BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS026E04

Length=629
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009623066.1|  PREDICTED: uncharacterized protein LOC104114346    223   2e-66   Nicotiana tomentosiformis
emb|CDP16156.1|  unnamed protein product                                221   1e-65   Coffea canephora [robusta coffee]
ref|XP_009627765.1|  PREDICTED: uncharacterized protein LOC104118259    219   5e-65   Nicotiana tomentosiformis
ref|XP_004245262.1|  PREDICTED: uncharacterized protein LOC101258883    218   1e-64   Solanum lycopersicum
ref|XP_009791161.1|  PREDICTED: uncharacterized protein LOC104238494    218   3e-64   Nicotiana sylvestris
ref|XP_011081835.1|  PREDICTED: uncharacterized protein LOC105164774    216   1e-63   Sesamum indicum [beniseed]
ref|XP_009783706.1|  PREDICTED: uncharacterized protein LOC104232253    216   1e-63   Nicotiana sylvestris
ref|XP_006366207.1|  PREDICTED: uncharacterized protein LOC102587...    214   4e-63   Solanum tuberosum [potatoes]
ref|XP_006366208.1|  PREDICTED: uncharacterized protein LOC102587...    214   4e-63   Solanum tuberosum [potatoes]
ref|XP_006340268.1|  PREDICTED: uncharacterized protein LOC102587334    213   9e-63   Solanum tuberosum [potatoes]
ref|XP_007012055.1|  Sulfite exporter TauE/SafE family protein          210   2e-61   
ref|XP_002284175.1|  PREDICTED: uncharacterized protein LOC100267889    210   2e-61   Vitis vinifera
ref|XP_008357417.1|  PREDICTED: uncharacterized protein LOC103421160    204   3e-61   
gb|KJB07537.1|  hypothetical protein B456_001G028700                    209   6e-61   Gossypium raimondii
ref|XP_010313606.1|  PREDICTED: uncharacterized protein LOC101255958    208   1e-60   Solanum lycopersicum
gb|KJB54849.1|  hypothetical protein B456_009G051700                    207   2e-60   Gossypium raimondii
gb|KJB54846.1|  hypothetical protein B456_009G051700                    207   2e-60   Gossypium raimondii
ref|XP_008347634.1|  PREDICTED: uncharacterized protein LOC103410...    204   3e-60   
ref|XP_009367912.1|  PREDICTED: uncharacterized protein LOC103957476    205   1e-59   Pyrus x bretschneideri [bai li]
ref|XP_008393890.1|  PREDICTED: uncharacterized protein LOC103456039    205   2e-59   
ref|XP_002516035.1|  conserved hypothetical protein                     205   2e-59   Ricinus communis
ref|XP_008220035.1|  PREDICTED: uncharacterized protein LOC103320179    204   3e-59   Prunus mume [ume]
ref|XP_006833308.1|  hypothetical protein AMTR_s00109p00049700          204   4e-59   Amborella trichopoda
gb|KDO79725.1|  hypothetical protein CISIN_1g011811mg                   201   6e-59   Citrus sinensis [apfelsine]
ref|XP_008347633.1|  PREDICTED: uncharacterized protein LOC103410...    203   7e-59   
gb|EYU21883.1|  hypothetical protein MIMGU_mgv1a005504mg                202   2e-58   Erythranthe guttata [common monkey flower]
ref|XP_010526181.1|  PREDICTED: uncharacterized protein LOC104803...    202   2e-58   Tarenaya hassleriana [spider flower]
ref|XP_010526182.1|  PREDICTED: uncharacterized protein LOC104803...    202   2e-58   Tarenaya hassleriana [spider flower]
gb|EYU21882.1|  hypothetical protein MIMGU_mgv1a005504mg                202   2e-58   Erythranthe guttata [common monkey flower]
gb|KDP37239.1|  hypothetical protein JCGZ_06295                         202   3e-58   Jatropha curcas
ref|XP_007222835.1|  hypothetical protein PRUPE_ppa005114mg             201   4e-58   Prunus persica
gb|KDO79723.1|  hypothetical protein CISIN_1g011811mg                   200   4e-58   Citrus sinensis [apfelsine]
dbj|BAK01650.1|  predicted protein                                      201   5e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010048100.1|  PREDICTED: uncharacterized protein LOC104436943    201   5e-58   Eucalyptus grandis [rose gum]
ref|XP_008799063.1|  PREDICTED: uncharacterized protein LOC103713782    201   6e-58   Phoenix dactylifera
ref|XP_010254104.1|  PREDICTED: uncharacterized protein LOC104595187    201   7e-58   Nelumbo nucifera [Indian lotus]
gb|KDP34212.1|  hypothetical protein JCGZ_07783                         201   7e-58   Jatropha curcas
ref|XP_006450629.1|  hypothetical protein CICLE_v10008167mg             201   8e-58   Citrus clementina [clementine]
ref|XP_011019654.1|  PREDICTED: uncharacterized protein LOC105122312    200   1e-57   Populus euphratica
ref|XP_002309560.2|  hypothetical protein POPTR_0006s25880g             200   1e-57   Populus trichocarpa [western balsam poplar]
gb|EPS70854.1|  hypothetical protein M569_03904                         200   1e-57   Genlisea aurea
ref|XP_006476094.1|  PREDICTED: uncharacterized protein LOC102623437    200   1e-57   Citrus sinensis [apfelsine]
gb|AAY63998.1|  unknown                                                 196   2e-57   Brassica napus [oilseed rape]
gb|KHG13748.1|  Flavonol synthase/flavanone 3-hydroxylase               194   3e-57   Gossypium arboreum [tree cotton]
ref|XP_004291206.1|  PREDICTED: uncharacterized protein LOC101310663    199   3e-57   Fragaria vesca subsp. vesca
dbj|BAG89362.1|  unnamed protein product                                195   4e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010915823.1|  PREDICTED: uncharacterized protein LOC105040818    198   5e-57   Elaeis guineensis
ref|XP_006294138.1|  hypothetical protein CARUB_v10023132mg             197   8e-57   Capsella rubella
ref|XP_003636475.1|  hypothetical protein MTR_042s0018                  197   8e-57   
ref|XP_010429580.1|  PREDICTED: uncharacterized protein LOC104714041    197   1e-56   Camelina sativa [gold-of-pleasure]
gb|EEC84400.1|  hypothetical protein OsI_30977                          197   1e-56   Oryza sativa Indica Group [Indian rice]
ref|XP_006660551.1|  PREDICTED: uncharacterized protein LOC102715329    196   2e-56   Oryza brachyantha
ref|XP_002878880.1|  hypothetical protein ARALYDRAFT_481426             196   3e-56   
ref|XP_009388715.1|  PREDICTED: uncharacterized protein LOC103975470    196   3e-56   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAZ42610.1|  hypothetical protein OsJ_27176                          195   5e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010109461.1|  hypothetical protein L484_001800                   196   5e-56   
ref|XP_002516571.1|  conserved hypothetical protein                     196   6e-56   
gb|EEE69518.1|  hypothetical protein OsJ_28979                          196   7e-56   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001062933.1|  Os09g0344800                                       196   7e-56   
ref|XP_010472594.1|  PREDICTED: uncharacterized protein LOC104752...    195   7e-56   Camelina sativa [gold-of-pleasure]
emb|CDX77007.1|  BnaC04g38020D                                          195   7e-56   
ref|XP_010472595.1|  PREDICTED: uncharacterized protein LOC104752...    195   7e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010249713.1|  PREDICTED: uncharacterized protein LOC104592186    195   7e-56   Nelumbo nucifera [Indian lotus]
ref|XP_009140696.1|  PREDICTED: uncharacterized protein LOC103864686    195   7e-56   Brassica rapa
emb|CDY35338.1|  BnaA04g15090D                                          195   8e-56   Brassica napus [oilseed rape]
ref|XP_010417351.1|  PREDICTED: uncharacterized protein LOC104703106    195   8e-56   Camelina sativa [gold-of-pleasure]
ref|NP_850068.1|  Sulfite exporter TauE/SafE family protein             195   9e-56   Arabidopsis thaliana [mouse-ear cress]
gb|EEC83519.1|  hypothetical protein OsI_29108                          195   9e-56   Oryza sativa Indica Group [Indian rice]
ref|XP_010924740.1|  PREDICTED: uncharacterized protein LOC105047500    195   1e-55   Elaeis guineensis
ref|XP_003578003.1|  PREDICTED: uncharacterized protein LOC100827421    195   1e-55   Brachypodium distachyon [annual false brome]
ref|NP_001061719.1|  Os08g0389700                                       194   1e-55   
gb|KHN42580.1|  hypothetical protein glysoja_042801                     194   1e-55   Glycine soja [wild soybean]
ref|XP_007137180.1|  hypothetical protein PHAVU_009G106400g             194   1e-55   Phaseolus vulgaris [French bean]
ref|XP_002303288.2|  hypothetical protein POPTR_0003s05180g             194   2e-55   
gb|KHN10230.1|  hypothetical protein glysoja_017834                     193   2e-55   Glycine soja [wild soybean]
ref|XP_011001600.1|  PREDICTED: uncharacterized protein LOC105108...    194   3e-55   Populus euphratica
ref|XP_011001598.1|  PREDICTED: uncharacterized protein LOC105108...    194   3e-55   Populus euphratica
ref|XP_010667910.1|  PREDICTED: uncharacterized protein LOC104884...    191   3e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003523730.1|  PREDICTED: uncharacterized protein LOC100809318    193   4e-55   Glycine max [soybeans]
ref|XP_006660104.1|  PREDICTED: uncharacterized protein LOC102707608    192   4e-55   
ref|XP_009409060.1|  PREDICTED: uncharacterized protein LOC103991...    193   5e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009409059.1|  PREDICTED: uncharacterized protein LOC103991...    193   6e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003527825.1|  PREDICTED: uncharacterized protein LOC100810784    192   9e-55   Glycine max [soybeans]
ref|XP_004501773.1|  PREDICTED: uncharacterized protein LOC101498079    192   1e-54   
ref|XP_011026589.1|  PREDICTED: uncharacterized protein LOC105127137    192   1e-54   Populus euphratica
ref|XP_010249715.1|  PREDICTED: uncharacterized protein LOC104592187    192   2e-54   Nelumbo nucifera [Indian lotus]
ref|XP_010062471.1|  PREDICTED: uncharacterized protein LOC104449877    191   2e-54   Eucalyptus grandis [rose gum]
ref|XP_009403528.1|  PREDICTED: uncharacterized protein LOC103987...    191   3e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403527.1|  PREDICTED: uncharacterized protein LOC103987...    191   3e-54   
ref|XP_009381051.1|  PREDICTED: uncharacterized protein LOC103969282    191   3e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010667904.1|  PREDICTED: uncharacterized protein LOC104884...    191   4e-54   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY70121.1|  BnaC03g72820D                                          190   4e-54   Brassica napus [oilseed rape]
dbj|BAJ87419.1|  predicted protein                                      191   5e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009133962.1|  PREDICTED: uncharacterized protein LOC103858367    190   5e-54   Brassica rapa
ref|XP_006405251.1|  hypothetical protein EUTSA_v10000151mg             189   1e-53   Eutrema salsugineum [saltwater cress]
ref|XP_010049082.1|  PREDICTED: uncharacterized protein LOC104437756    189   1e-53   Eucalyptus grandis [rose gum]
ref|XP_003636476.1|  hypothetical protein MTR_042s0018                  189   1e-53   
emb|CDX83221.1|  BnaA03g22850D                                          189   2e-53   
ref|XP_010235080.1|  PREDICTED: uncharacterized protein LOC100846...    188   2e-53   
gb|EMT12794.1|  hypothetical protein F775_19997                         188   2e-53   
ref|XP_009410875.1|  PREDICTED: uncharacterized protein LOC103992760    186   3e-53   
ref|XP_003574412.1|  PREDICTED: uncharacterized protein LOC100846...    188   3e-53   
ref|XP_010235081.1|  PREDICTED: uncharacterized protein LOC100846...    184   2e-52   Brachypodium distachyon [annual false brome]
gb|KDO56901.1|  hypothetical protein CISIN_1g0116821mg                  183   3e-52   Citrus sinensis [apfelsine]
gb|KDO56900.1|  hypothetical protein CISIN_1g0116821mg                  183   3e-52   Citrus sinensis [apfelsine]
gb|KDO56902.1|  hypothetical protein CISIN_1g0116821mg                  182   3e-52   Citrus sinensis [apfelsine]
ref|XP_011011436.1|  PREDICTED: uncharacterized protein LOC105116...    184   4e-52   Populus euphratica
ref|XP_004956625.1|  PREDICTED: uncharacterized protein LOC101768056    185   4e-52   Setaria italica
ref|XP_010048101.1|  PREDICTED: uncharacterized protein LOC104436...    185   4e-52   Eucalyptus grandis [rose gum]
ref|XP_010048102.1|  PREDICTED: uncharacterized protein LOC104436...    185   5e-52   
gb|KDP37236.1|  hypothetical protein JCGZ_06292                         183   7e-52   Jatropha curcas
ref|XP_008380922.1|  PREDICTED: uncharacterized protein LOC103443804    184   8e-52   Malus domestica [apple tree]
ref|XP_003574413.1|  PREDICTED: uncharacterized protein LOC100846...    184   1e-51   Brachypodium distachyon [annual false brome]
ref|XP_011011435.1|  PREDICTED: uncharacterized protein LOC105116...    184   1e-51   Populus euphratica
ref|XP_008466240.1|  PREDICTED: uncharacterized protein LOC103503714    184   1e-51   Cucumis melo [Oriental melon]
ref|XP_002284423.1|  PREDICTED: uncharacterized protein LOC100266912    184   1e-51   Vitis vinifera
gb|KDO79523.1|  hypothetical protein CISIN_1g011797mg                   181   1e-51   Citrus sinensis [apfelsine]
ref|XP_011011433.1|  PREDICTED: uncharacterized protein LOC105116...    184   2e-51   Populus euphratica
gb|KHN41986.1|  hypothetical protein glysoja_003726                     176   2e-51   Glycine soja [wild soybean]
tpg|DAA61110.1|  TPA: hypothetical protein ZEAMMB73_890925              182   2e-51   
ref|XP_003537580.2|  PREDICTED: uncharacterized protein LOC100817312    176   2e-51   
ref|XP_004136295.1|  PREDICTED: uncharacterized protein LOC101214783    183   2e-51   
ref|XP_004168635.1|  PREDICTED: uncharacterized LOC101214783            183   2e-51   
ref|XP_006426963.1|  hypothetical protein CICLE_v10025503mg             183   2e-51   Citrus clementina [clementine]
ref|XP_006465615.1|  PREDICTED: uncharacterized protein LOC102614...    183   3e-51   Citrus sinensis [apfelsine]
ref|XP_006465614.1|  PREDICTED: uncharacterized protein LOC102614...    183   4e-51   Citrus sinensis [apfelsine]
ref|XP_008792340.1|  PREDICTED: uncharacterized protein LOC103708984    182   5e-51   Phoenix dactylifera
ref|XP_002299704.2|  hypothetical protein POPTR_0001s18300g             182   6e-51   
ref|XP_007216108.1|  hypothetical protein PRUPE_ppa018715mg             181   6e-51   
ref|XP_003546436.1|  PREDICTED: uncharacterized protein LOC100816528    182   8e-51   
ref|XP_008651296.1|  PREDICTED: uncharacterized protein LOC100279...    182   9e-51   
ref|XP_002460084.1|  hypothetical protein SORBIDRAFT_02g022510          182   9e-51   Sorghum bicolor [broomcorn]
ref|XP_007046968.1|  DNA-directed RNA polymerase isoform 2              181   1e-50   
ref|XP_006595132.1|  PREDICTED: uncharacterized protein LOC100789...    181   2e-50   Glycine max [soybeans]
ref|XP_009353619.1|  PREDICTED: uncharacterized protein LOC103944866    181   2e-50   Pyrus x bretschneideri [bai li]
ref|XP_002516570.1|  conserved hypothetical protein                     181   2e-50   Ricinus communis
ref|XP_003542098.1|  PREDICTED: uncharacterized protein LOC100789...    181   2e-50   Glycine max [soybeans]
ref|XP_007046967.1|  Sulfite exporter TauE/SafE family protein, p...    180   3e-50   
gb|KDO79522.1|  hypothetical protein CISIN_1g011797mg                   180   4e-50   Citrus sinensis [apfelsine]
ref|XP_006425693.1|  hypothetical protein CICLE_v10025446mg             180   4e-50   Citrus clementina [clementine]
gb|KDO79521.1|  hypothetical protein CISIN_1g011797mg                   180   4e-50   Citrus sinensis [apfelsine]
gb|AEI72271.1|  hypothetical protein                                    177   4e-50   Citrus trifoliata [hardy orange]
ref|XP_007216479.1|  hypothetical protein PRUPE_ppa024737mg             180   5e-50   Prunus persica
gb|KHN36120.1|  hypothetical protein glysoja_003243                     179   6e-50   Glycine soja [wild soybean]
gb|EPS70855.1|  hypothetical protein M569_03905                         179   6e-50   Genlisea aurea
gb|ABR16333.1|  unknown                                                 180   7e-50   Picea sitchensis
ref|XP_006426964.1|  hypothetical protein CICLE_v10025511mg             179   7e-50   Citrus clementina [clementine]
emb|CDP02034.1|  unnamed protein product                                179   8e-50   Coffea canephora [robusta coffee]
ref|XP_003517231.1|  PREDICTED: uncharacterized protein LOC100801441    179   9e-50   Glycine max [soybeans]
ref|XP_006465610.1|  PREDICTED: uncharacterized protein LOC102613...    179   1e-49   
ref|XP_008228542.1|  PREDICTED: uncharacterized protein LOC103327945    179   1e-49   Prunus mume [ume]
ref|XP_010691331.1|  PREDICTED: uncharacterized protein LOC104904681    178   2e-49   Beta vulgaris subsp. vulgaris [field beet]
gb|AEI98632.1|  hypothetical protein 111018.19                          178   2e-49   Coffea canephora [robusta coffee]
ref|XP_011025767.1|  PREDICTED: uncharacterized protein LOC105126564    178   3e-49   Populus euphratica
ref|XP_002310222.2|  hypothetical protein POPTR_0007s12700g             178   3e-49   Populus trichocarpa [western balsam poplar]
ref|XP_006383214.1|  hypothetical protein POPTR_0005s12570g             177   4e-49   Populus trichocarpa [western balsam poplar]
ref|XP_008342687.1|  PREDICTED: uncharacterized protein LOC103405461    176   4e-49   
ref|XP_004512029.1|  PREDICTED: uncharacterized protein LOC101496...    178   5e-49   Cicer arietinum [garbanzo]
ref|XP_004512031.1|  PREDICTED: uncharacterized protein LOC101496...    178   6e-49   Cicer arietinum [garbanzo]
ref|XP_004512030.1|  PREDICTED: uncharacterized protein LOC101496...    178   6e-49   Cicer arietinum [garbanzo]
ref|XP_004512028.1|  PREDICTED: uncharacterized protein LOC101496...    178   6e-49   Cicer arietinum [garbanzo]
gb|KHM98753.1|  hypothetical protein glysoja_030806                     177   7e-49   Glycine soja [wild soybean]
ref|XP_010999980.1|  PREDICTED: uncharacterized protein LOC105107666    177   8e-49   Populus euphratica
ref|XP_008363110.1|  PREDICTED: uncharacterized protein LOC103426...    176   1e-48   Malus domestica [apple tree]
ref|XP_008363111.1|  PREDICTED: uncharacterized protein LOC103426...    176   1e-48   Malus domestica [apple tree]
ref|XP_010070053.1|  PREDICTED: uncharacterized protein LOC104456870    176   1e-48   Eucalyptus grandis [rose gum]
gb|KHN32619.1|  hypothetical protein glysoja_022301                     176   2e-48   Glycine soja [wild soybean]
ref|XP_002298219.2|  hypothetical protein POPTR_0001s18390g             175   2e-48   
ref|XP_009356692.1|  PREDICTED: uncharacterized protein LOC103947...    176   2e-48   Pyrus x bretschneideri [bai li]
ref|XP_008338104.1|  PREDICTED: uncharacterized protein LOC103401...    176   2e-48   Malus domestica [apple tree]
ref|XP_009356691.1|  PREDICTED: uncharacterized protein LOC103947...    176   2e-48   Pyrus x bretschneideri [bai li]
ref|XP_008338105.1|  PREDICTED: uncharacterized protein LOC103401...    176   2e-48   Malus domestica [apple tree]
ref|XP_009371582.1|  PREDICTED: uncharacterized protein LOC103960...    176   2e-48   Pyrus x bretschneideri [bai li]
ref|XP_007202022.1|  hypothetical protein PRUPE_ppa004997mg             176   2e-48   Prunus persica
ref|XP_009371583.1|  PREDICTED: uncharacterized protein LOC103960...    176   2e-48   Pyrus x bretschneideri [bai li]
gb|AAL27555.1|AF420410_1  hypothetical protein                          169   4e-48   Musa acuminata AAA Group [Cavendish banana]
ref|XP_003611976.1|  Membrane protein-like protein                      174   5e-48   Medicago truncatula
gb|ACJ86264.1|  unknown                                                 174   6e-48   Medicago truncatula
ref|XP_004232395.1|  PREDICTED: uncharacterized protein LOC101255155    174   6e-48   Solanum lycopersicum
ref|XP_008241663.1|  PREDICTED: uncharacterized protein LOC103340075    174   6e-48   Prunus mume [ume]
ref|XP_003629897.1|  hypothetical protein MTR_8g088080                  174   7e-48   
ref|XP_006340601.1|  PREDICTED: uncharacterized protein LOC102601548    174   7e-48   Solanum tuberosum [potatoes]
ref|XP_007150626.1|  hypothetical protein PHAVU_005G168100g             174   7e-48   Phaseolus vulgaris [French bean]
ref|XP_010254877.1|  PREDICTED: uncharacterized protein LOC104595...    171   7e-48   
gb|KJB40204.1|  hypothetical protein B456_007G050900                    174   8e-48   Gossypium raimondii
ref|XP_002516037.1|  conserved hypothetical protein                     174   8e-48   
ref|XP_004504238.1|  PREDICTED: uncharacterized protein LOC101507523    174   9e-48   
ref|XP_002521607.1|  conserved hypothetical protein                     174   1e-47   Ricinus communis
ref|XP_009788571.1|  PREDICTED: uncharacterized protein LOC104236361    173   1e-47   Nicotiana sylvestris
ref|XP_008228544.1|  PREDICTED: uncharacterized protein LOC103327946    173   2e-47   Prunus mume [ume]
ref|XP_009631525.1|  PREDICTED: uncharacterized protein LOC104121277    172   3e-47   
ref|XP_007156932.1|  hypothetical protein PHAVU_002G029400g             172   5e-47   Phaseolus vulgaris [French bean]
ref|XP_009346009.1|  PREDICTED: uncharacterized protein LOC103937781    172   5e-47   Pyrus x bretschneideri [bai li]
ref|XP_002324817.1|  hypothetical protein POPTR_0018s00760g             171   6e-47   Populus trichocarpa [western balsam poplar]
gb|KJB18685.1|  hypothetical protein B456_003G065000                    171   7e-47   Gossypium raimondii
gb|KJB18684.1|  hypothetical protein B456_003G065000                    171   7e-47   Gossypium raimondii
gb|AAC42255.1|  hypothetical protein                                    175   9e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007024174.1|  Sulfite exporter TauE/SafE family protein, p...    171   1e-46   
ref|XP_010254876.1|  PREDICTED: uncharacterized protein LOC104595...    171   1e-46   Nelumbo nucifera [Indian lotus]
gb|KDP38300.1|  hypothetical protein JCGZ_05186                         171   1e-46   Jatropha curcas
ref|XP_010935066.1|  PREDICTED: uncharacterized protein LOC105055061    171   2e-46   Elaeis guineensis
ref|XP_004287906.1|  PREDICTED: uncharacterized protein LOC101304510    170   2e-46   Fragaria vesca subsp. vesca
ref|XP_008353719.1|  PREDICTED: uncharacterized protein LOC103417306    174   2e-46   
ref|XP_002516036.1|  conserved hypothetical protein                     169   4e-46   
gb|KJB43508.1|  hypothetical protein B456_007G203800                    168   4e-46   Gossypium raimondii
ref|XP_004959391.1|  PREDICTED: uncharacterized protein LOC101762929    169   5e-46   
ref|XP_004509250.1|  PREDICTED: uncharacterized protein LOC101512581    169   6e-46   Cicer arietinum [garbanzo]
ref|XP_010680799.1|  PREDICTED: uncharacterized protein LOC104895...    169   8e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010680798.1|  PREDICTED: uncharacterized protein LOC104895...    169   8e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004302906.1|  PREDICTED: uncharacterized protein LOC101294...    169   9e-46   Fragaria vesca subsp. vesca
ref|XP_007217721.1|  hypothetical protein PRUPE_ppa005105mg             168   9e-46   
gb|KHG02837.1|  ATP synthase subunit delta                              168   1e-45   Gossypium arboreum [tree cotton]
ref|XP_009592781.1|  PREDICTED: uncharacterized protein LOC104089...    168   1e-45   Nicotiana tomentosiformis
gb|KJB43509.1|  hypothetical protein B456_007G203800                    168   1e-45   Gossypium raimondii
ref|XP_009800425.1|  PREDICTED: uncharacterized protein LOC104246...    168   1e-45   Nicotiana sylvestris
ref|XP_011466694.1|  PREDICTED: uncharacterized protein LOC101294...    168   2e-45   Fragaria vesca subsp. vesca
ref|XP_009353615.1|  PREDICTED: uncharacterized protein LOC103944864    168   2e-45   
ref|XP_008670142.1|  PREDICTED: uncharacterized protein LOC103647377    166   2e-45   
ref|XP_011026588.1|  PREDICTED: uncharacterized protein LOC105127135    167   2e-45   Populus euphratica
ref|XP_008380919.1|  PREDICTED: uncharacterized protein LOC103443803    167   3e-45   
gb|KJB56746.1|  hypothetical protein B456_009G134400                    167   3e-45   Gossypium raimondii
ref|XP_008228546.1|  PREDICTED: uncharacterized protein LOC103327...    167   3e-45   Prunus mume [ume]
ref|XP_003527721.1|  PREDICTED: uncharacterized protein LOC100789748    167   4e-45   Glycine max [soybeans]
ref|XP_010263696.1|  PREDICTED: uncharacterized protein LOC104601887    167   4e-45   Nelumbo nucifera [Indian lotus]
gb|EMT09652.1|  hypothetical protein F775_10698                         162   5e-45   
ref|NP_001061712.1|  Os08g0387200                                       166   5e-45   
gb|EAZ06861.1|  hypothetical protein OsI_29096                          166   6e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_006659358.1|  PREDICTED: uncharacterized protein LOC102716712    166   6e-45   Oryza brachyantha
gb|AET04372.2|  sulfite exporter TauE/SafE family protein               166   7e-45   Medicago truncatula
tpg|DAA39926.1|  TPA: hypothetical protein ZEAMMB73_327447              166   1e-44   
ref|XP_006585192.1|  PREDICTED: uncharacterized protein LOC100801244    164   1e-44   Glycine max [soybeans]
ref|XP_010113488.1|  hypothetical protein L484_026823                   165   1e-44   
ref|XP_006580862.1|  PREDICTED: uncharacterized protein LOC100818240    164   2e-44   
ref|XP_006465613.1|  PREDICTED: uncharacterized protein LOC102613991    163   2e-44   Citrus sinensis [apfelsine]
ref|XP_011009831.1|  PREDICTED: uncharacterized protein LOC105114838    165   2e-44   Populus euphratica
gb|ABC47842.1|  membrane protein-like protein                           165   2e-44   Glycine max [soybeans]
ref|XP_003523605.1|  PREDICTED: uncharacterized protein LOC100816633    165   2e-44   Glycine max [soybeans]
gb|KHN06458.1|  hypothetical protein glysoja_010802                     165   2e-44   Glycine soja [wild soybean]
ref|XP_007159525.1|  hypothetical protein PHAVU_002G244800g             162   3e-44   Phaseolus vulgaris [French bean]
ref|XP_007159526.1|  hypothetical protein PHAVU_002G244900g             164   3e-44   Phaseolus vulgaris [French bean]
gb|KHN48050.1|  hypothetical protein glysoja_015520                     164   3e-44   Glycine soja [wild soybean]
gb|AET03944.2|  sulfite exporter TauE/SafE family protein               164   4e-44   Medicago truncatula
ref|XP_003629468.1|  hypothetical protein MTR_8g077830                  164   4e-44   
ref|XP_003532779.1|  PREDICTED: uncharacterized protein LOC100801788    164   5e-44   Glycine max [soybeans]
gb|AFK35007.1|  unknown                                                 163   6e-44   Medicago truncatula
ref|XP_006580197.1|  PREDICTED: uncharacterized protein LOC100818778    163   7e-44   Glycine max [soybeans]
ref|XP_010649158.1|  PREDICTED: uncharacterized protein LOC100253061    163   7e-44   Vitis vinifera
gb|EMS53169.1|  hypothetical protein TRIUR3_09961                       164   1e-43   Triticum urartu
ref|XP_009784625.1|  PREDICTED: uncharacterized protein LOC104233...    160   2e-43   Nicotiana sylvestris
ref|XP_006585193.1|  PREDICTED: uncharacterized protein LOC100802321    162   3e-43   Glycine max [soybeans]
gb|ACJ85296.1|  unknown                                                 162   3e-43   Medicago truncatula
ref|XP_007159524.1|  hypothetical protein PHAVU_002G244800g             161   3e-43   Phaseolus vulgaris [French bean]
ref|XP_008783526.1|  PREDICTED: uncharacterized protein LOC103702749    161   6e-43   
ref|XP_006343068.1|  PREDICTED: uncharacterized protein LOC102587...    160   9e-43   Solanum tuberosum [potatoes]
ref|XP_009613204.1|  PREDICTED: uncharacterized protein LOC104106373    160   1e-42   Nicotiana tomentosiformis
ref|XP_007156036.1|  hypothetical protein PHAVU_003G253000g             160   1e-42   Phaseolus vulgaris [French bean]
gb|KJB54850.1|  hypothetical protein B456_009G051700                    159   1e-42   Gossypium raimondii
ref|XP_007159577.1|  hypothetical protein PHAVU_002G249100g             159   2e-42   Phaseolus vulgaris [French bean]
ref|XP_009396550.1|  PREDICTED: uncharacterized protein LOC103981523    159   2e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007012056.1|  Membrane protein-like, putative                    160   2e-42   
ref|XP_009784620.1|  PREDICTED: uncharacterized protein LOC104233...    159   3e-42   Nicotiana sylvestris
ref|XP_006580198.1|  PREDICTED: uncharacterized protein LOC100819316    159   3e-42   Glycine max [soybeans]
ref|XP_004235668.1|  PREDICTED: uncharacterized protein LOC101262796    158   5e-42   
ref|XP_002460083.1|  hypothetical protein SORBIDRAFT_02g022500          158   5e-42   
ref|XP_011466685.1|  PREDICTED: uncharacterized protein LOC101291...    156   2e-41   Fragaria vesca subsp. vesca
ref|XP_004305285.1|  PREDICTED: uncharacterized protein LOC101291...    156   2e-41   Fragaria vesca subsp. vesca
ref|XP_006369186.1|  hypothetical protein POPTR_0001s18380g             155   3e-41   
gb|EYU21457.1|  hypothetical protein MIMGU_mgv1a005411mg                156   3e-41   Erythranthe guttata [common monkey flower]
ref|XP_007159523.1|  hypothetical protein PHAVU_002G244700g             155   5e-41   Phaseolus vulgaris [French bean]
ref|XP_010314287.1|  PREDICTED: uncharacterized protein LOC101268...    155   6e-41   Solanum lycopersicum
ref|XP_010314281.1|  PREDICTED: uncharacterized protein LOC101268...    155   1e-40   
ref|XP_009800426.1|  PREDICTED: uncharacterized protein LOC104246...    154   1e-40   Nicotiana sylvestris
ref|XP_006359451.1|  PREDICTED: uncharacterized protein LOC102590...    154   3e-40   Solanum tuberosum [potatoes]
ref|XP_004504239.1|  PREDICTED: uncharacterized protein LOC101507...    153   3e-40   Cicer arietinum [garbanzo]
ref|XP_011014738.1|  PREDICTED: uncharacterized protein LOC105118467    151   4e-40   Populus euphratica
ref|XP_009592782.1|  PREDICTED: uncharacterized protein LOC104089...    152   9e-40   Nicotiana tomentosiformis
gb|AFK45505.1|  unknown                                                 147   3e-39   Lotus japonicus
ref|XP_009338074.1|  PREDICTED: uncharacterized protein LOC103930452    150   3e-39   
ref|XP_009338073.1|  PREDICTED: uncharacterized protein LOC103930451    150   5e-39   
ref|XP_009777903.1|  PREDICTED: uncharacterized protein LOC104227...    149   9e-39   
ref|XP_009394307.1|  PREDICTED: uncharacterized protein LOC103979817    149   1e-38   
ref|XP_011072363.1|  PREDICTED: uncharacterized protein LOC105157640    149   1e-38   
ref|XP_007216194.1|  hypothetical protein PRUPE_ppa015991mg             148   1e-38   
ref|XP_009777896.1|  PREDICTED: uncharacterized protein LOC104227...    149   2e-38   
ref|XP_008228601.1|  PREDICTED: uncharacterized protein LOC103327990    148   2e-38   
ref|XP_004498483.1|  PREDICTED: uncharacterized protein LOC101508...    148   3e-38   
ref|XP_004498484.1|  PREDICTED: uncharacterized protein LOC101508...    148   3e-38   
ref|XP_006833307.1|  hypothetical protein AMTR_s00109p00047950          147   4e-38   
ref|XP_009611253.1|  PREDICTED: uncharacterized protein LOC104104...    147   4e-38   
ref|XP_008342674.1|  PREDICTED: uncharacterized protein LOC103405448    147   7e-38   
gb|KEH35985.1|  sulfite exporter TauE/SafE family protein               146   1e-37   
gb|KHG04871.1|  hypothetical protein F383_28778                         142   2e-36   
emb|CDO98032.1|  unnamed protein product                                142   3e-36   
ref|XP_004302905.1|  PREDICTED: uncharacterized protein LOC101293605    142   3e-36   
gb|KEH40300.1|  sulfite exporter TauE/SafE family protein               140   2e-35   
ref|XP_007161545.1|  hypothetical protein PHAVU_001G078400g             131   3e-35   
ref|XP_010098073.1|  hypothetical protein L484_026205                   139   4e-35   
gb|KHN48052.1|  hypothetical protein glysoja_015522                     135   5e-34   
gb|KHN06459.1|  hypothetical protein glysoja_010803                     133   5e-33   
ref|XP_003629896.1|  hypothetical protein MTR_8g088070                  133   7e-33   
ref|XP_006359480.1|  PREDICTED: uncharacterized protein LOC102600300    132   1e-32   
ref|XP_004504240.1|  PREDICTED: uncharacterized protein LOC101507...    131   3e-32   
gb|EMS49201.1|  hypothetical protein TRIUR3_18274                       126   3e-32   
gb|EMS50771.1|  hypothetical protein TRIUR3_13143                       126   9e-31   
ref|XP_008228549.1|  PREDICTED: uncharacterized protein LOC103327...    126   1e-30   
gb|EMT22888.1|  hypothetical protein F775_28607                         125   2e-30   
ref|XP_003611978.1|  Membrane protein-like protein                      119   3e-30   
ref|XP_003636267.1|  Membrane protein-like protein                      118   4e-30   
gb|AES94936.2|  membrane-like protein, putative                         118   4e-30   
ref|XP_006596173.1|  PREDICTED: uncharacterized protein LOC100781...    125   5e-30   
ref|XP_008228548.1|  PREDICTED: uncharacterized protein LOC103327...    125   5e-30   
ref|XP_007161342.1|  hypothetical protein PHAVU_001G061000g             124   9e-30   
gb|EMT16950.1|  hypothetical protein F775_12779                         124   1e-29   
ref|XP_004246584.1|  PREDICTED: uncharacterized protein LOC101249675    118   1e-27   
ref|XP_006651766.1|  PREDICTED: uncharacterized protein LOC102721538    117   3e-27   
gb|KHG12656.1|  putative tripeptidyl-peptidase SED4                     116   4e-27   
gb|KJB15102.1|  hypothetical protein B456_002G160300                    115   6e-27   
ref|XP_009592783.1|  PREDICTED: uncharacterized protein LOC104089...    115   6e-27   
ref|XP_006341192.1|  PREDICTED: uncharacterized protein LOC102602443    116   6e-27   
gb|KJB15099.1|  hypothetical protein B456_002G160300                    115   7e-27   
ref|XP_006596174.1|  PREDICTED: uncharacterized protein LOC100781...    115   8e-27   
gb|KJB15098.1|  hypothetical protein B456_002G160300                    115   9e-27   
gb|KHN04837.1|  hypothetical protein glysoja_047520                     115   1e-26   
ref|XP_009143571.1|  PREDICTED: uncharacterized protein LOC103867...    115   1e-26   
gb|KJB15101.1|  hypothetical protein B456_002G160300                    115   1e-26   
gb|KHN06457.1|  hypothetical protein glysoja_010801                     115   1e-26   
ref|XP_007027568.1|  Sulfite exporter TauE/SafE family protein is...    115   1e-26   
ref|XP_007027567.1|  Sulfite exporter TauE/SafE family protein is...    115   1e-26   
ref|XP_009388390.1|  PREDICTED: uncharacterized protein LOC103975...    115   1e-26   
ref|XP_009143570.1|  PREDICTED: uncharacterized protein LOC103867...    115   1e-26   
emb|CDX75027.1|  BnaA05g07730D                                          115   2e-26   
ref|XP_009388389.1|  PREDICTED: uncharacterized protein LOC103975...    115   2e-26   
emb|CDY33170.1|  BnaC04g08690D                                          115   2e-26   
ref|XP_004981916.1|  PREDICTED: uncharacterized protein LOC101758770    114   3e-26   
gb|EYU41559.1|  hypothetical protein MIMGU_mgv1a005977mg                114   3e-26   
ref|XP_006381336.1|  hypothetical protein POPTR_0006s11920g             114   4e-26   
ref|XP_009803774.1|  PREDICTED: uncharacterized protein LOC104249090    114   4e-26   
ref|XP_011101500.1|  PREDICTED: uncharacterized protein LOC105179547    113   7e-26   
ref|NP_001051136.1|  Os03g0726500                                       113   1e-25   
gb|EAY91726.1|  hypothetical protein OsI_13369                          112   1e-25   
ref|XP_011094444.1|  PREDICTED: uncharacterized protein LOC105174142    112   1e-25   
ref|XP_009615566.1|  PREDICTED: uncharacterized protein LOC104108278    112   2e-25   
ref|XP_009611256.1|  PREDICTED: uncharacterized protein LOC104104...    112   2e-25   
ref|XP_008387475.1|  PREDICTED: uncharacterized protein LOC103449926    112   2e-25   
ref|XP_009340971.1|  PREDICTED: uncharacterized protein LOC103933044    111   3e-25   
ref|XP_011018859.1|  PREDICTED: uncharacterized protein LOC105121770    111   3e-25   
emb|CDP15335.1|  unnamed protein product                                111   3e-25   
ref|XP_009777900.1|  PREDICTED: uncharacterized protein LOC104227...    111   3e-25   
ref|XP_010243123.1|  PREDICTED: uncharacterized protein LOC104587275    111   3e-25   
ref|XP_010683928.1|  PREDICTED: uncharacterized protein LOC104898535    111   4e-25   
ref|XP_006410834.1|  hypothetical protein EUTSA_v10016620mg             110   4e-25   
gb|KJB54847.1|  hypothetical protein B456_009G051700                    110   5e-25   
ref|XP_009603782.1|  PREDICTED: uncharacterized protein LOC104098687    110   5e-25   
gb|ABK22903.1|  unknown                                                 104   6e-25   
gb|EEE59848.1|  hypothetical protein OsJ_12424                          110   6e-25   
ref|XP_006410835.1|  hypothetical protein EUTSA_v10016620mg             110   8e-25   
gb|EYU38596.1|  hypothetical protein MIMGU_mgv1a005752mg                110   1e-24   
ref|XP_010527869.1|  PREDICTED: uncharacterized protein LOC104805133    110   1e-24   
ref|XP_010936218.1|  PREDICTED: uncharacterized protein LOC105055...    110   1e-24   
ref|XP_007145273.1|  hypothetical protein PHAVU_007G225100g             109   1e-24   
ref|XP_010505210.1|  PREDICTED: uncharacterized protein LOC104782082    109   1e-24   
gb|KHN48208.1|  hypothetical protein glysoja_007877                     109   1e-24   
gb|KEH24087.1|  sulfite exporter TauE/SafE family protein               108   2e-24   
ref|XP_006594178.1|  PREDICTED: uncharacterized protein LOC100804918    109   2e-24   
gb|KHN45702.1|  hypothetical protein glysoja_036851                     109   2e-24   
gb|KEH24086.1|  sulfite exporter TauE/SafE family protein               108   2e-24   
ref|XP_008462667.1|  PREDICTED: uncharacterized protein LOC103500970    108   2e-24   
ref|XP_002881456.1|  hypothetical protein ARALYDRAFT_902780             108   3e-24   
ref|XP_004494124.1|  PREDICTED: uncharacterized protein LOC101492516    108   3e-24   
ref|XP_009760234.1|  PREDICTED: uncharacterized protein LOC104212618    108   3e-24   
gb|KEH24085.1|  sulfite exporter TauE/SafE family protein               108   3e-24   
ref|NP_001168709.1|  uncharacterized protein LOC100382501               108   4e-24   
ref|XP_010516887.1|  PREDICTED: uncharacterized protein LOC104792440    108   4e-24   
ref|XP_006588810.1|  PREDICTED: uncharacterized protein LOC100788770    108   4e-24   
ref|XP_010558974.1|  PREDICTED: uncharacterized protein LOC104827497    108   4e-24   
ref|XP_002463955.1|  hypothetical protein SORBIDRAFT_01g009520          108   4e-24   
ref|XP_010278281.1|  PREDICTED: uncharacterized protein LOC104612536    107   7e-24   
ref|NP_850267.1|  Sulfite exporter TauE/SafE family protein             107   7e-24   
ref|XP_003553577.1|  PREDICTED: uncharacterized protein LOC100807336    107   7e-24   
gb|KDP29233.1|  hypothetical protein JCGZ_16622                         107   7e-24   
ref|XP_003560372.1|  PREDICTED: uncharacterized protein LOC100844938    107   8e-24   
ref|XP_002528632.1|  conserved hypothetical protein                     107   1e-23   
ref|XP_004143372.1|  PREDICTED: uncharacterized protein LOC101206149    107   1e-23   
ref|XP_010509452.1|  PREDICTED: uncharacterized protein LOC104785865    107   1e-23   
gb|KJB15100.1|  hypothetical protein B456_002G160300                    106   2e-23   
ref|XP_008790425.1|  PREDICTED: uncharacterized protein LOC103707634    106   2e-23   
gb|KJB07538.1|  hypothetical protein B456_001G028700                    105   3e-23   
ref|XP_006838739.1|  hypothetical protein AMTR_s00002p00254220          105   4e-23   
ref|XP_002283988.1|  PREDICTED: uncharacterized protein LOC100240792    105   4e-23   
gb|KHG01219.1|  hypothetical protein F383_22307                         105   4e-23   
ref|XP_010050180.1|  PREDICTED: uncharacterized protein LOC104438693    105   4e-23   
ref|XP_007202039.1|  hypothetical protein PRUPE_ppa005330mg             105   4e-23   
ref|XP_008241334.1|  PREDICTED: uncharacterized protein LOC103339...    105   5e-23   
ref|XP_008241333.1|  PREDICTED: uncharacterized protein LOC103339...    105   5e-23   
ref|XP_004303051.1|  PREDICTED: uncharacterized protein LOC101313325    105   7e-23   
gb|KDO57298.1|  hypothetical protein CISIN_1g048232mg                   104   8e-23   
gb|KJB62289.1|  hypothetical protein B456_009G410000                    103   8e-23   
ref|XP_006481932.1|  PREDICTED: uncharacterized protein LOC102623178    104   1e-22   
ref|XP_006430350.1|  hypothetical protein CICLE_v10011694mg             104   1e-22   
gb|KJB62286.1|  hypothetical protein B456_009G410000                    103   2e-22   
gb|KEH40299.1|  sulfite exporter TauE/SafE family protein               102   4e-22   
dbj|BAK00649.1|  predicted protein                                      102   5e-22   
gb|EMS67477.1|  hypothetical protein TRIUR3_25438                     99.0    5e-22   
ref|XP_004498087.1|  PREDICTED: uncharacterized protein LOC101512728    102   5e-22   
gb|KDP37237.1|  hypothetical protein JCGZ_06293                         100   1e-21   
gb|KEH35984.1|  sulfite exporter TauE/SafE family protein             97.8    2e-20   
ref|XP_006294156.1|  hypothetical protein CARUB_v10023149mg           97.8    3e-20   
gb|KHN02273.1|  60S ribosomal protein L24                             96.3    2e-19   
ref|XP_008795085.1|  PREDICTED: uncharacterized protein LOC103710932  94.0    4e-19   
ref|XP_007159527.1|  hypothetical protein PHAVU_002G2450001g          86.7    2e-18   
gb|KDP37238.1|  hypothetical protein JCGZ_06294                       90.1    3e-18   
ref|XP_007159528.1|  hypothetical protein PHAVU_002G2450000g          89.7    1e-17   
gb|ACY95275.1|  unknown                                               84.3    3e-17   
gb|KDO56904.1|  hypothetical protein CISIN_1g0454881mg                82.8    5e-17   
gb|AES60654.2|  sulfite exporter TauE/SafE family protein             89.0    5e-17   
gb|EPS64071.1|  hypothetical protein M569_10711                       81.3    3e-16   
gb|KEH24089.1|  sulfite exporter TauE/SafE family protein             84.3    1e-15   
gb|EMT30170.1|  hypothetical protein F775_26300                       83.6    2e-15   
ref|XP_009611257.1|  PREDICTED: uncharacterized protein LOC104104...  80.5    3e-14   
ref|XP_006426967.1|  hypothetical protein CICLE_v10025511mg           75.5    4e-13   
ref|XP_002968975.1|  hypothetical protein SELMODRAFT_170159           75.1    7e-13   
ref|XP_002990023.1|  hypothetical protein SELMODRAFT_184956           75.1    1e-12   
ref|XP_003590403.1|  hypothetical protein MTR_1g061710                75.5    2e-12   
ref|XP_009777901.1|  PREDICTED: uncharacterized protein LOC104227...  73.6    7e-12   
ref|XP_007024175.1|  Sulfite exporter TauE/SafE family protein, p...  71.6    3e-11   
ref|XP_007161546.1|  hypothetical protein PHAVU_001G078500g           70.1    7e-11   
ref|XP_001774657.1|  predicted protein                                68.6    3e-10   
ref|XP_010104542.1|  hypothetical protein L484_025516                 64.7    8e-10   
ref|XP_006425694.1|  hypothetical protein CICLE_v10025446mg           67.0    1e-09   
ref|XP_007217409.1|  hypothetical protein PRUPE_ppa025656mg           64.7    2e-09   
ref|XP_002974406.1|  hypothetical protein SELMODRAFT_414563           65.9    2e-09   
gb|EMS56955.1|  hypothetical protein TRIUR3_23950                     64.7    7e-09   
ref|NP_001175555.1|  Os08g0389733                                     60.1    8e-09   
ref|XP_002460081.1|  hypothetical protein SORBIDRAFT_02g022480        63.9    8e-09   
ref|XP_002985707.1|  hypothetical protein SELMODRAFT_446339           63.2    2e-08   
ref|XP_006450630.1|  hypothetical protein CICLE_v10010242mg           61.6    2e-08   
gb|KJB40205.1|  hypothetical protein B456_007G050900                  62.4    3e-08   
ref|XP_006589072.1|  PREDICTED: uncharacterized protein LOC100806...  59.3    5e-08   
ref|XP_004514668.1|  PREDICTED: uncharacterized protein LOC101497...  57.4    1e-07   
ref|XP_002962601.1|  hypothetical protein SELMODRAFT_65204            60.8    1e-07   
ref|XP_002980486.1|  hypothetical protein SELMODRAFT_55219            60.8    1e-07   
ref|XP_004514669.1|  PREDICTED: uncharacterized protein LOC101497...  57.0    2e-07   
gb|KDO79726.1|  hypothetical protein CISIN_1g039794mg                 58.9    2e-07   
gb|KHN24669.1|  Succinate dehydrogenase [ubiquinone] iron-sulfur ...  59.3    2e-07   
emb|CAN61520.1|  hypothetical protein VITISV_033969                   40.0    1e-06   
ref|XP_007203428.1|  hypothetical protein PRUPE_ppa021619mg           55.1    8e-06   
ref|XP_001762486.1|  predicted protein                                53.1    4e-05   
ref|XP_009611258.1|  PREDICTED: uncharacterized protein LOC104104...  51.6    1e-04   
ref|XP_009777905.1|  PREDICTED: uncharacterized protein LOC104227...  50.4    4e-04   
ref|XP_003636488.1|  hypothetical protein MTR_042s0030                47.8    8e-04   



>ref|XP_009623066.1| PREDICTED: uncharacterized protein LOC104114346 [Nicotiana tomentosiformis]
Length=483

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            + LYWVVNLLQIPVSLGV+ +EA  LYKGWR+I SKGD G+N R  QLIVYCFFG++AG+
Sbjct  293  TALYWVVNLLQIPVSLGVSSYEAISLYKGWRRIESKGDQGTNFRVLQLIVYCFFGVVAGM  352

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGP+FLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYA + 
Sbjct  353  VGGLLGLGGGFIMGPMFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAAYF  412

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVATVAA +GQHVVRR+I +LGRASLIIFILAFTIFVSAISLGGVGISNMIEKI +HEY
Sbjct  413  VAVATVAALVGQHVVRRMIVILGRASLIIFILAFTIFVSAISLGGVGISNMIEKIQHHEY  472

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  473  MGFENLCKY  481



>emb|CDP16156.1| unnamed protein product [Coffea canephora]
Length=482

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S LYWVVNLLQIPVS GV+ FEA  LYKGWRKI+SKGD+G+N +  QLI YCFFG++AGV
Sbjct  292  SALYWVVNLLQIPVSFGVSSFEAFSLYKGWRKIASKGDTGTNFKVHQLITYCFFGVLAGV  351

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMMFS+SMSVVEYYLLKRFPVPYAL+ 
Sbjct  352  VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMMFSASMSVVEYYLLKRFPVPYALYF  411

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVATVAAFIGQH VRR+I +LGRASLIIFILAFTIFVSAISLGGVGISNMI KI +HEY
Sbjct  412  IAVATVAAFIGQHFVRRIIILLGRASLIIFILAFTIFVSAISLGGVGISNMIGKIEHHEY  471

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  472  MGFENLCKY  480



>ref|XP_009627765.1| PREDICTED: uncharacterized protein LOC104118259 [Nicotiana tomentosiformis]
Length=478

 Score =   219 bits (559),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW VNLLQIPVS+GV+ FEA  LYKGWRKI SKG+ G+N R  QLIVYCFFG++AG+
Sbjct  288  SVWYWAVNLLQIPVSVGVSSFEAISLYKGWRKIQSKGEDGTNFRVMQLIVYCFFGILAGL  347

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  348  VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYF  407

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVATVAAF+GQHVVRRLI VLGRASLIIFILAFTIFVSAISLGGVGISNMI KI  HEY
Sbjct  408  VAVATVAAFVGQHVVRRLIVVLGRASLIIFILAFTIFVSAISLGGVGISNMIGKIQRHEY  467

Query  542  MGFENLCKYGV  574
            MGFENLCKY V
Sbjct  468  MGFENLCKYEV  478



>ref|XP_004245262.1| PREDICTED: uncharacterized protein LOC101258883 [Solanum lycopersicum]
Length=476

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            + LYWVVNLLQIPV+LGV+ +EA  LYKGWR+I SKG+ G+N R  QLIVYCFFG++AG+
Sbjct  286  TPLYWVVNLLQIPVALGVSSYEAVSLYKGWRRIESKGEDGTNFRVMQLIVYCFFGIVAGM  345

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGP+FLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  346  VGGLLGLGGGFIMGPMFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYF  405

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVATVAA IGQHVVRR+I +LGRASLIIFILA TIFVSAISLGGVGISNMI KI  HEY
Sbjct  406  VAVATVAALIGQHVVRRMIMILGRASLIIFILASTIFVSAISLGGVGISNMIGKIQRHEY  465

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  466  MGFENLCKY  474



>ref|XP_009791161.1| PREDICTED: uncharacterized protein LOC104238494 [Nicotiana sylvestris]
Length=483

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            + LYWVVNLLQIPVSLGV+ +EA  LYKGWR+I SKG+ G+N R  QLIVYCFFG++AG+
Sbjct  293  TALYWVVNLLQIPVSLGVSSYEAISLYKGWRRIDSKGEQGTNFRVLQLIVYCFFGVVAGI  352

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGP+FLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYA + 
Sbjct  353  VGGLLGLGGGFIMGPMFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAAYF  412

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVATVAA +GQHVVRR+I +LGRASLIIFILAFTIFVSAISLGGVGISNMI KI  HEY
Sbjct  413  VAVATVAALVGQHVVRRMIVILGRASLIIFILAFTIFVSAISLGGVGISNMIGKIERHEY  472

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  473  MGFENLCKY  481



>ref|XP_011081835.1| PREDICTED: uncharacterized protein LOC105164774 [Sesamum indicum]
Length=480

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            STLYWVVNLLQ+PVS GV+ +EA  LYKGWRKI SKGD G+N +  QL+ Y FFG++AG+
Sbjct  290  STLYWVVNLLQVPVSFGVSGYEAVSLYKGWRKIGSKGDEGTNFKVHQLLTYGFFGVLAGM  349

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  350  VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYF  409

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVAT+AAFIGQHVVR+LI VLGRAS+IIFIL+FTIFVSAISLGGVGISNMI KI  HEY
Sbjct  410  VAVATIAAFIGQHVVRKLIIVLGRASIIIFILSFTIFVSAISLGGVGISNMIGKIQRHEY  469

Query  542  MGFENLCKYGV  574
            MGFENLCKY V
Sbjct  470  MGFENLCKYAV  480



>ref|XP_009783706.1| PREDICTED: uncharacterized protein LOC104232253 [Nicotiana sylvestris]
Length=478

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW VNLLQIPVS+GV+ FEA  LYKGWRKI SKG+ G+N R  QLIVYC FG++AG+
Sbjct  288  SVWYWGVNLLQIPVSVGVSSFEAISLYKGWRKIQSKGEDGTNFRVMQLIVYCLFGILAGL  347

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  348  VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYF  407

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVATVAAF+GQHVVRRLI VLGRASLIIFILAFTIFVSAISLGGVGISNMI KI  HEY
Sbjct  408  VAVATVAAFVGQHVVRRLIVVLGRASLIIFILAFTIFVSAISLGGVGISNMIGKIQRHEY  467

Query  542  MGFENLCKYGV  574
            MGFENLCKY V
Sbjct  468  MGFENLCKYEV  478



>ref|XP_006366207.1| PREDICTED: uncharacterized protein LOC102587808 isoform X1 [Solanum 
tuberosum]
Length=476

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            + LYWVVNLLQ+PV+LGV+ +EA  LYKGWR+I SKG+ G+N R  QLIVYCFFG++AG+
Sbjct  286  TPLYWVVNLLQVPVALGVSSYEAVSLYKGWRRIESKGEDGTNFRVMQLIVYCFFGIVAGM  345

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGP+FLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  346  VGGLLGLGGGFIMGPMFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYF  405

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVATVAAF+GQHVVRR+I +LGRASLIIFILA TIFVSAISLGGVGISNMI KI  HEY
Sbjct  406  VAVATVAAFVGQHVVRRMIMILGRASLIIFILASTIFVSAISLGGVGISNMIGKIQRHEY  465

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  466  MGFENLCKY  474



>ref|XP_006366208.1| PREDICTED: uncharacterized protein LOC102587808 isoform X2 [Solanum 
tuberosum]
Length=474

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            + LYWVVNLLQ+PV+LGV+ +EA  LYKGWR+I SKG+ G+N R  QLIVYCFFG++AG+
Sbjct  284  TPLYWVVNLLQVPVALGVSSYEAVSLYKGWRRIESKGEDGTNFRVMQLIVYCFFGIVAGM  343

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGP+FLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  344  VGGLLGLGGGFIMGPMFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYF  403

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVATVAAF+GQHVVRR+I +LGRASLIIFILA TIFVSAISLGGVGISNMI KI  HEY
Sbjct  404  VAVATVAAFVGQHVVRRMIMILGRASLIIFILASTIFVSAISLGGVGISNMIGKIQRHEY  463

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  464  MGFENLCKY  472



>ref|XP_006340268.1| PREDICTED: uncharacterized protein LOC102587334 [Solanum tuberosum]
Length=477

 Score =   213 bits (543),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWVVNLLQ+PVS+GV+ +EA  LYKGWR+I SKGD G++ R  QLI YC FG++AG+
Sbjct  287  SAWYWVVNLLQVPVSVGVSFYEAISLYKGWRRIQSKGDDGTDFRVTQLIAYCSFGILAGM  346

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  347  VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYF  406

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVAT+AAF+GQHVVRRLI VLGRASLIIFILAFTIFVSAISLGGVGISNMI KI   EY
Sbjct  407  VAVATIAAFVGQHVVRRLIFVLGRASLIIFILAFTIFVSAISLGGVGISNMIGKIQRDEY  466

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  467  MGFENLCKY  475



>ref|XP_007012055.1| Sulfite exporter TauE/SafE family protein [Theobroma cacao]
 gb|EOY29674.1| Sulfite exporter TauE/SafE family protein [Theobroma cacao]
Length=483

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NLLQIPVS GV+L+EA  LYKGWR I+SKGD G+N R  QL+ YC FG++AG+
Sbjct  293  SVAYWVLNLLQIPVSFGVSLYEAVSLYKGWRVIASKGDEGTNWRVHQLVTYCAFGVLAGI  352

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  353  VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYF  412

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            TAVAT+AA IGQH+VR+LI V GRASLIIFILAFTIFVSA+SLGGVGISNMI KI  HEY
Sbjct  413  TAVATIAALIGQHIVRKLIIVFGRASLIIFILAFTIFVSAVSLGGVGISNMIGKIERHEY  472

Query  542  MGFENLCKY  568
            MGFENLC Y
Sbjct  473  MGFENLCMY  481



>ref|XP_002284175.1| PREDICTED: uncharacterized protein LOC100267889 [Vitis vinifera]
 emb|CBI20891.3| unnamed protein product [Vitis vinifera]
Length=478

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+N +QIPVS+GV+L+EA  LYKG R I+SKGD+G+N R  QLI+YCF G++AG+
Sbjct  288  SMAYWVLNFMQIPVSVGVSLYEAVSLYKGRRIIASKGDAGTNFRVHQLILYCFCGVLAGI  347

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA++L
Sbjct  348  VGGLLGLGGGFILGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAVYL  407

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAFIGQHVVRRLI++LGRASLIIFILAFTIF+SAISLGGVG+SNMI KI  HEY
Sbjct  408  VLVATIAAFIGQHVVRRLISILGRASLIIFILAFTIFISAISLGGVGLSNMIGKIERHEY  467

Query  542  MGFENLCKYGV  574
            MGFENLC+Y V
Sbjct  468  MGFENLCRYEV  478



>ref|XP_008357417.1| PREDICTED: uncharacterized protein LOC103421160 [Malus domestica]
Length=265

 Score =   204 bits (518),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWVVNLLQIPVSLGV+++EA  LY+G R I+SKG+ G++ +  QL++YC FG+IAG+
Sbjct  75   SPAYWVVNLLQIPVSLGVSMYEAVSLYQGRRVIASKGEEGTDWKVHQLVIYCLFGVIAGI  134

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA++L
Sbjct  135  VGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAVYL  194

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            TAVATVAA +GQH+VRRLI + GRASLIIFILAFTIFVSAISLGGVGISNMI KI+ +EY
Sbjct  195  TAVATVAALVGQHIVRRLIILFGRASLIIFILAFTIFVSAISLGGVGISNMIGKINRNEY  254

Query  542  MGFENLCKYGV  574
            MGFENLCKY V
Sbjct  255  MGFENLCKYDV  265



>gb|KJB07537.1| hypothetical protein B456_001G028700 [Gossypium raimondii]
Length=475

 Score =   209 bits (531),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  11   YWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvgg  190
            YWV+NLLQIPVS+ V+ +EA  LYKG R I+SKG+ GSN +A QL+ YCFFG++AG+VGG
Sbjct  288  YWVLNLLQIPVSVAVSAYEAVSLYKGNRAIASKGEQGSNFQAHQLVSYCFFGVLAGIVGG  347

Query  191  llglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltav  370
            LLGLGGGFIMGPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+ TAV
Sbjct  348  LLGLGGGFIMGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFTAV  407

Query  371  atvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGF  550
            AT AAF+GQHVVRRLI V GRASLIIFILAFTIFVSA+SLGGVGISNMI+KIH++EYMGF
Sbjct  408  ATFAAFVGQHVVRRLIIVFGRASLIIFILAFTIFVSAVSLGGVGISNMIDKIHHNEYMGF  467

Query  551  ENLCKY  568
            ENLCKY
Sbjct  468  ENLCKY  473



>ref|XP_010313606.1| PREDICTED: uncharacterized protein LOC101255958 [Solanum lycopersicum]
Length=477

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWVVNLLQ+PVS+G++ +EA  LYKGWR+I SKGD G++ R  QLI YC FG++AG+
Sbjct  287  SVWYWVVNLLQVPVSVGISFYEAISLYKGWRRIQSKGDDGTDFRVTQLIAYCSFGILAGM  346

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  347  VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYF  406

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVATVAAF+GQHVVRRLI VLGRASLIIFILAFTIFVSAISLGGVGISNMI KI   EY
Sbjct  407  VAVATVAAFVGQHVVRRLIIVLGRASLIIFILAFTIFVSAISLGGVGISNMIGKIQRDEY  466

Query  542  MGFENLCKYGV  574
            MGFENLC Y +
Sbjct  467  MGFENLCNYRI  477



>gb|KJB54849.1| hypothetical protein B456_009G051700 [Gossypium raimondii]
Length=474

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S LYWV+NLLQIPVSLGV+L+EA  LYKG+R I+SKG+ G++ R  QL+ YC FG++AGV
Sbjct  284  SALYWVLNLLQIPVSLGVSLYEAVSLYKGYRVIASKGEDGTSFRVAQLVTYCAFGVLAGV  343

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  344  VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYF  403

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            T VATVAAFIGQHVVR+LI + GRASLIIFILA TIFVSAISLGGVGISNMI KI  HEY
Sbjct  404  TGVATVAAFIGQHVVRKLIILFGRASLIIFILASTIFVSAISLGGVGISNMIGKIERHEY  463

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  464  MGFENLCKY  472



>gb|KJB54846.1| hypothetical protein B456_009G051700 [Gossypium raimondii]
Length=475

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S LYWV+NLLQIPVSLGV+L+EA  LYKG+R I+SKG+ G++ R  QL+ YC FG++AGV
Sbjct  285  SALYWVLNLLQIPVSLGVSLYEAVSLYKGYRVIASKGEDGTSFRVAQLVTYCAFGVLAGV  344

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  345  VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYF  404

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            T VATVAAFIGQHVVR+LI + GRASLIIFILA TIFVSAISLGGVGISNMI KI  HEY
Sbjct  405  TGVATVAAFIGQHVVRKLIILFGRASLIIFILASTIFVSAISLGGVGISNMIGKIERHEY  464

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  465  MGFENLCKY  473



>ref|XP_008347634.1| PREDICTED: uncharacterized protein LOC103410743 isoform X2 [Malus 
domestica]
Length=360

 Score =   204 bits (518),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWVVNLLQIPVSLGV+++EA  LY+G R I+SKG+ G++ +  QL++YC FG+IAG+
Sbjct  170  SPAYWVVNLLQIPVSLGVSMYEAVSLYQGRRVIASKGEEGTDWKVHQLVIYCLFGVIAGI  229

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA++L
Sbjct  230  VGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAVYL  289

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            TAVATVAA +GQH+VRRLI + GRASLIIFILAFTIFVSAISLGGVGISNMI KI+ +EY
Sbjct  290  TAVATVAALVGQHIVRRLIILFGRASLIIFILAFTIFVSAISLGGVGISNMIGKINRNEY  349

Query  542  MGFENLCKYGV  574
            MGFENLCKY V
Sbjct  350  MGFENLCKYDV  360



>ref|XP_009367912.1| PREDICTED: uncharacterized protein LOC103957476 [Pyrus x bretschneideri]
Length=475

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWVVNLLQIPVSLGV+++EA  LY+G R I+SKG+ G++ +  QL++YC FG+IAG+
Sbjct  285  SPAYWVVNLLQIPVSLGVSMYEAVSLYQGRRVIASKGEEGTDWKVHQLVIYCLFGVIAGI  344

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA++L
Sbjct  345  VGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAVYL  404

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            TAVATVAA +GQH+VRRLI + GRASLIIFILAFTIFVSA+SLGGVGISNMI KI+ HEY
Sbjct  405  TAVATVAALVGQHIVRRLIILFGRASLIIFILAFTIFVSAVSLGGVGISNMIGKINQHEY  464

Query  542  MGFENLCKYGV  574
            MGFENLCKY V
Sbjct  465  MGFENLCKYDV  475



>ref|XP_008393890.1| PREDICTED: uncharacterized protein LOC103456039 [Malus domestica]
 ref|XP_008352023.1| PREDICTED: uncharacterized protein LOC103415470 [Malus domestica]
Length=489

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWVVNLLQIPVSLGV+++EA  LY+G R I+SKG+ G++ +  QL++YC FG+IAG+
Sbjct  299  SPAYWVVNLLQIPVSLGVSMYEAVSLYQGRRVIASKGEEGTDWKVHQLVIYCLFGVIAGI  358

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA++L
Sbjct  359  VGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAVYL  418

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            TAVATVAA +GQH+VRRLI + GRASLIIFILAFTIFVSAISLGGVGISNM+ KI+ HEY
Sbjct  419  TAVATVAALVGQHIVRRLIILFGRASLIIFILAFTIFVSAISLGGVGISNMVGKINRHEY  478

Query  542  MGFENLCKYGV  574
            MGFENLCKY V
Sbjct  479  MGFENLCKYDV  489



>ref|XP_002516035.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46455.1| conserved hypothetical protein [Ricinus communis]
Length=483

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S +YWV NLLQIPV+LGV+ ++A  LYKG R+I+SKG++G+N R  QL++YC  G++AG+
Sbjct  293  SVVYWVCNLLQIPVALGVSSYQAVSLYKGKRRIASKGEAGTNWRVHQLVLYCACGVLAGM  352

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELGVPPQVSSATATFAM FS+SMSV+EYYLLKRFPVPYAL+ 
Sbjct  353  VGGLLGLGGGFILGPLFLELGVPPQVSSATATFAMTFSASMSVIEYYLLKRFPVPYALYF  412

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AV+T+AAF+GQHVVRRLI++LGRASLIIFIL+FTIFVSAISLGGVGI+NMIEKI NHEY
Sbjct  413  VAVSTIAAFVGQHVVRRLISILGRASLIIFILSFTIFVSAISLGGVGIANMIEKIENHEY  472

Query  542  MGFENLCKY  568
            MGF+N+C Y
Sbjct  473  MGFDNICSY  481



>ref|XP_008220035.1| PREDICTED: uncharacterized protein LOC103320179 [Prunus mume]
Length=476

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S +YWVVNLLQIP+S GV+L+EA  LYKG R I+SKG+ G+  R  QL+VYC FG++AG+
Sbjct  286  SPVYWVVNLLQIPISFGVSLYEAVSLYKGRRVIASKGEQGTVWRVHQLVVYCIFGVLAGI  345

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGF+MGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  346  VGGLLGLGGGFVMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYF  405

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVAT+AAF+GQH+VRRLI + GRASLIIFILAFTIFVSAISLGGVGISNMI KIH +EY
Sbjct  406  VAVATIAAFVGQHIVRRLIILFGRASLIIFILAFTIFVSAISLGGVGISNMIVKIHQNEY  465

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  466  MGFENLCKY  474



>ref|XP_006833308.1| hypothetical protein AMTR_s00109p00049700 [Amborella trichopoda]
 gb|ERM98586.1| hypothetical protein AMTR_s00109p00049700 [Amborella trichopoda]
Length=477

 Score =   204 bits (518),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NLLQ+PV++GV+L+EA  LYKGWR I+SKG++G+N +  QL++YCF G++AG+
Sbjct  287  SVEYWVLNLLQVPVAVGVSLYEAVSLYKGWRVIASKGNAGTNWKIRQLVLYCFCGILAGM  346

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA++ 
Sbjct  347  VGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAVYF  406

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VA+ AA +GQHVVR++I +LGRASLIIFILAFTIFVSAI+LGGVGISNMI KI N EY
Sbjct  407  ALVASGAALVGQHVVRKIIILLGRASLIIFILAFTIFVSAITLGGVGISNMIHKIQNREY  466

Query  542  MGFENLCKY  568
            MGFENLC Y
Sbjct  467  MGFENLCSY  475



>gb|KDO79725.1| hypothetical protein CISIN_1g011811mg [Citrus sinensis]
Length=365

 Score =   201 bits (510),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S +YWV++LLQIPVSL V+L+EA  LYKG R I+SKGD G + R  QL+ YC FG++AG+
Sbjct  175  SIVYWVLDLLQIPVSLVVSLYEAISLYKGRRVIASKGDDGKSFRVFQLVSYCAFGVLAGI  234

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  235  VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYF  294

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVAT+AAF+GQHVVR+LI +LGRASLIIFILAF IFVSAISLGGVGISNMI K H HEY
Sbjct  295  VAVATIAAFVGQHVVRKLIILLGRASLIIFILAFMIFVSAISLGGVGISNMIGKFHRHEY  354

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  355  MGFENLCKY  363



>ref|XP_008347633.1| PREDICTED: uncharacterized protein LOC103410743 isoform X1 [Malus 
domestica]
Length=476

 Score =   203 bits (517),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWVVNLLQIPVSLGV+++EA  LY+G R I+SKG+ G++ +  QL++YC FG+IAG+
Sbjct  286  SPAYWVVNLLQIPVSLGVSMYEAVSLYQGRRVIASKGEEGTDWKVHQLVIYCLFGVIAGI  345

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA++L
Sbjct  346  VGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAVYL  405

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            TAVATVAA +GQH+VRRLI + GRASLIIFILAFTIFVSAISLGGVGISNMI KI+ +EY
Sbjct  406  TAVATVAALVGQHIVRRLIILFGRASLIIFILAFTIFVSAISLGGVGISNMIGKINRNEY  465

Query  542  MGFENLCKYGV  574
            MGFENLCKY V
Sbjct  466  MGFENLCKYDV  476



>gb|EYU21883.1| hypothetical protein MIMGU_mgv1a005504mg [Erythranthe guttata]
Length=477

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW VNLLQIPVS+GV+ +EA  LYKGWRK+ SKGD G+N +  QL+VY FFG++AG+
Sbjct  287  SVTYWTVNLLQIPVSMGVSGYEALSLYKGWRKLGSKGDEGTNFKVHQLLVYGFFGILAGL  346

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  347  VGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYF  406

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVATVAAFIGQH VR+LI +LGRAS+IIFILA TIF+SAISLGGVGISNMI KI  +EY
Sbjct  407  VAVATVAAFIGQHFVRKLIIILGRASIIIFILASTIFISAISLGGVGISNMIGKIERNEY  466

Query  542  MGFENLCKYGV  574
            MGFENLCKY V
Sbjct  467  MGFENLCKYQV  477



>ref|XP_010526181.1| PREDICTED: uncharacterized protein LOC104803812 isoform X1 [Tarenaya 
hassleriana]
Length=478

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S LYWV+NLLQIPVS+GV+ +EA  LY+G R I+SKG++G+N    QL++YC FG++AG+
Sbjct  288  SALYWVINLLQIPVSVGVSAYEAVALYQGRRVIASKGETGTNFTVAQLLLYCTFGVLAGI  347

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYY+LKRFPVPYAL+ 
Sbjct  348  VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYILKRFPVPYALYF  407

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVATVAAF+GQHVVRRLIAVLGRASLIIFILAF IF+SAISLGGVGISNM+ KI  HEY
Sbjct  408  VAVATVAAFVGQHVVRRLIAVLGRASLIIFILAFMIFISAISLGGVGISNMVGKIQRHEY  467

Query  542  MGFENLCKYGV  574
            MGFENLC Y +
Sbjct  468  MGFENLCMYDI  478



>ref|XP_010526182.1| PREDICTED: uncharacterized protein LOC104803812 isoform X2 [Tarenaya 
hassleriana]
Length=477

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S LYWV+NLLQIPVS+GV+ +EA  LY+G R I+SKG++G+N    QL++YC FG++AG+
Sbjct  287  SALYWVINLLQIPVSVGVSAYEAVALYQGRRVIASKGETGTNFTVAQLLLYCTFGVLAGI  346

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYY+LKRFPVPYAL+ 
Sbjct  347  VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYILKRFPVPYALYF  406

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVATVAAF+GQHVVRRLIAVLGRASLIIFILAF IF+SAISLGGVGISNM+ KI  HEY
Sbjct  407  VAVATVAAFVGQHVVRRLIAVLGRASLIIFILAFMIFISAISLGGVGISNMVGKIQRHEY  466

Query  542  MGFENLCKYGV  574
            MGFENLC Y +
Sbjct  467  MGFENLCMYDI  477



>gb|EYU21882.1| hypothetical protein MIMGU_mgv1a005504mg [Erythranthe guttata]
Length=481

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW VNLLQIPVS+GV+ +EA  LYKGWRK+ SKGD G+N +  QL+VY FFG++AG+
Sbjct  291  SVTYWTVNLLQIPVSMGVSGYEALSLYKGWRKLGSKGDEGTNFKVHQLLVYGFFGILAGL  350

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  351  VGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYF  410

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVATVAAFIGQH VR+LI +LGRAS+IIFILA TIF+SAISLGGVGISNMI KI  +EY
Sbjct  411  VAVATVAAFIGQHFVRKLIIILGRASIIIFILASTIFISAISLGGVGISNMIGKIERNEY  470

Query  542  MGFENLCKYGV  574
            MGFENLCKY V
Sbjct  471  MGFENLCKYQV  481



>gb|KDP37239.1| hypothetical protein JCGZ_06295 [Jatropha curcas]
Length=482

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+N+LQ PV+LGV++++A  LYKG RKI SKG++G+NL+  QL++YC  G++AGV
Sbjct  292  SAAYWVLNILQFPVALGVSVYQAVNLYKGRRKIKSKGEAGTNLKVHQLVLYCCCGVLAGV  351

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELGVP QVSSATATFAM FS+SMSV+EYYLLKRFPVPYAL+ 
Sbjct  352  VGGLLGLGGGFILGPLFLELGVPAQVSSATATFAMTFSASMSVIEYYLLKRFPVPYALYF  411

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             +V+TVAAF+GQHVVRRLI++LGRAS+IIFILAFTIFVSAISLGGVGI+NM+EKI NH+Y
Sbjct  412  VSVSTVAAFVGQHVVRRLISILGRASIIIFILAFTIFVSAISLGGVGIANMVEKIENHQY  471

Query  542  MGFENLCKY  568
            MGFENLC Y
Sbjct  472  MGFENLCTY  480



>ref|XP_007222835.1| hypothetical protein PRUPE_ppa005114mg [Prunus persica]
 gb|EMJ24034.1| hypothetical protein PRUPE_ppa005114mg [Prunus persica]
Length=476

 Score =   201 bits (512),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S +YWVVNLLQIP+S+GV+L+EA  LYKG R I+SKG+ G+  R  QL++YC FG++AG+
Sbjct  286  SPVYWVVNLLQIPISVGVSLYEAVSLYKGRRVIASKGEQGTVWRVHQLVIYCIFGVLAGI  345

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGF+MGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  346  VGGLLGLGGGFVMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYF  405

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVATVAA +GQH+VRRLI + GRASLIIFILAFTIFVSAISLGGVGISNMI KIH +EY
Sbjct  406  VAVATVAALVGQHIVRRLIILFGRASLIIFILAFTIFVSAISLGGVGISNMIGKIHQNEY  465

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  466  MGFENLCKY  474



>gb|KDO79723.1| hypothetical protein CISIN_1g011811mg [Citrus sinensis]
Length=425

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S +YWV++LLQIPVSL V+L+EA  LYKG R I+SKGD G + R  QL+ YC FG++AG+
Sbjct  235  SIVYWVLDLLQIPVSLVVSLYEAISLYKGRRVIASKGDDGKSFRVFQLVSYCAFGVLAGI  294

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  295  VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYF  354

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVAT+AAF+GQHVVR+LI +LGRASLIIFILAF IFVSAISLGGVGISNMI K H HEY
Sbjct  355  VAVATIAAFVGQHVVRKLIILLGRASLIIFILAFMIFVSAISLGGVGISNMIGKFHRHEY  414

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  415  MGFENLCKY  423



>dbj|BAK01650.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=471

 Score =   201 bits (511),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST YWV+N LQIPVS+GV ++EA GL  G R +SSKGD  + L+  QL +YCFFG+ AG+
Sbjct  281  STWYWVLNFLQIPVSVGVTMYEALGLMNGKRVLSSKGDEQTTLKFHQLCIYCFFGVTAGL  340

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAMMFS+SMSVVEYYLL RFPVPYA + 
Sbjct  341  VGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSASMSVVEYYLLNRFPVPYAAYF  400

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVA VAA IGQHVVRRLI+ LGRASLIIFILAF IFVSAISLGGVGISNMI KI  HEY
Sbjct  401  VAVAFVAAIIGQHVVRRLISWLGRASLIIFILAFMIFVSAISLGGVGISNMIHKIEQHEY  460

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  461  MGFENLCKY  469



>ref|XP_010048100.1| PREDICTED: uncharacterized protein LOC104436943 [Eucalyptus grandis]
 gb|KCW80234.1| hypothetical protein EUGRSUZ_C01581 [Eucalyptus grandis]
Length=480

 Score =   201 bits (511),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  11   YWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvgg  190
            YWV+NLLQ+PVS+GV+L+EA  LYKG R I+SKGD G+ L+  QL +YC  G++AGVVGG
Sbjct  293  YWVLNLLQVPVSVGVSLYEAVSLYKGRRVIASKGDYGTGLKVSQLALYCACGVLAGVVGG  352

Query  191  llglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltav  370
            LLGLGGGFIMGPLFLELGVPP+VSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+   V
Sbjct  353  LLGLGGGFIMGPLFLELGVPPEVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFVMV  412

Query  371  atvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGF  550
            AT AA +GQH+VRRLI VLGRASLIIFILAFTIFVSAISLGGVGISNMI K H HEYMGF
Sbjct  413  ATFAALVGQHIVRRLIIVLGRASLIIFILAFTIFVSAISLGGVGISNMIGKFHRHEYMGF  472

Query  551  ENLCKY  568
            ENLCKY
Sbjct  473  ENLCKY  478



>ref|XP_008799063.1| PREDICTED: uncharacterized protein LOC103713782 [Phoenix dactylifera]
Length=477

 Score =   201 bits (511),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++NLLQIPVS+GV  +EA  LY+G R ISSKGD  +N R  QL +YC  G++AGV
Sbjct  287  SKSYWILNLLQIPVSVGVTSYEAVSLYRGKRVISSKGDEETNWRILQLFLYCATGVLAGV  346

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA + 
Sbjct  347  VGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAAYF  406

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AV TVAAFIGQHVVR+LI +LGRASLIIFILAFTIFVSAISLGGVGISNMI+KI  HEY
Sbjct  407  VAVVTVAAFIGQHVVRKLINILGRASLIIFILAFTIFVSAISLGGVGISNMIQKIQRHEY  466

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  467  MGFENLCKY  475



>ref|XP_010254104.1| PREDICTED: uncharacterized protein LOC104595187 [Nelumbo nucifera]
Length=481

 Score =   201 bits (510),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++NLLQIPVS GV+L+EA  LY G R I+S GD+G+N +  QLI+YC  G++AGV
Sbjct  291  SISYWILNLLQIPVSCGVSLYEAVSLYNGRRVIASNGDAGTNWKVHQLILYCCCGILAGV  350

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  351  VGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYF  410

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVAT+AAFIGQHVVRRLI VLGRASLIIFIL+FTIFVSAISLGGVGISNMI KI  HEY
Sbjct  411  VAVATIAAFIGQHVVRRLIIVLGRASLIIFILSFTIFVSAISLGGVGISNMIYKIEKHEY  470

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  471  MGFENLCKY  479



>gb|KDP34212.1| hypothetical protein JCGZ_07783 [Jatropha curcas]
Length=477

 Score =   201 bits (510),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWVVNLLQ+PVS GV+ +EA  LYKG RK+ SKGD+ +NL+A QL++YC  G++AG+
Sbjct  287  SMEYWVVNLLQVPVSFGVSTYEAVSLYKGRRKLGSKGDAATNLKALQLVLYCSCGVLAGI  346

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELG+PP+V+SATAT  M FSSSMSVVEYYLL RFPVPYA++ 
Sbjct  347  VGGLLGLGGGFIMGPLFLELGIPPEVTSATATLGMTFSSSMSVVEYYLLNRFPVPYAVYF  406

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVATVAA +GQH++ +LIA+ GRASLIIFILAFTIFVSAISLGGVGISNMI KIH HEY
Sbjct  407  IAVATVAALVGQHIMSKLIAIFGRASLIIFILAFTIFVSAISLGGVGISNMIGKIHRHEY  466

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  467  MGFENLCKY  475



>ref|XP_006450629.1| hypothetical protein CICLE_v10008167mg [Citrus clementina]
 gb|ESR63869.1| hypothetical protein CICLE_v10008167mg [Citrus clementina]
Length=477

 Score =   201 bits (510),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S +YWV++LLQIPVSL V+L+EA  LYKG R I+SKGD G + R  QL+ YC FG++AG+
Sbjct  287  SIVYWVLDLLQIPVSLVVSLYEAISLYKGRRVIASKGDDGKSFRVFQLVSYCAFGVLAGI  346

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  347  VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYF  406

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVAT+AAFIGQHVVR+LI +LGRASLIIFILAF IFVSAISLGGVGISNMI K H HEY
Sbjct  407  VAVATIAAFIGQHVVRKLIILLGRASLIIFILAFMIFVSAISLGGVGISNMIGKFHRHEY  466

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  467  MGFENLCKY  475



>ref|XP_011019654.1| PREDICTED: uncharacterized protein LOC105122312 [Populus euphratica]
 ref|XP_011019655.1| PREDICTED: uncharacterized protein LOC105122312 [Populus euphratica]
Length=479

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST YWV+NLLQIPVS+GV+++EA  LYKG R I+SKG   +N    QL++YC FG++AGV
Sbjct  289  STAYWVLNLLQIPVSVGVSMYEAVSLYKGHRIIASKGTEDTNFTVLQLVIYCLFGILAGV  348

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA++ 
Sbjct  349  VGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAVYF  408

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVAT AAFIGQH+VRRLI + GRASLIIFILA TIF+SAISLGGVG++NMI KIH HEY
Sbjct  409  VAVATFAAFIGQHIVRRLIIMFGRASLIIFILASTIFISAISLGGVGVANMIGKIHRHEY  468

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  469  MGFENLCKY  477



>ref|XP_002309560.2| hypothetical protein POPTR_0006s25880g [Populus trichocarpa]
 gb|EEE93083.2| hypothetical protein POPTR_0006s25880g [Populus trichocarpa]
Length=479

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST YWV+NLLQIPVS+GV+++EA  LYKG R I+SKG  G+N    QL++YC FG++AGV
Sbjct  289  STTYWVLNLLQIPVSVGVSMYEAVSLYKGHRIIASKGTEGTNFTILQLVIYCLFGILAGV  348

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPV YA++ 
Sbjct  349  VGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVSYAVYF  408

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVAT AAFIGQH+VRRLI V GRASLIIFILA TIF+SAISLGGVG++NMI KIH HEY
Sbjct  409  VAVATFAAFIGQHIVRRLIIVFGRASLIIFILASTIFISAISLGGVGVANMIGKIHRHEY  468

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  469  MGFENLCKY  477



>gb|EPS70854.1| hypothetical protein M569_03904, partial [Genlisea aurea]
Length=479

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S L+WVVNLLQIPV++GV+ +EA GLY GW+K+ SKGD G+NL+  QL++Y  FG++AGV
Sbjct  291  SALFWVVNLLQIPVAVGVSGYEAVGLYMGWKKLGSKGDDGTNLKPQQLLIYALFGILAGV  350

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLL+RFPVPY ++L
Sbjct  351  VGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLRRFPVPYGVYL  410

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF+GQHVV RLI V+GRAS+IIFIL+FTIFVSAISLGGVGISNM+ KI  HEY
Sbjct  411  AVVATMAAFVGQHVVGRLIVVMGRASIIIFILSFTIFVSAISLGGVGISNMVGKIAGHEY  470

Query  542  MGFENLCKY  568
            MGF+NLC Y
Sbjct  471  MGFDNLCSY  479



>ref|XP_006476094.1| PREDICTED: uncharacterized protein LOC102623437 [Citrus sinensis]
 gb|KDO79724.1| hypothetical protein CISIN_1g011811mg [Citrus sinensis]
Length=477

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S +YWV++LLQIPVSL V+L+EA  LYKG R I+SKGD G + R  QL+ YC FG++AG+
Sbjct  287  SIVYWVLDLLQIPVSLVVSLYEAISLYKGRRVIASKGDDGKSFRVFQLVSYCAFGVLAGI  346

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  347  VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYF  406

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVAT+AAF+GQHVVR+LI +LGRASLIIFILAF IFVSAISLGGVGISNMI K H HEY
Sbjct  407  VAVATIAAFVGQHVVRKLIILLGRASLIIFILAFMIFVSAISLGGVGISNMIGKFHRHEY  466

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  467  MGFENLCKY  475



>gb|AAY63998.1| unknown [Brassica napus]
Length=348

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  11   YWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvgg  190
            YWV+NLLQIPV++GV+ +EA  LY+G R I+S G  GSN   GQLI+YC FG++AGVVGG
Sbjct  161  YWVINLLQIPVAVGVSGYEAVALYQGRRIIASNGQGGSNFTIGQLILYCSFGVLAGVVGG  220

Query  191  llglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltav  370
            LLGLGGGFIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+L  V
Sbjct  221  LLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYLVGV  280

Query  371  atvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGF  550
            AT+AA +GQHVVRRLIAVLGRASLIIFILA TIF+SAISLGGVGI NM+ K+  HEYMGF
Sbjct  281  ATIAALVGQHVVRRLIAVLGRASLIIFILASTIFISAISLGGVGIVNMMGKLQRHEYMGF  340

Query  551  ENLCKY  568
            ENLCKY
Sbjct  341  ENLCKY  346



>gb|KHG13748.1| Flavonol synthase/flavanone 3-hydroxylase [Gossypium arboreum]
Length=303

 Score =   194 bits (494),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +2

Query  32   QIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglggg  211
            +IPVS+ V+ +EA  LYKG R I+SKG+ GSN +A QL+ YCFFG++AG+VGGLLGLGGG
Sbjct  123  KIPVSVAVSAYEAVSLYKGNRAIASKGEQGSNFQAHQLVSYCFFGVLAGIVGGLLGLGGG  182

Query  212  fimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafI  391
            FIMGPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+ TAVAT AAF+
Sbjct  183  FIMGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFTAVATFAAFV  242

Query  392  GQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  568
            GQHVVRRLI V GRASLIIFILAFTIFVSA+SLGGVGISNMI+KIH++EYMGFENLCKY
Sbjct  243  GQHVVRRLIIVFGRASLIIFILAFTIFVSAVSLGGVGISNMIDKIHHNEYMGFENLCKY  301



>ref|XP_004291206.1| PREDICTED: uncharacterized protein LOC101310663 [Fragaria vesca 
subsp. vesca]
Length=473

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWVVNLLQIPVSLGV+ +EA GLY+G + ISSKG+ G+N +  QLI+YC  G++AG+
Sbjct  283  SVAYWVVNLLQIPVSLGVSTYEAVGLYQGRKVISSKGEEGTNWQVHQLILYCLMGVVAGI  342

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYA + 
Sbjct  343  VGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAAYY  402

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            TAVAT+AA  GQHVVRRLI + GRASLIIFILAF IF+SAISLGGVG+SNMI KI+++EY
Sbjct  403  TAVATIAAITGQHVVRRLITIFGRASLIIFILAFMIFISAISLGGVGVSNMIWKINHNEY  462

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  463  MGFENLCKY  471



>dbj|BAG89362.1| unnamed protein product [Oryza sativa Japonica Group]
Length=349

 Score =   195 bits (496),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST YWV+N LQIPVS+GV ++E  GL +G R ISSKGD  +NL+  QL+VYCFFGM+AGV
Sbjct  159  STWYWVLNFLQIPVSVGVTMYEGLGLMQGRRVISSKGDEQTNLKFHQLLVYCFFGMMAGV  218

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYALF 
Sbjct  219  VGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLDRFPVPYALFF  278

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            T VA  AA IGQH+VR+LI  LGRASLIIFIL+F IF+SAISLGGVGISNMI KI  HEY
Sbjct  279  TVVAFFAAIIGQHIVRKLINWLGRASLIIFILSFMIFISAISLGGVGISNMIGKIARHEY  338

Query  542  MGFENLCKYGV  574
            MGF+N+C Y V
Sbjct  339  MGFDNICNYDV  349



>ref|XP_010915823.1| PREDICTED: uncharacterized protein LOC105040818 [Elaeis guineensis]
Length=475

 Score =   198 bits (504),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++NLLQIPVS+GV  +EA  LY+G R I+SKGD G+N R  QL++YC  G++AG+
Sbjct  287  SKSYWILNLLQIPVSVGVTAYEAVSLYRGKRVIASKGDEGTNWRVLQLVLYCATGILAGM  346

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA + 
Sbjct  347  VGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAAYF  406

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVATVAAF+GQH VR+LI +LGRASLIIFILAFTIFVSAISLGGVGISNMI KI  HEY
Sbjct  407  VAVATVAAFVGQHAVRKLINILGRASLIIFILAFTIFVSAISLGGVGISNMIHKIQRHEY  466

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  467  MGFENLCKY  475



>ref|XP_006294138.1| hypothetical protein CARUB_v10023132mg [Capsella rubella]
 gb|EOA27036.1| hypothetical protein CARUB_v10023132mg [Capsella rubella]
Length=472

 Score =   197 bits (502),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NLLQIPV++GV+ +EA  LY+G R I+SKG   SN   GQL++YC FG++AG+
Sbjct  282  SVAYWVINLLQIPVAIGVSGYEAVALYQGRRIIASKGQGDSNFTVGQLVLYCTFGILAGI  341

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+L
Sbjct  342  VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYL  401

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AA +GQHVVRRLIA LGRASLIIFILA  IF SAISLGGVGI+NMI KI  HEY
Sbjct  402  VGVATIAALVGQHVVRRLIAALGRASLIIFILASMIFTSAISLGGVGIANMIGKIQRHEY  461

Query  542  MGFENLCKYG  571
            MGFENLCKYG
Sbjct  462  MGFENLCKYG  471



>ref|XP_003636475.1| hypothetical protein MTR_042s0018 [Medicago truncatula]
 gb|KEH35983.1| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=470

 Score =   197 bits (502),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++NLLQIP+++GV  +EAT L+ G R I+S GD G     GQL++YC FG++AG+
Sbjct  280  SAAYWILNLLQIPIAVGVTAYEATALFTGRRVIASTGDQGKAFTVGQLVIYCVFGVLAGI  339

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGF+MGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+L
Sbjct  340  VGGLLGLGGGFVMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYL  399

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            + VAT+AA +GQH+VRRLI + GRASLIIFILA TIF+SAISLGGVGISNM+ KI NHEY
Sbjct  400  SLVATIAALVGQHIVRRLIILFGRASLIIFILAGTIFISAISLGGVGISNMVHKIANHEY  459

Query  542  MGFENLCKYG  571
            MGFEN+CKYG
Sbjct  460  MGFENICKYG  469



>ref|XP_010429580.1| PREDICTED: uncharacterized protein LOC104714041 [Camelina sativa]
Length=475

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NLLQIPV++GV+ +EA  LY+G R I+SKG   SN   GQL++YC FG++AG+
Sbjct  285  SVAYWVINLLQIPVAVGVSGYEAVALYQGRRIIASKGQGDSNFTVGQLVLYCTFGILAGI  344

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+L
Sbjct  345  VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYL  404

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AA +GQHVVRRLI+ LGRASLIIFILA TIF+SAISLGGVGI NMI KI  HEY
Sbjct  405  VGVATIAALVGQHVVRRLISALGRASLIIFILASTIFISAISLGGVGIVNMIGKIQRHEY  464

Query  542  MGFENLCKYG  571
            MGFENLCKYG
Sbjct  465  MGFENLCKYG  474



>gb|EEC84400.1| hypothetical protein OsI_30977 [Oryza sativa Indica Group]
Length=465

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S+ YW++NLLQIPVS+GV L+EA GL  G R +SSKG+  + L+  QL +YCFFG+ AGV
Sbjct  275  SSWYWILNLLQIPVSVGVTLYEALGLMSGKRVLSSKGNEQTTLKFHQLCIYCFFGITAGV  334

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYAL+ 
Sbjct  335  VGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLNRFPVPYALYF  394

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VA +AA IGQHVVRRLI  LGRASLIIFILAF IFVSAISLGGVGISNMI KI+ HEY
Sbjct  395  VIVAFIAAIIGQHVVRRLINWLGRASLIIFILAFMIFVSAISLGGVGISNMIHKINQHEY  454

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  455  MGFENLCKY  463



>ref|XP_006660551.1| PREDICTED: uncharacterized protein LOC102715329 [Oryza brachyantha]
Length=470

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S+ YW++NLLQIPVS+GV L+EA GL  G R +SSKG   + L+  QL +YCFFG+ AGV
Sbjct  280  SSWYWILNLLQIPVSVGVTLYEALGLMSGKRVLSSKGTEQTTLKFHQLCIYCFFGITAGV  339

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYAL+ 
Sbjct  340  VGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLNRFPVPYALYF  399

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVA +AA IGQHVVRRLI  LGRASLIIFILAF IFVSAISLGGVGISNMI KI  HEY
Sbjct  400  VAVAFIAAIIGQHVVRRLINWLGRASLIIFILAFMIFVSAISLGGVGISNMIHKIQQHEY  459

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  460  MGFENLCKY  468



>ref|XP_002878880.1| hypothetical protein ARALYDRAFT_481426 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55139.1| hypothetical protein ARALYDRAFT_481426 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NLLQIPV++GV+ +EA  LY+G R I+SKG   SN   GQL++YC FG++AG+
Sbjct  289  SVAYWVINLLQIPVAVGVSGYEAVALYQGRRIIASKGQGDSNFTVGQLVMYCTFGILAGI  348

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+L
Sbjct  349  VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYL  408

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF+GQHVVRRLIA LGRASLIIFILA  IF+SAISLGGVGI NMI KI  HEY
Sbjct  409  VGVATIAAFVGQHVVRRLIAALGRASLIIFILASMIFISAISLGGVGIVNMIGKIQRHEY  468

Query  542  MGFENLCKYG  571
            MGFENLCKYG
Sbjct  469  MGFENLCKYG  478



>ref|XP_009388715.1| PREDICTED: uncharacterized protein LOC103975470 [Musa acuminata 
subsp. malaccensis]
Length=477

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 168/191 (88%), Gaps = 0/191 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST YW++N LQIP+SLGV+ +EA  LY+G R ISSKGD G+N    QL+ YC  G++AGV
Sbjct  287  STWYWILNFLQIPISLGVSGYEAVSLYRGKRVISSKGDEGTNFTVLQLVFYCSIGVLAGV  346

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGF++GP+FLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+ 
Sbjct  347  VGGLLGLGGGFVLGPVFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYF  406

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             +VA VAAF+GQ+VV+RLI +LGRASLIIFILAFTIFVSA+SLGGVGISNM++KI +H Y
Sbjct  407  ISVALVAAFVGQYVVKRLIDILGRASLIIFILAFTIFVSAVSLGGVGISNMVQKIQHHGY  466

Query  542  MGFENLCKYGV  574
            MGFENLCKY V
Sbjct  467  MGFENLCKYEV  477



>gb|EAZ42610.1| hypothetical protein OsJ_27176 [Oryza sativa Japonica Group]
Length=442

 Score =   195 bits (495),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST YWV+N LQIPVS+GV ++E  GL +G R ISSKGD  +NL+  QL+VYCFFGM+AGV
Sbjct  252  STWYWVLNFLQIPVSVGVTMYEGLGLMQGRRVISSKGDEQTNLKFHQLLVYCFFGMMAGV  311

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYALF 
Sbjct  312  VGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLDRFPVPYALFF  371

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            T VA  AA IGQH+VR+LI  LGRASLIIFIL+F IF+SAISLGGVGISNMI KI  HEY
Sbjct  372  TVVAFFAAIIGQHIVRKLINWLGRASLIIFILSFMIFISAISLGGVGISNMIGKIARHEY  431

Query  542  MGFENLCKYGV  574
            MGF+N+C Y V
Sbjct  432  MGFDNICNYDV  442



>ref|XP_010109461.1| hypothetical protein L484_001800 [Morus notabilis]
 gb|EXC22697.1| hypothetical protein L484_001800 [Morus notabilis]
Length=478

 Score =   196 bits (497),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST YWV+NL+QIPVS+GV L+EA  LYKG R I+SKG+ G+N +  QL +YC  G++AG+
Sbjct  288  STAYWVLNLMQIPVSVGVTLYEAISLYKGRRIIASKGEDGTNFKVHQLALYCACGVLAGI  347

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYA++L
Sbjct  348  VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAVYL  407

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AA +GQH+VRRLI + GRASLIIFILAFTIFVSAISLGGVGIS+MI  I  H Y
Sbjct  408  VLVATLAAVVGQHIVRRLIILFGRASLIIFILAFTIFVSAISLGGVGISDMIGMIERHAY  467

Query  542  MGFENLCKYGV  574
            MGFENLCKY V
Sbjct  468  MGFENLCKYKV  478



>ref|XP_002516571.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45912.1| conserved hypothetical protein [Ricinus communis]
Length=476

 Score =   196 bits (497),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWVVNLLQIPVSLGV+ +EA  LYKG R I+SKG  G+N +  QL++YC  G++AGV
Sbjct  286  SIEYWVVNLLQIPVSLGVSGYEAVSLYKGRRIIASKGKEGTNFKVHQLVLYCSCGVLAGV  345

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  346  VGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYF  405

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             +VAT+AA IGQH+VRR+I + GRASLIIFILAFTIFVSAISLGGVGISNMI KI ++EY
Sbjct  406  VSVATIAALIGQHIVRRMIIMFGRASLIIFILAFTIFVSAISLGGVGISNMIWKIQHNEY  465

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  466  MGFENLCKY  474



>gb|EEE69518.1| hypothetical protein OsJ_28979 [Oryza sativa Japonica Group]
Length=481

 Score =   196 bits (497),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S+ YW++NLLQIPVS+GV ++EA GL  G R +SSKG+  + L+  QL +YCFFG+ AGV
Sbjct  291  SSWYWILNLLQIPVSVGVTMYEALGLMSGKRVLSSKGNEQTTLKFHQLCIYCFFGITAGV  350

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYAL+ 
Sbjct  351  VGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLNRFPVPYALYF  410

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VA +AA IGQHVVRRLI  LGRASLIIFILAF IFVSAISLGGVGISNMI +I+ HEY
Sbjct  411  VIVAFIAAIIGQHVVRRLINWLGRASLIIFILAFMIFVSAISLGGVGISNMIHRINQHEY  470

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  471  MGFENLCKY  479



>ref|NP_001062933.1| Os09g0344800 [Oryza sativa Japonica Group]
 dbj|BAD29095.1| membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAF24847.1| Os09g0344800 [Oryza sativa Japonica Group]
 dbj|BAG88213.1| unnamed protein product [Oryza sativa Japonica Group]
Length=481

 Score =   196 bits (497),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S+ YW++NLLQIPVS+GV ++EA GL  G R +SSKG+  + L+  QL +YCFFG+ AGV
Sbjct  291  SSWYWILNLLQIPVSVGVTMYEALGLMSGKRVLSSKGNEQTTLKFHQLCIYCFFGITAGV  350

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYAL+ 
Sbjct  351  VGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLNRFPVPYALYF  410

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VA +AA IGQHVVRRLI  LGRASLIIFILAF IFVSAISLGGVGISNMI +I+ HEY
Sbjct  411  VIVAFIAAIIGQHVVRRLINWLGRASLIIFILAFMIFVSAISLGGVGISNMIHRINQHEY  470

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  471  MGFENLCKY  479



>ref|XP_010472594.1| PREDICTED: uncharacterized protein LOC104752213 isoform X1 [Camelina 
sativa]
Length=475

 Score =   195 bits (496),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NLLQIPV++GV+ +EA  LY+G R I+SKG   SN   GQL++YC FG++AG+
Sbjct  285  SVAYWVINLLQIPVAVGVSGYEAVALYQGRRIIASKGQGDSNFTVGQLVLYCTFGILAGI  344

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+L
Sbjct  345  VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYL  404

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AA +GQHVVRRLI+ LGRASLIIFILA  IF+SAISLGGVGI NMI KI  HEY
Sbjct  405  VGVATIAAIVGQHVVRRLISALGRASLIIFILASMIFISAISLGGVGIVNMIGKIQRHEY  464

Query  542  MGFENLCKYG  571
            MGFENLCKYG
Sbjct  465  MGFENLCKYG  474



>emb|CDX77007.1| BnaC04g38020D [Brassica napus]
Length=470

 Score =   195 bits (496),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  11   YWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvgg  190
            YWV+NLLQIPV++GV+ +EA  LY+G R I+S G  GSN   GQLI+YC FG++AGVVGG
Sbjct  283  YWVINLLQIPVAVGVSGYEAVALYQGRRIIASNGQGGSNFTIGQLILYCSFGVLAGVVGG  342

Query  191  llglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltav  370
            LLGLGGGFIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+L  V
Sbjct  343  LLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYLVGV  402

Query  371  atvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGF  550
            AT+AA +GQHVVRRLIAVLGRASLIIFILA TIF+SAISLGGVGI NM+ K+  HEYMGF
Sbjct  403  ATIAALVGQHVVRRLIAVLGRASLIIFILASTIFISAISLGGVGIVNMMGKLQRHEYMGF  462

Query  551  ENLCKY  568
            ENLCKY
Sbjct  463  ENLCKY  468



>ref|XP_010472595.1| PREDICTED: uncharacterized protein LOC104752213 isoform X2 [Camelina 
sativa]
Length=472

 Score =   195 bits (496),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NLLQIPV++GV+ +EA  LY+G R I+SKG   SN   GQL++YC FG++AG+
Sbjct  282  SVAYWVINLLQIPVAVGVSGYEAVALYQGRRIIASKGQGDSNFTVGQLVLYCTFGILAGI  341

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+L
Sbjct  342  VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYL  401

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AA +GQHVVRRLI+ LGRASLIIFILA  IF+SAISLGGVGI NMI KI  HEY
Sbjct  402  VGVATIAAIVGQHVVRRLISALGRASLIIFILASMIFISAISLGGVGIVNMIGKIQRHEY  461

Query  542  MGFENLCKYG  571
            MGFENLCKYG
Sbjct  462  MGFENLCKYG  471



>ref|XP_010249713.1| PREDICTED: uncharacterized protein LOC104592186 [Nelumbo nucifera]
Length=480

 Score =   195 bits (496),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST+YWV+NLLQIPV++GV+L+E   LYKGW+ I SKGD G+N R  QLI+YC  G++AGV
Sbjct  290  STIYWVLNLLQIPVAVGVSLYEGVSLYKGWKVIGSKGDKGTNWRVHQLILYCCCGILAGV  349

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLE+GVPP+VSSATATFAMMFSSSMSVVEYYLLKRFP+PYAL+ 
Sbjct  350  VGGLLGLGGGFILGPLFLEMGVPPEVSSATATFAMMFSSSMSVVEYYLLKRFPIPYALYF  409

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            TAVATVAAF+GQ VVRRLI +LGRASLIIFIL+ TIFVSAISLGG+GIS MI KI  HEY
Sbjct  410  TAVATVAAFVGQRVVRRLIILLGRASLIIFILSLTIFVSAISLGGIGISRMIHKIERHEY  469

Query  542  MGFENLCKYG  571
            MG ENLC Y 
Sbjct  470  MGLENLCNYN  479



>ref|XP_009140696.1| PREDICTED: uncharacterized protein LOC103864686 [Brassica rapa]
Length=470

 Score =   195 bits (496),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  11   YWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvgg  190
            YWV+NLLQIPV++GV+ +EA  LY+G R I+S G  GSN   GQLI+YC FG++AGVVGG
Sbjct  283  YWVINLLQIPVAVGVSGYEAVALYQGRRIIASNGQGGSNFTIGQLILYCSFGVLAGVVGG  342

Query  191  llglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltav  370
            LLGLGGGFIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+L  V
Sbjct  343  LLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYLVGV  402

Query  371  atvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGF  550
            AT+AA +GQHVVRRLIAVLGRASLIIFILA TIF+SAISLGGVGI NM+ K+  HEYMGF
Sbjct  403  ATIAALVGQHVVRRLIAVLGRASLIIFILASTIFISAISLGGVGIVNMMGKLQRHEYMGF  462

Query  551  ENLCKY  568
            ENLCKY
Sbjct  463  ENLCKY  468



>emb|CDY35338.1| BnaA04g15090D [Brassica napus]
Length=470

 Score =   195 bits (496),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  11   YWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvgg  190
            YWV+NLLQIPV++GV+ +EA  LY+G R I+S G  GSN   GQLI+YC FG++AGVVGG
Sbjct  283  YWVINLLQIPVAVGVSGYEAVALYQGRRIIASNGQGGSNFTIGQLILYCSFGVLAGVVGG  342

Query  191  llglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltav  370
            LLGLGGGFIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+L  V
Sbjct  343  LLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYLVGV  402

Query  371  atvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGF  550
            AT+AA +GQHVVRRLIAVLGRASLIIFILA TIF+SAISLGGVGI NM+ K+  HEYMGF
Sbjct  403  ATIAALVGQHVVRRLIAVLGRASLIIFILASTIFISAISLGGVGIVNMMGKLQRHEYMGF  462

Query  551  ENLCKY  568
            ENLCKY
Sbjct  463  ENLCKY  468



>ref|XP_010417351.1| PREDICTED: uncharacterized protein LOC104703106 [Camelina sativa]
Length=481

 Score =   195 bits (496),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NLLQIPV++GV+ +EA  LY+G R I+SKG   SN   GQL++YC FG++AG+
Sbjct  291  SVAYWVINLLQIPVAVGVSGYEAVALYQGRRIIASKGQGDSNFTVGQLVLYCTFGILAGI  350

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+L
Sbjct  351  VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYL  410

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AA +GQHVVRRLI+ LGRASLIIFILA  IF+SAISLGGVGI NMI KI  HEY
Sbjct  411  VGVATIAALVGQHVVRRLISALGRASLIIFILASMIFISAISLGGVGIVNMIGKIQRHEY  470

Query  542  MGFENLCKYG  571
            MGFENLCKYG
Sbjct  471  MGFENLCKYG  480



>ref|NP_850068.1| Sulfite exporter TauE/SafE family protein [Arabidopsis thaliana]
 gb|AAM97053.1| unknown protein [Arabidopsis thaliana]
 gb|AAN72117.1| unknown protein [Arabidopsis thaliana]
 dbj|BAC42374.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63445.1| At2g25737 [Arabidopsis thaliana]
 gb|AEC07746.1| Sulfite exporter TauE/SafE family protein [Arabidopsis thaliana]
Length=476

 Score =   195 bits (496),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NLLQIPV++GV+ +EA  LY+G R I+SKG   SN   GQL++YC FG+IAG+
Sbjct  286  SVAYWVINLLQIPVAVGVSGYEAVALYQGRRIIASKGQGDSNFTVGQLVMYCTFGIIAGI  345

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+L
Sbjct  346  VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYL  405

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AA++GQHVVRRLIA +GRASLIIFILA  IF+SAISLGGVGI NMI KI  HEY
Sbjct  406  VGVATIAAWVGQHVVRRLIAAIGRASLIIFILASMIFISAISLGGVGIVNMIGKIQRHEY  465

Query  542  MGFENLCKYG  571
            MGFENLCKYG
Sbjct  466  MGFENLCKYG  475



>gb|EEC83519.1| hypothetical protein OsI_29108 [Oryza sativa Indica Group]
Length=466

 Score =   195 bits (495),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST YWV+N LQIPVS+GV ++E  GL +G R ISSKGD  +NL+  QL+VYCFFGM+AGV
Sbjct  276  STWYWVLNFLQIPVSVGVTMYEGLGLMQGRRVISSKGDEQTNLKFHQLLVYCFFGMMAGV  335

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYALF 
Sbjct  336  VGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLDRFPVPYALFF  395

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            T VA  AA IGQH+VR+LI  LGRASLIIFIL+F IF+SAISLGGVGISNMI KI  HEY
Sbjct  396  TTVAFFAAIIGQHIVRKLINWLGRASLIIFILSFMIFISAISLGGVGISNMIGKIARHEY  455

Query  542  MGFENLCKYGV  574
            MGF+N+C Y V
Sbjct  456  MGFDNICNYDV  466



>ref|XP_010924740.1| PREDICTED: uncharacterized protein LOC105047500 [Elaeis guineensis]
Length=478

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  +WV+NLLQIPVS+ V L+EA  LY G R I+SKG  G+N +  QL +YC   +IAG+
Sbjct  288  SIWFWVLNLLQIPVSMAVTLYEAISLYNGKRVIASKGHEGTNWKVHQLFIYCSLAVIAGI  347

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLL RFPVPYAL+ 
Sbjct  348  VGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLDRFPVPYALYF  407

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VA VAAF+GQHVVRRLI ++GRASLIIFILAFTIFVSAISLGGVGISNMI KI +HEY
Sbjct  408  ITVAAVAAFVGQHVVRRLIILMGRASLIIFILAFTIFVSAISLGGVGISNMIRKIKDHEY  467

Query  542  MGFENLCKY  568
            MGFENLC+Y
Sbjct  468  MGFENLCRY  476



>ref|XP_003578003.1| PREDICTED: uncharacterized protein LOC100827421 [Brachypodium 
distachyon]
Length=469

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST YW++N LQIPVS+GV L+EA GL  G R +SSKG   + L+  QL +YCFFG+ AG+
Sbjct  279  STWYWILNFLQIPVSVGVTLYEALGLMNGKRVLSSKGGEQTTLKFHQLCIYCFFGVTAGL  338

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAMMFS+SMSVVEYYLL RFPVPYA++ 
Sbjct  339  VGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSASMSVVEYYLLNRFPVPYAVYF  398

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVA +AA IGQH VR+LI+ LGRASLIIFILAF IFVSAISLGGVG+SNMI+KI  HEY
Sbjct  399  VAVAFIAAIIGQHAVRKLISWLGRASLIIFILAFMIFVSAISLGGVGVSNMIQKIQRHEY  458

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  459  MGFENLCKY  467



>ref|NP_001061719.1| Os08g0389700 [Oryza sativa Japonica Group]
 dbj|BAD05341.1| membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAD05726.1| membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAF23633.1| Os08g0389700 [Oryza sativa Japonica Group]
Length=465

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST YWV+N LQIPVS+GV ++E  GL +G R ISSKGD  +NL+  QL+VYCFFGM+AGV
Sbjct  275  STWYWVLNFLQIPVSVGVTMYEGLGLMQGRRVISSKGDEQTNLKFHQLLVYCFFGMMAGV  334

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYALF 
Sbjct  335  VGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLDRFPVPYALFF  394

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            T VA  AA IGQH+VR+LI  LGRASLIIFIL+F IF+SAISLGGVGISNMI KI  HEY
Sbjct  395  TVVAFFAAIIGQHIVRKLINWLGRASLIIFILSFMIFISAISLGGVGISNMIGKIARHEY  454

Query  542  MGFENLCKYGV  574
            MGF+N+C Y V
Sbjct  455  MGFDNICNYDV  465



>gb|KHN42580.1| hypothetical protein glysoja_042801 [Glycine soja]
Length=469

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST+YWV+N+LQIP+S+GV+ +EA  LYKG R+ISS GD G    + QL +YC FG++AG+
Sbjct  279  STIYWVLNMLQIPISVGVSGYEAASLYKGRRQISSVGDQGKTFTSQQLTIYCIFGVLAGI  338

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLG+GGGF+MGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  339  VGGLLGIGGGFVMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYF  398

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVA ++A +GQH+VR+LI VLGRASLIIF+LAFTI VSA+SLGGVGI  M++KI NHEY
Sbjct  399  IAVAAISAIVGQHIVRKLIDVLGRASLIIFVLAFTILVSAVSLGGVGIVAMVKKIENHEY  458

Query  542  MGFENLCKY  568
            MGF++LC Y
Sbjct  459  MGFDDLCTY  467



>ref|XP_007137180.1| hypothetical protein PHAVU_009G106400g [Phaseolus vulgaris]
 gb|ESW09174.1| hypothetical protein PHAVU_009G106400g [Phaseolus vulgaris]
Length=468

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            STLYWV+NLLQ+PVS+GV  +EA  L+ G R I+S G+ G +    QL +YC FG++AGV
Sbjct  278  STLYWVLNLLQVPVSVGVTAYEAAALFSGRRVIASTGEEGKDFTVLQLTIYCVFGILAGV  337

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGG+LGLGGGF+MGPLFLELGVPPQVSSATATFAM FSSSMSV+EYYLLKRFPVPYA++ 
Sbjct  338  VGGMLGLGGGFVMGPLFLELGVPPQVSSATATFAMTFSSSMSVIEYYLLKRFPVPYAVYF  397

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            T VA +AAF+GQH+VR+LI VLGRASLIIFILA TIF SA+SLGGVGI NM+ KI NHEY
Sbjct  398  TLVAVIAAFVGQHIVRKLIIVLGRASLIIFILASTIFASAVSLGGVGIVNMVHKIQNHEY  457

Query  542  MGFENLCKYG  571
            MGF+NLCKYG
Sbjct  458  MGFDNLCKYG  467



>ref|XP_002303288.2| hypothetical protein POPTR_0003s05180g [Populus trichocarpa]
 gb|EEE78267.2| hypothetical protein POPTR_0003s05180g [Populus trichocarpa]
Length=485

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW +NLLQIPV++GV+ +EA  LYKG RKI+SKG++G+N RA QL++YC  G++AG+
Sbjct  295  SMAYWALNLLQIPVAVGVSSYEAVSLYKGTRKIASKGETGTNWRAHQLVLYCACGVLAGI  354

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+ PQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+ 
Sbjct  355  VGGLLGLGGGFILGPLFLELGISPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYF  414

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVATV+AF+GQ VVR+LI +LGRASLIIFILAFTIFVSAISLGGVGI NMIEKI +H+Y
Sbjct  415  VAVATVSAFVGQFVVRKLINLLGRASLIIFILAFTIFVSAISLGGVGIVNMIEKIEHHDY  474

Query  542  MGFENLCKY  568
            MGFEN+C Y
Sbjct  475  MGFENICSY  483



>gb|KHN10230.1| hypothetical protein glysoja_017834 [Glycine soja]
Length=439

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            STLYWV+NLLQ+PVS+GV  +EA  L+ G R I+S G+ G +    QL++YC FG++AGV
Sbjct  249  STLYWVLNLLQVPVSVGVTAYEAAALFSGRRVIASTGEQGKDFTVLQLMIYCVFGVLAGV  308

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGG+LGLGGGF+MGPLFLELGVPPQVSSATATFAM FSSSMSV+EYYLLKRFPVPYAL+ 
Sbjct  309  VGGMLGLGGGFVMGPLFLELGVPPQVSSATATFAMTFSSSMSVIEYYLLKRFPVPYALYF  368

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF+GQH+VR+LI + GRASLIIFILA TIFVSA+SLGGVGI NM+ KI NHEY
Sbjct  369  ILVATIAAFVGQHIVRKLIILFGRASLIIFILASTIFVSAVSLGGVGIVNMVHKIQNHEY  428

Query  542  MGFENLCKYG  571
            MGFE+LCKYG
Sbjct  429  MGFEDLCKYG  438



>ref|XP_011001600.1| PREDICTED: uncharacterized protein LOC105108832 isoform X2 [Populus 
euphratica]
Length=485

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW +NLLQIPV++GV+ +EA  LYKG RKI+SKG++G+N RA QL++YC  G++AG+
Sbjct  295  SMAYWALNLLQIPVAVGVSSYEAVSLYKGRRKIASKGETGTNWRAHQLVLYCACGVLAGM  354

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFL+LG+PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+ 
Sbjct  355  VGGLLGLGGGFILGPLFLDLGIPPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYF  414

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVATVAAF+GQ VVR+LI +LGRASLIIFIL+FTIFVSAISLGGVGI NMIEKI +HEY
Sbjct  415  VAVATVAAFVGQFVVRKLINLLGRASLIIFILSFTIFVSAISLGGVGIENMIEKIEHHEY  474

Query  542  MGFENLCKY  568
            MGFEN+C Y
Sbjct  475  MGFENICSY  483



>ref|XP_011001598.1| PREDICTED: uncharacterized protein LOC105108832 isoform X1 [Populus 
euphratica]
Length=489

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW +NLLQIPV++GV+ +EA  LYKG RKI+SKG++G+N RA QL++YC  G++AG+
Sbjct  299  SMAYWALNLLQIPVAVGVSSYEAVSLYKGRRKIASKGETGTNWRAHQLVLYCACGVLAGM  358

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFL+LG+PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+ 
Sbjct  359  VGGLLGLGGGFILGPLFLDLGIPPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYF  418

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVATVAAF+GQ VVR+LI +LGRASLIIFIL+FTIFVSAISLGGVGI NMIEKI +HEY
Sbjct  419  VAVATVAAFVGQFVVRKLINLLGRASLIIFILSFTIFVSAISLGGVGIENMIEKIEHHEY  478

Query  542  MGFENLCKY  568
            MGFEN+C Y
Sbjct  479  MGFENICSY  487



>ref|XP_010667910.1| PREDICTED: uncharacterized protein LOC104884897 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=347

 Score =   191 bits (484),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NLLQ+PV++GV+L+EA GLYKG R ISSKGD  +     QL++YC  G++AG+
Sbjct  157  SIAYWVLNLLQVPVAIGVSLYEAVGLYKGRRIISSKGDVSTTWEVHQLVLYCCCGILAGI  216

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+ PLFLELGVPPQVSSATATFAM FS+SMSVVEYYLLKRFP+ YAL+ 
Sbjct  217  VGGLLGLGGGFILIPLFLELGVPPQVSSATATFAMAFSASMSVVEYYLLKRFPITYALYF  276

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVA VAAF+GQH+VR+LI +LGRASLIIFILAF+IFVSA+SLGGVGISNMI+  H H Y
Sbjct  277  MAVAIVAAFVGQHLVRKLIILLGRASLIIFILAFSIFVSAVSLGGVGISNMIKMFHRHHY  336

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  337  MGFENLCKY  345



>ref|XP_003523730.1| PREDICTED: uncharacterized protein LOC100809318 [Glycine max]
Length=472

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            STLYWV+NLLQ+PVS+GV  +EA  L+ G R I+S G+ G +    QL++YC FG++AGV
Sbjct  282  STLYWVLNLLQVPVSVGVTAYEAAALFSGRRVIASTGEQGKDFTVLQLMIYCVFGVLAGV  341

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGG+LGLGGGF+MGPLFLELGVPPQVSSATATFAM FSSSMSV+EYYLLKRFPVPYAL+ 
Sbjct  342  VGGMLGLGGGFVMGPLFLELGVPPQVSSATATFAMTFSSSMSVIEYYLLKRFPVPYALYF  401

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF+GQH+VR+LI + GRASLIIFILA TIFVSA+SLGGVGI NM+ KI NHEY
Sbjct  402  ILVATIAAFVGQHIVRKLIILFGRASLIIFILASTIFVSAVSLGGVGIVNMVHKIQNHEY  461

Query  542  MGFENLCKYG  571
            MGFE+LCKYG
Sbjct  462  MGFEDLCKYG  471



>ref|XP_006660104.1| PREDICTED: uncharacterized protein LOC102707608 [Oryza brachyantha]
Length=446

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST YWV+N+LQIPVS+GV ++E  GL +G R ISSKG   +NL+  QL+VYCFFGM+AGV
Sbjct  256  STWYWVLNILQIPVSIGVTMYEGLGLMQGRRVISSKGTEQTNLKFHQLLVYCFFGMMAGV  315

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYALF 
Sbjct  316  VGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLNRFPVPYALFF  375

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            T  A  AA +GQHVVR+LI  LGRASLIIFIL+F IFVSAISLGGVGISNM+ KI  HEY
Sbjct  376  TVTAFFAAIVGQHVVRKLINWLGRASLIIFILSFMIFVSAISLGGVGISNMVGKISRHEY  435

Query  542  MGFENLCKYGV  574
            MGF+N+C Y V
Sbjct  436  MGFDNICNYDV  446



>ref|XP_009409060.1| PREDICTED: uncharacterized protein LOC103991359 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=474

 Score =   193 bits (491),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++NLLQ+PVSLGV+ +EA  LY+G R ISSKG  G+N    QL+ YC  G++AGV
Sbjct  284  SLWYWILNLLQVPVSLGVSGYEAVSLYRGKRIISSKGGDGTNFTVIQLVFYCLIGVLAGV  343

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GP+FLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+ 
Sbjct  344  VGGLLGLGGGFILGPVFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYF  403

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             +VA VAAF+GQH+V+RLI +LGRASLIIFILA TIF+SAISLGGVGISNM++KI +HEY
Sbjct  404  VSVALVAAFVGQHLVKRLIEILGRASLIIFILASTIFISAISLGGVGISNMVQKIQHHEY  463

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  464  MGFENLCKY  472



>ref|XP_009409059.1| PREDICTED: uncharacterized protein LOC103991359 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=499

 Score =   193 bits (491),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++NLLQ+PVSLGV+ +EA  LY+G R ISSKG  G+N    QL+ YC  G++AGV
Sbjct  309  SLWYWILNLLQVPVSLGVSGYEAVSLYRGKRIISSKGGDGTNFTVIQLVFYCLIGVLAGV  368

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GP+FLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+ 
Sbjct  369  VGGLLGLGGGFILGPVFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYF  428

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             +VA VAAF+GQH+V+RLI +LGRASLIIFILA TIF+SAISLGGVGISNM++KI +HEY
Sbjct  429  VSVALVAAFVGQHLVKRLIEILGRASLIIFILASTIFISAISLGGVGISNMVQKIQHHEY  488

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  489  MGFENLCKY  497



>ref|XP_003527825.1| PREDICTED: uncharacterized protein LOC100810784 [Glycine max]
 gb|KHN18202.1| hypothetical protein glysoja_025092 [Glycine soja]
Length=477

 Score =   192 bits (489),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST YWV+NLLQ+PVS+GV  +EA  L+ G R I+S G+ G +    QLI+YC FG++AGV
Sbjct  287  STFYWVLNLLQVPVSVGVTAYEAAALFSGRRVIASTGEQGKDFTVLQLIIYCVFGVLAGV  346

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGG+LGLGGGF+MGPLFLELGVPPQVSSATATFAM FSSSMSV+EYYLLKRFP+PYAL+ 
Sbjct  347  VGGMLGLGGGFVMGPLFLELGVPPQVSSATATFAMTFSSSMSVIEYYLLKRFPIPYALYF  406

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF+GQH+VR+LI + GRASLIIFILA TIFVSA+SLGGVGI NM+ KI NHEY
Sbjct  407  VLVATIAAFVGQHIVRKLIILFGRASLIIFILASTIFVSAVSLGGVGIVNMVHKIDNHEY  466

Query  542  MGFENLCKYG  571
            MGFE+LCKYG
Sbjct  467  MGFEDLCKYG  476



>ref|XP_004501773.1| PREDICTED: uncharacterized protein LOC101498079 [Cicer arietinum]
Length=484

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST YWV+NLLQIP+S+GV  +EAT L+ G R I+S GD G      QL++YC FG++AG+
Sbjct  294  STAYWVLNLLQIPISVGVTGYEATALFTGKRVIASTGDQGKEFTVFQLVIYCVFGVLAGI  353

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGF+MGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+L
Sbjct  354  VGGLLGLGGGFVMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYL  413

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AA +GQH+VR+LI + GRASLIIFILA TIF+SAISLGGVGISNM+ KI +HEY
Sbjct  414  GLVATIAAVVGQHIVRKLIILFGRASLIIFILAGTIFISAISLGGVGISNMVHKIASHEY  473

Query  542  MGFENLCKYG  571
            MGFEN+CKYG
Sbjct  474  MGFENICKYG  483



>ref|XP_011026589.1| PREDICTED: uncharacterized protein LOC105127137 [Populus euphratica]
Length=479

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 158/186 (85%), Gaps = 0/186 (0%)
 Frame = +2

Query  11   YWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvgg  190
            YWV+NL QIPVS+GV L+E   LY G R I+SKGD G+N R  QL+ YC  G++AGVVGG
Sbjct  292  YWVLNLSQIPVSVGVTLYEVVSLYTGRRVIASKGDDGTNFRVLQLMTYCALGVMAGVVGG  351

Query  191  llglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltav  370
            LLGLGGGFIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA++   V
Sbjct  352  LLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAVYFVVV  411

Query  371  atvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGF  550
            A  AA IGQH+VRRLI V GRASLIIFILAFTIFVSAI LGG GISN+I KIH+ EYMGF
Sbjct  412  AAFAALIGQHIVRRLIIVFGRASLIIFILAFTIFVSAILLGGFGISNIIGKIHHQEYMGF  471

Query  551  ENLCKY  568
            ENLCK+
Sbjct  472  ENLCKH  477



>ref|XP_010249715.1| PREDICTED: uncharacterized protein LOC104592187 [Nelumbo nucifera]
Length=481

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NLLQIP+++ V+ +EA  LY+G R I+SKGD+G+N +  QLI+YC  G++AG+
Sbjct  291  SVPYWVLNLLQIPIAVVVSGYEAISLYRGRRVIASKGDAGTNWKVHQLILYCSCGVLAGM  350

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  351  VGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYF  410

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVATVAAFIGQHVVR+LI +LGRASLIIFIL+ TIFVSA+SLGGVGISNMI KI  HEY
Sbjct  411  VAVATVAAFIGQHVVRKLIIILGRASLIIFILSLTIFVSAVSLGGVGISNMIGKIQRHEY  470

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  471  MGFENLCKY  479



>ref|XP_010062471.1| PREDICTED: uncharacterized protein LOC104449877 [Eucalyptus grandis]
 gb|KCW69612.1| hypothetical protein EUGRSUZ_F03030 [Eucalyptus grandis]
Length=480

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S LYWV+NLLQIPV+ GV+ +EA  LY G R I+S+G+  +N +  QL++YC FG+ AG+
Sbjct  290  SALYWVLNLLQIPVAFGVSGYEAYNLYTGRRVIASRGEVAANWKISQLVMYCAFGIAAGM  349

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  350  VGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYF  409

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVAT+AAF GQHVVRR+IA+LGRASLIIFILAFTIFVSAISLGGVGI NMIE I N EY
Sbjct  410  VAVATIAAFTGQHVVRRIIAILGRASLIIFILAFTIFVSAISLGGVGIVNMIEDIENKEY  469

Query  542  MGFENLC  562
            MGFE+LC
Sbjct  470  MGFEDLC  476



>ref|XP_009403528.1| PREDICTED: uncharacterized protein LOC103987063 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=474

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++NLLQ+PVSLGV+ +EA  LYKG R ISSKG+ G++     L+ YC  G++AGV
Sbjct  284  SLWYWILNLLQVPVSLGVSGYEAVSLYKGKRIISSKGEEGTSFTVLHLVFYCCIGILAGV  343

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GP+FLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+ 
Sbjct  344  VGGLLGLGGGFILGPVFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYF  403

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVA VAA +GQH+V+RLI +LGRASLIIFILAFTIFVSAISLGGVGISNM++KI +HEY
Sbjct  404  VAVALVAALVGQHIVKRLIEILGRASLIIFILAFTIFVSAISLGGVGISNMVQKIQHHEY  463

Query  542  MGFENLCKY  568
            MGF+NLCKY
Sbjct  464  MGFDNLCKY  472



>ref|XP_009403527.1| PREDICTED: uncharacterized protein LOC103987063 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=475

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++NLLQ+PVSLGV+ +EA  LYKG R ISSKG+ G++     L+ YC  G++AGV
Sbjct  285  SLWYWILNLLQVPVSLGVSGYEAVSLYKGKRIISSKGEEGTSFTVLHLVFYCCIGILAGV  344

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GP+FLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+ 
Sbjct  345  VGGLLGLGGGFILGPVFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYF  404

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVA VAA +GQH+V+RLI +LGRASLIIFILAFTIFVSAISLGGVGISNM++KI +HEY
Sbjct  405  VAVALVAALVGQHIVKRLIEILGRASLIIFILAFTIFVSAISLGGVGISNMVQKIQHHEY  464

Query  542  MGFENLCKY  568
            MGF+NLCKY
Sbjct  465  MGFDNLCKY  473



>ref|XP_009381051.1| PREDICTED: uncharacterized protein LOC103969282 [Musa acuminata 
subsp. malaccensis]
Length=475

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++N LQ+PVSLGV+ +EA  LY+G R ISSKG+ G+N    QL+ YC  G++AG+
Sbjct  285  SPWYWILNFLQVPVSLGVSGYEAVSLYRGKRIISSKGEKGTNFTVVQLVFYCLIGVLAGM  344

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GP+FLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+L
Sbjct  345  VGGLLGLGGGFILGPVFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYL  404

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVA VAA +GQHVV+RLI +LGRASLIIFILA TIFVSAISLGGVGISNM++KI +HEY
Sbjct  405  VAVALVAAIVGQHVVKRLIEILGRASLIIFILASTIFVSAISLGGVGISNMVQKIQHHEY  464

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  465  MGFENLCKY  473



>ref|XP_010667904.1| PREDICTED: uncharacterized protein LOC104884897 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=478

 Score =   191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NLLQ+PV++GV+L+EA GLYKG R ISSKGD  +     QL++YC  G++AG+
Sbjct  288  SIAYWVLNLLQVPVAIGVSLYEAVGLYKGRRIISSKGDVSTTWEVHQLVLYCCCGILAGI  347

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+ PLFLELGVPPQVSSATATFAM FS+SMSVVEYYLLKRFP+ YAL+ 
Sbjct  348  VGGLLGLGGGFILIPLFLELGVPPQVSSATATFAMAFSASMSVVEYYLLKRFPITYALYF  407

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVA VAAF+GQH+VR+LI +LGRASLIIFILAF+IFVSA+SLGGVGISNMI+  H H Y
Sbjct  408  MAVAIVAAFVGQHLVRKLIILLGRASLIIFILAFSIFVSAVSLGGVGISNMIKMFHRHHY  467

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  468  MGFENLCKY  476



>emb|CDY70121.1| BnaC03g72820D [Brassica napus]
Length=463

 Score =   190 bits (483),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NLLQIPV++GV+ +EA  LY+G R I+S G   SN   GQL++YC FG++AG+
Sbjct  273  SIAYWVINLLQIPVAVGVSGYEAVALYQGRRIIASNGQGDSNFTVGQLVLYCTFGILAGI  332

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAM FSSSMSV+EYYLLKRFPVPYAL+L
Sbjct  333  VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVIEYYLLKRFPVPYALYL  392

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VATVAA +GQHVVRRLIAV+GRASLIIFILA  IF+SAISLGGVGI NMI K   HEY
Sbjct  393  VGVATVAALVGQHVVRRLIAVIGRASLIIFILASMIFISAISLGGVGIVNMIGKFQRHEY  452

Query  542  MGFENLCKY  568
            MGFEN+CKY
Sbjct  453  MGFENICKY  461



>dbj|BAJ87419.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=474

 Score =   191 bits (484),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NLLQIPVS+GVA++EA GL +G R ISSK +  ++LRA QL+VYCF G+ AGV
Sbjct  284  SISYWVLNLLQIPVSVGVAMYEAVGLMQGRRVISSKRNEENSLRAHQLLVYCFLGVTAGV  343

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            V GLLG+GGG IMGPLFLELGVPPQV+SATATFAMMFS+SMSVVEYYLL RFPVPYAL+L
Sbjct  344  VAGLLGVGGGSIMGPLFLELGVPPQVASATATFAMMFSASMSVVEYYLLNRFPVPYALYL  403

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            T +A +AA IGQ VVR+LI +LGRAS+IIFIL+F IF+SA+SLGGVGISN I KI   EY
Sbjct  404  TILAFLAAIIGQRVVRKLIDLLGRASIIIFILSFMIFISALSLGGVGISNTIHKIARREY  463

Query  542  MGFENLCKYGV  574
            MGFEN+CKYGV
Sbjct  464  MGFENICKYGV  474



>ref|XP_009133962.1| PREDICTED: uncharacterized protein LOC103858367 [Brassica rapa]
Length=462

 Score =   190 bits (483),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NLLQIPV++GV+ +EA  LY+G R I+S G   SN   GQL++YC FG++AG+
Sbjct  272  SIAYWVINLLQIPVAVGVSGYEAVALYQGRRIIASNGQGDSNFTVGQLVLYCTFGILAGI  331

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAM FSSSMSV+EYYLLKRFPVPYAL+L
Sbjct  332  VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVIEYYLLKRFPVPYALYL  391

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VATVAA +GQHVVRRLIAV+GRASLIIFILA  IF+SAISLGGVGI NMI K   HEY
Sbjct  392  VGVATVAALVGQHVVRRLIAVIGRASLIIFILASMIFISAISLGGVGIVNMIGKFQRHEY  451

Query  542  MGFENLCKY  568
            MGFEN+CKY
Sbjct  452  MGFENICKY  460



>ref|XP_006405251.1| hypothetical protein EUTSA_v10000151mg [Eutrema salsugineum]
 gb|ESQ46704.1| hypothetical protein EUTSA_v10000151mg [Eutrema salsugineum]
Length=478

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NLLQIPV++GV+ +EA  LY+G R I+S G   SN   GQL++YC FG++AG+
Sbjct  288  SVAYWVINLLQIPVAVGVSGYEAVALYQGRRIIASNGQGDSNFTVGQLLLYCTFGVLAGI  347

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  348  VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYF  407

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AA +GQHV+RRLI VLGRASLIIFILA  IF+SAISLGGVGI NMI K   HEY
Sbjct  408  VGVATIAALVGQHVIRRLITVLGRASLIIFILASMIFISAISLGGVGIVNMIGKYQRHEY  467

Query  542  MGFENLCKYG  571
            MGFENLCKY 
Sbjct  468  MGFENLCKYS  477



>ref|XP_010049082.1| PREDICTED: uncharacterized protein LOC104437756 [Eucalyptus grandis]
 gb|KCW81533.1| hypothetical protein EUGRSUZ_C02892 [Eucalyptus grandis]
Length=477

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = +2

Query  11   YWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvgg  190
            YWV+NLLQ+P+S  V+L+EA  LYKG R ISSKGD  +  +  QL+ YC  G++AG+VGG
Sbjct  290  YWVLNLLQVPISFSVSLYEAISLYKGRRVISSKGDHETTFQVHQLVFYCACGVLAGIVGG  349

Query  191  llglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltav  370
            LLGLGGGFIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLL RFPVPYAL+   V
Sbjct  350  LLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLNRFPVPYALYFVIV  409

Query  371  atvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGF  550
            ATVAA  GQH+VR+LI V GRASLIIFILAFTIFVSAISLGGVGISNM+ KI  HEYMGF
Sbjct  410  ATVAALFGQHIVRKLIIVFGRASLIIFILAFTIFVSAISLGGVGISNMVGKIERHEYMGF  469

Query  551  ENLCKY  568
            ENLCKY
Sbjct  470  ENLCKY  475



>ref|XP_003636476.1| hypothetical protein MTR_042s0018 [Medicago truncatula]
Length=480

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 166/200 (83%), Gaps = 10/200 (5%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++NLLQIP+++GV  +EAT L+ G R I+S GD G     GQL++YC FG++AG+
Sbjct  280  SAAYWILNLLQIPIAVGVTAYEATALFTGRRVIASTGDQGKAFTVGQLVIYCVFGVLAGI  339

Query  182  vggllglgggfimgplflELGVPPQVs----------satatfammfsssmsVVEYYLLK  331
            VGGLLGLGGGF+MGPLFLELGVPPQVS          SATATFAM FSSSMSVVEYYLLK
Sbjct  340  VGGLLGLGGGFVMGPLFLELGVPPQVSFKLQYINHVSSATATFAMTFSSSMSVVEYYLLK  399

Query  332  RFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISN  511
            RFPVPYAL+L+ VAT+AA +GQH+VRRLI + GRASLIIFILA TIF+SAISLGGVGISN
Sbjct  400  RFPVPYALYLSLVATIAALVGQHIVRRLIILFGRASLIIFILAGTIFISAISLGGVGISN  459

Query  512  MIEKIHNHEYMGFENLCKYG  571
            M+ KI NHEYMGFEN+CKYG
Sbjct  460  MVHKIANHEYMGFENICKYG  479



>emb|CDX83221.1| BnaA03g22850D [Brassica napus]
Length=462

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NLLQIPV++GV+ +EA  LY+G R I+S G   SN   GQL++YC FG++AG+
Sbjct  272  SIAYWVINLLQIPVAVGVSGYEAVALYQGRRIIASNGQGDSNFTVGQLVLYCTFGILAGI  331

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAM FSSSMSV+EYYLLKRFPVPYAL+L
Sbjct  332  VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVIEYYLLKRFPVPYALYL  391

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VATVAA +GQHVVR+LIAV+GRASLIIFILA  IF+SAISLGGVGI NMI K   HEY
Sbjct  392  VGVATVAALVGQHVVRKLIAVIGRASLIIFILASMIFISAISLGGVGIVNMIGKFQRHEY  451

Query  542  MGFENLCKY  568
            MGFEN+CKY
Sbjct  452  MGFENICKY  460



>ref|XP_010235080.1| PREDICTED: uncharacterized protein LOC100846223 isoform X2 [Brachypodium 
distachyon]
Length=451

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST YWV+NLLQIPVS+GVA++EA GL +G R ISSK +  ++L+  QL++YCF G++AGV
Sbjct  261  STWYWVLNLLQIPVSVGVAMYEAVGLLQGKRVISSKANDQTSLKVHQLLLYCFLGLMAGV  320

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            V GLLG+GGG IMGPLFLELGVPPQVSSATATFAMMFSSSMSVVEY+LL RFPVPYALF 
Sbjct  321  VAGLLGVGGGSIMGPLFLELGVPPQVSSATATFAMMFSSSMSVVEYFLLNRFPVPYALFF  380

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            T +A  AA +GQ VVR+LI +LGRASLI+FIL+  IFVSA SLGGVGISNMI KI  HEY
Sbjct  381  TVLAFFAAIVGQRVVRKLIGLLGRASLIVFILSMMIFVSAFSLGGVGISNMIHKITRHEY  440

Query  542  MGFENLCKYG  571
            MGFEN+CKY 
Sbjct  441  MGFENICKYD  450



>gb|EMT12794.1| hypothetical protein F775_19997 [Aegilops tauschii]
Length=468

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NLLQIPVS+GVA++EA GL +G R ISSK +  ++LRA QL VYCF G+ AGV
Sbjct  278  SIWYWVLNLLQIPVSVGVAMYEAVGLVQGRRVISSKRNEQNSLRAHQLFVYCFLGVTAGV  337

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            V GLLG+GGG IMGPLFLELGVPPQV+SATATFAMMFSSSMSVVEYYLL RFPVPYA++L
Sbjct  338  VAGLLGVGGGSIMGPLFLELGVPPQVASATATFAMMFSSSMSVVEYYLLNRFPVPYAVYL  397

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            T +A  AA +GQ VVR+LI +LGRAS+I+FIL+F IF+SA+SLGGVGISN I KI  HEY
Sbjct  398  TILAFFAAIVGQRVVRKLIDLLGRASIIVFILSFMIFISALSLGGVGISNTIHKIERHEY  457

Query  542  MGFENLCKY  568
            MGFEN+CKY
Sbjct  458  MGFENICKY  466



>ref|XP_009410875.1| PREDICTED: uncharacterized protein LOC103992760 [Musa acuminata 
subsp. malaccensis]
Length=373

 Score =   186 bits (472),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST YW++N LQIPVS+ V L EA  LYKG R I+S+GD G+N +  QL V+C  G+IAG+
Sbjct  183  STWYWILNFLQIPVSVAVTLHEAISLYKGERVIASRGDEGTNWKVSQLFVFCLSGIIAGI  242

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATATFAM FSSS+SVVEYYLL RFPVPYA++ 
Sbjct  243  VGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSSSLSVVEYYLLNRFPVPYAVYF  302

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VATVAAF+GQHVVRRL+ ++GRASLIIFILA  IF+SAISLGGVGI NMI+KI +++Y
Sbjct  303  IFVATVAAFVGQHVVRRLVILIGRASLIIFILASMIFISAISLGGVGIVNMIKKIEDNDY  362

Query  542  MGFENLCKY  568
            MGFENLC+Y
Sbjct  363  MGFENLCRY  371



>ref|XP_003574412.1| PREDICTED: uncharacterized protein LOC100846223 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235079.1| PREDICTED: uncharacterized protein LOC100846223 isoform X1 [Brachypodium 
distachyon]
Length=468

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST YWV+NLLQIPVS+GVA++EA GL +G R ISSK +  ++L+  QL++YCF G++AGV
Sbjct  278  STWYWVLNLLQIPVSVGVAMYEAVGLLQGKRVISSKANDQTSLKVHQLLLYCFLGLMAGV  337

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            V GLLG+GGG IMGPLFLELGVPPQVSSATATFAMMFSSSMSVVEY+LL RFPVPYALF 
Sbjct  338  VAGLLGVGGGSIMGPLFLELGVPPQVSSATATFAMMFSSSMSVVEYFLLNRFPVPYALFF  397

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            T +A  AA +GQ VVR+LI +LGRASLI+FIL+  IFVSA SLGGVGISNMI KI  HEY
Sbjct  398  TVLAFFAAIVGQRVVRKLIGLLGRASLIVFILSMMIFVSAFSLGGVGISNMIHKITRHEY  457

Query  542  MGFENLCKYG  571
            MGFEN+CKY 
Sbjct  458  MGFENICKYD  467



>ref|XP_010235081.1| PREDICTED: uncharacterized protein LOC100846525 isoform X2 [Brachypodium 
distachyon]
Length=373

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST YWV+N+LQIPVS+GV +++A GL +G R ISSK ++ ++L+A QL VYC  G+ AG 
Sbjct  183  STWYWVLNILQIPVSVGVTMYQAVGLAQGKRVISSKANNQTSLKAYQLFVYCSLGLTAGS  242

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            +GGLLG+GGG IMGPLFLELGVPPQVSSAT+TFAMMFS+SMSVVEYYLLKRFPVPYA F 
Sbjct  243  MGGLLGVGGGIIMGPLFLELGVPPQVSSATSTFAMMFSASMSVVEYYLLKRFPVPYAAFF  302

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            T VA +AA +GQ VVR++I+ LGRASLIIF+L+F IF+SA+SLGGVG SNMI KI  HEY
Sbjct  303  TIVAFLAAIVGQGVVRKMISWLGRASLIIFVLSFMIFISALSLGGVGTSNMIHKITQHEY  362

Query  542  MGFENLCKYG  571
            +GFEN+CKY 
Sbjct  363  LGFENICKYD  372



>gb|KDO56901.1| hypothetical protein CISIN_1g0116821mg, partial [Citrus sinensis]
Length=353

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S LYWV+NLLQIPV+ GV+ +EA  LYKG RKI+SKGD G+  RA QL+ YC  G+ AG+
Sbjct  165  SVLYWVLNLLQIPVAGGVSAYEAVALYKGRRKIASKGDEGTKWRASQLVFYCACGITAGM  224

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATA FA+ FSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  225  VGGLLGLGGGFILGPLFLELGIPPQVSSATALFAITFSSSMSVVEYYLLKRFPVPYALYF  284

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             A++ +AAF+GQHV+++LI +LGRAS+IIF L+F IFVSA+SLGGVG++ MI++I + EY
Sbjct  285  FALSIIAAFVGQHVLKKLIKILGRASIIIFTLSFIIFVSALSLGGVGLAKMIKRIEHKEY  344

Query  542  MGFENLC  562
            MGF+N+C
Sbjct  345  MGFDNIC  351



>gb|KDO56900.1| hypothetical protein CISIN_1g0116821mg, partial [Citrus sinensis]
Length=355

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S LYWV+NLLQIPV+ GV+ +EA  LYKG RKI+SKGD G+  RA QL+ YC  G+ AG+
Sbjct  167  SVLYWVLNLLQIPVAGGVSAYEAVALYKGRRKIASKGDEGTKWRASQLVFYCACGITAGM  226

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATA FA+ FSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  227  VGGLLGLGGGFILGPLFLELGIPPQVSSATALFAITFSSSMSVVEYYLLKRFPVPYALYF  286

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             A++ +AAF+GQHV+++LI +LGRAS+IIF L+F IFVSA+SLGGVG++ MI++I + EY
Sbjct  287  FALSIIAAFVGQHVLKKLIKILGRASIIIFTLSFIIFVSALSLGGVGLAKMIKRIEHKEY  346

Query  542  MGFENLC  562
            MGF+N+C
Sbjct  347  MGFDNIC  353



>gb|KDO56902.1| hypothetical protein CISIN_1g0116821mg, partial [Citrus sinensis]
Length=348

 Score =   182 bits (463),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S LYWV+NLLQIPV+ GV+ +EA  LYKG RKI+SKGD G+  RA QL+ YC  G+ AG+
Sbjct  160  SVLYWVLNLLQIPVAGGVSAYEAVALYKGRRKIASKGDEGTKWRASQLVFYCACGITAGM  219

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATA FA+ FSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  220  VGGLLGLGGGFILGPLFLELGIPPQVSSATALFAITFSSSMSVVEYYLLKRFPVPYALYF  279

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             A++ +AAF+GQHV+++LI +LGRAS+IIF L+F IFVSA+SLGGVG++ MI++I + EY
Sbjct  280  FALSIIAAFVGQHVLKKLIKILGRASIIIFTLSFIIFVSALSLGGVGLAKMIKRIEHKEY  339

Query  542  MGFENLC  562
            MGF+N+C
Sbjct  340  MGFDNIC  346



>ref|XP_011011436.1| PREDICTED: uncharacterized protein LOC105116005 isoform X3 [Populus 
euphratica]
Length=422

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++N+LQIPV+ GV+ +EA  LYKG RKI+SKGD+ +N +  QL++YCF G++AG+
Sbjct  235  SVAYWLLNILQIPVAFGVSSYEAFNLYKGRRKIASKGDAVTNWKIRQLVLYCFIGLLAGI  294

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGG+LGLGGGFI+GPLFLE+G+PPQVSSATATF+MMFS+SMSVVEYYLLKRFPVPYAL+ 
Sbjct  295  VGGMLGLGGGFILGPLFLEMGIPPQVSSATATFSMMFSASMSVVEYYLLKRFPVPYALYF  354

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVAT+AA +GQHV+R+LI++LGRASLIIF LAFTIFVSAI LGGVGI+ M+ +I   EY
Sbjct  355  FAVATLAALVGQHVIRKLISILGRASLIIFTLAFTIFVSAILLGGVGIARMVRRIERKEY  414

Query  542  MGFENLC  562
            MGFEN+C
Sbjct  415  MGFENIC  421



>ref|XP_004956625.1| PREDICTED: uncharacterized protein LOC101768056 [Setaria italica]
Length=468

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST YWV+NLLQ+PVS+GV ++E  GL  G R +SSKG   S L+  Q+ +Y FFG+ AG+
Sbjct  278  STWYWVLNLLQVPVSVGVTMYEGLGLMSGKRVLSSKGSEQSTLKLYQIFIYGFFGIAAGL  337

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGF+MGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYA+F 
Sbjct  338  VGGLLGLGGGFVMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLNRFPVPYAVFF  397

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VA  AA IGQH+VR+L+  LGRASLIIFILAF IFVSA+SLGGVGISNM+ KI +HEY
Sbjct  398  VVVAFFAAIIGQHIVRKLVNWLGRASLIIFILAFMIFVSALSLGGVGISNMVNKIAHHEY  457

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  458  MGFENLCKY  466



>ref|XP_010048101.1| PREDICTED: uncharacterized protein LOC104436944 isoform X1 [Eucalyptus 
grandis]
 gb|KCW80235.1| hypothetical protein EUGRSUZ_C01582 [Eucalyptus grandis]
Length=474

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST YWV+N LQ+PVS+GV  +EA  LYKGWR I+SKG+ G   +  +L+ YC  G++AG+
Sbjct  284  STAYWVLNFLQVPVSIGVFAYEAISLYKGWRVIASKGEKGKKWQVRELLAYCGCGVLAGI  343

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            +GGLLG+GGGF+MGPLFLELG+PP+VSSATATF M +SSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  344  IGGLLGIGGGFVMGPLFLELGIPPEVSSATATFGMTYSSSMSVVEYYLLKRFPVPYALYF  403

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VATVAAF+GQH+VR+LI + GRAS+IIFIL+FTIFVSAI LGGVG+SNMI KI  HEY
Sbjct  404  ILVATVAAFVGQHIVRKLIIITGRASIIIFILSFTIFVSAILLGGVGLSNMIGKIERHEY  463

Query  542  MGFENLCKYG  571
            MGF+NLC +G
Sbjct  464  MGFDNLCNFG  473



>ref|XP_010048102.1| PREDICTED: uncharacterized protein LOC104436944 isoform X2 [Eucalyptus 
grandis]
Length=472

 Score =   185 bits (470),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST YWV+N LQ+PVS+GV  +EA  LYKGWR I+SKG+ G   +  +L+ YC  G++AG+
Sbjct  282  STAYWVLNFLQVPVSIGVFAYEAISLYKGWRVIASKGEKGKKWQVRELLAYCGCGVLAGI  341

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            +GGLLG+GGGF+MGPLFLELG+PP+VSSATATF M +SSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  342  IGGLLGIGGGFVMGPLFLELGIPPEVSSATATFGMTYSSSMSVVEYYLLKRFPVPYALYF  401

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VATVAAF+GQH+VR+LI + GRAS+IIFIL+FTIFVSAI LGGVG+SNMI KI  HEY
Sbjct  402  ILVATVAAFVGQHIVRKLIIITGRASIIIFILSFTIFVSAILLGGVGLSNMIGKIERHEY  461

Query  542  MGFENLCKYG  571
            MGF+NLC +G
Sbjct  462  MGFDNLCNFG  471



>gb|KDP37236.1| hypothetical protein JCGZ_06292 [Jatropha curcas]
Length=411

 Score =   183 bits (465),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW +N+LQIPV++G+  +EA GLYKG RKI+S G++ ++ R  QL++YC  GM+AGV
Sbjct  221  SVTYWALNILQIPVAVGLTAYEAVGLYKGQRKIASMGEAITHWRVHQLVLYCAVGMLAGV  280

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            +G +LGLGGGFI+GPLFL++G+PPQVSSAT TF M FS+SMSV+EYYLLKRFPVPYAL+ 
Sbjct  281  LGAMLGLGGGFILGPLFLQMGIPPQVSSATTTFVMTFSASMSVIEYYLLKRFPVPYALYF  340

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
               A  AAF+GQHVVR+LI++LGRASLIIFILAFTIFVSAI LGGVGI++MI++I   EY
Sbjct  341  FGAAIFAAFVGQHVVRKLISILGRASLIIFILAFTIFVSAILLGGVGIAHMIKRIERSEY  400

Query  542  MGFENLCKYG  571
            MGFEN+C YG
Sbjct  401  MGFENICSYG  410



>ref|XP_008380922.1| PREDICTED: uncharacterized protein LOC103443804 [Malus domestica]
Length=474

 Score =   184 bits (468),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NLLQIPV+LGV+ +EA  LYKG R I S  +SG++ +  QL +YC  G+ AG+
Sbjct  284  SAEYWVLNLLQIPVALGVSTYEAVNLYKGHRVIESMEESGTDWKVRQLFLYCGGGITAGI  343

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+ 
Sbjct  344  VGGLLGLGGGFILGPLFLELGLPPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYF  403

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VA+++A +GQHVVR++I+VLGRAS+I+FILA TIFVSAISLGGVGI++M+EKI N EY
Sbjct  404  ALVASLSALVGQHVVRKVISVLGRASIIVFILASTIFVSAISLGGVGIASMVEKIENKEY  463

Query  542  MGFENLCKYG  571
            MGFEN+C Y 
Sbjct  464  MGFENICTYD  473



>ref|XP_003574413.1| PREDICTED: uncharacterized protein LOC100846525 isoform X1 [Brachypodium 
distachyon]
Length=461

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST YWV+N+LQIPVS+GV +++A GL +G R ISSK ++ ++L+A QL VYC  G+ AG 
Sbjct  271  STWYWVLNILQIPVSVGVTMYQAVGLAQGKRVISSKANNQTSLKAYQLFVYCSLGLTAGS  330

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            +GGLLG+GGG IMGPLFLELGVPPQVSSAT+TFAMMFS+SMSVVEYYLLKRFPVPYA F 
Sbjct  331  MGGLLGVGGGIIMGPLFLELGVPPQVSSATSTFAMMFSASMSVVEYYLLKRFPVPYAAFF  390

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            T VA +AA +GQ VVR++I+ LGRASLIIF+L+F IF+SA+SLGGVG SNMI KI  HEY
Sbjct  391  TIVAFLAAIVGQGVVRKMISWLGRASLIIFVLSFMIFISALSLGGVGTSNMIHKITQHEY  450

Query  542  MGFENLCKY  568
            +GFEN+CKY
Sbjct  451  LGFENICKY  459



>ref|XP_011011435.1| PREDICTED: uncharacterized protein LOC105116005 isoform X2 [Populus 
euphratica]
Length=475

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 165/188 (88%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++N+LQIPV+ GV+ +EA  LYKG RKI+SKGD+ +N +  QL++YCF G++AG+
Sbjct  288  SVAYWLLNILQIPVAFGVSSYEAFNLYKGRRKIASKGDAVTNWKIRQLVLYCFIGLLAGI  347

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGG+LGLGGGFI+GPLFLE+G+PPQVSSATATF+MMFS+SMSVVEYYLLKRFPVPYAL+ 
Sbjct  348  VGGMLGLGGGFILGPLFLEMGIPPQVSSATATFSMMFSASMSVVEYYLLKRFPVPYALYF  407

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVAT+AA +GQHV+R+LI++LGRASLIIF LAFTIFVSAI LGGVGI+ M+ +I   EY
Sbjct  408  FAVATLAALVGQHVIRKLISILGRASLIIFTLAFTIFVSAILLGGVGIARMVRRIERKEY  467

Query  542  MGFENLCK  565
            MGFEN+C 
Sbjct  468  MGFENICS  475



>ref|XP_008466240.1| PREDICTED: uncharacterized protein LOC103503714 [Cucumis melo]
 ref|XP_008466242.1| PREDICTED: uncharacterized protein LOC103503714 [Cucumis melo]
Length=471

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  11   YWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvgg  190
            YW++N LQIP++ GV+ +EA  LYKG RKI+S G+  ++ R  QL++YCF G+IAGVVGG
Sbjct  284  YWLLNFLQIPIAFGVSGYEAVSLYKGKRKIASLGNQKTDFRIYQLVLYCFLGIIAGVVGG  343

Query  191  llglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltav  370
            LLGLGGGFIMGPLFLELG+PPQVSSA+ATF M FSSSMSV++YYLL RFPVPYAL+ T V
Sbjct  344  LLGLGGGFIMGPLFLELGIPPQVSSASATFGMTFSSSMSVIQYYLLNRFPVPYALYFTIV  403

Query  371  atvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGF  550
            A VAAF+GQHV+RRLI ++GRASLIIFIL+FTIFVSA+SLGGVGIS MI +I  HEYMGF
Sbjct  404  AAVAAFVGQHVIRRLINLIGRASLIIFILSFTIFVSALSLGGVGISKMIRQIQRHEYMGF  463

Query  551  ENLCKY  568
            ENLCKY
Sbjct  464  ENLCKY  469



>ref|XP_002284423.1| PREDICTED: uncharacterized protein LOC100266912 [Vitis vinifera]
 emb|CBI36119.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW +NLLQ+PV++GV+ +EA  LYKG R I+SKG+ G+N +   LI YC  G++AG+
Sbjct  291  SAGYWTLNLLQVPVAVGVSGYEAVCLYKGRRVIASKGEEGTNWKVHNLIFYCGVGVLAGI  350

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+ 
Sbjct  351  VGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYF  410

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVATVAAF+GQHVVR+LI +LGRASLIIFIL+FTIFVSAISLGGVGI +MIEKI   +Y
Sbjct  411  VAVATVAAFLGQHVVRKLINILGRASLIIFILSFTIFVSAISLGGVGIKDMIEKIEQKDY  470

Query  542  MGFENLCKY  568
            MGFENLC Y
Sbjct  471  MGFENLCTY  479



>gb|KDO79523.1| hypothetical protein CISIN_1g011797mg [Citrus sinensis]
 gb|KDO79524.1| hypothetical protein CISIN_1g011797mg [Citrus sinensis]
Length=347

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 160/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++N LQ+P+++ VALFEA  LYKG R I+SKG   +N +  Q++ YCF G++AG+
Sbjct  158  SITYWILNALQVPIAVSVALFEAICLYKGTRVIASKGKEITNWKIHQIVFYCFCGIVAGM  217

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM FSSSMSVV+YYLL RFPVPYA F 
Sbjct  218  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMTFSSSMSVVQYYLLDRFPVPYAAFF  277

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            T VAT AAF GQHVVR++IAVLGRAS+I+FILA TIFVSAISLGG GI NM++K+ N EY
Sbjct  278  TLVATFAAFAGQHVVRKIIAVLGRASIIVFILALTIFVSAISLGGFGIENMVKKLKNQEY  337

Query  542  MGFENLCK  565
            MGFENLC+
Sbjct  338  MGFENLCQ  345



>ref|XP_011011433.1| PREDICTED: uncharacterized protein LOC105116005 isoform X1 [Populus 
euphratica]
Length=497

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++N+LQIPV+ GV+ +EA  LYKG RKI+SKGD+ +N +  QL++YCF G++AG+
Sbjct  310  SVAYWLLNILQIPVAFGVSSYEAFNLYKGRRKIASKGDAVTNWKIRQLVLYCFIGLLAGI  369

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGG+LGLGGGFI+GPLFLE+G+PPQVSSATATF+MMFS+SMSVVEYYLLKRFPVPYAL+ 
Sbjct  370  VGGMLGLGGGFILGPLFLEMGIPPQVSSATATFSMMFSASMSVVEYYLLKRFPVPYALYF  429

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVAT+AA +GQHV+R+LI++LGRASLIIF LAFTIFVSAI LGGVGI+ M+ +I   EY
Sbjct  430  FAVATLAALVGQHVIRKLISILGRASLIIFTLAFTIFVSAILLGGVGIARMVRRIERKEY  489

Query  542  MGFENLC  562
            MGFEN+C
Sbjct  490  MGFENIC  496



>gb|KHN41986.1| hypothetical protein glysoja_003726 [Glycine soja]
Length=198

 Score =   176 bits (447),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = +2

Query  11   YWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvgg  190
            +W++N LQ+P+++ V LFEA GLYKG R I+SKG   +N +  Q+ +YC  G++AG+VGG
Sbjct  12   FWLLNFLQVPIAVSVTLFEAIGLYKGTRVIASKGKEVTNWKIHQICLYCSTGIMAGMVGG  71

Query  191  llglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltav  370
            LLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA +   V
Sbjct  72   LLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSVVQYYLLDRFPVPYASYFALV  131

Query  371  atvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGF  550
            AT+AAF GQHVVR++I VLGRAS+IIFILA TIF+SAISLGGVGI N+IEKI +HEYMGF
Sbjct  132  ATIAAFTGQHVVRKVIVVLGRASIIIFILALTIFISAISLGGVGIENIIEKIESHEYMGF  191

Query  551  ENLC  562
            E+LC
Sbjct  192  EDLC  195



>tpg|DAA61110.1| TPA: hypothetical protein ZEAMMB73_890925 [Zea mays]
Length=404

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NLLQ+PVS+GV L+E  GL  G R +SSKG   + ++  Q++VY  FG+ AG+
Sbjct  214  SPWYWVLNLLQVPVSVGVTLYEGFGLMSGKRVLSSKGSGQTTMKFHQVVVYGLFGIAAGL  273

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYA++ 
Sbjct  274  VGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLNRFPVPYAVYF  333

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VA VAA IGQHVVR+LI  LGRASLIIFILAF IFVSAISLGGVG+SNM+ KI  HEY
Sbjct  334  IVVAFVAAIIGQHVVRKLINWLGRASLIIFILAFMIFVSAISLGGVGVSNMVHKIERHEY  393

Query  542  MGFENLCKY  568
            MGFE+LCKY
Sbjct  394  MGFEDLCKY  402



>ref|XP_003537580.2| PREDICTED: uncharacterized protein LOC100817312 [Glycine max]
Length=204

 Score =   176 bits (446),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = +2

Query  11   YWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvgg  190
            +W++N LQ+P+++ V LFEA GLYKG R I+SKG   +N +  Q+ +YC  G++AG+VGG
Sbjct  18   FWLLNFLQVPIAVSVTLFEAIGLYKGTRVIASKGKEVTNWKIHQICLYCSTGIMAGMVGG  77

Query  191  llglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltav  370
            LLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA +   V
Sbjct  78   LLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSVVQYYLLDRFPVPYASYFALV  137

Query  371  atvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGF  550
            AT+AAF GQHVVR++I VLGRAS+IIFILA TIF+SAISLGGVGI N+IEKI +HEYMGF
Sbjct  138  ATIAAFTGQHVVRKVIVVLGRASIIIFILALTIFISAISLGGVGIENIIEKIESHEYMGF  197

Query  551  ENLC  562
            E+LC
Sbjct  198  EDLC  201



>ref|XP_004136295.1| PREDICTED: uncharacterized protein LOC101214783 [Cucumis sativus]
 gb|KGN60205.1| hypothetical protein Csa_3G889130 [Cucumis sativus]
Length=471

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  11   YWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvgg  190
            YW++N LQ+P++ GV+ +EA GLYKG RKI+S G+  ++ R  QL++YCF G+IAGVVGG
Sbjct  284  YWLLNFLQVPIAFGVSGYEAVGLYKGKRKIASLGNQKTDFRIYQLVLYCFMGIIAGVVGG  343

Query  191  llglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltav  370
            LLGLGGGFIMGPLFLELG+PPQVSSA+ATF M FSSSMSV++YYLL RFPVPYAL+ T V
Sbjct  344  LLGLGGGFIMGPLFLELGIPPQVSSASATFGMTFSSSMSVIQYYLLNRFPVPYALYFTIV  403

Query  371  atvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGF  550
            A VAAF+GQHV+R+LI ++GRASLIIFIL+FTIFVSA+SLGGVGIS MI +I  HEYMGF
Sbjct  404  AAVAAFVGQHVIRKLILLIGRASLIIFILSFTIFVSALSLGGVGISKMIGQIQRHEYMGF  463

Query  551  ENLCKY  568
            ENLCKY
Sbjct  464  ENLCKY  469



>ref|XP_004168635.1| PREDICTED: uncharacterized LOC101214783 [Cucumis sativus]
Length=471

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  11   YWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvgg  190
            YW++N LQ+P++ GV+ +EA GLYKG RKI+S G+  ++ R  QL++YCF G+IAGVVGG
Sbjct  284  YWLLNFLQVPIAFGVSGYEAVGLYKGKRKIASLGNQKTDFRIYQLVLYCFMGIIAGVVGG  343

Query  191  llglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltav  370
            LLGLGGGFIMGPLFLELG+PPQVSSA+ATF M FSSSMSV++YYLL RFPVPYAL+ T V
Sbjct  344  LLGLGGGFIMGPLFLELGIPPQVSSASATFGMTFSSSMSVIQYYLLNRFPVPYALYFTIV  403

Query  371  atvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGF  550
            A VAAF+GQHV+R+LI ++GRASLIIFIL+FTIFVSA+SLGGVGIS MI +I  HEYMGF
Sbjct  404  AAVAAFVGQHVIRKLILLIGRASLIIFILSFTIFVSALSLGGVGISKMIGQIQRHEYMGF  463

Query  551  ENLCKY  568
            ENLCKY
Sbjct  464  ENLCKY  469



>ref|XP_006426963.1| hypothetical protein CICLE_v10025503mg [Citrus clementina]
 gb|ESR40203.1| hypothetical protein CICLE_v10025503mg [Citrus clementina]
Length=479

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S LYWV+NLLQIPV+ GV+ +EA  LYKG RKI+SKGD G+  RA QL+ YC  G+ AG+
Sbjct  291  SVLYWVLNLLQIPVAGGVSAYEAVALYKGRRKIASKGDEGTKWRASQLVFYCACGITAGM  350

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATA FA+ FSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  351  VGGLLGLGGGFILGPLFLELGIPPQVSSATALFAITFSSSMSVVEYYLLKRFPVPYALYF  410

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             A++ +AAF+GQHVV++LI +LGRAS+IIF L+F IFVSA+SLGGVG++ MI++I + EY
Sbjct  411  FALSIIAAFVGQHVVKKLIKILGRASIIIFTLSFIIFVSALSLGGVGLAKMIKRIEHKEY  470

Query  542  MGFENLC  562
            MGF+N+C
Sbjct  471  MGFDNIC  477



>ref|XP_006465615.1| PREDICTED: uncharacterized protein LOC102614288 isoform X2 [Citrus 
sinensis]
Length=477

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S LYWV+NLLQIPV+ GV+ +EA  LYKG RKI+SKGD G+  RA QL+ YC  G+ AG+
Sbjct  289  SVLYWVLNLLQIPVAGGVSAYEAVALYKGRRKIASKGDEGTKWRASQLVFYCACGITAGM  348

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATA FA+ FSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  349  VGGLLGLGGGFILGPLFLELGIPPQVSSATALFAITFSSSMSVVEYYLLKRFPVPYALYF  408

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             A++ +AAF+GQHV+++LI +LGRAS+IIF L+F IFVSA+SLGGVG++ MI++I + EY
Sbjct  409  FALSIIAAFVGQHVLKKLIKILGRASIIIFTLSFIIFVSAVSLGGVGLAKMIKRIEHKEY  468

Query  542  MGFENLC  562
            MGF+N+C
Sbjct  469  MGFDNIC  475



>ref|XP_006465614.1| PREDICTED: uncharacterized protein LOC102614288 isoform X1 [Citrus 
sinensis]
Length=479

 Score =   183 bits (464),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S LYWV+NLLQIPV+ GV+ +EA  LYKG RKI+SKGD G+  RA QL+ YC  G+ AG+
Sbjct  291  SVLYWVLNLLQIPVAGGVSAYEAVALYKGRRKIASKGDEGTKWRASQLVFYCACGITAGM  350

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATA FA+ FSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  351  VGGLLGLGGGFILGPLFLELGIPPQVSSATALFAITFSSSMSVVEYYLLKRFPVPYALYF  410

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             A++ +AAF+GQHV+++LI +LGRAS+IIF L+F IFVSA+SLGGVG++ MI++I + EY
Sbjct  411  FALSIIAAFVGQHVLKKLIKILGRASIIIFTLSFIIFVSAVSLGGVGLAKMIKRIEHKEY  470

Query  542  MGFENLC  562
            MGF+N+C
Sbjct  471  MGFDNIC  477



>ref|XP_008792340.1| PREDICTED: uncharacterized protein LOC103708984 [Phoenix dactylifera]
Length=478

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  +WV+NLLQIPVS+ V L+EA  LY G R I+S G  G+N +  QL +YC  G++AG+
Sbjct  288  SIWFWVLNLLQIPVSMAVTLYEAISLYNGKRVIASNGHEGTNWKVHQLFIYCSLGVLAGI  347

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLL RFPVPYAL+ 
Sbjct  348  VGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLNRFPVPYALYF  407

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VA VAA++GQ+VVRRLI ++GRASLIIFILAFTIF+SAISLGGVGISN+I KI +HEY
Sbjct  408  VTVAAVAAYVGQNVVRRLIILMGRASLIIFILAFTIFISAISLGGVGISNIIRKIKHHEY  467

Query  542  MGFENLCKY  568
            MGFENLC+Y
Sbjct  468  MGFENLCRY  476



>ref|XP_002299704.2| hypothetical protein POPTR_0001s18300g [Populus trichocarpa]
 gb|EEE84509.2| hypothetical protein POPTR_0001s18300g [Populus trichocarpa]
Length=475

 Score =   182 bits (462),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++N+LQIPV+ GV+ +EA  LYKG RKI+SKGD+ +N +  QL++YC  G++AGV
Sbjct  288  SMAYWLLNILQIPVAFGVSSYEAFNLYKGRRKIASKGDAVTNWKIRQLVLYCIIGLLAGV  347

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGG+LGLGGGFI+GPLFLE+G+PPQVSSATATFAMMFS+SMSVVEYYLLKRFPVPYAL+ 
Sbjct  348  VGGMLGLGGGFILGPLFLEMGIPPQVSSATATFAMMFSASMSVVEYYLLKRFPVPYALYF  407

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVATVAA +GQHV+R+LI++LGRASLIIF LAFTIFVSAI LGGVGI+ M+++I   EY
Sbjct  408  FAVATVAALVGQHVIRKLISILGRASLIIFTLAFTIFVSAILLGGVGIARMVKRIERKEY  467

Query  542  MGFENLC  562
            MGFEN+C
Sbjct  468  MGFENIC  474



>ref|XP_007216108.1| hypothetical protein PRUPE_ppa018715mg [Prunus persica]
 gb|EMJ17307.1| hypothetical protein PRUPE_ppa018715mg [Prunus persica]
Length=439

 Score =   181 bits (460),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 164/188 (87%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NLLQIPV+ GV+ +EA  LYKG R I+SK +SG++ +  QL++YC  G++AG+
Sbjct  252  SAEYWVLNLLQIPVAFGVSTYEAVNLYKGRRVIASKEESGTDWKVHQLVLYCACGILAGI  311

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA++ 
Sbjct  312  VGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAVYF  371

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              +++++A +GQHVVR++I+VLGRAS+IIFILA TIFVSAISLGGVGI++MI KI + EY
Sbjct  372  AVMSSLSALVGQHVVRKVISVLGRASIIIFILASTIFVSAISLGGVGIADMIGKIEHKEY  431

Query  542  MGFENLCK  565
            MGFEN+C 
Sbjct  432  MGFENICN  439



>ref|XP_003546436.1| PREDICTED: uncharacterized protein LOC100816528 [Glycine max]
Length=476

 Score =   182 bits (462),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NLLQ+PV+LG   ++A  LY G R I+SKGD  +  RA QLI+YC  G+ AG+
Sbjct  286  SVEYWVLNLLQVPVALGATSYQAVLLYTGKRVIASKGDQRTQWRAHQLIMYCSCGICAGI  345

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATATFAM FS+SMSVVEYYLLKRFP+PY L+ 
Sbjct  346  VGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYYLLKRFPIPYTLYF  405

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AV+T AAF+GQ +VR+L+A+LGRASLIIFIL+ TIFVSAISLGGVGISNMI++I N EY
Sbjct  406  VAVSTFAAFVGQVLVRKLVAILGRASLIIFILSSTIFVSAISLGGVGISNMIQRIANKEY  465

Query  542  MGFENLCKYG  571
            MGFENLC Y 
Sbjct  466  MGFENLCTYS  475



>ref|XP_008651296.1| PREDICTED: uncharacterized protein LOC100279247 isoform X1 [Zea 
mays]
 tpg|DAA61108.1| TPA: hypothetical protein ZEAMMB73_890925 [Zea mays]
Length=470

 Score =   182 bits (461),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NLLQ+PVS+GV L+E  GL  G R +SSKG   + ++  Q++VY  FG+ AG+
Sbjct  280  SPWYWVLNLLQVPVSVGVTLYEGFGLMSGKRVLSSKGSGQTTMKFHQVVVYGLFGIAAGL  339

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYA++ 
Sbjct  340  VGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLNRFPVPYAVYF  399

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VA VAA IGQHVVR+LI  LGRASLIIFILAF IFVSAISLGGVG+SNM+ KI  HEY
Sbjct  400  IVVAFVAAIIGQHVVRKLINWLGRASLIIFILAFMIFVSAISLGGVGVSNMVHKIERHEY  459

Query  542  MGFENLCKY  568
            MGFE+LCKY
Sbjct  460  MGFEDLCKY  468



>ref|XP_002460084.1| hypothetical protein SORBIDRAFT_02g022510 [Sorghum bicolor]
 gb|EER96605.1| hypothetical protein SORBIDRAFT_02g022510 [Sorghum bicolor]
Length=470

 Score =   182 bits (461),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NLLQ+PVS+GV L+E  GL  G R +SSKG   + ++  Q++VY  FG+ AG+
Sbjct  280  SPWYWVLNLLQVPVSVGVTLYEGFGLMSGKRVLSSKGSEQTTMKFHQVVVYGLFGIAAGL  339

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYA++ 
Sbjct  340  VGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLNRFPVPYAVYF  399

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            T VA  AA IGQH VR+LI  LGRASLIIFILAF IFVSA+SLGGVGISNM+ KI  HEY
Sbjct  400  TIVAFAAALIGQHAVRKLINWLGRASLIIFILAFMIFVSALSLGGVGISNMVHKIARHEY  459

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  460  MGFENLCKY  468



>ref|XP_007046968.1| DNA-directed RNA polymerase isoform 2 [Theobroma cacao]
 gb|EOX91125.1| DNA-directed RNA polymerase isoform 2 [Theobroma cacao]
Length=443

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 162/188 (86%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S +YW+VN LQIP++  V LFEA  LYKG R I+SKG   +N +  Q+++YC  G+IAG+
Sbjct  254  SVVYWIVNSLQIPIAASVTLFEAICLYKGTRVIASKGKEVTNWKIYQILLYCSCGIIAGM  313

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA + 
Sbjct  314  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSVVQYYLLNRFPVPYAAYF  373

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF GQHVVR++IAVLGRAS+IIFILA TIF+SAISLGGVGI++M+EK+ N EY
Sbjct  374  VLVATIAAFTGQHVVRKIIAVLGRASIIIFILALTIFISAISLGGVGIADMVEKLENEEY  433

Query  542  MGFENLCK  565
            MGFENLCK
Sbjct  434  MGFENLCK  441



>ref|XP_006595132.1| PREDICTED: uncharacterized protein LOC100789733 isoform X2 [Glycine 
max]
Length=480

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++NLLQ+PV+LG   ++A  LY G R I+SKGD  +  RA QL++YC  G+ AG+
Sbjct  290  SVEYWILNLLQVPVALGATSYQAVLLYTGKRVIASKGDQRTQWRAHQLVLYCSCGICAGI  349

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATATFAM FS+SMSVVEYYLLKRFP+PY L+ 
Sbjct  350  VGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYYLLKRFPIPYTLYF  409

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AV+T AAF+GQ +VR+L+A+LGRASLIIFIL+ TIFVSAISLGGVGISNMI+KI N EY
Sbjct  410  VAVSTFAAFVGQVLVRKLVAILGRASLIIFILSGTIFVSAISLGGVGISNMIQKIANKEY  469

Query  542  MGFENLCKY  568
            MGFENLC Y
Sbjct  470  MGFENLCTY  478



>ref|XP_009353619.1| PREDICTED: uncharacterized protein LOC103944866 [Pyrus x bretschneideri]
Length=474

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NLLQIPV+LGV+ +EA  LYKG R I+S  + G++ +  +L +YC  G+ AG+
Sbjct  284  SAEYWVLNLLQIPVALGVSTYEAVNLYKGHRVIASMEELGTDWKVHRLFLYCGGGITAGI  343

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+ 
Sbjct  344  VGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYF  403

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VA+++A +GQHVVR++I+VLGRAS+I+FILA TIFVSAISLGGVGI++M+EKI N EY
Sbjct  404  ALVASLSALVGQHVVRKVISVLGRASIIVFILASTIFVSAISLGGVGIASMVEKIENKEY  463

Query  542  MGFENLCKY  568
            MGFEN+C Y
Sbjct  464  MGFENICTY  472



>ref|XP_002516570.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45911.1| conserved hypothetical protein [Ricinus communis]
Length=465

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST YWV+NLLQ+PVS+GV L+ A GLY+G R+I+SKGD G NL+A QL+ +C +G++AG+
Sbjct  275  STAYWVLNLLQVPVSVGVFLYAAVGLYRGRRRIASKGDEGMNLKAYQLLAFCAYGVMAGI  334

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELG+PPQV+SATATF M FSSSMSV EYYLL RFPVPYAL+ 
Sbjct  335  VGGLLGLGGGFIMGPLFLELGIPPQVTSATATFGMAFSSSMSVAEYYLLSRFPVPYALYF  394

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVAT+AAF GQH++ +LIA+ GRASLIIF+LAFTIFVSA++LGGVGISN+I KI   E 
Sbjct  395  IAVATIAAFAGQHIITKLIAITGRASLIIFVLAFTIFVSALTLGGVGISNIIGKIEKGES  454

Query  542  MGFENLCKY  568
            M F+NLC Y
Sbjct  455  MEFQNLCNY  463



>ref|XP_003542098.1| PREDICTED: uncharacterized protein LOC100789733 isoform X1 [Glycine 
max]
Length=487

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++NLLQ+PV+LG   ++A  LY G R I+SKGD  +  RA QL++YC  G+ AG+
Sbjct  297  SVEYWILNLLQVPVALGATSYQAVLLYTGKRVIASKGDQRTQWRAHQLVLYCSCGICAGI  356

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATATFAM FS+SMSVVEYYLLKRFP+PY L+ 
Sbjct  357  VGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYYLLKRFPIPYTLYF  416

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AV+T AAF+GQ +VR+L+A+LGRASLIIFIL+ TIFVSAISLGGVGISNMI+KI N EY
Sbjct  417  VAVSTFAAFVGQVLVRKLVAILGRASLIIFILSGTIFVSAISLGGVGISNMIQKIANKEY  476

Query  542  MGFENLCKY  568
            MGFENLC Y
Sbjct  477  MGFENLCTY  485



>ref|XP_007046967.1| Sulfite exporter TauE/SafE family protein, putative isoform 1 
[Theobroma cacao]
 gb|EOX91124.1| Sulfite exporter TauE/SafE family protein, putative isoform 1 
[Theobroma cacao]
Length=476

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 162/188 (86%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S +YW+VN LQIP++  V LFEA  LYKG R I+SKG   +N +  Q+++YC  G+IAG+
Sbjct  287  SVVYWIVNSLQIPIAASVTLFEAICLYKGTRVIASKGKEVTNWKIYQILLYCSCGIIAGM  346

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA + 
Sbjct  347  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSVVQYYLLNRFPVPYAAYF  406

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF GQHVVR++IAVLGRAS+IIFILA TIF+SAISLGGVGI++M+EK+ N EY
Sbjct  407  VLVATIAAFTGQHVVRKIIAVLGRASIIIFILALTIFISAISLGGVGIADMVEKLENEEY  466

Query  542  MGFENLCK  565
            MGFENLCK
Sbjct  467  MGFENLCK  474



>gb|KDO79522.1| hypothetical protein CISIN_1g011797mg [Citrus sinensis]
Length=474

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 160/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++N LQ+P+++ VALFEA  LYKG R I+SKG   +N +  Q++ YCF G++AG+
Sbjct  285  SITYWILNALQVPIAVSVALFEAICLYKGTRVIASKGKEITNWKIHQIVFYCFCGIVAGM  344

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM FSSSMSVV+YYLL RFPVPYA F 
Sbjct  345  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMTFSSSMSVVQYYLLDRFPVPYAAFF  404

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            T VAT AAF GQHVVR++IAVLGRAS+I+FILA TIFVSAISLGG GI NM++K+ N EY
Sbjct  405  TLVATFAAFAGQHVVRKIIAVLGRASIIVFILALTIFVSAISLGGFGIENMVKKLKNQEY  464

Query  542  MGFENLCK  565
            MGFENLC+
Sbjct  465  MGFENLCQ  472



>ref|XP_006425693.1| hypothetical protein CICLE_v10025446mg [Citrus clementina]
 ref|XP_006466780.1| PREDICTED: uncharacterized protein LOC102622706 [Citrus sinensis]
 gb|ESR38933.1| hypothetical protein CICLE_v10025446mg [Citrus clementina]
Length=477

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 160/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++N LQ+P+++ VALFEA  LYKG R I+SKG   +N +  Q++ YCF G++AG+
Sbjct  288  SITYWILNALQVPIAVSVALFEAICLYKGTRVIASKGKEITNWKIHQIVFYCFCGIVAGM  347

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM FSSSMSVV+YYLL RFPVPYA F 
Sbjct  348  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMTFSSSMSVVQYYLLDRFPVPYAAFF  407

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            T VAT AAF GQHVVR++IAVLGRAS+I+FILA TIFVSAISLGG GI NM++K+ N EY
Sbjct  408  TLVATFAAFAGQHVVRKIIAVLGRASIIVFILALTIFVSAISLGGFGIENMVKKLKNQEY  467

Query  542  MGFENLCK  565
            MGFENLC+
Sbjct  468  MGFENLCQ  475



>gb|KDO79521.1| hypothetical protein CISIN_1g011797mg [Citrus sinensis]
Length=477

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 160/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++N LQ+P+++ VALFEA  LYKG R I+SKG   +N +  Q++ YCF G++AG+
Sbjct  288  SITYWILNALQVPIAVSVALFEAICLYKGTRVIASKGKEITNWKIHQIVFYCFCGIVAGM  347

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM FSSSMSVV+YYLL RFPVPYA F 
Sbjct  348  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMTFSSSMSVVQYYLLDRFPVPYAAFF  407

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            T VAT AAF GQHVVR++IAVLGRAS+I+FILA TIFVSAISLGG GI NM++K+ N EY
Sbjct  408  TLVATFAAFAGQHVVRKIIAVLGRASIIVFILALTIFVSAISLGGFGIENMVKKLKNQEY  467

Query  542  MGFENLCK  565
            MGFENLC+
Sbjct  468  MGFENLCQ  475



>gb|AEI72271.1| hypothetical protein [Citrus trifoliata]
Length=353

 Score =   177 bits (449),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S LYWV+N LQIPV+ GV+ +EA  LYKG R I+SKGD G+N R  QL+ YC  G+ AGV
Sbjct  164  SVLYWVLNFLQIPVAGGVSAYEAVALYKGRRTIASKGDVGTNWRPHQLVFYCACGITAGV  223

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+ 
Sbjct  224  VGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYF  283

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AV+T+AAF+GQHVVR+LI +LGRAS+IIF L+ TIFVSA+SL G+G++ M+ +I   EY
Sbjct  284  FAVSTIAAFVGQHVVRKLINILGRASIIIFTLSLTIFVSALSLSGIGLAKMVPRIDRKEY  343

Query  542  MGFENLCKY  568
            MGF+++C Y
Sbjct  344  MGFDSICSY  352



>ref|XP_007216479.1| hypothetical protein PRUPE_ppa024737mg [Prunus persica]
 gb|EMJ17678.1| hypothetical protein PRUPE_ppa024737mg [Prunus persica]
Length=489

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW +NLLQ+PV+ GV ++EA  LY G R I+SKG+S ++ +  QL++Y   G+IAG+
Sbjct  299  SATYWALNLLQLPVAFGVTIYEAVNLYTGRRVIASKGESNTDWKVHQLVLYSACGIIAGI  358

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GP+FLELG+PPQVSSATATFAM FS+SMSV+EYYLL+RFPVPYAL+L
Sbjct  359  VGGLLGLGGGFILGPVFLELGIPPQVSSATATFAMTFSASMSVIEYYLLRRFPVPYALYL  418

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVAT++A +GQHVVR+++ +LGRAS+IIFILAFTIFVSAISLGGVGI++M+EKI + EY
Sbjct  419  AAVATLSAIVGQHVVRKVVMILGRASIIIFILAFTIFVSAISLGGVGIADMVEKIEHKEY  478

Query  542  MGFENLCKY  568
            MGFEN+C Y
Sbjct  479  MGFENICTY  487



>gb|KHN36120.1| hypothetical protein glysoja_003243 [Glycine soja]
Length=441

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  +W++N LQ+PV++ V LFEA GLYKG R I+SKG   +N +  Q+ +YC  G++AG+
Sbjct  252  SIQFWLLNFLQVPVAVSVTLFEAIGLYKGTRVIASKGKEVTNWKIHQICLYCSTGIMAGM  311

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA + 
Sbjct  312  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSVVQYYLLDRFPVPYASYF  371

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF GQHVVR++I VLGRAS+IIFILA TIF+SAISLGGVGI N+IEKI NHEY
Sbjct  372  ALVATIAAFTGQHVVRKVIVVLGRASIIIFILALTIFISAISLGGVGIENIIEKIENHEY  431

Query  542  MGFENLC  562
            MGFE+LC
Sbjct  432  MGFEDLC  438



>gb|EPS70855.1| hypothetical protein M569_03905 [Genlisea aurea]
Length=444

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 164/190 (86%), Gaps = 1/190 (1%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSK-GDSGSNLRAGQLIVYCFFgmiag  178
            S ++W VNLLQIPVS+GV+ +EA  LY GW++I SK  D  +  +  QL++YC FG++AG
Sbjct  255  SAIFWFVNLLQIPVSVGVSGYEAVRLYLGWKRIGSKVDDETTTFKPRQLVIYCSFGIVAG  314

Query  179  vvggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalf  358
            VVGGLLG+GGGFIMGPLFLELGVPPQVSSATATF MMFS+SMSVVEY+LL RFPVPYAL+
Sbjct  315  VVGGLLGIGGGFIMGPLFLELGVPPQVSSATATFIMMFSASMSVVEYHLLNRFPVPYALY  374

Query  359  ltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHE  538
            L  VAT+AA++GQHVVRR+IAV+GRAS+IIF+L+FTIFVSA+SLGG GIS ++ KI  HE
Sbjct  375  LFVVATIAAYVGQHVVRRIIAVMGRASIIIFVLSFTIFVSAVSLGGFGISKIVAKIRWHE  434

Query  539  YMGFENLCKY  568
            YMGF NLCKY
Sbjct  435  YMGFGNLCKY  444



>gb|ABR16333.1| unknown [Picea sitchensis]
Length=505

 Score =   180 bits (456),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 159/190 (84%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NLLQIPV++ V+L+EA GLYKG + ++SKG++G N +  QL++Y F G++AGV
Sbjct  315  SVEYWVLNLLQIPVAMSVSLYEAIGLYKGTKAVASKGEAGINWKISQLVLYFFCGILAGV  374

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPL LELGVPPQVSSATATF M FSSSMSVVEYY LKRFPVPYA +L
Sbjct  375  VGGLLGLGGGFILGPLLLELGVPPQVSSATATFVMTFSSSMSVVEYYFLKRFPVPYAAYL  434

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              V  +AAF+GQHV+RRL+ +LGRASLIIFILAF IF+SAI+LGGVGI  MI K  N +Y
Sbjct  435  FGVCVIAAFMGQHVIRRLVILLGRASLIIFILAFVIFLSAITLGGVGIVKMIHKFENGDY  494

Query  542  MGFENLCKYG  571
            MGFENLC Y 
Sbjct  495  MGFENLCSYS  504



>ref|XP_006426964.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
 ref|XP_006426965.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
 ref|XP_006426966.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
 gb|ESR40204.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
 gb|ESR40205.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
 gb|ESR40206.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
Length=477

 Score =   179 bits (455),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S LYWV+N LQIPV+ GV+ +EA  LYKG R I+SKGD G+N R  QL+ YC  G+ AGV
Sbjct  288  SVLYWVLNFLQIPVAGGVSAYEAVALYKGRRTIASKGDVGTNWRPHQLVFYCACGITAGV  347

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+ 
Sbjct  348  VGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYF  407

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              V+TVAAF+GQHVVR+LI +LGRAS+IIF L+ TIFVSA+SLGG+G++ M+++I   EY
Sbjct  408  FGVSTVAAFVGQHVVRKLINILGRASIIIFTLSLTIFVSALSLGGIGLAKMVQRIDRKEY  467

Query  542  MGFENLCKY  568
            MGF+++C Y
Sbjct  468  MGFDSICSY  476



>emb|CDP02034.1| unnamed protein product [Coffea canephora]
Length=479

 Score =   179 bits (455),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW +N LQ+P++  V+L+EAT LYKG R I+SKG   +  +   + +YC  G++AGV
Sbjct  290  SAKYWTLNFLQVPIAASVSLYEATCLYKGTRTIASKGKEITVWKPNLIFLYCCLGIVAGV  349

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGF++GPLFLELGVPPQV+SAT+TFAM FSSSMSVV+YYLL RFPVPYA + 
Sbjct  350  VGGLLGLGGGFVLGPLFLELGVPPQVASATSTFAMTFSSSMSVVQYYLLNRFPVPYATYF  409

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VATVAA +GQHVVRR+IA+LGRASLIIFILA TIFVSAISLGGVGI++MIEK+ NHEY
Sbjct  410  VLVATVAALVGQHVVRRIIAILGRASLIIFILALTIFVSAISLGGVGIASMIEKLQNHEY  469

Query  542  MGFENLCK  565
            MGF+NLC+
Sbjct  470  MGFDNLCR  477



>ref|XP_003517231.1| PREDICTED: uncharacterized protein LOC100801441 [Glycine max]
Length=470

 Score =   179 bits (454),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  +W++N LQ+PV++ V LFEA GLYKG R I+SKG   +N +  Q+ +YC  G++AG+
Sbjct  281  SIQFWLLNFLQVPVAVSVTLFEAIGLYKGTRVIASKGKEVTNWKIHQICLYCSTGIMAGM  340

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA + 
Sbjct  341  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSVVQYYLLDRFPVPYASYF  400

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF GQHVVR++I VLGRAS+IIFILA TIF+SAISLGGVGI N+IEKI NHEY
Sbjct  401  ALVATIAAFTGQHVVRKVIVVLGRASIIIFILALTIFISAISLGGVGIENIIEKIENHEY  460

Query  542  MGFENLC  562
            MGFE+LC
Sbjct  461  MGFEDLC  467



>ref|XP_006465610.1| PREDICTED: uncharacterized protein LOC102613305 isoform X1 [Citrus 
sinensis]
 ref|XP_006465611.1| PREDICTED: uncharacterized protein LOC102613305 isoform X2 [Citrus 
sinensis]
 ref|XP_006465612.1| PREDICTED: uncharacterized protein LOC102613305 isoform X3 [Citrus 
sinensis]
Length=477

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S LYW +N LQIPV+ GV+ +EA  LYKG R I+SKGD G+N R  QL+ YC  G+ AGV
Sbjct  288  SVLYWALNFLQIPVAGGVSAYEAVALYKGRRTIASKGDVGTNWRPHQLVFYCACGITAGV  347

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+ 
Sbjct  348  VGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYF  407

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AV+T+AAF+GQHVVR+LI +LGRAS+IIF L+ TIFVSA+SLGG+G++ M+++I   EY
Sbjct  408  FAVSTIAAFVGQHVVRKLINILGRASIIIFTLSLTIFVSALSLGGIGLAKMVQRIDRKEY  467

Query  542  MGFENLCKY  568
            MGF+++C Y
Sbjct  468  MGFDSICSY  476



>ref|XP_008228542.1| PREDICTED: uncharacterized protein LOC103327945 [Prunus mume]
 ref|XP_008228543.1| PREDICTED: uncharacterized protein LOC103327945 [Prunus mume]
Length=479

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NLLQIPV+ GV+ +EA  LYKG R I+SK +S ++ +  QL++YC  G+IAG+
Sbjct  292  SAEYWVLNLLQIPVAFGVSTYEAVNLYKGRRVIASKEESVTDWKVHQLVLYCACGIIAGI  351

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYA++ 
Sbjct  352  VGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYAVYF  411

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              +++++A +GQHVVRR+I+VLGRAS+IIFILA TIFVSAISLGGVGI+ MI KI   EY
Sbjct  412  AVMSSLSALVGQHVVRRVISVLGRASIIIFILASTIFVSAISLGGVGIAAMIGKIERKEY  471

Query  542  MGFENLC  562
            MGFEN+C
Sbjct  472  MGFENIC  478



>ref|XP_010691331.1| PREDICTED: uncharacterized protein LOC104904681 [Beta vulgaris 
subsp. vulgaris]
Length=463

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            + L+WV NL QIP++LG + +EA  LY G R I+S+GD+  N +  QL++  F GM AG+
Sbjct  273  TVLFWVTNLAQIPIALGASGYEAYMLYTGKRVIASRGDAAGNWKVYQLVLCLFTGMSAGM  332

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYA + 
Sbjct  333  VGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAAYF  392

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVAT AA +GQ +VRRLIA++GRASLIIFILAFTIFVSAISLGGVGISNM+ KI  HEY
Sbjct  393  VAVATFAALVGQILVRRLIAIIGRASLIIFILAFTIFVSAISLGGVGISNMVYKIQQHEY  452

Query  542  MGFENLCKYG  571
            MGF++LC Y 
Sbjct  453  MGFDSLCAYA  462



>gb|AEI98632.1| hypothetical protein 111018.19 [Coffea canephora]
Length=465

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW +N LQ+P++  V+L+EAT LYKG R I+SKG   +  +   + +YC  G++AGV
Sbjct  276  SAKYWTLNFLQVPIAASVSLYEATCLYKGTRTIASKGKEITVWKPNLIFLYCCLGIVAGV  335

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGF++GPLFLELGVPPQV+SAT+TFAM FSSSMSVV+YYLL RFPVPYA + 
Sbjct  336  VGGLLGLGGGFVLGPLFLELGVPPQVASATSTFAMTFSSSMSVVQYYLLNRFPVPYATYF  395

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VATVAA +GQHVVRR+IA+LGRASLIIFILA TIFVSAISLGGVGI++MIEK+ NHEY
Sbjct  396  VLVATVAALVGQHVVRRIIAILGRASLIIFILALTIFVSAISLGGVGIASMIEKLQNHEY  455

Query  542  MGFENLC  562
            MGF+NLC
Sbjct  456  MGFDNLC  462



>ref|XP_011025767.1| PREDICTED: uncharacterized protein LOC105126564 [Populus euphratica]
Length=477

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S +YW++NLLQ+P++  V LFEA  L KG R I+SKG   +N +   +++YC  G+IAG+
Sbjct  288  SVMYWILNLLQVPIAASVTLFEAISLCKGTRVIASKGKEITNWKLHLVLLYCSCGIIAGI  347

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM FSSSMSVVEYYLL RFPVPYA + 
Sbjct  348  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMAFSSSMSVVEYYLLNRFPVPYAAYF  407

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF GQHV+RR+IA+LGRAS+IIFILA TIFVSAISLGGVGI+NM+EK+ N EY
Sbjct  408  VLVATIAAFAGQHVIRRIIAILGRASIIIFILALTIFVSAISLGGVGIANMVEKLENDEY  467

Query  542  MGFENLC  562
            MGFENLC
Sbjct  468  MGFENLC  474



>ref|XP_002310222.2| hypothetical protein POPTR_0007s12700g [Populus trichocarpa]
 gb|EEE90672.2| hypothetical protein POPTR_0007s12700g [Populus trichocarpa]
Length=477

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S +YW++N LQ+P++  V LFEA  L KG R I+SKG   +N +  Q+++YC  G+IAG+
Sbjct  288  SVMYWILNSLQVPIAASVTLFEAICLCKGTRVIASKGKEITNWKLHQVLLYCSCGIIAGI  347

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM FSSSMSVVEYYLL RFPVPYA + 
Sbjct  348  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMAFSSSMSVVEYYLLNRFPVPYAAYF  407

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF GQHV+RR+IA+LGRAS+IIFILA TIFVSAISLGGVGI+NM+EK+ N EY
Sbjct  408  VLVATIAAFAGQHVIRRIIAILGRASIIIFILALTIFVSAISLGGVGIANMVEKLENDEY  467

Query  542  MGFENLC  562
            MGFENLC
Sbjct  468  MGFENLC  474



>ref|XP_006383214.1| hypothetical protein POPTR_0005s12570g [Populus trichocarpa]
 gb|ERP61011.1| hypothetical protein POPTR_0005s12570g [Populus trichocarpa]
Length=477

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++N LQ+P++  V LFEA  L KG R I+SKG   +N +  Q+++YC  G+IAG+
Sbjct  288  SVTYWILNSLQVPIAASVTLFEAICLCKGTRVIASKGKEITNWKLHQILLYCSCGIIAGM  347

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM FSSSMSVVEYYLL RFPVPYA + 
Sbjct  348  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMAFSSSMSVVEYYLLNRFPVPYAAYF  407

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT++AF+GQHVVR++IA LGRASLIIFILA TIFVSA+SLGGVGI+NM+EK+ N EY
Sbjct  408  ALVATISAFVGQHVVRKIIAFLGRASLIIFILALTIFVSAVSLGGVGIANMVEKLENEEY  467

Query  542  MGFENLCK  565
            MGFENLC+
Sbjct  468  MGFENLCQ  475



>ref|XP_008342687.1| PREDICTED: uncharacterized protein LOC103405461 [Malus domestica]
Length=428

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW  NLLQIPV+ GV +FEA  LYKG R I+S+ +S +N    QL++    G+ AG+
Sbjct  238  SAAYWAYNLLQIPVAFGVTIFEAVKLYKGHRVIASRAESNTNWTVNQLVLCSACGITAGI  297

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GP+FLELG+PPQVSSATATFAM FS+SMSVVEYYLLKRFP+PYAL+ 
Sbjct  298  VGGLLGLGGGFILGPVFLELGIPPQVSSATATFAMTFSASMSVVEYYLLKRFPIPYALYF  357

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            TAVAT +A +GQ+VVR+++++ GRAS+IIFILAFTIFVSAISLGGVGI++MIEKI + EY
Sbjct  358  TAVATFSALVGQYVVRKVVSIFGRASIIIFILAFTIFVSAISLGGVGIADMIEKIKHKEY  417

Query  542  MGFENLCKYG  571
            MGFEN+C Y 
Sbjct  418  MGFENICTYD  427



>ref|XP_004512029.1| PREDICTED: uncharacterized protein LOC101496928 isoform X2 [Cicer 
arietinum]
Length=523

 Score =   178 bits (451),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+N LQ+P+++ VALFEA  LYKG R I SKG   +N +  Q+ +YCF G++AG+
Sbjct  334  SIEYWVINFLQVPIAISVALFEAVCLYKGTRVIGSKGKEITNWKIHQIFLYCFCGIVAGM  393

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TF+M+FSSSMSVV+YYLL RFPVPYA F 
Sbjct  394  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFSMLFSSSMSVVQYYLLDRFPVPYASFF  453

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF+GQHVVR++IA+LGRAS+IIFILA TIF+SAISLGGVGI NMI K+ N EY
Sbjct  454  VLVATIAAFVGQHVVRKIIAILGRASIIIFILASTIFISAISLGGVGIENMIVKMENQEY  513

Query  542  MGFENLCK  565
            MGFEN C 
Sbjct  514  MGFENFCN  521



>ref|XP_004512031.1| PREDICTED: uncharacterized protein LOC101496928 isoform X4 [Cicer 
arietinum]
Length=522

 Score =   178 bits (451),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+N LQ+P+++ VALFEA  LYKG R I SKG   +N +  Q+ +YCF G++AG+
Sbjct  333  SIEYWVINFLQVPIAISVALFEAVCLYKGTRVIGSKGKEITNWKIHQIFLYCFCGIVAGM  392

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TF+M+FSSSMSVV+YYLL RFPVPYA F 
Sbjct  393  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFSMLFSSSMSVVQYYLLDRFPVPYASFF  452

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF+GQHVVR++IA+LGRAS+IIFILA TIF+SAISLGGVGI NMI K+ N EY
Sbjct  453  VLVATIAAFVGQHVVRKIIAILGRASIIIFILASTIFISAISLGGVGIENMIVKMENQEY  512

Query  542  MGFENLCK  565
            MGFEN C 
Sbjct  513  MGFENFCN  520



>ref|XP_004512030.1| PREDICTED: uncharacterized protein LOC101496928 isoform X3 [Cicer 
arietinum]
Length=523

 Score =   178 bits (451),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+N LQ+P+++ VALFEA  LYKG R I SKG   +N +  Q+ +YCF G++AG+
Sbjct  334  SIEYWVINFLQVPIAISVALFEAVCLYKGTRVIGSKGKEITNWKIHQIFLYCFCGIVAGM  393

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TF+M+FSSSMSVV+YYLL RFPVPYA F 
Sbjct  394  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFSMLFSSSMSVVQYYLLDRFPVPYASFF  453

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF+GQHVVR++IA+LGRAS+IIFILA TIF+SAISLGGVGI NMI K+ N EY
Sbjct  454  VLVATIAAFVGQHVVRKIIAILGRASIIIFILASTIFISAISLGGVGIENMIVKMENQEY  513

Query  542  MGFENLCK  565
            MGFEN C 
Sbjct  514  MGFENFCN  521



>ref|XP_004512028.1| PREDICTED: uncharacterized protein LOC101496928 isoform X1 [Cicer 
arietinum]
Length=524

 Score =   178 bits (451),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+N LQ+P+++ VALFEA  LYKG R I SKG   +N +  Q+ +YCF G++AG+
Sbjct  335  SIEYWVINFLQVPIAISVALFEAVCLYKGTRVIGSKGKEITNWKIHQIFLYCFCGIVAGM  394

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TF+M+FSSSMSVV+YYLL RFPVPYA F 
Sbjct  395  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFSMLFSSSMSVVQYYLLDRFPVPYASFF  454

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF+GQHVVR++IA+LGRAS+IIFILA TIF+SAISLGGVGI NMI K+ N EY
Sbjct  455  VLVATIAAFVGQHVVRKIIAILGRASIIIFILASTIFISAISLGGVGIENMIVKMENQEY  514

Query  542  MGFENLCK  565
            MGFEN C 
Sbjct  515  MGFENFCN  522



>gb|KHM98753.1| hypothetical protein glysoja_030806 [Glycine soja]
Length=479

 Score =   177 bits (448),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 161/192 (84%), Gaps = 2/192 (1%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NLLQ+PV+LG   ++A  LY G R I+SKGD  +  RA QLI+YC  G+ AG+
Sbjct  287  SVEYWVLNLLQVPVALGATSYQAVLLYTGKRVIASKGDQRTQWRAHQLIMYCSCGICAGI  346

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATATFAM FS+SMSVVEYYLLKRFP+PY L+ 
Sbjct  347  VGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYYLLKRFPIPYTLYF  406

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLG--GVGISNMIEKIHNH  535
             AV+T AAF+GQ +VR+L+A+LGRASLIIFIL+ TIFVSAISLG  GVGISNMI++I N 
Sbjct  407  VAVSTFAAFVGQVLVRKLVAILGRASLIIFILSSTIFVSAISLGKCGVGISNMIQRIANK  466

Query  536  EYMGFENLCKYG  571
            EYMGFENLC Y 
Sbjct  467  EYMGFENLCTYS  478



>ref|XP_010999980.1| PREDICTED: uncharacterized protein LOC105107666 [Populus euphratica]
Length=477

 Score =   177 bits (448),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++N LQ+P++  V LFEA  L KG R I+SKG   +N +  Q+++YC  G+IAG+
Sbjct  288  SVTYWILNSLQVPIAASVTLFEAICLCKGTRVIASKGKEITNWKLHQILLYCSCGIIAGM  347

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM FSSSMSVVEYYLL RFPVPYA + 
Sbjct  348  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMAFSSSMSVVEYYLLNRFPVPYAAYF  407

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT++A +GQHVVR++IA LGRASLIIFILA TIFVSA+SLGGVGI+NM+EK+ N EY
Sbjct  408  ALVATISALVGQHVVRKIIAFLGRASLIIFILALTIFVSAVSLGGVGIANMVEKLENEEY  467

Query  542  MGFENLC  562
            MGFENLC
Sbjct  468  MGFENLC  474



>ref|XP_008363110.1| PREDICTED: uncharacterized protein LOC103426807 isoform X1 [Malus 
domestica]
Length=477

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST +W++N LQ+P++L V LFEA  L KG R I+SKG   +N +  Q+ +YC  G++AG+
Sbjct  288  STTFWIMNSLQVPIALSVTLFEAICLRKGTRVIASKGKEITNWKLHQIFLYCSCGIVAGM  347

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA + 
Sbjct  348  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMLFSSSMSVVQYYLLNRFPVPYAAYF  407

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF GQHVVR++IAVLGRAS+IIFILA TIFVSAISLGGVGI+NM+EK+ N EY
Sbjct  408  VVVATIAAFTGQHVVRKIIAVLGRASIIIFILALTIFVSAISLGGVGIANMVEKMENREY  467

Query  542  MGFENLC  562
            MGFEN C
Sbjct  468  MGFENFC  474



>ref|XP_008363111.1| PREDICTED: uncharacterized protein LOC103426807 isoform X2 [Malus 
domestica]
Length=475

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST +W++N LQ+P++L V LFEA  L KG R I+SKG   +N +  Q+ +YC  G++AG+
Sbjct  286  STTFWIMNSLQVPIALSVTLFEAICLRKGTRVIASKGKEITNWKLHQIFLYCSCGIVAGM  345

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA + 
Sbjct  346  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMLFSSSMSVVQYYLLNRFPVPYAAYF  405

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF GQHVVR++IAVLGRAS+IIFILA TIFVSAISLGGVGI+NM+EK+ N EY
Sbjct  406  VVVATIAAFTGQHVVRKIIAVLGRASIIIFILALTIFVSAISLGGVGIANMVEKMENREY  465

Query  542  MGFENLC  562
            MGFEN C
Sbjct  466  MGFENFC  472



>ref|XP_010070053.1| PREDICTED: uncharacterized protein LOC104456870 [Eucalyptus grandis]
 gb|KCW58607.1| hypothetical protein EUGRSUZ_H01268 [Eucalyptus grandis]
Length=481

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++N LQ+P++  V LFEA  LY+G R I+SKG   +N +  Q+++YC  G+IAG+
Sbjct  292  SVKYWILNSLQVPIACSVTLFEAIALYRGTRVIASKGKEITNWKLHQILLYCSCGIIAGM  351

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM FSSSMSVV+YY+LKRFPVP+A + 
Sbjct  352  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMTFSSSMSVVQYYILKRFPVPFASYF  411

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VATVAA +GQHVVR++IA+LGR S+IIFILA TIFVSAISLGGVGISNM+EK+ N EY
Sbjct  412  VLVATVAAIVGQHVVRKIIAILGRTSIIIFILALTIFVSAISLGGVGISNMVEKLENQEY  471

Query  542  MGFENLC  562
            MGFE+LC
Sbjct  472  MGFESLC  478



>gb|KHN32619.1| hypothetical protein glysoja_022301 [Glycine soja]
Length=490

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 161/192 (84%), Gaps = 2/192 (1%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++NLLQ+PV+LG   ++A  LY G R I+SKGD  +  RA QL++YC  G+ AG+
Sbjct  298  SVEYWILNLLQVPVALGATSYQAVLLYTGKRVIASKGDQRTQWRAHQLVLYCSCGICAGI  357

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATATFAM FS+SMSVVEYYLLKRFP+PY L+ 
Sbjct  358  VGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYYLLKRFPIPYTLYF  417

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLG--GVGISNMIEKIHNH  535
             AV+T AAF+GQ +VR+L+A+LGRASLIIFIL+ TIFVSAISLG  GVGISNMI+KI N 
Sbjct  418  VAVSTFAAFVGQVLVRKLVAILGRASLIIFILSGTIFVSAISLGKCGVGISNMIQKIANK  477

Query  536  EYMGFENLCKYG  571
            EYMGFENLC Y 
Sbjct  478  EYMGFENLCTYS  489



>ref|XP_002298219.2| hypothetical protein POPTR_0001s18390g [Populus trichocarpa]
 gb|EEE83024.2| hypothetical protein POPTR_0001s18390g [Populus trichocarpa]
Length=438

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S +YW++N+LQIPV+ GV  +EA  LYKG RKI+S G++ +N    +LI+YCF G++AG 
Sbjct  251  SAIYWLLNILQIPVAAGVTSYEAVSLYKGRRKITSMGEASNNWPVHELILYCFIGVMAGT  310

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGG+LGLGGGFI+GPLFLE+G+PPQVSSATATFAMMFS+SMSVVE+YLLKRFPVPYAL+ 
Sbjct  311  VGGMLGLGGGFILGPLFLEMGIPPQVSSATATFAMMFSASMSVVEFYLLKRFPVPYALYF  370

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AA +GQHVVR+LI++LGRASLIIFILA TIFVSAI +GG G+++MIEK    EY
Sbjct  371  FTVATIAAVVGQHVVRKLISILGRASLIIFILASTIFVSAILVGGAGMASMIEKFERKEY  430

Query  542  MGFENLC  562
            MGFE++C
Sbjct  431  MGFESMC  437



>ref|XP_009356692.1| PREDICTED: uncharacterized protein LOC103947501 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009349999.1| PREDICTED: uncharacterized protein LOC103941518 isoform X2 [Pyrus 
x bretschneideri]
Length=475

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST +W++N LQ+P++L V LFEA  L KG R I+SKG   +N +  Q+ +YC  G++AG+
Sbjct  286  STTFWIMNSLQVPIALSVTLFEAICLRKGTRVIASKGKEITNWKLHQIFLYCSCGIVAGM  345

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA + 
Sbjct  346  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMLFSSSMSVVQYYLLNRFPVPYAAYF  405

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF GQHVVR++IAVLGRAS++IFILA TIFVSAISLGGVGI+NM+EK+ N EY
Sbjct  406  VLVATIAAFTGQHVVRKIIAVLGRASIVIFILALTIFVSAISLGGVGIANMVEKMENQEY  465

Query  542  MGFENLC  562
            MGFEN C
Sbjct  466  MGFENFC  472



>ref|XP_008338104.1| PREDICTED: uncharacterized protein LOC103401168 isoform X1 [Malus 
domestica]
Length=486

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 160/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST++W++N LQ+P+++ V LFEA  L KG R I+SKG   +N +  Q+ +YC  G++AG+
Sbjct  297  STMFWIMNSLQVPIAISVTLFEAICLCKGTRVIASKGKEITNWKLHQIFLYCSCGIVAGM  356

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA + 
Sbjct  357  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMLFSSSMSVVQYYLLNRFPVPYAAYF  416

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF GQHVVR++IAVLGRAS++IFILA TIFVSAISLGGVGI+NM+EK+ N EY
Sbjct  417  VLVATIAAFTGQHVVRKIIAVLGRASIVIFILALTIFVSAISLGGVGIANMVEKMENQEY  476

Query  542  MGFENLCK  565
            MGFEN C 
Sbjct  477  MGFENFCN  484



>ref|XP_009356691.1| PREDICTED: uncharacterized protein LOC103947501 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009349998.1| PREDICTED: uncharacterized protein LOC103941518 isoform X1 [Pyrus 
x bretschneideri]
Length=477

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST +W++N LQ+P++L V LFEA  L KG R I+SKG   +N +  Q+ +YC  G++AG+
Sbjct  288  STTFWIMNSLQVPIALSVTLFEAICLRKGTRVIASKGKEITNWKLHQIFLYCSCGIVAGM  347

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA + 
Sbjct  348  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMLFSSSMSVVQYYLLNRFPVPYAAYF  407

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF GQHVVR++IAVLGRAS++IFILA TIFVSAISLGGVGI+NM+EK+ N EY
Sbjct  408  VLVATIAAFTGQHVVRKIIAVLGRASIVIFILALTIFVSAISLGGVGIANMVEKMENQEY  467

Query  542  MGFENLC  562
            MGFEN C
Sbjct  468  MGFENFC  474



>ref|XP_008338105.1| PREDICTED: uncharacterized protein LOC103401168 isoform X2 [Malus 
domestica]
Length=484

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 160/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST++W++N LQ+P+++ V LFEA  L KG R I+SKG   +N +  Q+ +YC  G++AG+
Sbjct  295  STMFWIMNSLQVPIAISVTLFEAICLCKGTRVIASKGKEITNWKLHQIFLYCSCGIVAGM  354

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA + 
Sbjct  355  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMLFSSSMSVVQYYLLNRFPVPYAAYF  414

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF GQHVVR++IAVLGRAS++IFILA TIFVSAISLGGVGI+NM+EK+ N EY
Sbjct  415  VLVATIAAFTGQHVVRKIIAVLGRASIVIFILALTIFVSAISLGGVGIANMVEKMENQEY  474

Query  542  MGFENLCK  565
            MGFEN C 
Sbjct  475  MGFENFCN  482



>ref|XP_009371582.1| PREDICTED: uncharacterized protein LOC103960817 isoform X1 [Pyrus 
x bretschneideri]
Length=486

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 160/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST++W++N LQ+P+++ V LFEA  L KG R I+SKG   +N +  Q+ +YC  G++AG+
Sbjct  297  STMFWIMNSLQVPIAISVTLFEAICLCKGTRVIASKGKEITNWKLHQIFLYCSCGIVAGM  356

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA + 
Sbjct  357  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMLFSSSMSVVQYYLLNRFPVPYAAYF  416

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF GQHVVR++IAVLGRAS++IFILA TIFVSAISLGGVGI+NM+EK+ N EY
Sbjct  417  VLVATIAAFTGQHVVRKIIAVLGRASIVIFILALTIFVSAISLGGVGIANMVEKMENQEY  476

Query  542  MGFENLCK  565
            MGFEN C 
Sbjct  477  MGFENFCN  484



>ref|XP_007202022.1| hypothetical protein PRUPE_ppa004997mg [Prunus persica]
 gb|EMJ03221.1| hypothetical protein PRUPE_ppa004997mg [Prunus persica]
Length=482

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST++WV+N LQ+P+++ V LFEA  L KG R I+SKG   +N +  Q+ +YC  G++AG+
Sbjct  293  STMFWVLNSLQVPIAVSVTLFEAICLCKGTRVIASKGKEITNWKLHQIFLYCSCGIVAGM  352

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA + 
Sbjct  353  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMLFSSSMSVVQYYLLNRFPVPYAAYF  412

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF GQHVVR++IAVLGRAS++IFILA TIFVSAISLGGVGI+NM+EK+ N EY
Sbjct  413  VLVATIAAFTGQHVVRKIIAVLGRASIVIFILALTIFVSAISLGGVGIANMVEKMENQEY  472

Query  542  MGFENLC  562
            MGFEN C
Sbjct  473  MGFENFC  479



>ref|XP_009371583.1| PREDICTED: uncharacterized protein LOC103960817 isoform X2 [Pyrus 
x bretschneideri]
Length=484

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 160/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST++W++N LQ+P+++ V LFEA  L KG R I+SKG   +N +  Q+ +YC  G++AG+
Sbjct  295  STMFWIMNSLQVPIAISVTLFEAICLCKGTRVIASKGKEITNWKLHQIFLYCSCGIVAGM  354

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA + 
Sbjct  355  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMLFSSSMSVVQYYLLNRFPVPYAAYF  414

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF GQHVVR++IAVLGRAS++IFILA TIFVSAISLGGVGI+NM+EK+ N EY
Sbjct  415  VLVATIAAFTGQHVVRKIIAVLGRASIVIFILALTIFVSAISLGGVGIANMVEKMENQEY  474

Query  542  MGFENLCK  565
            MGFEN C 
Sbjct  475  MGFENFCN  482



>gb|AAL27555.1|AF420410_1 hypothetical protein [Musa acuminata AAA Group]
Length=238

 Score =   169 bits (427),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++NLLQ+PVSLGV+ +EA  LY+G R ISSKG  G++    QL+ YC  G++AGV
Sbjct  16   SLWYWILNLLQVPVSLGVSGYEAVSLYRGKRIISSKGLEGTDFTVIQLVFYCLIGVLAGV  75

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GP+FLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+ 
Sbjct  76   VGGLLGLGGGFILGPVFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYF  135

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             +VA VAAF+GQH+V+RLI +LGRASLIIFILA TIF+SAISLGGVGISNM++KI +HE 
Sbjct  136  VSVALVAAFVGQHLVKRLIEILGRASLIIFILASTIFISAISLGGVGISNMVQKIQHHES  195

Query  542  MGFE  553
             G  
Sbjct  196  WGLR  199



>ref|XP_003611976.1| Membrane protein-like protein [Medicago truncatula]
 ref|XP_003636269.1| Membrane protein-like protein [Medicago truncatula]
 gb|AES94934.1| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=470

 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++N LQ+P+++ V LFEA  +YKG R I SKG    N++  Q+++YC  G+IAG+
Sbjct  282  SIEYWILNFLQVPIAISVTLFEAVCIYKGTRVIKSKGKEVKNMKIYQILLYCSIGVIAGM  341

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLE+G+PPQV+SAT+TF+M+FSSSMSVV+YY L RFPVPYA + 
Sbjct  342  VGGLLGLGGGFILGPLFLEMGIPPQVASATSTFSMLFSSSMSVVQYYYLDRFPVPYASYF  401

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF GQHVVRR+IA+LGRAS+IIFILA TIF+SAISLGGVGI NMI K+ NHEY
Sbjct  402  VLVATIAAFAGQHVVRRIIAILGRASIIIFILASTIFISAISLGGVGIQNMIVKLENHEY  461

Query  542  MGFENLC  562
            MGFENLC
Sbjct  462  MGFENLC  468



>gb|ACJ86264.1| unknown [Medicago truncatula]
Length=481

 Score =   174 bits (442),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S +YW++NLLQ+P+++GV+ +EA  LYKG R I+S GD G N    QLI+YC  G+IAG+
Sbjct  289  SLIYWILNLLQVPIAIGVSGYEAILLYKGKRVIASNGDQGINWSVKQLILYCSCGIIAGI  348

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            +GGLLGLGGGFI+GPLF+ LG+PPQV+SAT+TFAM FS+SMSVVEYYLLKRFP+PYAL+ 
Sbjct  349  IGGLLGLGGGFILGPLFIGLGIPPQVASATSTFAMTFSASMSVVEYYLLKRFPIPYALYF  408

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VATVAA +GQH+VR+LIA+LGRAS+IIFILA T+FVS ISLGG GI+N+I+++ N EY
Sbjct  409  VVVATVAALVGQHLVRKLIALLGRASIIIFILALTVFVSGISLGGTGIANLIKRLENKEY  468

Query  542  MGFENLCKYGV*N  580
            MGF NLC Y V N
Sbjct  469  MGFGNLCSYAVRN  481



>ref|XP_004232395.1| PREDICTED: uncharacterized protein LOC101255155 [Solanum lycopersicum]
Length=486

 Score =   174 bits (442),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = +2

Query  11   YWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvgg  190
            YW++NLLQ+PV++ V+L+EA  LYKG R I+SKG   +N +   L  YC  G++AG+VGG
Sbjct  300  YWILNLLQVPVAVSVSLYEAVCLYKGTRVIASKGKEITNWKPHLLFFYCCCGIVAGIVGG  359

Query  191  llglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltav  370
            LLGLGGGFI+GPLFLELG+PPQV+SAT+TF+M FSSSMSVV+YYLLKRFPVPYA +  ++
Sbjct  360  LLGLGGGFILGPLFLELGIPPQVASATSTFSMTFSSSMSVVQYYLLKRFPVPYATYFVSI  419

Query  371  atvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGF  550
            AT+AA +GQHV+RR+IA+LGRAS+IIFILA TIF SAISLGGVGI+NMIEK+ N++YMGF
Sbjct  420  ATIAAVVGQHVIRRVIALLGRASIIIFILAMTIFTSAISLGGVGIANMIEKLKNNDYMGF  479

Query  551  ENLC  562
            +NLC
Sbjct  480  DNLC  483



>ref|XP_008241663.1| PREDICTED: uncharacterized protein LOC103340075 [Prunus mume]
Length=482

 Score =   174 bits (442),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST++WV+N LQ+P+++ V LFEA  L KG R I+SKG   +N +  Q+ +YC  G++AG+
Sbjct  293  STMFWVLNSLQVPIAVSVTLFEAICLCKGTRVIASKGKEITNWKLHQIFLYCSCGIVAGM  352

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA + 
Sbjct  353  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMLFSSSMSVVQYYLLNRFPVPYAAYF  412

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF GQHVVR++IAV+GRAS++IFILA TIFVSAISLGGVGI+NM+EK+ N EY
Sbjct  413  VLVATIAAFTGQHVVRKIIAVVGRASIVIFILALTIFVSAISLGGVGIANMVEKMENQEY  472

Query  542  MGFENLC  562
            MGFEN C
Sbjct  473  MGFENFC  479



>ref|XP_003629897.1| hypothetical protein MTR_8g088080 [Medicago truncatula]
 gb|AET04373.1| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=479

 Score =   174 bits (441),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S +YW++NLLQ+P+++GV+ +EA  LYKG R I+S GD G N    QLI+YC  G+IAG+
Sbjct  287  SLIYWILNLLQVPIAIGVSGYEAILLYKGKRVIASNGDQGINWSVKQLILYCSCGIIAGI  346

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            +GGLLGLGGGFI+GPLF+ LG+PPQV+SAT+TFAM FS+SMSVVEYYLLKRFP+PYAL+ 
Sbjct  347  IGGLLGLGGGFILGPLFIGLGIPPQVASATSTFAMTFSASMSVVEYYLLKRFPIPYALYF  406

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VATVAA +GQH+VR+LIA+LGRAS+IIFILA T+FVS ISLGG GI+N+I+++ N EY
Sbjct  407  VVVATVAALVGQHLVRKLIALLGRASIIIFILALTVFVSGISLGGTGIANLIKRLENKEY  466

Query  542  MGFENLCKYGV*N  580
            MGF NLC Y V N
Sbjct  467  MGFGNLCSYAVRN  479



>ref|XP_006340601.1| PREDICTED: uncharacterized protein LOC102601548 [Solanum tuberosum]
Length=476

 Score =   174 bits (441),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = +2

Query  11   YWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvgg  190
            YW++NLLQ+PV++ V+L+EA  LYKG R I+SKG   +N +   L  YC  G++AG+VGG
Sbjct  290  YWILNLLQVPVAVSVSLYEAICLYKGTRVIASKGKEITNWKPHLLFFYCCCGIVAGIVGG  349

Query  191  llglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltav  370
            LLGLGGGFI+GPLFLELG+PPQV+SAT+TF+M FSSSMSVV+YYLLKRFPVPYA +  ++
Sbjct  350  LLGLGGGFILGPLFLELGIPPQVASATSTFSMTFSSSMSVVQYYLLKRFPVPYATYFVSI  409

Query  371  atvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGF  550
            AT+AA +GQHV+RR+IA+LGRAS+IIFILA TIF SAISLGGVGI+NMIEK+ N +YMGF
Sbjct  410  ATIAAVVGQHVIRRVIALLGRASIIIFILAMTIFTSAISLGGVGIANMIEKLENQDYMGF  469

Query  551  ENLC  562
            +NLC
Sbjct  470  DNLC  473



>ref|XP_007150626.1| hypothetical protein PHAVU_005G168100g [Phaseolus vulgaris]
 gb|ESW22620.1| hypothetical protein PHAVU_005G168100g [Phaseolus vulgaris]
Length=480

 Score =   174 bits (441),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST YW++NLLQ+PV+LGV  F+A  LYKG   I+SKGD  +  RA QLI+YC  G+ AG+
Sbjct  290  STDYWILNLLQVPVALGVTTFQAVRLYKGKAVIASKGDQQTQWRAHQLILYCACGICAGM  349

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATATFAM FS+SMSVVEYYLL RFP+PY L+ 
Sbjct  350  VGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYYLLNRFPIPYTLYF  409

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AV+T AAF+GQ +V++L+A+LGRASLIIFIL+ TIFVSA+SLG VGI++M++K+ + EY
Sbjct  410  VAVSTFAAFVGQVLVKKLVALLGRASLIIFILSGTIFVSALSLGSVGIASMVQKLAHKEY  469

Query  542  MGFENLCKYG  571
            MGFENLC Y 
Sbjct  470  MGFENLCTYA  479



>ref|XP_010254877.1| PREDICTED: uncharacterized protein LOC104595716 isoform X2 [Nelumbo 
nucifera]
Length=345

 Score =   171 bits (433),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 159/185 (86%), Gaps = 0/185 (0%)
 Frame = +2

Query  11   YWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvgg  190
            YW++NLLQ+P+++ V+L+EA  LYKG R I+SKG   +NL+   L  YC  G++AGVVGG
Sbjct  161  YWLLNLLQVPIAVSVSLYEAVCLYKGKRVIASKGKEVTNLKVHLLFFYCLCGIVAGVVGG  220

Query  191  llglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltav  370
            LLGLGGGFI+GPLFLELG+PPQV+S+T+TF M+FSSSMSV++YYLLKRFPVPYA +   +
Sbjct  221  LLGLGGGFILGPLFLELGIPPQVASSTSTFVMVFSSSMSVIQYYLLKRFPVPYAAYFVLI  280

Query  371  atvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGF  550
            ATVAAF GQHVVR+LI + GRASLIIFILA TIFVSAI LGGVGI++M+EK+ ++EYMGF
Sbjct  281  ATVAAFTGQHVVRKLIRLFGRASLIIFILALTIFVSAIGLGGVGIADMVEKLEHNEYMGF  340

Query  551  ENLCK  565
            E+LC+
Sbjct  341  ESLCQ  345



>gb|KJB40204.1| hypothetical protein B456_007G050900 [Gossypium raimondii]
Length=475

 Score =   174 bits (441),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S +YW+VN LQIP++  V +FEA  LYKG R I+SKG   +N +  Q++ YC  G+IAG+
Sbjct  286  SVMYWIVNSLQIPIAASVTVFEAICLYKGRRVIASKGKEITNWKIYQILFYCSCGIIAGM  345

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TF+M FSSSMSVV+YYLL RFP+PYA + 
Sbjct  346  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFSMAFSSSMSVVQYYLLNRFPIPYAAYF  405

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF GQHVVR++I VLGRAS+IIFILA TIF+SAISLGGVGI++M+EK+ + EY
Sbjct  406  VLVATIAAFTGQHVVRKIITVLGRASIIIFILALTIFISAISLGGVGIADMVEKLEDEEY  465

Query  542  MGFENLCK  565
            MGFENLCK
Sbjct  466  MGFENLCK  473



>ref|XP_002516037.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46457.1| conserved hypothetical protein [Ricinus communis]
Length=481

 Score =   174 bits (441),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV++ LQIPV++GV  +EA  LYKG RKI+S+G+  +N +  QL+ Y   G++AGV
Sbjct  291  SVTYWVLSTLQIPVAVGVTGYEAISLYKGQRKIASRGEVSTNWKIHQLVSYSAIGILAGV  350

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGG+LGLGGGFI+GPLFLE+G+PPQVSSATATF M FS+SMSV+EYYLLKRFPVPYAL+L
Sbjct  351  VGGMLGLGGGFILGPLFLEMGIPPQVSSATATFIMAFSASMSVIEYYLLKRFPVPYALYL  410

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVA +AAF+GQHVVR+LI++LGRASLIIFILAFTIF SAISLGGVGI+  I+KI   EY
Sbjct  411  FAVAIIAAFVGQHVVRKLISLLGRASLIIFILAFTIFASAISLGGVGIARAIKKIERKEY  470

Query  542  MGFENLCKY  568
            MGFE++C Y
Sbjct  471  MGFEDICSY  479



>ref|XP_004504238.1| PREDICTED: uncharacterized protein LOC101507523 [Cicer arietinum]
Length=468

 Score =   174 bits (440),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++NLLQ+P+++GV+ +EA  LYKG R I+SKGD  +     QLI+YC  G++AG+
Sbjct  276  SVAYWILNLLQVPITVGVSSYEAVLLYKGKRVIASKGDQQTQWSVQQLILYCACGIVAGI  335

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            +GGLLGLGGGFI+GPLF+ LG+PPQVSSAT+TFAM FS+SMSVVEYYLLKRFP+ YAL+ 
Sbjct  336  IGGLLGLGGGFILGPLFIGLGIPPQVSSATSTFAMTFSASMSVVEYYLLKRFPISYALYF  395

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVATVAA IGQH+VR+LIA+LGRAS+IIFILA T+FVS ISLGG GI+N+I+++ N EY
Sbjct  396  VAVATVAALIGQHLVRKLIAILGRASIIIFILALTVFVSGISLGGTGIANLIKRVENKEY  455

Query  542  MGFENLCKYGV*N  580
            MGF NLC+Y V N
Sbjct  456  MGFGNLCEYRVRN  468



>ref|XP_002521607.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40878.1| conserved hypothetical protein [Ricinus communis]
Length=478

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++N LQ+P++  V LFEA  L KG R I+S+G   +N +  Q+++YC  G+IAG+
Sbjct  291  SVAYWILNALQVPIAASVTLFEAICLRKGTRVIASRGKEITNWKYHQILLYCSCGIIAGM  350

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+FSSSMSVV+YYLLKRFPVPYA F 
Sbjct  351  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSVVQYYLLKRFPVPYATFF  410

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VATVAA +GQHVVR++IA+LGRAS+IIFILA TIFVSAISLGGVGI +M+EK+ N EY
Sbjct  411  VLVATVAALVGQHVVRKIIAILGRASIIIFILALTIFVSAISLGGVGIVDMVEKLTNEEY  470

Query  542  MGFENLC  562
            MGFENLC
Sbjct  471  MGFENLC  477



>ref|XP_009788571.1| PREDICTED: uncharacterized protein LOC104236361 [Nicotiana sylvestris]
Length=479

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++N LQIPV++ V+L+EA  LYKG R I+SKG   ++ +   L  YC  G++AG+
Sbjct  290  SIEYWILNFLQIPVAVSVSLYEAVCLYKGTRVIASKGKEITSWKPHLLFFYCCCGIVAGI  349

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TF+M FSSSMSVV+YYLLKRFPVPYA + 
Sbjct  350  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFSMTFSSSMSVVQYYLLKRFPVPYAAYF  409

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             +VAT+AA +GQHVVRR+IA+LGRAS+IIFILA TIFVSAISLGGVGI+NMIEK+ N +Y
Sbjct  410  VSVATIAALVGQHVVRRVIALLGRASIIIFILAMTIFVSAISLGGVGIANMIEKLENKDY  469

Query  542  MGFENLC  562
            MGF+NLC
Sbjct  470  MGFDNLC  476



>ref|XP_008228544.1| PREDICTED: uncharacterized protein LOC103327946 [Prunus mume]
Length=489

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW +NLLQIPV+  V  +EA  LY G R I+SKG+S ++ +  QL++Y   G++AG+
Sbjct  299  SAAYWALNLLQIPVAFSVTTYEAVNLYLGHRVITSKGESHTDWKVHQLVLYSACGIVAGI  358

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GP+FLELG+PPQVSSATATFAM FS+SMSV+EYYLL RFPVPYAL+L
Sbjct  359  VGGLLGLGGGFILGPVFLELGIPPQVSSATATFAMTFSASMSVIEYYLLHRFPVPYALYL  418

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVAT++A +GQHVVR+++ +LGRAS+IIFILAFTIFVSAISLGGVGI++ +EKI + EY
Sbjct  419  AAVATLSAVVGQHVVRKVVMILGRASIIIFILAFTIFVSAISLGGVGIADTVEKIEHKEY  478

Query  542  MGFENLCKYG  571
            MGFEN+C Y 
Sbjct  479  MGFENICTYD  488



>ref|XP_009631525.1| PREDICTED: uncharacterized protein LOC104121277 [Nicotiana tomentosiformis]
Length=480

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++N LQ+PV++ V+L+EA  LYKG R I+SKG   ++ +   L  YC  G++AG+
Sbjct  291  SIEYWILNFLQVPVAVSVSLYEAVCLYKGTRVIASKGKEITSWKPHLLFFYCCCGIVAGI  350

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TF+M FSSSMSVV+YYLLKRFPVPYA + 
Sbjct  351  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFSMTFSSSMSVVQYYLLKRFPVPYAAYF  410

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             +VAT+AA +GQHVVRR+IA+LGRAS+IIFILA TIFVSAISLGGVGI+NMIEK+ N +Y
Sbjct  411  VSVATIAALVGQHVVRRVIALLGRASIIIFILAMTIFVSAISLGGVGIANMIEKLENKDY  470

Query  542  MGFENLC  562
            MGF+NLC
Sbjct  471  MGFDNLC  477



>ref|XP_007156932.1| hypothetical protein PHAVU_002G029400g [Phaseolus vulgaris]
 gb|ESW28926.1| hypothetical protein PHAVU_002G029400g [Phaseolus vulgaris]
Length=470

 Score =   172 bits (435),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  +W++N LQ+P+++ V LFEA  LYKG R I+SKG   ++ +  Q+ +YC  G++AG+
Sbjct  281  SIQFWILNFLQVPIAISVTLFEAISLYKGTRVIASKGKEITHWKIHQICLYCSTGIMAGM  340

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA + 
Sbjct  341  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSVVQYYLLDRFPVPYASYF  400

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF GQHVVR++I VLGRAS+IIFILA TIF+SA+SLGGVGI N+IEKI  HEY
Sbjct  401  ALVATLAAFTGQHVVRKIIVVLGRASIIIFILALTIFISALSLGGVGIENIIEKIEKHEY  460

Query  542  MGFENLC  562
            MGFE+LC
Sbjct  461  MGFEDLC  467



>ref|XP_009346009.1| PREDICTED: uncharacterized protein LOC103937781 [Pyrus x bretschneideri]
Length=489

 Score =   172 bits (436),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 159/190 (84%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW  NLLQIPV+ GV +FEA  LYKG R I+S+ +  +N    QL++    G+IAG+
Sbjct  299  SAAYWAYNLLQIPVAFGVTIFEAVKLYKGDRVIASRAELNTNWTVNQLVLCSACGIIAGI  358

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GP+FLELG+PPQVSSATATFAM FS+S+SVVEYYLLKRFP+PYAL+ 
Sbjct  359  VGGLLGLGGGFILGPVFLELGIPPQVSSATATFAMTFSASLSVVEYYLLKRFPIPYALYF  418

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            TAVAT +A +GQ+VVR++++ LGRAS+IIFILAFTIFVSAISLGGVGI +MIEKI + EY
Sbjct  419  TAVATFSALVGQYVVRKVVSFLGRASIIIFILAFTIFVSAISLGGVGIVDMIEKIKHKEY  478

Query  542  MGFENLCKYG  571
            MGFEN+C Y 
Sbjct  479  MGFENICTYD  488



>ref|XP_002324817.1| hypothetical protein POPTR_0018s00760g [Populus trichocarpa]
 gb|EEF03382.1| hypothetical protein POPTR_0018s00760g [Populus trichocarpa]
Length=474

 Score =   171 bits (434),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST +WV+NLLQIP+S+GV L+EA GLYKG R+ISSKGD   + +  +L+++   G++AG+
Sbjct  283  STTFWVLNLLQIPISIGVFLYEAIGLYKGRRRISSKGDEIMDWQVHRLLMFSVCGVVAGI  342

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLG+GGGF+MGPLFLE+G+PPQVSS TATF M+FSSSMSVVEYYLL RFPVPYAL+ 
Sbjct  343  VGGLLGIGGGFVMGPLFLEMGIPPQVSSGTATFGMLFSSSMSVVEYYLLDRFPVPYALYF  402

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVA +AAFIGQ+++ +LI + GRASLIIF+LAFTIF+SAI+LGGVGI+  I  +  HEY
Sbjct  403  IAVAVIAAFIGQNIITKLITISGRASLIIFVLAFTIFISAIALGGVGITRTIGMVERHEY  462

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  463  MGFENLCKY  471



>gb|KJB18685.1| hypothetical protein B456_003G065000 [Gossypium raimondii]
Length=474

 Score =   171 bits (434),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+N LQIPV++GV+ +EA  LYKG RKI+SKGD+ +N R  +L++YC FG++AGV
Sbjct  284  SVEYWVLNFLQIPVTVGVSSYEAVFLYKGRRKIASKGDAVANWRVHKLVIYCGFGVLAGV  343

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            +GG+LGLGGGFI+GPLFLE+G+PPQVSSATATFAM+FS+SMSVVEYYLLKRFP+PYAL+L
Sbjct  344  LGGMLGLGGGFILGPLFLEMGIPPQVSSATATFAMLFSASMSVVEYYLLKRFPIPYALYL  403

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF+GQHVV ++I +LGR+S+IIFILA  IF SAISLGG+GI+ MI++I   EY
Sbjct  404  AGVATIAAFVGQHVVGKVIKILGRSSIIIFILAGMIFGSAISLGGLGIAKMIKRIERKEY  463

Query  542  MGFENLCKY  568
            MGFE++C Y
Sbjct  464  MGFEDICSY  472



>gb|KJB18684.1| hypothetical protein B456_003G065000 [Gossypium raimondii]
Length=461

 Score =   171 bits (433),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+N LQIPV++GV+ +EA  LYKG RKI+SKGD+ +N R  +L++YC FG++AGV
Sbjct  271  SVEYWVLNFLQIPVTVGVSSYEAVFLYKGRRKIASKGDAVANWRVHKLVIYCGFGVLAGV  330

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            +GG+LGLGGGFI+GPLFLE+G+PPQVSSATATFAM+FS+SMSVVEYYLLKRFP+PYAL+L
Sbjct  331  LGGMLGLGGGFILGPLFLEMGIPPQVSSATATFAMLFSASMSVVEYYLLKRFPIPYALYL  390

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF+GQHVV ++I +LGR+S+IIFILA  IF SAISLGG+GI+ MI++I   EY
Sbjct  391  AGVATIAAFVGQHVVGKVIKILGRSSIIIFILAGMIFGSAISLGGLGIAKMIKRIERKEY  450

Query  542  MGFENLCKY  568
            MGFE++C Y
Sbjct  451  MGFEDICSY  459



>gb|AAC42255.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAM15102.1| hypothetical protein [Arabidopsis thaliana]
Length=902

 Score =   175 bits (444),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 161/189 (85%), Gaps = 4/189 (2%)
 Frame = +2

Query  14   WVV----NLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            W+V     + +IPV++GV+ +EA  LY+G R I+SKG   SN   GQL++YC FG+IAG+
Sbjct  141  WIVFLALQISKIPVAVGVSGYEAVALYQGRRIIASKGQGDSNFTVGQLVMYCTFGIIAGI  200

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+L
Sbjct  201  VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYL  260

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AA++GQHVVRRLIA +GRASLIIFILA  IF+SAISLGGVGI NMI KI  HEY
Sbjct  261  VGVATIAAWVGQHVVRRLIAAIGRASLIIFILASMIFISAISLGGVGIVNMIGKIQRHEY  320

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  321  MGFENLCKY  329



>ref|XP_007024174.1| Sulfite exporter TauE/SafE family protein, putative isoform 1 
[Theobroma cacao]
 gb|EOY26796.1| Sulfite exporter TauE/SafE family protein, putative isoform 1 
[Theobroma cacao]
Length=486

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+N LQIPV++GV+ +EA  LYKG R+I+SKGD  +N R  +L++YC FG++AG+
Sbjct  296  SVEYWVLNFLQIPVAVGVSSYEAVCLYKGRRRIASKGDVVANWRVHKLVIYCAFGLLAGI  355

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            +GG+LGLGGGFI+GPLFLE+G+PPQVSSAT+TFAM+FS+SMSVVEYYLLKRFPVPYAL+L
Sbjct  356  LGGMLGLGGGFILGPLFLEMGIPPQVSSATSTFAMLFSASMSVVEYYLLKRFPVPYALYL  415

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            + VAT+AAF+GQHVV ++I +LGRAS+IIFILA  IF SAISLGG+GI+ MI++I   EY
Sbjct  416  SLVATIAAFVGQHVVGKVIKILGRASIIIFILAGMIFGSAISLGGLGIAKMIKRIERKEY  475

Query  542  MGFENLCKY  568
            MGF+++C Y
Sbjct  476  MGFDDICSY  484



>ref|XP_010254876.1| PREDICTED: uncharacterized protein LOC104595716 isoform X1 [Nelumbo 
nucifera]
Length=471

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 159/185 (86%), Gaps = 0/185 (0%)
 Frame = +2

Query  11   YWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvgg  190
            YW++NLLQ+P+++ V+L+EA  LYKG R I+SKG   +NL+   L  YC  G++AGVVGG
Sbjct  287  YWLLNLLQVPIAVSVSLYEAVCLYKGKRVIASKGKEVTNLKVHLLFFYCLCGIVAGVVGG  346

Query  191  llglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltav  370
            LLGLGGGFI+GPLFLELG+PPQV+S+T+TF M+FSSSMSV++YYLLKRFPVPYA +   +
Sbjct  347  LLGLGGGFILGPLFLELGIPPQVASSTSTFVMVFSSSMSVIQYYLLKRFPVPYAAYFVLI  406

Query  371  atvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGF  550
            ATVAAF GQHVVR+LI + GRASLIIFILA TIFVSAI LGGVGI++M+EK+ ++EYMGF
Sbjct  407  ATVAAFTGQHVVRKLIRLFGRASLIIFILALTIFVSAIGLGGVGIADMVEKLEHNEYMGF  466

Query  551  ENLCK  565
            E+LC+
Sbjct  467  ESLCQ  471



>gb|KDP38300.1| hypothetical protein JCGZ_05186 [Jatropha curcas]
Length=469

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++N LQIP++  V +FEA  L KG R I+SKG   +N +  Q+ +YC  G+IAG+
Sbjct  282  SMTYWILNALQIPIAASVTIFEAICLRKGTRVIASKGKEITNWKFHQIFLYCSCGIIAGM  341

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+FSSSMSVV+YY L RFPVPYA + 
Sbjct  342  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSVVQYYFLNRFPVPYATYF  401

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT AA  GQHVVRR+IAVLGR S+IIFILA TIFVSAISLGGVGI++M+EK+ N EY
Sbjct  402  VIVATFAALAGQHVVRRIIAVLGRTSIIIFILALTIFVSAISLGGVGIADMVEKLENEEY  461

Query  542  MGFENLC  562
            MGFENLC
Sbjct  462  MGFENLC  468



>ref|XP_010935066.1| PREDICTED: uncharacterized protein LOC105055061 [Elaeis guineensis]
Length=495

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = +2

Query  11   YWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvgg  190
            YW++N+LQ+P++L V L+EA  L KG R I+S+G      +  QL++YCF G++AG+VGG
Sbjct  301  YWILNVLQVPIALSVTLYEAINLCKGTRTIASRGKQDMRWKMHQLLLYCFCGVLAGIVGG  360

Query  191  llglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltav  370
            LLGLGGGFI+GPLFLE+GVPPQV+SAT+TFAM FSSSMSV++YYLL RFPVPYA +   +
Sbjct  361  LLGLGGGFILGPLFLEMGVPPQVASATSTFAMTFSSSMSVIQYYLLDRFPVPYAAYFVFL  420

Query  371  atvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGF  550
            ATVAAF GQH+VRRLI +LGRASLIIFILA TIFVSAISLGGVGI++M+EK+   E+MGF
Sbjct  421  ATVAAFTGQHIVRRLIVLLGRASLIIFILALTIFVSAISLGGVGIAHMVEKLERKEHMGF  480

Query  551  ENLC  562
            ENLC
Sbjct  481  ENLC  484



>ref|XP_004287906.1| PREDICTED: uncharacterized protein LOC101304510 [Fragaria vesca 
subsp. vesca]
Length=478

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST++WV+N +Q+P++  V +FE+  L+KG R I+SKG   +N +  QL +YC  G++AG+
Sbjct  289  STMFWVLNSMQVPIAASVTVFESICLWKGTRVIASKGKEITNWKLHQLFLYCSCGIVAGM  348

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA + 
Sbjct  349  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMLFSSSMSVVQYYLLNRFPVPYAAYF  408

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF GQHVVR++IAV+GRAS++IFILA TI VSAISLGGVGI+NM+EK+ N EY
Sbjct  409  VLVATIAAFTGQHVVRKVIAVVGRASIVIFILALTILVSAISLGGVGIANMVEKMENQEY  468

Query  542  MGFENLC  562
            MGFEN C
Sbjct  469  MGFENFC  475



>ref|XP_008353719.1| PREDICTED: uncharacterized protein LOC103417306 [Malus domestica]
Length=1022

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +2

Query  2     STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
             S  YW  NLLQIPV+ GV +FEA  LYKG R I+S+ +S +N    QL++    G+ AG+
Sbjct  832   SAAYWAYNLLQIPVAFGVTIFEAVKLYKGHRVIASRAESNTNWTVNQLVLCSACGITAGI  891

Query  182   vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
             VGGLLGLGGGFI+GP+FLELG+PPQVSSATATFAM FS+SMSVVEYYLLKRFP+PYAL+ 
Sbjct  892   VGGLLGLGGGFILGPVFLELGIPPQVSSATATFAMTFSASMSVVEYYLLKRFPIPYALYF  951

Query  362   tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             TAVAT +A +GQ+VVR+++++ GRAS+IIFILAFTIFVSAISLGGVGI++MIEKI + EY
Sbjct  952   TAVATFSALVGQYVVRKVVSIFGRASIIIFILAFTIFVSAISLGGVGIADMIEKIKHKEY  1011

Query  542   MGFENLCKYGV  574
             MGFEN+C Y  
Sbjct  1012  MGFENICTYDA  1022



>ref|XP_002516036.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46456.1| conserved hypothetical protein [Ricinus communis]
Length=466

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = +2

Query  11   YWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvgg  190
            YW+++  QIPV+  + +++A  LYKG RKI+S+G++ SN R  +L++YCF G++AG++GG
Sbjct  280  YWILDFAQIPVAASLTIYQAVRLYKGRRKIASRGEAESNWRVHKLLLYCFSGLLAGIIGG  339

Query  191  llglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltav  370
            LLGLGGGFI+GPLFLE+G+PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+L AV
Sbjct  340  LLGLGGGFILGPLFLEMGIPPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYLFAV  399

Query  371  atvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGF  550
             T+A F+GQ+VV+++I +LGRAS+IIFIL+FTI VSAISLGGVG+++MI+KI   EYMGF
Sbjct  400  TTLAGFVGQYVVKKVIDMLGRASIIIFILSFTILVSAISLGGVGLADMIKKIERKEYMGF  459

Query  551  ENLCKYG  571
            E++C Y 
Sbjct  460  EDICLYS  466



>gb|KJB43508.1| hypothetical protein B456_007G203800 [Gossypium raimondii]
Length=417

 Score =   168 bits (426),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S +YW+V  LQIP++  V +FEA  L KG R I+SKG   +N +  Q+++YC  G+IAG+
Sbjct  229  SVMYWIVTSLQIPIAASVTIFEAICLCKGTRVIASKGKEITNWKMHQILLYCSCGIIAGM  288

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TF+M+FSSSMSVV+YYLL RFPVPYA + 
Sbjct  289  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFSMVFSSSMSVVQYYLLDRFPVPYAAYF  348

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AA  GQHVVRR+IAV+GRAS+IIFILA TIF+SAISLGGVGI++M++K+ N EY
Sbjct  349  VLVATIAAIAGQHVVRRIIAVIGRASIIIFILALTIFISAISLGGVGIADMVKKLANKEY  408

Query  542  MGFENLCK  565
            MGFENLCK
Sbjct  409  MGFENLCK  416



>ref|XP_004959391.1| PREDICTED: uncharacterized protein LOC101762929 [Setaria italica]
Length=459

 Score =   169 bits (428),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 158/190 (83%), Gaps = 2/190 (1%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKG--DSGSNLRAGQLIVYCFFgmia  175
            S  YWV+N LQIPV++GV ++EA GL  G R ++SKG     S LR  QL VYC FG++A
Sbjct  269  SAWYWVLNSLQIPVAIGVTMYEAHGLMTGKRVLASKGSQQQQSTLRVRQLSVYCLFGILA  328

Query  176  gvvggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYal  355
            G++GGLLG+GGGFIMGPLFLELG+PPQVSSATATF MMFSSSMSVVEYYLL RFPVPYA 
Sbjct  329  GLIGGLLGMGGGFIMGPLFLELGIPPQVSSATATFTMMFSSSMSVVEYYLLHRFPVPYAA  388

Query  356  fltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNH  535
            + TAVA VAA +GQH VR+LIA LGRASLIIFILA  IFVSA++LGGVGISN++ ++  H
Sbjct  389  YFTAVAFVAAIVGQHCVRKLIAWLGRASLIIFILASMIFVSALTLGGVGISNIVHRMERH  448

Query  536  EYMGFENLCK  565
            +YMGFE+LC+
Sbjct  449  QYMGFESLCR  458



>ref|XP_004509250.1| PREDICTED: uncharacterized protein LOC101512581 [Cicer arietinum]
Length=472

 Score =   169 bits (427),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 155/187 (83%), Gaps = 0/187 (0%)
 Frame = +2

Query  11   YWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvgg  190
            YW++N LQ+P+++ V +FEA  L KG R I+SKG   +  +  Q+ +YC  G+IAG+V G
Sbjct  286  YWILNSLQVPIAISVTVFEAICLSKGSRVIASKGKEITGWKFHQICLYCLCGIIAGMVSG  345

Query  191  llglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltav  370
            LLGLGGGFI+GPLFLELG+PPQV+SAT+TF M+FSSSMSVV+YYLL RFPVPYA +L  V
Sbjct  346  LLGLGGGFILGPLFLELGIPPQVASATSTFVMVFSSSMSVVQYYLLDRFPVPYASYLVLV  405

Query  371  atvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGF  550
            AT+AA  GQHVVR+++A+ GRAS+IIFILAFTIFVSAISLGGVGI NM+EK+ N +YMGF
Sbjct  406  ATIAALTGQHVVRKMVAIFGRASIIIFILAFTIFVSAISLGGVGIENMVEKMENEDYMGF  465

Query  551  ENLCKYG  571
            +NLC + 
Sbjct  466  DNLCHHS  472



>ref|XP_010680799.1| PREDICTED: uncharacterized protein LOC104895862 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=475

 Score =   169 bits (427),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW+++ LQ+P+++ V+LFE   LYKG + I+SKG   + L+  Q+  YC  G++AG+
Sbjct  286  SVQYWLLDSLQVPIAVSVSLFEGVCLYKGTKVIASKGKEITVLKVHQIFFYCLCGVVAGM  345

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TF+M+FSSSMSVV+YY+LKRFPVPYA + 
Sbjct  346  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFSMIFSSSMSVVQYYILKRFPVPYAAYF  405

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AA +GQHVVRRLI +LGRAS+IIFILA TI VSAI+LGGVGI NMI+K+ NHEY
Sbjct  406  VLVATLAAIVGQHVVRRLITLLGRASIIIFILASTILVSAITLGGVGIVNMIQKLENHEY  465

Query  542  MGFENLC  562
            MGFEN C
Sbjct  466  MGFENFC  472



>ref|XP_010680798.1| PREDICTED: uncharacterized protein LOC104895862 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=476

 Score =   169 bits (427),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW+++ LQ+P+++ V+LFE   LYKG + I+SKG   + L+  Q+  YC  G++AG+
Sbjct  287  SVQYWLLDSLQVPIAVSVSLFEGVCLYKGTKVIASKGKEITVLKVHQIFFYCLCGVVAGM  346

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TF+M+FSSSMSVV+YY+LKRFPVPYA + 
Sbjct  347  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFSMIFSSSMSVVQYYILKRFPVPYAAYF  406

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AA +GQHVVRRLI +LGRAS+IIFILA TI VSAI+LGGVGI NMI+K+ NHEY
Sbjct  407  VLVATLAAIVGQHVVRRLITLLGRASIIIFILASTILVSAITLGGVGIVNMIQKLENHEY  466

Query  542  MGFENLC  562
            MGFEN C
Sbjct  467  MGFENFC  473



>ref|XP_004302906.1| PREDICTED: uncharacterized protein LOC101294092 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=479

 Score =   169 bits (427),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NL+QIPV+ G + +EA  LY G R ISS+  S  + +   L++YC  G+IAG+
Sbjct  292  SVAYWVLNLMQIPVAFGASSYEAVRLYYGQRVISSQDVSSMDWKVHHLVLYCGCGIIAGI  351

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+ 
Sbjct  352  VGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYF  411

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            TAVA+ AA +GQHVVR++I +LGRAS+IIFILA TIFVSAISLGGVGI++ I+KI N+EY
Sbjct  412  TAVASFAALVGQHVVRKVINILGRASIIIFILAATIFVSAISLGGVGIADTIQKIENNEY  471

Query  542  MGFENLC  562
            MGFEN+C
Sbjct  472  MGFENIC  478



>ref|XP_007217721.1| hypothetical protein PRUPE_ppa005105mg [Prunus persica]
 gb|EMJ18920.1| hypothetical protein PRUPE_ppa005105mg [Prunus persica]
Length=477

 Score =   168 bits (426),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S +YW++NLLQIPV++G+  +EA  LYKG R I SKG+ G+N R  +L+ YC FG++AG+
Sbjct  287  SVVYWILNLLQIPVTVGITSYEAVKLYKGSRIIESKGEGGANWRVHKLVSYCAFGIVAGL  346

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            +GGLLGLGGGFIMGP+FLE+G+PPQVSSATATF M FSSSMSVVEYYLLKRFP+PYAL+ 
Sbjct  347  LGGLLGLGGGFIMGPVFLEMGIPPQVSSATATFIMTFSSSMSVVEYYLLKRFPIPYALYF  406

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVA V+A +GQ++V ++I  LGRASLIIFILA TIFVSA++LGGVGI+NM++KI + EY
Sbjct  407  AAVAIVSAIMGQYLVGKVIKALGRASLIIFILALTIFVSALTLGGVGIANMVKKIEHKEY  466

Query  542  MGFENLC  562
            + FE++C
Sbjct  467  LWFESMC  473



>gb|KHG02837.1| ATP synthase subunit delta [Gossypium arboreum]
Length=469

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S +YW+V  LQIP++  V +FEA  L KG R I+SKG   +N +  Q+++YC  G+IAG+
Sbjct  281  SVMYWIVTSLQIPIAASVTIFEAICLCKGTRVIASKGKEITNWKMHQILLYCSCGIIAGM  340

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TF+M+FSSSMSVV+YYLL RFPVPYA + 
Sbjct  341  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFSMVFSSSMSVVQYYLLDRFPVPYAAYF  400

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AA  GQHVVRR+IAV+GRAS+IIFILA TIF+SAISLGGVGI++M++K+ N EY
Sbjct  401  VLVATMAAIAGQHVVRRIIAVIGRASIIIFILALTIFISAISLGGVGIADMVKKLANKEY  460

Query  542  MGFENLCK  565
            MGFENLCK
Sbjct  461  MGFENLCK  468



>ref|XP_009592781.1| PREDICTED: uncharacterized protein LOC104089559 isoform X1 [Nicotiana 
tomentosiformis]
Length=473

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST YW++NLLQ+PV++G + +EA  LYKG R I S G+     +  QLI+YC  G++AG+
Sbjct  284  STTYWILNLLQLPVAVGASAYEAVCLYKGSRMIMSSGEIVITWKVHQLILYCCCGILAGI  343

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATA F M+FSSSMSV++YYLL+RFPVPYAL+ 
Sbjct  344  VGGLLGLGGGFILGPLFLELGIPPQVSSATAAFVMIFSSSMSVIQYYLLRRFPVPYALYF  403

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVA++AA +GQHVVRR+I+++GRAS+IIFILAFTIFVSAISLGGVGI++ I+KI   ++
Sbjct  404  IAVASIAALVGQHVVRRIISIVGRASVIIFILAFTIFVSAISLGGVGIADTIKKIEEGQH  463

Query  542  MGFENLCKYG  571
            MGF+N+C Y 
Sbjct  464  MGFDNICAYN  473



>gb|KJB43509.1| hypothetical protein B456_007G203800 [Gossypium raimondii]
Length=469

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S +YW+V  LQIP++  V +FEA  L KG R I+SKG   +N +  Q+++YC  G+IAG+
Sbjct  281  SVMYWIVTSLQIPIAASVTIFEAICLCKGTRVIASKGKEITNWKMHQILLYCSCGIIAGM  340

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TF+M+FSSSMSVV+YYLL RFPVPYA + 
Sbjct  341  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFSMVFSSSMSVVQYYLLDRFPVPYAAYF  400

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AA  GQHVVRR+IAV+GRAS+IIFILA TIF+SAISLGGVGI++M++K+ N EY
Sbjct  401  VLVATIAAIAGQHVVRRIIAVIGRASIIIFILALTIFISAISLGGVGIADMVKKLANKEY  460

Query  542  MGFENLCK  565
            MGFENLCK
Sbjct  461  MGFENLCK  468



>ref|XP_009800425.1| PREDICTED: uncharacterized protein LOC104246320 isoform X1 [Nicotiana 
sylvestris]
Length=473

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST YW++NL Q+PV++G + +EA  LYKG R I S G++    +  QLI+YC  G++AG+
Sbjct  284  STTYWILNLSQVPVAVGASAYEAVCLYKGSRTIMSSGETVITWKVHQLILYCCCGILAGI  343

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATA F M+FSSSMSV++YYLL+RFPVPYAL+ 
Sbjct  344  VGGLLGLGGGFILGPLFLELGIPPQVSSATAAFVMIFSSSMSVIQYYLLRRFPVPYALYF  403

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVA +AA +GQHVVRR+I+++GRAS+IIFILAFTIFVSAISLGGVGI++ I+KI   ++
Sbjct  404  IAVAGIAALVGQHVVRRIISIVGRASVIIFILAFTIFVSAISLGGVGIADTIKKIEEGQH  463

Query  542  MGFENLCKYG  571
            MGF+N+C Y 
Sbjct  464  MGFDNICAYN  473



>ref|XP_011466694.1| PREDICTED: uncharacterized protein LOC101294092 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=510

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NL+QIPV+ G + +EA  LY G R ISS+  S  + +   L++YC  G+IAG+
Sbjct  323  SVAYWVLNLMQIPVAFGASSYEAVRLYYGQRVISSQDVSSMDWKVHHLVLYCGCGIIAGI  382

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+ 
Sbjct  383  VGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYF  442

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            TAVA+ AA +GQHVVR++I +LGRAS+IIFILA TIFVSAISLGGVGI++ I+KI N+EY
Sbjct  443  TAVASFAALVGQHVVRKVINILGRASIIIFILAATIFVSAISLGGVGIADTIQKIENNEY  502

Query  542  MGFENLCK  565
            MGFEN+C 
Sbjct  503  MGFENICT  510



>ref|XP_009353615.1| PREDICTED: uncharacterized protein LOC103944864 [Pyrus x bretschneideri]
 ref|XP_009353616.1| PREDICTED: uncharacterized protein LOC103944864 [Pyrus x bretschneideri]
 ref|XP_009353617.1| PREDICTED: uncharacterized protein LOC103944864 [Pyrus x bretschneideri]
 ref|XP_009353618.1| PREDICTED: uncharacterized protein LOC103944864 [Pyrus x bretschneideri]
Length=480

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW+++ LQIPV++GV  +EA  +YKG R ISS+G++G+  R   L+ +CFFG+IAG+
Sbjct  290  SVAYWILDFLQIPVTVGVTSYEAVKVYKGQRVISSRGEAGAKWRVHNLVSFCFFGIIAGL  349

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            +GGLLGLGGGFIMGPLFLE+GVPPQV+SAT+TF M+FSSSMSVVEY LLKRFP+PYAL+ 
Sbjct  350  IGGLLGLGGGFIMGPLFLEMGVPPQVASATSTFIMLFSSSMSVVEYDLLKRFPIPYALYF  409

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            TAVA  +A IGQHVV ++I  +GRASLIIFILAFTIFVSA++LGGVGI+N+++KI + EY
Sbjct  410  TAVAIGSAIIGQHVVGKVIKAIGRASLIIFILAFTIFVSALTLGGVGIANLVKKIEHKEY  469

Query  542  MGFENLCKY  568
            +GF+++C +
Sbjct  470  LGFQSMCTH  478



>ref|XP_008670142.1| PREDICTED: uncharacterized protein LOC103647377 [Zea mays]
Length=383

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 158/192 (82%), Gaps = 4/192 (2%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISS-KGDSG---SNLRAGQLIVYCFFgm  169
            S  YWV+N LQ+PV++GV ++EA GL  G R +SS KG S    S LR  QL+VYC FG+
Sbjct  191  SVWYWVLNSLQVPVAVGVTVYEACGLRTGRRALSSNKGGSQQQQSALRIRQLLVYCLFGV  250

Query  170  iagvvggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPY  349
            +AG+VGGLLG+GGGFIMGPLFLELG+PPQVSSATATF MMFSSSMSVVEYYLL RFPVPY
Sbjct  251  LAGLVGGLLGMGGGFIMGPLFLELGIPPQVSSATATFTMMFSSSMSVVEYYLLHRFPVPY  310

Query  350  alfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIH  529
            A + T VA VAA  GQH VR+LIA LGRASLIIFILA  IFVSA++LGGVGISN++ ++ 
Sbjct  311  AAYFTGVAFVAAITGQHCVRKLIAWLGRASLIIFILASMIFVSALTLGGVGISNIVHRVE  370

Query  530  NHEYMGFENLCK  565
             H+YMGFE+LCK
Sbjct  371  RHQYMGFESLCK  382



>ref|XP_011026588.1| PREDICTED: uncharacterized protein LOC105127135 [Populus euphratica]
Length=475

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST +WV+NLLQIPVS+GV L+EA GLYKG R+ISSKGD   + +  +L+++   G++AG+
Sbjct  284  STTFWVLNLLQIPVSIGVFLYEAIGLYKGRRRISSKGDEIMDWQVHRLLMFSACGVVAGI  343

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLG+GGGFIMGPLFLE+G+PPQV+S TATF M+FSSSMSVVEYYLL RFPVPYAL+ 
Sbjct  344  VGGLLGIGGGFIMGPLFLEMGIPPQVTSGTATFGMLFSSSMSVVEYYLLDRFPVPYALYF  403

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVA +AAFIGQ+++ +LI + GRASLIIF+LAFTIF+SAI+LGGVGI+  I  +  HEY
Sbjct  404  IAVAIIAAFIGQNIITKLITLSGRASLIIFVLAFTIFISAIALGGVGITRTIGMMERHEY  463

Query  542  MGFENLCKY  568
            MGFENLCKY
Sbjct  464  MGFENLCKY  472



>ref|XP_008380919.1| PREDICTED: uncharacterized protein LOC103443803 [Malus domestica]
 ref|XP_008380921.1| PREDICTED: uncharacterized protein LOC103443803 [Malus domestica]
 ref|XP_008348510.1| PREDICTED: uncharacterized protein LOC103411659 [Malus domestica]
Length=480

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW+++ LQIPV++GV  +EA  +YKG R I+S+G++G+  R   L+ YCFFG+IAG+
Sbjct  290  SAAYWILDFLQIPVTVGVTSYEAVKVYKGQRVIASRGEAGAKWRVHNLVSYCFFGIIAGL  349

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            +GGLLGLGGGFIMGPLFLE+G+PPQV+SAT+TF M+FSSSMSVVEYYLLKRFP+PYAL+ 
Sbjct  350  IGGLLGLGGGFIMGPLFLEMGIPPQVASATSTFIMLFSSSMSVVEYYLLKRFPIPYALYF  409

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVA  +A IGQHVV ++I  +GRASLIIFILAFTIFVSA++LGGVGI+N+++KI + E 
Sbjct  410  AAVAIGSAIIGQHVVGKVIKAIGRASLIIFILAFTIFVSALTLGGVGIANLVKKIEHKEN  469

Query  542  MGFENLCKY  568
            +GF+ +C +
Sbjct  470  LGFQRMCTH  478



>gb|KJB56746.1| hypothetical protein B456_009G134400 [Gossypium raimondii]
Length=476

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NLLQIPV++GV+ +EA  LYKG RKI+SKGD  +  R  +L++YC FG++AGV
Sbjct  286  SVEYWVLNLLQIPVAVGVSSYEAICLYKGRRKIASKGDVAATWRVHKLLIYCGFGVLAGV  345

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            +GG+LGLGGGFI+GPL LE+G+PPQVSSAT TFAM FS+SMSV+EYYLLKRFPVPYA++L
Sbjct  346  LGGMLGLGGGFILGPLLLEMGIPPQVSSATTTFAMFFSASMSVIEYYLLKRFPVPYAVYL  405

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AAF GQHVV ++I +LGRAS+IIFIL+  IF SAISLGG+GI+ MI++I   EY
Sbjct  406  AVVATIAAFAGQHVVGKVIKILGRASIIIFILSGMIFGSAISLGGIGIAKMIKRIERKEY  465

Query  542  MGFENLCKY  568
            MG +++C Y
Sbjct  466  MGLDDICSY  474



>ref|XP_008228546.1| PREDICTED: uncharacterized protein LOC103327947 isoform X1 [Prunus 
mume]
 ref|XP_008228547.1| PREDICTED: uncharacterized protein LOC103327947 isoform X1 [Prunus 
mume]
Length=478

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S +YW++NLLQIPV++G+  +EA  LYKG R I SKG+ G+N R  +L+ YC  G++AG+
Sbjct  288  SVVYWILNLLQIPVTVGITSYEAVKLYKGSRIIESKGEGGANWRVHKLVSYCVLGIVAGI  347

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            +GGLLGLGGGFIMGP+FLE+G+PPQVSSATATF M FSSSMSVVEYYLLKRFP+PYAL+ 
Sbjct  348  LGGLLGLGGGFIMGPVFLEMGIPPQVSSATATFIMTFSSSMSVVEYYLLKRFPIPYALYF  407

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVATV+A +GQ++V ++I  LGRASLIIFILA TIFVSA++LGGVGI+NM++KI + E 
Sbjct  408  AAVATVSAIMGQYLVGKVIKALGRASLIIFILALTIFVSALTLGGVGIANMVKKIEHKES  467

Query  542  MGFENLC  562
            +GFE +C
Sbjct  468  LGFEKMC  474



>ref|XP_003527721.1| PREDICTED: uncharacterized protein LOC100789748 [Glycine max]
 gb|ABC47859.1| membrane protein-like protein [Glycine max]
 gb|KHN22333.1| hypothetical protein glysoja_022089 [Glycine soja]
Length=491

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 165/205 (80%), Gaps = 4/205 (2%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSN-LRAGQLIVYCFFgmiag  178
            S LYWV+N LQ+P+++ V L+EA  L  G R ISSKG   ++ ++  ++ +YC  G+IAG
Sbjct  287  SILYWVLNSLQVPIAISVTLYEAICLCNGTRVISSKGKENTDWMKLHKICLYCSCGIIAG  346

Query  179  vvggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalf  358
            +V GLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+FSSSMSVV+YYLL+RFPVPYA +
Sbjct  347  IVSGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSVVQYYLLERFPVPYASY  406

Query  359  ltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHE  538
               VAT+AA  GQHVVR++IA+ GRAS+IIF+LAFTIF+SAISLGGVGI NM+EK+ N+E
Sbjct  407  FILVATIAALTGQHVVRKIIAIFGRASIIIFVLAFTIFLSAISLGGVGIENMVEKMENNE  466

Query  539  YMGFENLCKY---GV*NLYRTTFYL  604
            YMGF N+C     GV   YR+  +L
Sbjct  467  YMGFANICHVNLGGVFPTYRSGSFL  491



>ref|XP_010263696.1| PREDICTED: uncharacterized protein LOC104601887 [Nelumbo nucifera]
Length=473

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 159/185 (86%), Gaps = 0/185 (0%)
 Frame = +2

Query  11   YWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvgg  190
            YW++NL+Q+P++  V+L+EA  LY+G R I+SKG   +N +   L +YCF G++AG+VGG
Sbjct  289  YWLLNLIQVPIAASVSLYEAICLYRGKRVIASKGKELTNWKVPLLFLYCFCGIVAGIVGG  348

Query  191  llglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltav  370
            LLGLGGGFI+GPLFLEL VPPQV+SAT+TF M+FSSSMSVV+YYLLKRFPVPYA +   V
Sbjct  349  LLGLGGGFILGPLFLELEVPPQVASATSTFVMVFSSSMSVVQYYLLKRFPVPYASYFVLV  408

Query  371  atvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGF  550
            AT+AAF GQHVVR+LI +LGRAS+IIFILA TIFVSA+SLGGVGI+NM+E + ++EYMGF
Sbjct  409  ATIAAFTGQHVVRKLITLLGRASIIIFILAMTIFVSALSLGGVGIANMLEMLEHNEYMGF  468

Query  551  ENLCK  565
            E+LC+
Sbjct  469  ESLCQ  473



>gb|EMT09652.1| hypothetical protein F775_10698 [Aegilops tauschii]
Length=298

 Score =   162 bits (411),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 154/189 (81%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST YWV+ +LQIPVS+GV++++A  L +G R +SS+ ++ ++ +A Q++VYCFFG+ AGV
Sbjct  108  STWYWVLTVLQIPVSVGVSMYQAASLVQGKRALSSRANNQTSPKAHQILVYCFFGVTAGV  167

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            + GLLG+GGG +MGPLFLELG+ PQVSSATA+FAMMFSSSM+ VEYYLLKRFPVPYALF 
Sbjct  168  LAGLLGVGGGVVMGPLFLELGIHPQVSSATASFAMMFSSSMAAVEYYLLKRFPVPYALFF  227

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            T++  VAA +GQ V R+L+  LGRAS IIFIL+  IFVSAISLGGVGIS    K+  HEY
Sbjct  228  TSLTFVAAIVGQRVARKLVNWLGRASFIIFILSSMIFVSAISLGGVGISKTTHKMARHEY  287

Query  542  MGFENLCKY  568
            MGF N+C Y
Sbjct  288  MGFGNICNY  296



>ref|NP_001061712.1| Os08g0387200 [Oryza sativa Japonica Group]
 dbj|BAD05436.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23626.1| Os08g0387200 [Oryza sativa Japonica Group]
 gb|EAZ42600.1| hypothetical protein OsJ_27163 [Oryza sativa Japonica Group]
Length=469

 Score =   166 bits (421),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 154/189 (81%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST YWV+NLLQIPVS+GV ++E  GL +G R ISS G+  +NL+  QL++YCFFG+ AG+
Sbjct  279  STWYWVLNLLQIPVSVGVTMYEGLGLMQGRRVISSNGNEQTNLKFHQLLMYCFFGITAGI  338

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            V GLLG+GGG I+GP+FL+LGVPPQV+SATATF+MMFS+SMS VEYY L RFPVPYAL+L
Sbjct  339  VAGLLGVGGGSILGPMFLDLGVPPQVASATATFSMMFSASMSAVEYYFLDRFPVPYALYL  398

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            T VA  +A +GQ +VR++I  LGRAS+IIF L+  IF+S I LGG+GI N I KI  HEY
Sbjct  399  TVVAFFSAIVGQRMVRKVINWLGRASIIIFTLSIMIFLSTIPLGGIGIVNWIGKIERHEY  458

Query  542  MGFENLCKY  568
            MGFE++CK+
Sbjct  459  MGFEDICKF  467



>gb|EAZ06861.1| hypothetical protein OsI_29096 [Oryza sativa Indica Group]
Length=469

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 154/189 (81%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST YWV+NLLQIPVS+GV ++E  GL +G R ISS G+  +NL+  QL++YCFFG+ AG+
Sbjct  279  STWYWVLNLLQIPVSVGVTMYEGLGLMQGRRVISSNGNEQTNLKFHQLLMYCFFGITAGI  338

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            V GLLG+GGG I+GP+FL+LGVPPQV+SATATF+MMFS+SMS VEYY L RFPVPYAL+L
Sbjct  339  VAGLLGVGGGSILGPMFLDLGVPPQVASATATFSMMFSASMSAVEYYFLDRFPVPYALYL  398

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            T VA  +A +GQ +VR++I  LGRAS+IIF L+  IF+S I LGG+GI N I KI  HEY
Sbjct  399  TVVAFFSAIVGQRMVRKVINWLGRASIIIFTLSIMIFLSTIPLGGIGIVNWIGKIERHEY  458

Query  542  MGFENLCKY  568
            MGFE++CK+
Sbjct  459  MGFEDICKF  467



>ref|XP_006659358.1| PREDICTED: uncharacterized protein LOC102716712 [Oryza brachyantha]
Length=468

 Score =   166 bits (420),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 153/189 (81%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST YW++NLLQIPVS+GV ++E  GL +G R ISS G+  +NL+  QL++YCFFG+ AG+
Sbjct  278  STWYWLLNLLQIPVSVGVTMYEGIGLVQGRRVISSNGNEQTNLKFHQLLMYCFFGITAGI  337

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            V GLLG+GGG I+GP+FL+LGVPPQV+SATATF+MMFSSSMS +EYY L RFPVPYAL+L
Sbjct  338  VAGLLGVGGGSILGPMFLDLGVPPQVASATATFSMMFSSSMSAIEYYFLDRFPVPYALYL  397

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
            T VA  +A +GQ VVR+LI  LGRAS+I+F L+  I +S   LGG+GISN I KI  HEY
Sbjct  398  TVVAFFSAIVGQRVVRKLINWLGRASIIVFTLSTMIILSTFPLGGIGISNWIGKIERHEY  457

Query  542  MGFENLCKY  568
            MGFEN+CKY
Sbjct  458  MGFENICKY  466



>gb|AET04372.2| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=474

 Score =   166 bits (420),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++NLLQ+P+++GV+ +EA  LYKG + I+SKGD G N    QLI+YC  G+IAG+
Sbjct  282  SVAYWILNLLQVPIAVGVSSYEAVLLYKGKKVIASKGDQGINWSVKQLILYCSCGIIAGL  341

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            +GGLLGLGGGFI+ PLFL LG+PPQVSSAT+TFAM FS+SMSVVEYYLLKRFP+PYAL+ 
Sbjct  342  IGGLLGLGGGFILAPLFLGLGIPPQVSSATSTFAMTFSASMSVVEYYLLKRFPIPYALYF  401

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VATVAA +GQH+VR+LI +LGRAS+IIFILA T+FVS ISLGG GI+++I++  N EY
Sbjct  402  VVVATVAALVGQHLVRKLIVLLGRASIIIFILALTVFVSGISLGGTGIASLIKRTENKEY  461

Query  542  MGFENLCKYGV*N  580
            MGF +LC Y V N
Sbjct  462  MGFGSLCAYRVRN  474



>tpg|DAA39926.1| TPA: hypothetical protein ZEAMMB73_327447 [Zea mays]
Length=497

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 158/192 (82%), Gaps = 4/192 (2%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISS-KGDSG---SNLRAGQLIVYCFFgm  169
            S  YWV+N LQ+PV++GV ++EA GL  G R +SS KG S    S LR  QL+VYC FG+
Sbjct  305  SVWYWVLNSLQVPVAVGVTVYEACGLRTGRRALSSNKGGSQQQQSALRIRQLLVYCLFGV  364

Query  170  iagvvggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPY  349
            +AG+VGGLLG+GGGFIMGPLFLELG+PPQVSSATATF MMFSSSMSVVEYYLL RFPVPY
Sbjct  365  LAGLVGGLLGMGGGFIMGPLFLELGIPPQVSSATATFTMMFSSSMSVVEYYLLHRFPVPY  424

Query  350  alfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIH  529
            A + T VA VAA  GQH VR+LIA LGRASLIIFILA  IFVSA++LGGVGISN++ ++ 
Sbjct  425  AAYFTGVAFVAAITGQHCVRKLIAWLGRASLIIFILASMIFVSALTLGGVGISNIVHRVE  484

Query  530  NHEYMGFENLCK  565
             H+YMGFE+LCK
Sbjct  485  RHQYMGFESLCK  496



>ref|XP_006585192.1| PREDICTED: uncharacterized protein LOC100801244 [Glycine max]
Length=406

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 156/191 (82%), Gaps = 0/191 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S +YWV+NLLQ+P+++G++ ++A  LYKG R I SKGD  +N R  QLI++C  G++AG 
Sbjct  214  SGVYWVINLLQVPIAVGMSSYQAMRLYKGQRIIGSKGDQQTNWRVLQLILFCACGILAGT  273

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            + GLLGLGGGFI+ PLFL +G+PPQV+SAT+  AM FS+SM+VVEYYLLKRFP+ YAL+ 
Sbjct  274  IAGLLGLGGGFILAPLFLGIGIPPQVASATSILAMAFSASMAVVEYYLLKRFPISYALYF  333

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVAT AA +GQH+VR++IA+LGRAS+IIFIL  T+ VSA+ LGGVG++NMI++I N EY
Sbjct  334  VAVATAAALVGQHLVRKVIAILGRASVIIFILTLTLCVSAVLLGGVGVANMIKRIENKEY  393

Query  542  MGFENLCKYGV  574
            MGF NLC Y V
Sbjct  394  MGFGNLCTYKV  404



>ref|XP_010113488.1| hypothetical protein L484_026823 [Morus notabilis]
 gb|EXC35515.1| hypothetical protein L484_026823 [Morus notabilis]
Length=460

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = +2

Query  20   VNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllg  199
            V ++++P+++ V LFEA  LY+G R I+SKG   +N +  Q+ +YC  G++AG+VGGLLG
Sbjct  277  VQIVKVPIAVSVTLFEAICLYRGTRVIASKGKEITNWKLHQIFLYCSCGIVAGMVGGLLG  336

Query  200  lgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatv  379
            LGGGFI+GPLFLELG+PPQV+SAT+TFAM+FSSSMSVV+YYLLKRFPVPYA +   VAT+
Sbjct  337  LGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSVVQYYLLKRFPVPYASYFVLVATI  396

Query  380  aafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENL  559
            AAF GQHVVR++IAV+GRAS+IIFILA TIFVSAISLGGVGI+NM+EK+ N EYMGFEN 
Sbjct  397  AAFTGQHVVRKIIAVVGRASIIIFILALTIFVSAISLGGVGIANMVEKMENQEYMGFENF  456

Query  560  C  562
            C
Sbjct  457  C  457



>ref|XP_006580862.1| PREDICTED: uncharacterized protein LOC100818240 [Glycine max]
Length=422

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 157/191 (82%), Gaps = 0/191 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S +YWV+NLLQ+P+++G++ ++A  LYKG R I+SKGD  ++ R  QLIV+C  G++AG 
Sbjct  230  SGVYWVINLLQVPIAVGMSSYQAMRLYKGQRIIASKGDQQTHWRVLQLIVFCACGILAGT  289

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            + GLLGLGGGFI+ PLFL LG+PPQV+SAT+  AM FS+S++VVEYYLLKRFP+ YAL+ 
Sbjct  290  IAGLLGLGGGFILAPLFLGLGIPPQVASATSILAMAFSASIAVVEYYLLKRFPISYALYF  349

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVAT AA +GQH+VR++IA+LGRAS+IIFIL  T+ VSA+ LGGVG++NMI++I N EY
Sbjct  350  VAVATAAALVGQHLVRKVIAMLGRASVIIFILTLTLCVSAVLLGGVGVANMIKRIENKEY  409

Query  542  MGFENLCKYGV  574
            MGF NLC Y V
Sbjct  410  MGFGNLCTYKV  420



>ref|XP_006465613.1| PREDICTED: uncharacterized protein LOC102613991 [Citrus sinensis]
Length=380

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 157/189 (83%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S +YWV+N LQIPV+  V+ +EA  LYKG RKI+SKGD  +  RA QL++YC  G++AGV
Sbjct  191  SVVYWVLNFLQIPVAGAVSAYEAIALYKGRRKIASKGDGRTKWRAHQLVLYCACGIMAGV  250

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+ PLFLELG+ PQVSSATA F M F+SS+S+VEYYLLK FP+PYA++ 
Sbjct  251  VGGLLGLGGGFILSPLFLELGIHPQVSSATAIFVMTFASSISIVEYYLLKGFPLPYAIYF  310

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVAT+AA +GQ+VVR+LI +  RAS+IIF L+FTIFVSA++LGGVG++ MI++I + EY
Sbjct  311  FAVATIAAIVGQYVVRKLINIFARASIIIFTLSFTIFVSALTLGGVGLAKMIKRIEHKEY  370

Query  542  MGFENLCKY  568
            MGF+++C Y
Sbjct  371  MGFDSICSY  379



>ref|XP_011009831.1| PREDICTED: uncharacterized protein LOC105114838 [Populus euphratica]
Length=478

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S +Y ++N+LQIPV+ GV  +EA  LYKG RKI+S G++ ++    +LI+YCF G++AG 
Sbjct  291  SAIYRLLNILQIPVAAGVTSYEAVNLYKGRRKITSMGEASNDWPVHKLILYCFIGVMAGT  350

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGG+LGLGGGFI+GPLFLE+G+PPQVSSATATFAMMFS+S+SVVEYYL+KRFPVPYAL+ 
Sbjct  351  VGGMLGLGGGFILGPLFLEMGIPPQVSSATATFAMMFSASLSVVEYYLIKRFPVPYALYF  410

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AA +GQHVVR+LI++LGRASLIIFILA TIFVSAI +GG G+++MI+K    EY
Sbjct  411  FTVATIAAVVGQHVVRKLISILGRASLIIFILASTIFVSAILVGGSGMASMIKKFERKEY  470

Query  542  MGFENLC  562
            MGFE++C
Sbjct  471  MGFESIC  477



>gb|ABC47842.1| membrane protein-like protein [Glycine max]
Length=469

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 158/188 (84%), Gaps = 1/188 (1%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSN-LRAGQLIVYCFFgmiag  178
            S LYWV+N LQ+P+++ V L+EA  L  G R I+SKG   ++ ++  ++ +YC  G+IAG
Sbjct  281  SILYWVLNSLQVPIAISVTLYEAICLCNGTRVIASKGKENTDWMKLHKICLYCSCGIIAG  340

Query  179  vvggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalf  358
            +V GLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+FSSSMSVV+YYLL+RFPVPYA +
Sbjct  341  IVSGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSVVQYYLLERFPVPYASY  400

Query  359  ltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHE  538
               VAT+AA  GQHVVR++IA+ GRAS+IIF+LAFTIF+SAISLGGVGI NM+EK+ N+E
Sbjct  401  FILVATIAALTGQHVVRKIIAIFGRASIIIFVLAFTIFLSAISLGGVGIENMVEKMENNE  460

Query  539  YMGFENLC  562
            YMGF N+C
Sbjct  461  YMGFANIC  468



>ref|XP_003523605.1| PREDICTED: uncharacterized protein LOC100816633 [Glycine max]
 gb|KHN04486.1| hypothetical protein glysoja_019573 [Glycine soja]
Length=474

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 158/188 (84%), Gaps = 1/188 (1%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSN-LRAGQLIVYCFFgmiag  178
            S LYWV+N LQ+P+++ V L+EA  L  G R I+SKG   ++ ++  ++ +YC  G+IAG
Sbjct  286  SILYWVLNSLQVPIAISVTLYEAICLCNGTRVIASKGKENTDWMKLHKICLYCSCGIIAG  345

Query  179  vvggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalf  358
            +V GLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+FSSSMSVV+YYLL+RFPVPYA +
Sbjct  346  IVSGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSVVQYYLLERFPVPYASY  405

Query  359  ltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHE  538
               VAT+AA  GQHVVR++IA+ GRAS+IIF+LAFTIF+SAISLGGVGI NM+EK+ N+E
Sbjct  406  FILVATIAALTGQHVVRKIIAIFGRASIIIFVLAFTIFLSAISLGGVGIENMVEKMENNE  465

Query  539  YMGFENLC  562
            YMGF N+C
Sbjct  466  YMGFANIC  473



>gb|KHN06458.1| hypothetical protein glysoja_010802 [Glycine soja]
Length=469

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 157/189 (83%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S L+W++NLLQ+P+++G++ +EA  LYKG R I+SKGD  S+    QL+++C  G +AG+
Sbjct  279  SRLFWLLNLLQVPIAVGMSSYEAVRLYKGKRIIASKGDQQSHWCVFQLVLFCACGTLAGM  338

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            + GLLGLGGGFI+GPLFL LG+PPQV+SAT+T  M FS+SM+VVEYYLLKRFPVPYAL+ 
Sbjct  339  IAGLLGLGGGFILGPLFLGLGIPPQVASATSTLVMAFSASMAVVEYYLLKRFPVPYALYF  398

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             A+AT AA +GQH+VR+ IA+LGRAS+IIFIL+ T+ VSA+ LGGVGI++MI+KI N EY
Sbjct  399  VAIATAAALVGQHLVRKAIAILGRASVIIFILSLTLSVSAVLLGGVGIAHMIQKIENKEY  458

Query  542  MGFENLCKY  568
            MGF +LC Y
Sbjct  459  MGFGDLCTY  467



>ref|XP_007159525.1| hypothetical protein PHAVU_002G244800g [Phaseolus vulgaris]
 gb|ESW31519.1| hypothetical protein PHAVU_002G244800g [Phaseolus vulgaris]
Length=347

 Score =   162 bits (409),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 156/193 (81%), Gaps = 0/193 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW +NL+Q+P+++G++ ++A  LYKG R I+SKGD  ++ R  QLI++C  G +AG 
Sbjct  155  SEAYWALNLIQVPIAVGMSSYQAVRLYKGQRVIASKGDQQTHWRVWQLILFCGCGTLAGT  214

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            + GLLGLGGGFI+ PLFL +G+PPQV+SAT+  AM FS+SM+ VEYYLLKRFPV YAL+L
Sbjct  215  IAGLLGLGGGFILAPLFLGIGIPPQVASATSILAMAFSASMAAVEYYLLKRFPVRYALYL  274

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVAT A+ +GQH+VR+++AVLGRAS+IIFIL FT+ VSA+ LGGVG+S+MI+KI + EY
Sbjct  275  VAVATAASLVGQHLVRKMVAVLGRASVIIFILTFTLSVSAVLLGGVGVSHMIQKIEHKEY  334

Query  542  MGFENLCKYGV*N  580
            MGF NLC Y V N
Sbjct  335  MGFGNLCMYKVKN  347



>ref|XP_007159526.1| hypothetical protein PHAVU_002G244900g [Phaseolus vulgaris]
 gb|ESW31520.1| hypothetical protein PHAVU_002G244900g [Phaseolus vulgaris]
Length=464

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 157/191 (82%), Gaps = 0/191 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S LYW++NLLQ+P+++G++ +EA  LYKG R I+SKGD  ++    QL+++C  G +AG+
Sbjct  272  SRLYWLMNLLQVPLAVGMSSYEAVRLYKGKRIIASKGDQQTHFCVLQLVLFCACGTLAGM  331

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            + GLLGLGGGFI+GPLFL LG+PPQV+SAT+T  M FS+SM+VVEYYLLKRFPVPYA++ 
Sbjct  332  IAGLLGLGGGFILGPLFLGLGIPPQVASATSTLVMAFSASMAVVEYYLLKRFPVPYAIYF  391

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             ++AT AA +GQH+VR+ IA+LGRAS+IIFIL FT+ VSA+ LGGVG+ +MI+KI + EY
Sbjct  392  VSIATAAALVGQHLVRKAIAILGRASVIIFILTFTLSVSAVLLGGVGVVHMIQKIEHQEY  451

Query  542  MGFENLCKYGV  574
            MGF +LC Y V
Sbjct  452  MGFGDLCTYKV  462



>gb|KHN48050.1| hypothetical protein glysoja_015520 [Glycine soja]
Length=465

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 156/191 (82%), Gaps = 0/191 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S +YWV+NLLQ+P+++G++ ++A  LYKG R I SKGD  +N R  QLI++C  G++AG 
Sbjct  273  SGVYWVINLLQVPIAVGMSSYQAMRLYKGQRIIGSKGDQQTNWRVLQLILFCACGILAGT  332

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            + GLLGLGGGFI+ PLFL +G+PPQV+SAT+  AM FS+SM+VVEYYLLKRFP+ YAL+ 
Sbjct  333  IAGLLGLGGGFILAPLFLGIGIPPQVASATSILAMAFSASMAVVEYYLLKRFPISYALYF  392

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVAT AA +GQH+VR++IA+LGRAS+IIFIL  T+ VSA+ LGGVG++NMI++I N EY
Sbjct  393  VAVATAAALVGQHLVRKVIAILGRASVIIFILTLTLCVSAVLLGGVGVANMIKRIENKEY  452

Query  542  MGFENLCKYGV  574
            MGF NLC Y V
Sbjct  453  MGFGNLCTYKV  463



>gb|AET03944.2| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=473

 Score =   164 bits (415),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 156/187 (83%), Gaps = 1/187 (1%)
 Frame = +2

Query  11   YWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvgg  190
            YW++N LQ+P+++ V LFEA  L KG R I+S+G      +  ++ +YCF G+IAG+V G
Sbjct  283  YWLLNSLQVPIAISVTLFEAICLCKGTRVIASRGKE-ITWKFHKICLYCFCGIIAGMVSG  341

Query  191  llglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltav  370
            LLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+FSSSMSVV+YY L RFP+PYA +L  V
Sbjct  342  LLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSVVQYYHLDRFPIPYASYLVLV  401

Query  371  atvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGF  550
            AT+AA  GQHVVR++IA+ GRAS+I+FILAFTIFVSAISLGGVGI NM+EK+ N EYMGF
Sbjct  402  ATIAALTGQHVVRKIIAIFGRASIIVFILAFTIFVSAISLGGVGIGNMVEKMENEEYMGF  461

Query  551  ENLCKYG  571
            +NLC +G
Sbjct  462  DNLCHHG  468



>ref|XP_003629468.1| hypothetical protein MTR_8g077830 [Medicago truncatula]
Length=480

 Score =   164 bits (415),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 158/190 (83%), Gaps = 1/190 (1%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++N LQ+P+++ V LFEA  L KG R I+S+G   +  +  ++ +YCF G+IAG+
Sbjct  287  SIEYWLLNSLQVPIAISVTLFEAICLCKGTRVIASRGKEIT-WKFHKICLYCFCGIIAGM  345

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            V GLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+FSSSMSVV+YY L RFP+PYA +L
Sbjct  346  VSGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSVVQYYHLDRFPIPYASYL  405

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AA  GQHVVR++IA+ GRAS+I+FILAFTIFVSAISLGGVGI NM+EK+ N EY
Sbjct  406  VLVATIAALTGQHVVRKIIAIFGRASIIVFILAFTIFVSAISLGGVGIGNMVEKMENEEY  465

Query  542  MGFENLCKYG  571
            MGF+NLC +G
Sbjct  466  MGFDNLCHHG  475



>ref|XP_003532779.1| PREDICTED: uncharacterized protein LOC100801788 [Glycine max]
 gb|KHN48051.1| hypothetical protein glysoja_015521 [Glycine soja]
Length=469

 Score =   164 bits (414),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 155/189 (82%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S LYW+ NLLQ+P+++G++ +EA  LYKG R I+SKGD  ++    QL+++C  G +AG+
Sbjct  279  SRLYWLSNLLQVPIAVGMSSYEAVRLYKGKRIIASKGDKQTHWCVLQLVLFCACGTLAGM  338

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            + GLLGLGGGFI+GPLFL LG+PPQV+SAT+T  M FS+SM+VVEYYLLKRFPVPYAL+ 
Sbjct  339  IAGLLGLGGGFILGPLFLGLGIPPQVASATSTLVMAFSASMAVVEYYLLKRFPVPYALYF  398

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             A+AT AA +GQH+VR+ IA+LGRAS+IIFIL  T+ VSA+ LGGVGI++MI+KI N EY
Sbjct  399  VAIATAAALVGQHLVRKAIAILGRASVIIFILTLTLSVSAVLLGGVGIAHMIQKIENKEY  458

Query  542  MGFENLCKY  568
            MGF +LC Y
Sbjct  459  MGFGDLCTY  467



>gb|AFK35007.1| unknown [Medicago truncatula]
Length=473

 Score =   163 bits (413),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 157/190 (83%), Gaps = 1/190 (1%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YW++N LQ+P+++ V LFEA  L KG R I+S+G      +  ++ +YCF G+IAG+
Sbjct  280  SIEYWLLNSLQVPIAISVTLFEAICLCKGTRVIASRGKE-ITWKFHKICLYCFCGIIAGM  338

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            V GLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+FSSSMSVV+YY L RFP+PYA +L
Sbjct  339  VSGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSVVQYYHLDRFPIPYASYL  398

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AA  GQHVVR++IA+ GRAS+I+FILAFTIFVSAISLGGVGI NM+EK+ N EY
Sbjct  399  VLVATIAALTGQHVVRKIIAIFGRASIIVFILAFTIFVSAISLGGVGIGNMVEKMENAEY  458

Query  542  MGFENLCKYG  571
            MGF+NLC +G
Sbjct  459  MGFDNLCHHG  468



>ref|XP_006580197.1| PREDICTED: uncharacterized protein LOC100818778 [Glycine max]
Length=469

 Score =   163 bits (413),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 156/189 (83%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S L+W++NLLQ+P+++G++ +EA  LYKG R I+SKGD  ++    QL+++C  G +AG+
Sbjct  279  SRLFWLLNLLQVPIAVGMSSYEAVRLYKGKRIIASKGDQQTHWCVLQLVLFCACGTLAGM  338

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            + GLLGLGGGFI+GPLFL LG+PPQV+SAT+T  M FS+SM+VVEYYLLKRFPVPYAL+ 
Sbjct  339  IAGLLGLGGGFILGPLFLGLGIPPQVASATSTLVMAFSASMAVVEYYLLKRFPVPYALYF  398

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             A+AT AA +GQH+VR+ IA+LGRAS+IIFIL  T+ VSA+ LGGVGI++MI+KI N EY
Sbjct  399  VAIATAAALVGQHLVRKAIAILGRASVIIFILTLTLSVSAVLLGGVGIAHMIQKIENKEY  458

Query  542  MGFENLCKY  568
            MGF +LC Y
Sbjct  459  MGFGDLCTY  467



>ref|XP_010649158.1| PREDICTED: uncharacterized protein LOC100253061 [Vitis vinifera]
 emb|CBI17534.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   163 bits (413),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+N LQ+P++  V+++EA  LYKG R I+SKG   +N +  Q+ +YC  G++AG+
Sbjct  292  SIEYWVLNCLQVPIAASVSIYEAVCLYKGTRVIASKGKEVTNWKIHQIFLYCSCGIVAGL  351

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TF+M FSSSMSVV+Y+LL+RFPVPYA + 
Sbjct  352  VGGLLGLGGGFILGPLFLELGIPPQVASATSTFSMAFSSSMSVVQYHLLRRFPVPYASYF  411

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
              VAT+AA +GQHVVR++I ++GRAS+IIFILA TIF+SAISLGGVGI  M+EK+ N+EY
Sbjct  412  VLVATIAALVGQHVVRKVIKLVGRASIIIFILALTIFISAISLGGVGIMTMVEKLANNEY  471

Query  542  MGFENLC  562
            MGF++LC
Sbjct  472  MGFDDLC  478



>gb|EMS53169.1| hypothetical protein TRIUR3_09961 [Triticum urartu]
Length=709

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 137/226 (61%), Positives = 162/226 (72%), Gaps = 37/226 (16%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S  YWV+NLLQIPVS GVA++EA GL +G R ISSK +  ++LRA QL+VYCF G+ AGV
Sbjct  482  SIWYWVLNLLQIPVSAGVAMYEAVGLVQGRRVISSKRNEQNSLRAHQLLVYCFLGVTAGV  541

Query  182  vggllglgggfimgplflELGVPPQV----------------------------------  259
            V GLLG+GGG IMGPLFLELGVPPQV                                  
Sbjct  542  VAGLLGVGGGSIMGPLFLELGVPPQVIISLFAHVKNFMFPSWFLLSIYHMFSKCLHSVER  601

Query  260  ---ssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLG  430
               +SATATFAMMFSSSMSV+EYYLL RFPVPYA++LT +A  +A +GQ VVR+LI +LG
Sbjct  602  PQVASATATFAMMFSSSMSVMEYYLLNRFPVPYAVYLTILAFFSAIVGQRVVRKLIDLLG  661

Query  431  RASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  568
            RAS+I+FIL+F IF+SA+SLGGVGISN I KI  HEYMGFEN+CKY
Sbjct  662  RASIIVFILSFMIFISALSLGGVGISNTIHKIARHEYMGFENICKY  707



>ref|XP_009784625.1| PREDICTED: uncharacterized protein LOC104233015 isoform X2 [Nicotiana 
sylvestris]
Length=373

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            ST YW++NLLQ+PV++G + +EA  LYKG R + S G++    +  QLI+YC  G++AG+
Sbjct  183  STTYWILNLLQVPVAVGASAYEAVCLYKGTRVVMSSGEAVITWKVHQLILYCCCGILAGI  242

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            VGGLLGLGGGFI+GPLFLELG+PPQVSSATATF M+FSSSMS ++YYLL+RFPVPYAL+ 
Sbjct  243  VGGLLGLGGGFILGPLFLELGIPPQVSSATATFVMIFSSSMSAIQYYLLRRFPVPYALYF  302

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVATVAA +GQHVVR++I+++GRAS+IIF+LAFTIFVSA++LGG GI++ I +I   +Y
Sbjct  303  VAVATVAALVGQHVVRKIISIVGRASVIIFVLAFTIFVSALTLGGFGIADTIRRIKEGQY  362

Query  542  MGFENLCKYG  571
            MGF+N+C Y 
Sbjct  363  MGFDNICAYS  372



>ref|XP_006585193.1| PREDICTED: uncharacterized protein LOC100802321 [Glycine max]
Length=473

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 157/193 (81%), Gaps = 3/193 (2%)
 Frame = +2

Query  2    STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  181
            S LYW +NLLQ+P+++G  ++EA  LYKG RKI+SKGD  +  R  QLI+YC  G+IAG+
Sbjct  284  SALYWALNLLQVPITVGTTVYEAVLLYKGKRKIASKGDQQTRWRVHQLILYCTCGIIAGI  343

Query  182  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  361
            +GGLLGLGGGFI+GPLF+ LG+ PQVSSAT+TFAM FS+SMSVVEYYLLKRFP+PYAL+ 
Sbjct  344  IGGLLGLGGGFILGPLFIGLGIHPQVSSATSTFAMTFSASMSVVEYYLLKRFPIPYALYF  403

Query  362  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  541
             AVAT AA +GQH+VR++IA+LGR SLIIFILA T+FVS ISLGGVGI+ +IEK      
Sbjct  404  VAVATAAALVGQHLVRKVIAILGRTSLIIFILALTVFVSGISLGGVGIAKLIEK---KVQ  460

Query  542  MGFENLCKYGV*N  580
            M FENLC Y V N
Sbjct  461  MKFENLCSYRVRN  473



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250