  96   PKTRVVAGIDLNHADMAGYLPPELGLLTDLALFH  129



>ref|XP_002885290.1| hypothetical protein ARALYDRAFT_479420 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61549.1| hypothetical protein ARALYDRAFT_479420 [Arabidopsis lyrata subsp. 
lyrata]
Length=927

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 85/121 (70%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGE--RVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            L+D E  ++ RRQLL    E GD  +     VD  L F N+R++ AYIALQAWK+A  SD
Sbjct  26   LTDEEASFLTRRQLLAL-SENGDLPDDMEYEVDLDLKFANNRLKRAYIALQAWKKAFYSD  84

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P NT ++WVG DVC+Y GVFCAPA D+P +  VA IDLNH DIAGYLP ELGLL D+ +F
Sbjct  85   PFNTAANWVGPDVCSYKGVFCAPALDDPSVLVVAGIDLNHADIAGYLPPELGLLTDVALF  144

Query  558  H  560
            H
Sbjct  145  H  145



>ref|XP_010655031.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Vitis 
vinifera]
Length=737

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +3

Query  276  GERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPD  455
             + V VDP L FEN R+R AYIALQAWK AI SDP N TS+WVG  VC+Y GV+CAP+  
Sbjct  28   AQSVVVDPKLKFENPRLRQAYIALQAWKTAIFSDPFNFTSNWVGPQVCSYMGVYCAPSLS  87

Query  456  NPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            NP ++ VA IDLNH DIAGYLP ELGLL+DL +FH
Sbjct  88   NPSLKVVAGIDLNHADIAGYLPSELGLLSDLALFH  122



>ref|XP_009118117.1| PREDICTED: leucine-rich repeat extensin-like protein 1 [Brassica 
rapa]
Length=584

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 77/98 (79%), Gaps = 1/98 (1%)
 Frame = +3

Query  270  DRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPA  449
            D G+ + VDP L FEN ++R AYIALQ+WKQ I SDP N T+ W GSDVC+Y G++CAP+
Sbjct  28   DLGDHIKVDPKLKFENPKLREAYIALQSWKQTIFSDPFNFTATWNGSDVCSYNGIYCAPS  87

Query  450  PDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            P++ PK R VA IDLNH D+AGYLP ELGLL+DL +FH
Sbjct  88   PNSYPKTRVVAGIDLNHADMAGYLPAELGLLSDLALFH  125



>emb|CDO97126.1| unnamed protein product [Coffea canephora]
Length=608

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 84/124 (68%), Gaps = 6/124 (5%)
 Frame = +3

Query  207  SDSEVHYIQRRQLLYYR--DEFGDRG----ERVTVDPSLTFENDRIRNAYIALQAWKQAI  368
            +D+E  YI RRQLL +   D   + G         + + TFENDR++ AYIALQAWK+A 
Sbjct  29   TDAEATYIARRQLLTFSKLDHLSEGGILDSTNFDFELNFTFENDRLKKAYIALQAWKKAT  88

Query  369  ISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADL  548
             SDP NTT +W G DVC YTGVFCAPA D+P +  VA IDLNH DIAG+LP E+GLL D+
Sbjct  89   YSDPHNTTGNWDGPDVCQYTGVFCAPALDDPNVTVVAGIDLNHADIAGHLPVEIGLLTDI  148

Query  549  GVFH  560
             + H
Sbjct  149  SLLH  152



>ref|XP_010520859.1| PREDICTED: leucine-rich repeat extensin-like protein 7 [Tarenaya 
hassleriana]
Length=452

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 85/116 (73%), Gaps = 6/116 (5%)
 Frame = +3

Query  213  SEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTT  392
            + VH    RQLLY +D        V+V P L F N+R+  AY+ALQAWK+ +ISDP N T
Sbjct  22   ATVHGSGIRQLLYTKDG------PVSVPPFLIFGNERLERAYVALQAWKRVMISDPFNLT  75

Query  393  SDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            ++W GS VCNYTG+FC+P+ D+P I+TV+ IDLNH DIAG+LP+ELGLL D+ +FH
Sbjct  76   ANWEGSSVCNYTGIFCSPSLDDPSIQTVSGIDLNHGDIAGHLPDELGLLTDIALFH  131



>emb|CDY19550.1| BnaC09g13530D [Brassica napus]
Length=767

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 79/109 (72%), Gaps = 3/109 (3%)
 Frame = +3

Query  243  LLYYRDEFGD---RGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSD  413
             L+ R + G     G+ + VDPSL FEN  +R AYIALQ+WKQAI SDP N T++W GSD
Sbjct  21   FLHTRAQEGQGDISGDNIKVDPSLKFENPSLRQAYIALQSWKQAIFSDPFNFTANWNGSD  80

Query  414  VCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            VC+Y GV+CA +P  PK R VA IDLNH D+AGYLP ELGLL DL +FH
Sbjct  81   VCSYNGVYCASSPSRPKTRVVAGIDLNHADMAGYLPPELGLLTDLALFH  129



>emb|CDY26536.1| BnaA09g47410D [Brassica napus]
Length=670

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 78/98 (80%), Gaps = 1/98 (1%)
 Frame = +3

Query  270  DRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPA  449
            D G+ + VDP L FEN ++R AYIALQ+WKQ I SDP N T++W GSDVC+Y G++CAP+
Sbjct  114  DLGDHIKVDPKLKFENPKLREAYIALQSWKQTIFSDPFNFTANWNGSDVCSYNGIYCAPS  173

Query  450  PDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            P++ PK R VA IDLNH D+AGYLP ELGLL+DL +FH
Sbjct  174  PNSYPKTRVVAGIDLNHADMAGYLPAELGLLSDLALFH  211



>ref|XP_010473463.1| PREDICTED: leucine-rich repeat extensin-like protein 2 isoform 
X2 [Camelina sativa]
Length=718

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 76/95 (80%), Gaps = 1/95 (1%)
 Frame = +3

Query  276  GERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPD  455
            G+ + VDPSLTFEN  +R AYIALQ+WKQAI SDP N T++W GSDVC+Y G+FCAP+P 
Sbjct  41   GDGIKVDPSLTFENPSLRQAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGIFCAPSPS  100

Query  456  NPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            + K R VA IDLNH D+AGYLP ELGLL DL +FH
Sbjct  101  S-KTRVVAGIDLNHADMAGYLPRELGLLTDLALFH  134



>ref|XP_010251729.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Nelumbo nucifera]
Length=692

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 89/121 (74%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGE--RVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            L+++E  YI +RQLL    E GD  +     V+ ++TF N R+R AYIALQAWK+A+ SD
Sbjct  25   LTEAETSYITQRQLLSL-PENGDLPDDYEYEVNINITFPNARLRRAYIALQAWKKAMYSD  83

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P N T +WVG+DVCNYTGVFCA A D PK+  VA IDLN++DIAG+LP ELGLL D+ +F
Sbjct  84   PHNVTGNWVGADVCNYTGVFCANALDEPKLTVVAGIDLNNEDIAGFLPVELGLLRDIALF  143

Query  558  H  560
            H
Sbjct  144  H  144



>ref|XP_002519151.1| protein binding protein, putative [Ricinus communis]
 gb|EEF43362.1| protein binding protein, putative [Ricinus communis]
Length=829

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 88/121 (73%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRD--EFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            L+D+EV +I  RQLL  ++  E  +  E   VD  +TF N R++ AYIALQAWK+A+ SD
Sbjct  28   LTDAEVSFITGRQLLSLKENEELPNEYEH-EVDVKVTFANQRLKRAYIALQAWKKAMYSD  86

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P NTTS+W G++VC Y GVFCAPA D+PK+  VA IDLN  DIAG+LP ELGL+ DL +F
Sbjct  87   PFNTTSNWNGANVCAYNGVFCAPALDDPKLSVVAGIDLNQADIAGFLPPELGLMTDLALF  146

Query  558  H  560
            H
Sbjct  147  H  147



>ref|XP_010473462.1| PREDICTED: leucine-rich repeat extensin-like protein 2 isoform 
X1 [Camelina sativa]
Length=734

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 76/95 (80%), Gaps = 1/95 (1%)
 Frame = +3

Query  276  GERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPD  455
            G+ + VDPSLTFEN  +R AYIALQ+WKQAI SDP N T++W GSDVC+Y G+FCAP+P 
Sbjct  41   GDGIKVDPSLTFENPSLRQAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGIFCAPSPS  100

Query  456  NPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            + K R VA IDLNH D+AGYLP ELGLL DL +FH
Sbjct  101  S-KTRVVAGIDLNHADMAGYLPRELGLLTDLALFH  134



>ref|XP_011018198.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 2 [Populus euphratica]
Length=576

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = +3

Query  294  DPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRT  473
            DP+L FEN RIR AYIALQ+WKQAI SDP N T++W GSDVC+Y GVFCAP+P N KIR 
Sbjct  42   DPTLKFENPRIRXAYIALQSWKQAIFSDPFNFTANWNGSDVCSYMGVFCAPSPKNKKIRV  101

Query  474  VASIDLNHDDIAGYLPEELGLLADLGVFH  560
            VA IDLNH DIAGYLP E GL+ DL + H
Sbjct  102  VAGIDLNHADIAGYLPTEPGLITDLALLH  130



>ref|XP_006838987.1| hypothetical protein AMTR_s00002p00271610 [Amborella trichopoda]
 gb|ERN01556.1| hypothetical protein AMTR_s00002p00271610 [Amborella trichopoda]
Length=487

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +3

Query  297  PSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTV  476
            PSL F N R++NAYIALQAWK AI+SDP+N T +WVG +VCNYTGV+CA A D+P I  V
Sbjct  33   PSLLFPNPRLQNAYIALQAWKHAIVSDPKNITRNWVGPNVCNYTGVYCARALDDPHITVV  92

Query  477  ASIDLNHDDIAGYLPEELGLLADLGVFH  560
            A ID+NHDDIAGYLPE+LGLL DL +FH
Sbjct  93   AGIDVNHDDIAGYLPEDLGLLTDLALFH  120



>emb|CDY15964.1| BnaC08g41590D [Brassica napus]
Length=588

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 79/107 (74%), Gaps = 1/107 (1%)
 Frame = +3

Query  243  LLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCN  422
            LL  + +    G  + VDP L FEN ++R AYIALQ+WKQ I SDP N T++W GSDVC+
Sbjct  19   LLQIKADESGLGNHIKVDPKLKFENPKLREAYIALQSWKQTIFSDPFNFTANWNGSDVCS  78

Query  423  YTGVFCAPAPDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            Y G++CAP+P++ PK R VA IDLNH D+AGYLP ELGLL DL +FH
Sbjct  79   YNGIYCAPSPNSYPKTRVVAGIDLNHADMAGYLPAELGLLTDLALFH  125



>ref|XP_002514492.1| LRX2, putative [Ricinus communis]
 gb|EEF47892.1| LRX2, putative [Ricinus communis]
Length=766

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 76/103 (74%), Gaps = 4/103 (4%)
 Frame = +3

Query  252  YRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTG  431
            + DE  D    + VDPS  FEN R+  AYIALQA KQ+I SDP N T++W G +VC+Y G
Sbjct  30   HEDELLD----IQVDPSFKFENPRLGQAYIALQALKQSIFSDPFNFTTNWKGPNVCSYMG  85

Query  432  VFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            VFCAP+P NPKIR VA IDLNH DIAGYLP ELGLL DL +FH
Sbjct  86   VFCAPSPSNPKIRVVAGIDLNHADIAGYLPPELGLLTDLALFH  128



>ref|XP_010431693.1| PREDICTED: leucine-rich repeat extensin-like protein 2 [Camelina 
sativa]
Length=743

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 76/95 (80%), Gaps = 1/95 (1%)
 Frame = +3

Query  276  GERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPD  455
            G+ + VDPSLTFEN  +R AYIALQ+WKQAI SDP N T++W GSDVC+Y G+FCAP+P 
Sbjct  47   GDGIKVDPSLTFENPSLRQAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGIFCAPSPS  106

Query  456  NPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            + K R VA IDLNH D+AGYLP ELGLL DL +FH
Sbjct  107  S-KTRVVAGIDLNHADMAGYLPRELGLLTDLALFH  140



>ref|XP_006384469.1| hypothetical protein POPTR_0004s153601g, partial [Populus trichocarpa]
 gb|ERP62266.1| hypothetical protein POPTR_0004s153601g, partial [Populus trichocarpa]
Length=552

 Score =   138 bits (348),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 83/120 (69%), Gaps = 1/120 (1%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGE-RVTVDPSLTFENDRIRNAYIALQAWKQAIISDP  380
            L+D+E  YI RRQLL   +      E    VD  +TF N R+R AYI LQAWK+AI SDP
Sbjct  28   LTDAEASYIARRQLLTLNENSELPHEFEYEVDVKITFANQRLRRAYIGLQAWKKAIYSDP  87

Query  381  RNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
             NTT +WVG++VC Y GVFCAPA D+P +  VA +DLN  DIAG+LP ELGL+ D+ +FH
Sbjct  88   FNTTGNWVGANVCAYNGVFCAPALDDPSLSVVAGVDLNGADIAGHLPAELGLMTDVALFH  147



>ref|XP_004151743.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1-like, partial [Cucumis sativus]
Length=219

 Score =   133 bits (335),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +3

Query  306  TFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASI  485
            TF N+R++ AY ALQAWK A+ SDP+N T++WVG+DVC+YTGVFCAPA D+PKI  VA I
Sbjct  34   TFPNERLKKAYRALQAWKLAVYSDPKNMTANWVGADVCSYTGVFCAPALDDPKIEVVAGI  93

Query  486  DLNHDDIAGYLPEELGLLADLGVFH  560
            DLNH DIAG+LP ELGLL DL +FH
Sbjct  94   DLNHGDIAGHLPPELGLLTDLALFH  118



>ref|XP_011005677.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Populus euphratica]
Length=799

 Score =   140 bits (353),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 83/120 (69%), Gaps = 1/120 (1%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGE-RVTVDPSLTFENDRIRNAYIALQAWKQAIISDP  380
            L+D+E  YI RRQLL   +      E    VD  +TF N R+R AYI LQAWK+AI SDP
Sbjct  28   LTDAEASYIARRQLLTLNENSELPHEFEYEVDVKITFANQRLRRAYIGLQAWKKAIYSDP  87

Query  381  RNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
             NTT DWVG++VC Y GVFCAPA D+P +  VA +DLN  DIAG+LP ELGL+ D+ +FH
Sbjct  88   FNTTGDWVGANVCAYNGVFCAPALDDPSLSVVAGVDLNGADIAGHLPAELGLMTDVALFH  147



>ref|XP_010507380.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 isoform X1 [Camelina sativa]
Length=907

 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 86/121 (71%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGERVT--VDPSLTFENDRIRNAYIALQAWKQAIISD  377
            L+D E  ++ RRQLL    E GD  + +   V   L F+N+R++ AYIALQAWK+AI SD
Sbjct  31   LTDEEASFLTRRQLLALS-ENGDLPDDMEYEVHLDLKFDNNRLKRAYIALQAWKKAIYSD  89

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P NT  +WVG +VC+Y GVFCAPA D+P +  VA IDLNH DIAGYLP ELGLL D+ +F
Sbjct  90   PFNTAGNWVGPNVCSYKGVFCAPALDDPSVMVVAGIDLNHADIAGYLPPELGLLTDVALF  149

Query  558  H  560
            H
Sbjct  150  H  150



>ref|XP_011001177.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Populus euphratica]
Length=830

 Score =   140 bits (353),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 83/120 (69%), Gaps = 1/120 (1%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGE-RVTVDPSLTFENDRIRNAYIALQAWKQAIISDP  380
            L+D+E  YI RRQLL   +      E    VD  +TF N R+R AYI LQAWK+AI SDP
Sbjct  28   LTDAEASYIARRQLLTLNENSELPHEFEYEVDVKITFANQRLRRAYIGLQAWKKAIYSDP  87

Query  381  RNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
             NTT DWVG++VC Y GVFCAPA D+P +  VA +DLN  DIAG+LP ELGL+ D+ +FH
Sbjct  88   FNTTGDWVGANVCAYNGVFCAPALDDPSLSVVAGVDLNGADIAGHLPAELGLMTDVALFH  147



>ref|XP_010507385.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 isoform X2 [Camelina sativa]
Length=891

 Score =   140 bits (353),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 86/121 (71%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGERVT--VDPSLTFENDRIRNAYIALQAWKQAIISD  377
            L+D E  ++ RRQLL    E GD  + +   V   L F+N+R++ AYIALQAWK+AI SD
Sbjct  31   LTDEEASFLTRRQLLALS-ENGDLPDDMEYEVHLDLKFDNNRLKRAYIALQAWKKAIYSD  89

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P NT  +WVG +VC+Y GVFCAPA D+P +  VA IDLNH DIAGYLP ELGLL D+ +F
Sbjct  90   PFNTAGNWVGPNVCSYKGVFCAPALDDPSVMVVAGIDLNHADIAGYLPPELGLLTDVALF  149

Query  558  H  560
            H
Sbjct  150  H  150



>ref|XP_010533784.1| PREDICTED: leucine-rich repeat extensin-like protein 2 isoform 
X1 [Tarenaya hassleriana]
Length=810

 Score =   140 bits (353),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = +3

Query  276  GERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPD  455
            G+ V VDPSL FEN ++R AYIALQAWK AI SDP N T++W GSDVC+Y G+FCAP P 
Sbjct  29   GDDVRVDPSLRFENPKLRQAYIALQAWKLAIFSDPFNFTANWNGSDVCSYNGIFCAPLPS  88

Query  456  NPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            + K R VA IDLNH DIAGYLP ELGLL DL +FH
Sbjct  89   DNKTRVVAGIDLNHADIAGYLPPELGLLTDLALFH  123



>ref|XP_011460368.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Fragaria vesca subsp. vesca]
Length=499

 Score =   137 bits (346),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 85/121 (70%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGERVT--VDPSLTFENDRIRNAYIALQAWKQAIISD  377
            L+D+E  ++ RRQLL    E GD  E     V  ++ F N R+R AYIALQAWK+AI SD
Sbjct  24   LTDAEASFLTRRQLLTL-PEGGDLPENFENGVQLNMEFPNPRLRRAYIALQAWKKAIYSD  82

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P  TT++WVG DVC+Y GVFC  A D+PK+  VASIDLN  DIAGYLP ELGLL +L VF
Sbjct  83   PLKTTANWVGPDVCHYKGVFCEKALDDPKLDVVASIDLNGADIAGYLPAELGLLQELAVF  142

Query  558  H  560
            H
Sbjct  143  H  143



>ref|XP_010533785.1| PREDICTED: leucine-rich repeat extensin-like protein 2 isoform 
X2 [Tarenaya hassleriana]
Length=845

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = +3

Query  276  GERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPD  455
            G+ V VDPSL FEN ++R AYIALQAWK AI SDP N T++W GSDVC+Y G+FCAP P 
Sbjct  29   GDDVRVDPSLRFENPKLRQAYIALQAWKLAIFSDPFNFTANWNGSDVCSYNGIFCAPLPS  88

Query  456  NPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            + K R VA IDLNH DIAGYLP ELGLL DL +FH
Sbjct  89   DNKTRVVAGIDLNHADIAGYLPPELGLLTDLALFH  123



>ref|XP_010064140.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Eucalyptus grandis]
Length=580

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 81/120 (68%), Gaps = 1/120 (1%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFG-DRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDP  380
            LS SE   I RRQLL  R+     R     V+ + TF N R+R AYIAL+AWK+A+ SDP
Sbjct  25   LSTSEASLIARRQLLALRENTKLPRNYEYVVEVNETFANSRLRRAYIALRAWKEAMYSDP  84

Query  381  RNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
             NTT +WVG  VC Y GVFC+PA D+P +  VA IDLNH DIAGYLP EL LL DL +FH
Sbjct  85   LNTTGNWVGPGVCEYNGVFCSPALDDPNLIVVAGIDLNHADIAGYLPPELSLLGDLALFH  144



>ref|XP_006394807.1| hypothetical protein EUTSA_v10004209mg [Eutrema salsugineum]
 gb|ESQ32093.1| hypothetical protein EUTSA_v10004209mg [Eutrema salsugineum]
Length=449

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 81/108 (75%), Gaps = 6/108 (6%)
 Frame = +3

Query  237  RQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDV  416
            RQLLY RD+       +T+ P L FEN R+  AY+ALQAWK+AIISDP N T++W GS V
Sbjct  30   RQLLYSRDD------PITIPPYLVFENARLERAYVALQAWKRAIISDPWNLTANWFGSRV  83

Query  417  CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            C+Y GV C+ + D+P I+TV+ +DLNH DIAG+LPEELGLL D+ +FH
Sbjct  84   CDYNGVVCSSSLDDPSIKTVSGVDLNHGDIAGHLPEELGLLTDIALFH  131



>gb|KFK27830.1| hypothetical protein AALP_AA8G435400 [Arabis alpina]
Length=446

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 80/108 (74%), Gaps = 6/108 (6%)
 Frame = +3

Query  237  RQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDV  416
            RQLLY RD        +TV P L FEN+R+  AY+ALQAWKQA+ISDP N T +W GS V
Sbjct  31   RQLLYSRDN------PITVPPYLIFENERLERAYVALQAWKQAMISDPWNLTLNWFGSRV  84

Query  417  CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            C+Y GV C+ + D+P I+TV+ +DLNH DIAG+LPEELGLL D+ +FH
Sbjct  85   CDYNGVVCSSSIDDPLIKTVSGVDLNHGDIAGHLPEELGLLTDIALFH  132



>gb|KJB47441.1| hypothetical protein B456_008G026700 [Gossypium raimondii]
Length=607

 Score =   138 bits (347),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 68/119 (57%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = +3

Query  210  DSEVHYIQRRQLLYYRD--EFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  383
            D+E  Y+ +RQLL   +  E  D G    V  +L F+N R+R AYIALQAWK+A+ SDP+
Sbjct  32   DAEASYLSQRQLLTLPENGELPD-GFEFQVQINLKFDNSRLRRAYIALQAWKKAMYSDPK  90

Query  384  NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            N T++WVG +VC Y+GVFCA A D+PKI  VA +DLNH DIAGYLP ELGL+ DL +FH
Sbjct  91   NITNNWVGPNVCGYSGVFCAQALDDPKINVVAGVDLNHADIAGYLPAELGLMTDLALFH  149



>ref|XP_006417273.1| hypothetical protein EUTSA_v10006975mg [Eutrema salsugineum]
 gb|ESQ35626.1| hypothetical protein EUTSA_v10006975mg [Eutrema salsugineum]
Length=691

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 79/102 (77%), Gaps = 2/102 (2%)
 Frame = +3

Query  258  DEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVF  437
            DE G  G  + VDP L FEN ++R+AYIALQ+WKQAI SDP N T++W GSDVC+Y G++
Sbjct  30   DESG-LGSHIKVDPKLKFENPKLRDAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGIY  88

Query  438  CAPAPDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            CAP+PD+  K R VA IDLNH D+AGYLP ELGLL DL +FH
Sbjct  89   CAPSPDSYGKTRVVAGIDLNHADMAGYLPSELGLLCDLALFH  130



>ref|XP_006480071.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3-like [Citrus sinensis]
Length=984

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 85/129 (66%), Gaps = 18/129 (14%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLY----------YRDEFGDRGERVTVDPSLTFENDRIRNAYIALQA  353
            L+D+E  +I RRQLL           + DE+G + +         F NDR++ AY+ALQA
Sbjct  30   LTDAEAAFIARRQLLTLPKDGKLPDNFDDEYGLKNKN--------FANDRLKKAYVALQA  81

Query  354  WKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELG  533
            +K+AI SDP N T +WV +DVC+Y GVFCAPAPDNP I  VA IDLN DDIAG  P ELG
Sbjct  82   FKKAIYSDPFNITGNWVDTDVCSYNGVFCAPAPDNPNITVVAGIDLNGDDIAGSFPAELG  141

Query  534  LLADLGVFH  560
            LL DL +FH
Sbjct  142  LLTDLALFH  150



>ref|XP_010479383.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Camelina sativa]
Length=888

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +3

Query  291  VDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIR  470
            VDP+L FENDR++ AYIALQAWK+AI SDP  TTS+WVGS+VC+Y GV+CAPA D+P + 
Sbjct  53   VDPNLRFENDRLKRAYIALQAWKKAIYSDPFKTTSNWVGSNVCSYNGVYCAPALDDPSLN  112

Query  471  TVASIDLNHDDIAGYLPEELGLLADLGVFH  560
             VA +DLNH DI+G+LP ELGL+ DL +FH
Sbjct  113  VVAGVDLNHADISGHLPPELGLMTDLALFH  142



>ref|XP_009622388.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 6 [Nicotiana tomentosiformis]
Length=403

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  312  ENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDL  491
            +N R+ NAYIALQAWK  + SDPRN T +W G  VCNYTGV+CAPAPDNPKI TVA IDL
Sbjct  36   QNPRLFNAYIALQAWKHVMTSDPRNFTKNWYGYKVCNYTGVYCAPAPDNPKITTVAGIDL  95

Query  492  NHDDIAGYLPEELGLLADLGVFH  560
            NH +I+GYLPE+LGLL DL VFH
Sbjct  96   NHANISGYLPEDLGLLTDLAVFH  118



>ref|XP_010461787.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Camelina sativa]
Length=905

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +3

Query  291  VDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIR  470
            VDP+L FENDR++ AYIALQAWK+AI SDP  TTS+WVGS+VC+Y GV+CAPA D+P + 
Sbjct  53   VDPNLRFENDRLKRAYIALQAWKKAIYSDPFKTTSNWVGSNVCSYNGVYCAPALDDPSLN  112

Query  471  TVASIDLNHDDIAGYLPEELGLLADLGVFH  560
             VA +DLNH DI+G+LP ELGL+ DL +FH
Sbjct  113  VVAGVDLNHADISGHLPPELGLMTDLALFH  142



>ref|XP_008225416.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Prunus mume]
Length=777

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 87/121 (72%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGE--RVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            L+D+E   I RRQLL    E GD  +     V+ +L F N R+R AYIALQAWK+A+ SD
Sbjct  24   LTDAEASSIARRQLLAL-PEGGDLPDHYEFEVELNLNFPNTRLRRAYIALQAWKKAMYSD  82

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P  TT +WVG++VC+YTGVFCA A D+P++  VA IDLNH DIAGYLP ELGLL D+ +F
Sbjct  83   PLKTTENWVGANVCSYTGVFCAKALDDPELEVVAGIDLNHADIAGYLPVELGLLTDIALF  142

Query  558  H  560
            H
Sbjct  143  H  143



>ref|XP_006361150.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Solanum 
tuberosum]
Length=494

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 83/120 (69%), Gaps = 6/120 (5%)
 Frame = +3

Query  201  PLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDP  380
            P     +     R+LL Y+      G+ + ++PSL+ EN R++NAYIALQ+WK+ I+SDP
Sbjct  41   PFGGIAIETSNSRKLLSYK------GDVLAINPSLSIENFRLKNAYIALQSWKEVILSDP  94

Query  381  RNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
             N T +WVGS+VCNYTGVFC+P+ D P   TV+ ID+NH DIAG LP ELGLL D+ + H
Sbjct  95   HNITQNWVGSNVCNYTGVFCSPSLDQPSELTVSGIDINHGDIAGKLPHELGLLFDIALIH  154



>ref|XP_010664614.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1, partial [Vitis vinifera]
Length=514

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 80/119 (67%), Gaps = 3/119 (3%)
 Frame = +3

Query  210  DSEVHYIQRRQLLYYRDEFGDRGE--RVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  383
            D E   I  RQLL    + GD        VD  + F N R+R AYIALQAWK A+ SDP 
Sbjct  27   DEEASLIAHRQLLAIPKD-GDLPNDFEYEVDLVVAFANARLRQAYIALQAWKHAMYSDPF  85

Query  384  NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            NTTS+W G++VC Y GVFCAPA DNPK+  VA +DLNH DIAGYLP ELGL+ DL +FH
Sbjct  86   NTTSNWEGANVCAYKGVFCAPALDNPKLSVVAGVDLNHADIAGYLPVELGLMTDLALFH  144



>ref|XP_007042323.1| Leucine-rich repeat family protein [Theobroma cacao]
 gb|EOX98154.1| Leucine-rich repeat family protein [Theobroma cacao]
Length=726

 Score =   138 bits (347),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 71/121 (59%), Positives = 86/121 (71%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSL--TFENDRIRNAYIALQAWKQAIISD  377
            LSD+E  YI  RQLL    E G+  E    +  +  TF N R++ AYIALQAWK+A+ SD
Sbjct  30   LSDAEASYIAHRQLLTL-PENGELPEDFEYEVKIVETFANQRLKRAYIALQAWKKAMYSD  88

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P NTT +WVG +VC YTGVFCAPA D+PK+  VA +DLNH DIAGYLP ELGL+ DL +F
Sbjct  89   PLNTTGNWVGPNVCAYTGVFCAPALDDPKLSVVAGVDLNHADIAGYLPAELGLMTDLALF  148

Query  558  H  560
            H
Sbjct  149  H  149



>ref|XP_010256147.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Nelumbo 
nucifera]
Length=378

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +3

Query  309  FENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASID  488
            F N R+ NAY ALQAWK  I+SDP+N+T++W G  VCNYTGVFCAPAPD+P I+TVA ID
Sbjct  32   FPNPRLLNAYTALQAWKHVILSDPKNSTANWYGPHVCNYTGVFCAPAPDDPYIKTVAGID  91

Query  489  LNHDDIAGYLPEELGLLADLGVFH  560
            LNH DIAG LPEELGLL DL +FH
Sbjct  92   LNHADIAGSLPEELGLLTDLALFH  115



>emb|CDY53352.1| BnaA06g38270D [Brassica napus]
Length=641

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 74/99 (75%), Gaps = 1/99 (1%)
 Frame = +3

Query  267  GDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAP  446
            G  G R+ VDP L FEN ++R AYIALQ+WKQAI SDP N T++W GSDVC+Y G++CAP
Sbjct  27   GVLGSRIKVDPKLKFENPKLRQAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGIYCAP  86

Query  447  AP-DNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
             P    K R VA IDLNH D+AGYLP ELGLL DL +FH
Sbjct  87   FPVSYNKTRVVAGIDLNHADMAGYLPSELGLLRDLALFH  125



>ref|XP_010040127.1| PREDICTED: leucine-rich repeat extensin-like protein 2, partial 
[Eucalyptus grandis]
Length=439

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = +3

Query  285  VTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPK  464
            V +D SL FEN R+R AYIALQAWKQAI SDP N T++W G +VC+Y GVFCAP+P N  
Sbjct  34   VKLDLSLKFENGRLRKAYIALQAWKQAIFSDPFNFTANWHGPNVCSYKGVFCAPSPSNSS  93

Query  465  IRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            +R VA IDLNH DIAG+LP ELGLL  L +FH
Sbjct  94   LRVVAGIDLNHADIAGFLPRELGLLRHLALFH  125



>emb|CDY16503.1| BnaA08g02640D [Brassica napus]
Length=730

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +3

Query  285  VTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPK  464
            + VDPSL FENDR++ AYIALQAWK+AI SDP  TT +WVG DVC+Y GV+CA A D+P 
Sbjct  46   IKVDPSLKFENDRLKRAYIALQAWKKAIYSDPFKTTKNWVGPDVCSYNGVYCAEALDDPS  105

Query  465  IRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            ++ VA +DLNH DIAG+LP ELGL+ DL +FH
Sbjct  106  LKVVAGVDLNHADIAGHLPAELGLITDLAMFH  137



>emb|CDY18563.1| BnaA01g26320D [Brassica napus]
Length=638

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 86/121 (71%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYY--RDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            L++ E  ++ +RQLL     ++  D  E   VD +L F N R++ AYIALQAWK+AI SD
Sbjct  31   LTNEETSFLTKRQLLALSENEDLSDDME-YEVDLNLKFANTRLKRAYIALQAWKKAIYSD  89

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P NT+++W+G +VC+Y GVFCAPA D+  I  VA ID+NH DIAGYLP ELGLL D+ +F
Sbjct  90   PFNTSANWIGQNVCSYKGVFCAPALDDQSIMVVAGIDINHADIAGYLPPELGLLTDVALF  149

Query  558  H  560
            H
Sbjct  150  H  150



>ref|XP_010418239.1| PREDICTED: leucine-rich repeat extensin-like protein 2 [Camelina 
sativa]
Length=722

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 73/90 (81%), Gaps = 1/90 (1%)
 Frame = +3

Query  291  VDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIR  470
            VDPSLTFEN  +R AYIALQ+WKQAI SDP N T++W GSDVC+Y G+FCAP+P + K R
Sbjct  41   VDPSLTFENPSLRQAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGIFCAPSPSS-KTR  99

Query  471  TVASIDLNHDDIAGYLPEELGLLADLGVFH  560
             VA IDLNH D+AGYLP ELGLL DL +FH
Sbjct  100  VVAGIDLNHADMAGYLPRELGLLTDLALFH  129



>ref|XP_004242113.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Solanum 
lycopersicum]
Length=493

 Score =   135 bits (341),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +3

Query  222  HYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDW  401
            +YI   ++   R      G+ + ++PS + EN R++NAYIALQAWK+ I+SDP N T +W
Sbjct  35   NYIDHIEISNSRKLLSYNGDVLAINPSFSIENFRLKNAYIALQAWKEVILSDPHNITQNW  94

Query  402  VGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            VGS+VC+YTGVFC+P+ D P   TV+ ID+NH DIAG LP ELGLL D+G+ H
Sbjct  95   VGSNVCSYTGVFCSPSLDQPSELTVSGIDINHGDIAGKLPHELGLLFDIGLIH  147



>ref|XP_009773829.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Nicotiana 
sylvestris]
Length=392

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  312  ENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDL  491
            +N R+ NAYIALQAWK  + SDPRN T +W G  VCNYTGV+CAP PDNPKI TVA IDL
Sbjct  36   QNPRLFNAYIALQAWKHVMTSDPRNFTKNWYGYKVCNYTGVYCAPVPDNPKITTVAGIDL  95

Query  492  NHDDIAGYLPEELGLLADLGVFH  560
            NH +I+GYLPE+LGLL DL VFH
Sbjct  96   NHANISGYLPEDLGLLTDLAVFH  118



>ref|XP_010104364.1| Pollen-specific leucine-rich repeat extensin-like protein 1 [Morus 
notabilis]
 gb|EXB99784.1| Pollen-specific leucine-rich repeat extensin-like protein 1 [Morus 
notabilis]
Length=939

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 83/121 (69%), Gaps = 2/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLL--YYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            L+D+E   I RRQLL  +   +  D  E      +LTF N R++ AYIALQAWK+AI SD
Sbjct  82   LTDAEASSIVRRQLLTLHQHGDLPDDYEYKVDLGNLTFSNSRLKRAYIALQAWKKAIYSD  141

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P N T  WVG+DVC+Y GVFCAPA D P +  VA ID+NH DIAGYLP ELGLL ++ +F
Sbjct  142  PLNITGGWVGTDVCSYNGVFCAPALDEPTLEVVAGIDINHGDIAGYLPVELGLLTEIALF  201

Query  558  H  560
            H
Sbjct  202  H  202



>ref|NP_001043463.1| Os01g0594300 [Oryza sativa Japonica Group]
 dbj|BAD52898.1| extensin precursor-like [Oryza sativa Japonica Group]
 dbj|BAD53165.1| extensin precursor-like [Oryza sativa Japonica Group]
 dbj|BAF05377.1| Os01g0594300 [Oryza sativa Japonica Group]
Length=551

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = +3

Query  231  QRRQLL-YYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVG  407
            QRR+LL Y+    G  G  V VDPS TF N R+R+AY+A+QAWK+A++SDP N T  W+G
Sbjct  38   QRRRLLDYHGGGGGHGGGDVYVDPSYTFPNARLRDAYVAMQAWKRAVLSDPHNVTGTWIG  97

Query  408  SDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
             DVC Y GVFCA A D+P +  VAS+DLNH D+AG+LP+ELGLLADL V H
Sbjct  98   PDVCAYEGVFCAAARDDPHLVVVASVDLNHADMAGHLPDELGLLADLAVLH  148



>emb|CBI28097.3| unnamed protein product [Vitis vinifera]
Length=192

 Score =   130 bits (326),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 79/113 (70%), Gaps = 0/113 (0%)
 Frame = +3

Query  195  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  374
            +G L+D+EV YI+RRQLLYYRDEFGDRGE VTVDPSL FEN R RNAYIALQAWKQAI+S
Sbjct  35   HGHLTDAEVMYIKRRQLLYYRDEFGDRGEDVTVDPSLVFENPRQRNAYIALQAWKQAILS  94

Query  375  DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELG  533
            DP N T +WVGS+     G      P     + + +I +NH+  A  LP+  G
Sbjct  95   DPLNLTLNWVGSNELATIGSPGRTVPKELFDKDLDAIFINHNRFAFDLPDNFG  147



>dbj|BAB91812.1| extensin precursor-like [Oryza sativa Japonica Group]
 dbj|BAB92308.1| extensin precursor-like [Oryza sativa Japonica Group]
 dbj|BAG97332.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70999.1| hypothetical protein OsI_02671 [Oryza sativa Indica Group]
Length=570

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = +3

Query  231  QRRQLL-YYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVG  407
            QRR+LL Y+    G  G  V VDPS TF N R+R+AY+A+QAWK+A++SDP N T  W+G
Sbjct  38   QRRRLLDYHGGGGGHGGGDVYVDPSYTFPNARLRDAYVAMQAWKRAVLSDPHNVTGTWIG  97

Query  408  SDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
             DVC Y GVFCA A D+P +  VAS+DLNH D+AG+LP+ELGLLADL V H
Sbjct  98   PDVCAYEGVFCAAARDDPHLVVVASVDLNHADMAGHLPDELGLLADLAVLH  148



>ref|NP_172668.1| leucine-rich repeat extensin-like protein 1 [Arabidopsis thaliana]
 sp|O65375.1|LRX1_ARATH RecName: Full=Leucine-rich repeat extensin-like protein 1; Short=AtLRX1; 
Short=LRR/EXTENSIN1; AltName: Full=Cell wall hydroxyproline-rich 
glycoprotein; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC17609.1| Strong similarity to extensin-like protein gb|Z34465 from Zea 
mays [Arabidopsis thaliana]
 gb|AAK07681.1| leucine-rich repeat/extensin 1 [Arabidopsis thaliana]
 gb|AEE28829.1| leucine-rich repeat extensin-like protein 1 [Arabidopsis thaliana]
Length=744

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = +3

Query  258  DEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVF  437
            D+  D G  + VD  L FEN ++R AYIALQ+WK+AI SDP N T++W GSDVC+Y G++
Sbjct  29   DDESDLGSDIKVDKRLKFENPKLRQAYIALQSWKKAIFSDPFNFTANWNGSDVCSYNGIY  88

Query  438  CAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            CAP+P  PK R VA IDLNH D+AGYL  ELGLL+DL +FH
Sbjct  89   CAPSPSYPKTRVVAGIDLNHADMAGYLASELGLLSDLALFH  129



>emb|CDX95474.1| BnaC01g33660D [Brassica napus]
Length=691

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 86/121 (71%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYY--RDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            L++ E  ++ +RQLL     ++  D  E   VD +L F N R++ AYIALQAWK+AI SD
Sbjct  31   LTNEETSFLTKRQLLALSENEDLSDDMEY-EVDLNLKFANTRLKRAYIALQAWKKAIYSD  89

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P NT+++W+G +VC+Y GVFCAPA D+  I  VA ID+NH DIAGYLP ELGLL D+ +F
Sbjct  90   PFNTSANWIGQNVCSYKGVFCAPALDDQSIMVVAGIDINHADIAGYLPPELGLLTDVALF  149

Query  558  H  560
            H
Sbjct  150  H  150



>ref|XP_002516600.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF45941.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=516

 Score =   135 bits (339),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 83/112 (74%), Gaps = 3/112 (3%)
 Frame = +3

Query  234  RRQLLYYRDEFGDRGERVTV---DPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWV  404
            +R+LL YR+      + V +     S  F+N R++ AYIALQ+WKQA+ISDP N T++WV
Sbjct  47   QRKLLPYRENVVAADDHVGLGSKTSSFKFDNPRLKTAYIALQSWKQAMISDPNNLTANWV  106

Query  405  GSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            G DVC+YTG+FC  APDN  I+TVA+IDLNH DIAG+L EELGLL D+ +FH
Sbjct  107  GCDVCSYTGIFCWTAPDNSSIQTVAAIDLNHGDIAGHLVEELGLLTDIALFH  158



>ref|XP_002889910.1| hypothetical protein ARALYDRAFT_312231 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66169.1| hypothetical protein ARALYDRAFT_312231 [Arabidopsis lyrata subsp. 
lyrata]
Length=574

 Score =   135 bits (340),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 78/109 (72%), Gaps = 3/109 (3%)
 Frame = +3

Query  243  LLYYRDEFGDRGE---RVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSD  413
             L  + + GD  +    + VD  L FEN ++R AYIALQ+WKQAI SDP N T++W GSD
Sbjct  21   FLQIKADHGDESDLDSHIKVDKRLKFENPKLRQAYIALQSWKQAIFSDPFNFTANWNGSD  80

Query  414  VCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            VC+Y G++CAP+P  PK R VA IDLNH D+AGYL  ELGLL+DL +FH
Sbjct  81   VCSYNGIYCAPSPSYPKTRVVAGIDLNHADMAGYLASELGLLSDLALFH  129



>ref|XP_006851043.1| hypothetical protein AMTR_s00025p00231840 [Amborella trichopoda]
 gb|ERN12624.1| hypothetical protein AMTR_s00025p00231840 [Amborella trichopoda]
Length=204

 Score =   129 bits (325),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +3

Query  276  GERVTVDPSLTFENDRIRNAYIALQAWKQ-AIISDPRNTTSDWVGSDVCNYTGVFCAPAP  452
            G+ VT++P+  F+N  +R AY ALQ WK+ AI SDP N T +W+G DVC+Y GVFCAP+P
Sbjct  33   GQTVTINPTFRFQNPSLRRAYYALQTWKKFAIFSDPFNQTGNWIGPDVCHYNGVFCAPSP  92

Query  453  DNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
             +  +  VA IDLNH DIAGYLP ELGLL+DL +FH
Sbjct  93   SDSSLNVVAGIDLNHADIAGYLPPELGLLSDLALFH  128



>ref|NP_175372.1| Leucine-rich repeat family protein [Arabidopsis thaliana]
 sp|Q9XIB6.1|PLRX2_ARATH RecName: Full=Pollen-specific leucine-rich repeat extensin-like 
protein 2; Short=AtPEX2; Short=Pollen-specific LRR/EXTENSIN2; 
AltName: Full=Cell wall hydroxyproline-rich glycoprotein; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD43152.1|AC007504_7 Hypothetical Protein [Arabidopsis thaliana]
 gb|AEE32435.1| Leucine-rich repeat family protein [Arabidopsis thaliana]
Length=847

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +3

Query  291  VDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIR  470
            VDP+L FENDR++ AYIALQAWK+AI SDP  TT++WVGSDVC+Y GV+CAPA D+  + 
Sbjct  48   VDPNLKFENDRLKRAYIALQAWKKAIYSDPFKTTANWVGSDVCSYNGVYCAPALDDDSLT  107

Query  471  TVASIDLNHDDIAGYLPEELGLLADLGVFH  560
             VA +DLNH DIAG+LP ELGL+ DL +FH
Sbjct  108  VVAGVDLNHADIAGHLPPELGLMTDLALFH  137



>ref|XP_010500490.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Camelina sativa]
Length=894

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +3

Query  291  VDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIR  470
            VDP+L FEN+R++ AYIALQAWK+AI SDP  TTS+WVGS+VC+Y GV+CAPA D+P + 
Sbjct  53   VDPNLRFENERLKKAYIALQAWKKAIYSDPFKTTSNWVGSNVCSYNGVYCAPALDDPSLN  112

Query  471  TVASIDLNHDDIAGYLPEELGLLADLGVFH  560
             VA +DLNH DI+G+LP ELGL+ DL +FH
Sbjct  113  VVAGVDLNHADISGHLPLELGLMTDLALFH  142



>ref|XP_009119384.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Brassica rapa]
Length=834

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 86/121 (71%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGERV--TVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            L+D+E  +I +RQLL   ++ GD  E +   VD  LTF N R++ AYIALQAWK+A+ SD
Sbjct  31   LTDAEASFIAQRQLLTLPED-GDLPENIEYKVDIKLTFPNQRLKRAYIALQAWKKAVYSD  89

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P NTT +W G  VC+YTGV CAPA D+P I  VA +DLN  DIAG+LP ELGLL D+ +F
Sbjct  90   PFNTTGNWHGPHVCDYTGVVCAPALDDPNIAVVAGVDLNGADIAGHLPAELGLLTDVAMF  149

Query  558  H  560
            H
Sbjct  150  H  150



>ref|XP_006289956.1| hypothetical protein CARUB_v10003584mg [Capsella rubella]
 gb|EOA22854.1| hypothetical protein CARUB_v10003584mg [Capsella rubella]
Length=429

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 80/108 (74%), Gaps = 6/108 (6%)
 Frame = +3

Query  237  RQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDV  416
            RQLLY RD+       +T+ P L FEN R+  AY+ALQAWK+A+ISDP N T++W GS V
Sbjct  28   RQLLYTRDD------PITIPPYLIFENVRLERAYVALQAWKRAMISDPWNLTTNWFGSRV  81

Query  417  CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            C+Y GV C+ + D P ++TV+ +DLNH DIAG+LPEELGLL D+ +FH
Sbjct  82   CDYNGVVCSSSLDEPLVKTVSGVDLNHGDIAGHLPEELGLLTDIALFH  129



>ref|XP_006304470.1| hypothetical protein CARUB_v10011166mg [Capsella rubella]
 gb|EOA37368.1| hypothetical protein CARUB_v10011166mg [Capsella rubella]
Length=714

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 74/101 (73%), Gaps = 1/101 (1%)
 Frame = +3

Query  258  DEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVF  437
            DE G  G  + VD  L FEN  +R AYIALQ+WKQAI SDP N T++W GSDVC+Y G++
Sbjct  30   DESG-LGSHIKVDKRLKFENSNLREAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGIY  88

Query  438  CAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            CAP+P  PK R VA IDLNH D+AGYL  ELGLL DL +FH
Sbjct  89   CAPSPSYPKTRVVAGIDLNHADMAGYLASELGLLTDLALFH  129



>gb|EYU28282.1| hypothetical protein MIMGU_mgv1a024954mg, partial [Erythranthe 
guttata]
Length=169

 Score =   128 bits (321),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = +3

Query  300  SLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVA  479
            + TF+N  +R AYIALQ+WKQAI SDP N T++W GSDVC+Y GVFCA AP N     VA
Sbjct  27   NFTFQNPSLRQAYIALQSWKQAIFSDPFNFTANWTGSDVCSYAGVFCAAAPYNASETVVA  86

Query  480  SIDLNHDDIAGYLPEELGLLADLGVFH  560
             +DLNH DIAGYLPEELGLL  L +FH
Sbjct  87   GVDLNHADIAGYLPEELGLLTHLALFH  113



>ref|XP_006391867.1| hypothetical protein EUTSA_v10023291mg [Eutrema salsugineum]
 gb|ESQ29153.1| hypothetical protein EUTSA_v10023291mg [Eutrema salsugineum]
Length=778

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 76/102 (75%), Gaps = 1/102 (1%)
 Frame = +3

Query  258  DEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVF  437
            D  G  G+   VDPSL FEN  +R AYIALQ+WKQAI SDP N T++W GSDVC+Y G++
Sbjct  32   DNSGINGDDFKVDPSLNFENPSLRQAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGIY  91

Query  438  CAPAPDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            CAP+P +  K R VA IDLNH D+AGYLP ELGLL DL +FH
Sbjct  92   CAPSPSSRQKTRVVAGIDLNHADMAGYLPPELGLLTDLALFH  133



>emb|CDY54073.1| BnaA07g36350D [Brassica napus]
Length=649

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 85/121 (70%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGERV--TVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            L+D+E  +I +RQLL   ++ GD  E +   VD  LTF N R++ AYIALQAWK+A+ SD
Sbjct  31   LTDAEASFIAQRQLLTLPED-GDLPENIEYKVDIKLTFPNQRLKRAYIALQAWKKAVYSD  89

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P NTT +W G  VC+YTGV CAPA D+P I  V  +DLN  DIAG+LP ELGLL D+ +F
Sbjct  90   PFNTTGNWHGPHVCDYTGVVCAPALDDPNIAVVTGVDLNGADIAGHLPAELGLLTDVAMF  149

Query  558  H  560
            H
Sbjct  150  H  150



>ref|XP_010424321.1| PREDICTED: leucine-rich repeat extensin-like protein 7 [Camelina 
sativa]
Length=432

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 80/108 (74%), Gaps = 6/108 (6%)
 Frame = +3

Query  237  RQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDV  416
            RQLLY RD+       +T+ P L FEN R+  AY+ALQAWK+ +ISDP N T++W GS V
Sbjct  28   RQLLYTRDD------PITIPPYLIFENVRLERAYVALQAWKRTMISDPWNLTANWFGSRV  81

Query  417  CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            C+Y GV C+ A D+P ++TV+ +DLNH DIAG+LPEELGLL D+ +FH
Sbjct  82   CDYNGVVCSSALDDPLVKTVSGVDLNHGDIAGHLPEELGLLTDIALFH  129



>ref|XP_010476158.1| PREDICTED: leucine-rich repeat extensin-like protein 1 [Camelina 
sativa]
 ref|XP_010476159.1| PREDICTED: leucine-rich repeat extensin-like protein 1 [Camelina 
sativa]
Length=698

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +3

Query  255  RDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGV  434
            +D+    G  + VD  L FEN  +R AYIALQ+WK+AI SDP N T++W GSDVC+Y G+
Sbjct  28   QDDESGLGSHIKVDKRLKFENPSLRQAYIALQSWKKAIFSDPFNFTANWNGSDVCSYNGI  87

Query  435  FCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            +CAP+P  PK R VA IDLNH D+AGYL  ELGLL+DL +FH
Sbjct  88   YCAPSPSYPKTRVVAGIDLNHADMAGYLASELGLLSDLALFH  129



>ref|XP_010647882.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1, partial [Vitis vinifera]
Length=719

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 83/119 (70%), Gaps = 3/119 (3%)
 Frame = +3

Query  210  DSEVHYIQRRQLLYYRDEFGDRGE--RVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  383
            D+E   I RRQLL   ++ GD  +     +D  +TF N R+R AYIALQAWK A+ SDP 
Sbjct  32   DAEASLIARRQLLSLPED-GDLPDDFEYEIDLVVTFANSRLRRAYIALQAWKNAMYSDPF  90

Query  384  NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            NTT +WVG++VC Y GVFCAPA D+  +  VA +D+NH DIAGYLP ELGL+ DL +FH
Sbjct  91   NTTGNWVGANVCAYNGVFCAPALDDSNLSVVAGVDINHADIAGYLPAELGLMTDLALFH  149



>gb|AAM13864.1| unknown protein [Arabidopsis thaliana]
Length=712

 Score =   135 bits (340),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 70/121 (58%), Positives = 86/121 (71%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGERVT--VDPSLTFENDRIRNAYIALQAWKQAIISD  377
            L+D E  ++ RRQLL    E GD  + +   VD  L F N+R++ AYIALQAWK+A  SD
Sbjct  31   LTDEEASFLTRRQLLAL-SENGDLPDDIEYEVDLDLKFANNRLKRAYIALQAWKKAFYSD  89

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P NT ++WVG DVC+Y GVFCAPA D+P +  VA IDLNH DIAGYLP ELGLL D+ +F
Sbjct  90   PFNTAANWVGPDVCSYKGVFCAPALDDPSVLVVAGIDLNHADIAGYLPPELGLLTDVALF  149

Query  558  H  560
            H
Sbjct  150  H  150



>ref|XP_006473926.1| PREDICTED: leucine-rich repeat extensin-like protein 2-like [Citrus 
sinensis]
Length=705

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 74/98 (76%), Gaps = 1/98 (1%)
 Frame = +3

Query  270  DRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPA  449
            D    + VDP+L FEN R+R AYIALQAWK AI SDP N T++W GSDVC+Y GVFCA +
Sbjct  36   DEELEIVVDPNLRFENPRLREAYIALQAWKAAIFSDPFNFTANWNGSDVCSYMGVFCARS  95

Query  450  PDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            P N P +R VASIDLNH DIAGYLP E+G L DL +FH
Sbjct  96   PFNSPSLRVVASIDLNHADIAGYLPPEIGRLTDLAIFH  133



>ref|XP_007200697.1| hypothetical protein PRUPE_ppa000722m2g, partial [Prunus persica]
 gb|EMJ01896.1| hypothetical protein PRUPE_ppa000722m2g, partial [Prunus persica]
Length=609

 Score =   134 bits (337),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 69/120 (58%), Positives = 83/120 (69%), Gaps = 3/120 (3%)
 Frame = +3

Query  207  SDSEVHYIQRRQLLYYRDEFGDRGER--VTVDPSLTFENDRIRNAYIALQAWKQAIISDP  380
            +D+EV +I  RQLL    E GD  E   V VD  L FENDR++NAY+ALQA K+AI SDP
Sbjct  32   TDAEVAFIAHRQLLAL-PEGGDLPENYVVQVDAKLNFENDRLKNAYVALQALKKAIFSDP  90

Query  381  RNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
               T +W G DVC+Y GVFCAPA DN K+  VA +DLNH DIAG+LP E+GLL D  + H
Sbjct  91   FGFTVNWEGEDVCSYKGVFCAPALDNEKLTVVAGLDLNHADIAGHLPVEMGLLTDAALIH  150



>ref|XP_006300262.1| hypothetical protein CARUB_v100151920mg, partial [Capsella rubella]
 gb|EOA33160.1| hypothetical protein CARUB_v100151920mg, partial [Capsella rubella]
Length=649

 Score =   134 bits (338),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 70/121 (58%), Positives = 87/121 (72%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGERVT--VDPSLTFENDRIRNAYIALQAWKQAIISD  377
            L+D E  ++ RRQLL    E GD  + +   VD  L F+N+R++ AYIALQAWK+AI SD
Sbjct  2    LTDEEASFLTRRQLLAL-SENGDLPDDMEYEVDVDLKFDNNRLKRAYIALQAWKKAIYSD  60

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P NT ++WVG +VC Y GVFCAPA D+P +  VA IDLNH DIAGYLP ELGLL D+ +F
Sbjct  61   PFNTAANWVGPNVCTYKGVFCAPALDDPSVMVVAGIDLNHADIAGYLPPELGLLTDVALF  120

Query  558  H  560
            H
Sbjct  121  H  121



>emb|CBI32495.3| unnamed protein product [Vitis vinifera]
Length=772

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 83/119 (70%), Gaps = 3/119 (3%)
 Frame = +3

Query  210  DSEVHYIQRRQLLYYRDEFGDRGE--RVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  383
            D+E   I RRQLL   ++ GD  +     +D  +TF N R+R AYIALQAWK A+ SDP 
Sbjct  32   DAEASLIARRQLLSLPED-GDLPDDFEYEIDLVVTFANSRLRRAYIALQAWKNAMYSDPF  90

Query  384  NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            NTT +WVG++VC Y GVFCAPA D+  +  VA +D+NH DIAGYLP ELGL+ DL +FH
Sbjct  91   NTTGNWVGANVCAYNGVFCAPALDDSNLSVVAGVDINHADIAGYLPAELGLMTDLALFH  149



>ref|XP_006453735.1| hypothetical protein CICLE_v10010678mg, partial [Citrus clementina]
 gb|ESR66975.1| hypothetical protein CICLE_v10010678mg, partial [Citrus clementina]
Length=698

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 74/98 (76%), Gaps = 1/98 (1%)
 Frame = +3

Query  270  DRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPA  449
            D    + VDP+L FEN R+R AYIALQAWK AI SDP N T++W GSDVC+Y GVFCA +
Sbjct  36   DEELEIVVDPNLRFENPRLREAYIALQAWKAAIFSDPFNFTANWNGSDVCSYMGVFCARS  95

Query  450  PDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            P N P +R VASIDLNH DIAGYLP E+G L DL +FH
Sbjct  96   PFNSPSLRVVASIDLNHADIAGYLPPEIGRLTDLAIFH  133



>ref|XP_002279192.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Vitis 
vinifera]
Length=394

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +3

Query  315  NDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLN  494
            N RI NAY ALQAWK  I+SDP+N TS+W G DVCNY GV+CAPAPD+P I TVA IDLN
Sbjct  40   NPRILNAYTALQAWKHVILSDPKNFTSNWCGFDVCNYKGVYCAPAPDDPHITTVAGIDLN  99

Query  495  HDDIAGYLPEELGLLADLGVFH  560
            H DIAG LPEELGLL DL +FH
Sbjct  100  HADIAGSLPEELGLLTDLALFH  121



>ref|XP_010454895.1| PREDICTED: leucine-rich repeat extensin-like protein 7 [Camelina 
sativa]
Length=432

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 80/108 (74%), Gaps = 6/108 (6%)
 Frame = +3

Query  237  RQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDV  416
            RQLLY RD+       +T+ P L FEN R+  AY+ALQAWK+ +ISDP N T++W GS V
Sbjct  28   RQLLYTRDD------PITIPPYLIFENVRLERAYVALQAWKRTMISDPWNLTANWFGSRV  81

Query  417  CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            C+Y GV C+ + D+P ++TV+ +DLNH DIAG+LPEELGLL D+ +FH
Sbjct  82   CDYNGVVCSSSLDDPSVKTVSGVDLNHGDIAGHLPEELGLLTDIALFH  129



>ref|XP_010458626.1| PREDICTED: leucine-rich repeat extensin-like protein 1 [Camelina 
sativa]
Length=741

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 75/101 (74%), Gaps = 1/101 (1%)
 Frame = +3

Query  258  DEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVF  437
            DE G  G  + VD  L FEN  +R AYIALQ+WK+AI SDP N T++W GSDVC+Y G++
Sbjct  30   DESG-LGSHIKVDKRLKFENPSLRQAYIALQSWKKAIFSDPFNFTANWNGSDVCSYNGIY  88

Query  438  CAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            CAP+P  PK R VA IDLNH D+AGYL  ELGLL+DL +FH
Sbjct  89   CAPSPSYPKTRVVAGIDLNHADMAGYLASELGLLSDLALFH  129



>ref|XP_002872172.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48431.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=435

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 80/108 (74%), Gaps = 6/108 (6%)
 Frame = +3

Query  237  RQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDV  416
            RQLLY RD+       +T+ P L FEN R+  AY+ALQAWK+ +ISDP N T++W GS V
Sbjct  29   RQLLYTRDD------PITIPPYLIFENVRLERAYVALQAWKRTMISDPWNLTANWFGSRV  82

Query  417  CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            C+Y GV C+ + D+P ++TV+ +DLNH DIAG+LPEELGLL D+ +FH
Sbjct  83   CDYNGVVCSSSLDDPLVKTVSGVDLNHGDIAGHLPEELGLLTDIALFH  130



>ref|XP_010493816.1| PREDICTED: leucine-rich repeat extensin-like protein 7 [Camelina 
sativa]
Length=432

 Score =   132 bits (331),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 80/108 (74%), Gaps = 6/108 (6%)
 Frame = +3

Query  237  RQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDV  416
            RQLLY RD+       +T+ P L FEN R+  AY+ALQAWK+ +ISDP N T++W GS V
Sbjct  28   RQLLYTRDD------PITIPPYLIFENVRLERAYVALQAWKRTMISDPWNLTANWFGSRV  81

Query  417  CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            C+Y GV C+ + D+P ++TV+ +DLNH DIAG+LPEELGLL D+ +FH
Sbjct  82   CDYNGVVCSSSLDDPLVKTVSGVDLNHGDIAGHLPEELGLLTDIALFH  129



>ref|XP_003523588.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1-like [Glycine max]
Length=529

 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 85/121 (70%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYR--DEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            LS++EV +I RRQLL+    DE  D       + +LTF N R++ AYIAL+A K+AI SD
Sbjct  24   LSNAEVSFIARRQLLHLHENDELSDNYVD-NYETNLTFSNPRLKLAYIALEALKKAIYSD  82

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P N T++W G +VC+Y GVFC  A D+PKI  VA IDLNH DIAGY+P E+GLL DL +F
Sbjct  83   PSNFTANWEGQNVCSYNGVFCEKALDDPKIDVVAGIDLNHADIAGYIPPEIGLLTDLALF  142

Query  558  H  560
            H
Sbjct  143  H  143



>ref|NP_179188.1| pollen-specific leucine-rich repeat extensin-like protein 3 [Arabidopsis 
thaliana]
 sp|Q9XIL9.1|PLRX3_ARATH RecName: Full=Pollen-specific leucine-rich repeat extensin-like 
protein 3; Short=AtPEX3; Short=Pollen-specific LRR/EXTENSIN3; 
AltName: Full=Cell wall hydroxyproline-rich glycoprotein; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD41978.1| unknown protein [Arabidopsis thaliana]
 gb|AEC06443.1| pollen-specific leucine-rich repeat extensin-like protein 3 [Arabidopsis 
thaliana]
Length=727

 Score =   134 bits (337),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 85/121 (70%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRD--EFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            L+D+EV +I +RQLL   +  E  D  E   VD  +TF N R++ AYIALQAWK+A+ SD
Sbjct  19   LTDAEVSFIAQRQLLTLPENGELPDDIE-YEVDLKVTFANHRLKRAYIALQAWKKAVYSD  77

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P NTT +W G  VC YTGVFCAPA D+P +  VA +DLN  DIAG+LP ELGL+ D+ +F
Sbjct  78   PFNTTGNWHGPHVCGYTGVFCAPALDDPDVAVVAGVDLNGADIAGHLPAELGLMTDVAMF  137

Query  558  H  560
            H
Sbjct  138  H  138



>ref|XP_006360809.1| PREDICTED: leucine-rich repeat extensin-like protein 6-like [Solanum 
tuberosum]
Length=377

 Score =   131 bits (329),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 71/92 (77%), Gaps = 1/92 (1%)
 Frame = +3

Query  288  TVDPSLTFE-NDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPK  464
            +   S+ +E N R+ +AYIALQAWK  + SDPRN T DW   +VCNYTGV+CAPAPDNP 
Sbjct  22   SFQASIKYEPNPRLFDAYIALQAWKHVMTSDPRNFTKDWYDYNVCNYTGVYCAPAPDNPN  81

Query  465  IRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            I TVA IDLNH +I+GYLPE+LGLL DL VFH
Sbjct  82   ITTVAGIDLNHANISGYLPEKLGLLTDLAVFH  113



>ref|XP_006409498.1| hypothetical protein EUTSA_v10023190mg, partial [Eutrema salsugineum]
 gb|ESQ50951.1| hypothetical protein EUTSA_v10023190mg, partial [Eutrema salsugineum]
Length=518

 Score =   132 bits (332),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 85/121 (70%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGERVT--VDPSLTFENDRIRNAYIALQAWKQAIISD  377
            L+D+E  +I +RQLL    E GD  + +   VD  +TF  +R++ AYIALQAWK+A+ SD
Sbjct  1    LTDAEASFIAQRQLLTL-PENGDLPDDIEYEVDLKVTFAKNRLKRAYIALQAWKKAVFSD  59

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P NTT +W G  VC YTGVFCAPA D+P +  VA +DLN  DIAG+LP ELGL+ D+ +F
Sbjct  60   PFNTTGNWHGPHVCGYTGVFCAPALDDPSVAVVAGVDLNGADIAGHLPVELGLMTDVAMF  119

Query  558  H  560
            H
Sbjct  120  H  120



>gb|AGT16383.1| hypothetical protein SHCRBa_052_I12_F_230 [Saccharum hybrid cultivar 
R570]
Length=641

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 81/120 (68%), Gaps = 2/120 (2%)
 Frame = +3

Query  207  SDSEVHYIQRRQLLYYRDEFGDRGERVTVD--PSLTFENDRIRNAYIALQAWKQAIISDP  380
            SD+E   I RRQLL  R+  GD  +    D    +TF NDR+R AY+ALQAW++A+ SDP
Sbjct  44   SDAEASNIARRQLLSLREGDGDLPDDFEFDIHVDVTFANDRLRRAYVALQAWRRAMYSDP  103

Query  381  RNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            +N T  WVG+DVC+Y G+ C PA D+ K   VA +DLN  DIAGYLP ELG+L D+  FH
Sbjct  104  KNFTGGWVGADVCSYFGITCVPALDDAKTTVVAGVDLNGGDIAGYLPVELGMLTDIAFFH  163



>ref|XP_006494306.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3-like [Citrus sinensis]
Length=1091

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 84/120 (70%), Gaps = 4/120 (3%)
 Frame = +3

Query  210  DSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLT---FENDRIRNAYIALQAWKQAIISDP  380
            D+E  ++ RRQLL    + G   + +  +  L    F NDR++ AY+ALQA+K+AI SDP
Sbjct  26   DAEAAFLVRRQLLTLPQD-GKLPDNIENEYDLKNKYFSNDRLKKAYVALQAFKKAIYSDP  84

Query  381  RNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
             NTT +WVG+DVC+Y GVFCAPAPDN  I  VA IDLN +DIAGY P ELG L+DL +FH
Sbjct  85   FNTTGNWVGTDVCSYNGVFCAPAPDNSNITVVAGIDLNGNDIAGYFPAELGWLSDLALFH  144



>ref|XP_006375015.1| hypothetical protein POPTR_0014s03600g [Populus trichocarpa]
 gb|ERP52812.1| hypothetical protein POPTR_0014s03600g [Populus trichocarpa]
Length=477

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 81/121 (67%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFG--DRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            LS SE  +I RRQ L         D  E + ++ ++TF N R+R AYIALQAWK+AI SD
Sbjct  25   LSHSEASFIARRQPLSLEKNVNLPDYFE-LKIELNITFPNPRLRKAYIALQAWKKAIRSD  83

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P N T +W G  VC+Y GVFCAPA D+PK   VA IDLNH DI GYLP ELGLL D+ +F
Sbjct  84   PFNITGNWEGLRVCDYNGVFCAPALDDPKQNVVAGIDLNHFDIVGYLPVELGLLTDIALF  143

Query  558  H  560
            H
Sbjct  144  H  144



>ref|NP_197937.1| leucine-rich repeat extensin-like protein 7 [Arabidopsis thaliana]
 sp|Q4PSE6.1|LRX7_ARATH RecName: Full=Leucine-rich repeat extensin-like protein 7; Short=AtLRX7; 
Short=LRR/EXTENSIN7; AltName: Full=Cell wall hydroxyproline-rich 
glycoprotein; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAY78836.1| leucine-rich repeat family protein [Arabidopsis thaliana]
 gb|AED93461.1| leucine-rich repeat extensin-like protein 7 [Arabidopsis thaliana]
Length=433

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 84/119 (71%), Gaps = 6/119 (5%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  383
            LS S V     RQLLY RD+       +T+ P L FEN R+  AY+ALQAWK+A+ISDP 
Sbjct  17   LSISAVAPGGSRQLLYTRDD------PITIPPYLIFENVRLERAYVALQAWKRAMISDPW  70

Query  384  NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            N T++W GS VC+Y GV C+ + D+P ++TV+ +DLN  DIAG+LPEELGLL D+ +FH
Sbjct  71   NLTTNWFGSRVCDYNGVVCSESLDDPLVKTVSGVDLNQGDIAGHLPEELGLLTDIALFH  129



>emb|CDY02276.1| BnaA03g38910D [Brassica napus]
Length=605

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 85/121 (70%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRDEFGDRGERVT--VDPSLTFENDRIRNAYIALQAWKQAIISD  377
            L+D+E  +I +RQLL    E GD  + +   VD   TF N+R++ AYIALQAWK+A+ SD
Sbjct  27   LTDAEASFIAQRQLLTL-PENGDLPDDIEYEVDLKETFANNRLKRAYIALQAWKKAVYSD  85

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P NTT +W G  VC YTGVFCAPA D+P +  VA +DLN  DIAG+LP ELGL+ D+ +F
Sbjct  86   PFNTTGNWHGPHVCGYTGVFCAPALDDPSVAVVAGVDLNGADIAGHLPVELGLMTDVAMF  145

Query  558  H  560
            H
Sbjct  146  H  146



>gb|ABA99464.2| extensin-like domain containing protein, putative, expressed 
[Oryza sativa Japonica Group]
Length=544

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 81/123 (66%), Gaps = 6/123 (5%)
 Frame = +3

Query  207  SDSEVHYIQRRQLLYYRDEFGDRGE-----RVTVDPSLTFENDRIRNAYIALQAWKQAII  371
            SD+E  YI  RQLL  + E G  GE        +   +TF NDR+R AY+ LQA +QAI 
Sbjct  32   SDAEASYIAGRQLLSLK-EGGGNGELPDDFEFDIHVDVTFANDRLRRAYVGLQALRQAIY  90

Query  372  SDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLG  551
            SDP+N T  WVG+DVC+Y G+ CA A D+P +  VA +DLN  DIAGYLP ELGL+ DL 
Sbjct  91   SDPKNFTGGWVGADVCSYFGITCAAALDDPAVTVVAGVDLNGGDIAGYLPAELGLMTDLA  150

Query  552  VFH  560
            +FH
Sbjct  151  LFH  153



>emb|CDY31235.1| BnaC08g15300D [Brassica napus]
Length=743

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +3

Query  276  GERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPD  455
            G  + VDP L FEN ++R AYIALQ+WKQAI SDP N T++W GSDVC+Y G++CAP P 
Sbjct  30   GGHIKVDPKLKFENPKLREAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGIYCAPLPG  89

Query  456  N-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
               K R VA IDLNH D+AGYLP ELGLL DL +FH
Sbjct  90   AYNKTRVVAGIDLNHADMAGYLPSELGLLCDLALFH  125



>ref|XP_007225572.1| hypothetical protein PRUPE_ppa019759m1g, partial [Prunus persica]
 gb|EMJ26771.1| hypothetical protein PRUPE_ppa019759m1g, partial [Prunus persica]
Length=508

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +3

Query  294  DPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRT  473
            DP+L FEN R+R AYIALQAWK AI SDP N TS W GSDVC+Y GVFCAP       R 
Sbjct  1    DPTLKFENPRLRQAYIALQAWKAAIFSDPFNFTSSWNGSDVCSYMGVFCAPKSTGAHGRV  60

Query  474  VASIDLNHDDIAGYLPEELGLLADLGVFH  560
            VA IDLNH DIAGYLP ELGLL+DL +FH
Sbjct  61   VAGIDLNHADIAGYLPPELGLLSDLALFH  89



>ref|XP_002875655.1| hypothetical protein ARALYDRAFT_347509 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51914.1| hypothetical protein ARALYDRAFT_347509 [Arabidopsis lyrata subsp. 
lyrata]
Length=495

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +3

Query  297  PSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTV  476
            P+L FENDR++ AYIALQAWK+AI SDP  TT++WVGSDVC+Y GV+CAPA D+  +  V
Sbjct  76   PNLKFENDRLKRAYIALQAWKKAIYSDPFKTTANWVGSDVCSYNGVYCAPALDDDSLTVV  135

Query  477  ASIDLNHDDIAGYLPEELGLLADLGVFH  560
            A +DLNH DIAG+LP ELGL+ DL +FH
Sbjct  136  AGVDLNHADIAGHLPPELGLITDLALFH  163



>gb|KJB14547.1| hypothetical protein B456_002G130500 [Gossypium raimondii]
Length=613

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 81/121 (67%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRD--EFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            LSDSE  +I RRQLL   +  +  D  E   V    TFEN R+R AYIALQAWK A+ SD
Sbjct  37   LSDSETAFIARRQLLSLPEGGKLPDDYES-HVKLKFTFENPRLRRAYIALQAWKSAVHSD  95

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P  TT  W G +VC+Y GVFCA A D+ K+  VA ID+NH DIAGYLP ELGLL DL +F
Sbjct  96   PLKTTHSWEGPNVCDYKGVFCAQALDDRKLIVVAGIDINHADIAGYLPVELGLLTDLALF  155

Query  558  H  560
            H
Sbjct  156  H  156



>ref|XP_008224557.1| PREDICTED: leucine-rich repeat extensin-like protein 2 [Prunus 
mume]
Length=740

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = +3

Query  291  VDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIR  470
            VDP+L FEN R+R AYIALQAWK AI SDP N TS W GSDVC+Y GVFCAP       R
Sbjct  41   VDPTLKFENPRLRQAYIALQAWKAAIFSDPFNFTSSWNGSDVCSYMGVFCAPKSTGAHGR  100

Query  471  TVASIDLNHDDIAGYLPEELGLLADLGVFH  560
             VA IDLNH DIAGYLP ELGLL+DL +FH
Sbjct  101  VVAGIDLNHADIAGYLPPELGLLSDLALFH  130



>gb|KEH40754.1| pollen-specific LRR extensin-like protein [Medicago truncatula]
Length=665

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  279  ERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDN  458
            + VT  P+  F N+R+++AY+A QAWK AI SDP NTT +WVG+DVC+YTGVFCAPA D+
Sbjct  150  DSVTSFPATNFPNERLKHAYVAFQAWKDAIHSDPFNTTGNWVGTDVCSYTGVFCAPALDD  209

Query  459  PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH  560
            PK+  VA +DL H DIAG+LPEELGLL D  +FH
Sbjct  210  PKLNVVAGVDLTHADIAGHLPEELGLLKDAALFH  243



>ref|XP_002308630.2| hypothetical protein POPTR_0006s26190g [Populus trichocarpa]
 gb|EEE92153.2| hypothetical protein POPTR_0006s26190g [Populus trichocarpa]
Length=487

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +3

Query  303  LTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVAS  482
            L F+N R+R+AYIALQAWK AIISDP N TS+WVGSDVCNYTGVFCA + DN  I+TVA 
Sbjct  6    LKFDNPRLRSAYIALQAWKLAIISDPLNLTSNWVGSDVCNYTGVFCATSLDNSSIQTVAG  65

Query  483  IDLNHDDIAGYLPEELGLLADLGVFH  560
            IDLNH D+AG+L  ELGLL D+ +FH
Sbjct  66   IDLNHGDMAGHLVAELGLLTDIALFH  91



>ref|NP_001066960.1| Os12g0542200 [Oryza sativa Japonica Group]
 dbj|BAF29979.1| Os12g0542200 [Oryza sativa Japonica Group]
Length=760

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 83/125 (66%), Gaps = 10/125 (8%)
 Frame = +3

Query  207  SDSEVHYIQRRQLLYYRDEFGDRGER-------VTVDPSLTFENDRIRNAYIALQAWKQA  365
            SD+E  YI  RQLL  + E G  GE        + VD  +TF NDR+R AY+ LQA +QA
Sbjct  32   SDAEASYIAGRQLLSLK-EGGGNGELPDDFEFDIHVD--VTFANDRLRRAYVGLQALRQA  88

Query  366  IISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLAD  545
            I SDP+N T  WVG+DVC+Y G+ CA A D+P +  VA +DLN  DIAGYLP ELGL+ D
Sbjct  89   IYSDPKNFTGGWVGADVCSYFGITCAAALDDPAVTVVAGVDLNGGDIAGYLPAELGLMTD  148

Query  546  LGVFH  560
            L +FH
Sbjct  149  LALFH  153



>ref|XP_002885986.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62245.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=740

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 84/121 (69%), Gaps = 3/121 (2%)
 Frame = +3

Query  204  LSDSEVHYIQRRQLLYYRD--EFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  377
            L+D+E  +I +RQLL   +  E  D  E   VD  +TF N R++ AYIALQAWK+A+ SD
Sbjct  19   LTDAEASFIAQRQLLTLPENGELPDDIE-YEVDLKVTFANHRLKRAYIALQAWKKAVYSD  77

Query  378  PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF  557
            P NTT +W G  VC YTGVFCAPA D+P +  VA +DLN  DIAG+LP ELGL+ D+ +F
Sbjct  78   PFNTTGNWHGPHVCGYTGVFCAPALDDPNVAVVAGVDLNGADIAGHLPAELGLMTDVAMF  137

Query  558  H  560
            H
Sbjct  138  H  138



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880