BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS025H09

Length=616
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU19497.1|  hypothetical protein MIMGU_mgv1a002250mg              90.9    2e-17   Erythranthe guttata [common monkey flower]
ref|XP_003536498.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  90.1    3e-17   Glycine max [soybeans]
gb|KHN02770.1|  DEAD-box ATP-dependent RNA helicase 7                 90.1    3e-17   Glycine soja [wild soybean]
gb|KHN15708.1|  DEAD-box ATP-dependent RNA helicase 7                 89.4    6e-17   Glycine soja [wild soybean]
ref|XP_003556075.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  89.4    7e-17   Glycine max [soybeans]
tpg|DAA40575.1|  TPA: putative DEAD-box ATP-dependent RNA helicas...  87.8    2e-16   
ref|XP_008670328.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  87.8    2e-16   Zea mays [maize]
gb|EPS64456.1|  hypothetical protein M569_10323                       87.4    3e-16   Genlisea aurea
gb|EYU25021.1|  hypothetical protein MIMGU_mgv1a027128mg              87.0    3e-16   Erythranthe guttata [common monkey flower]
ref|XP_006357902.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  87.0    3e-16   Solanum tuberosum [potatoes]
ref|XP_004240751.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  86.7    4e-16   Solanum lycopersicum
ref|XP_009587639.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  86.7    5e-16   Nicotiana tomentosiformis
ref|XP_009767597.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  86.7    6e-16   Nicotiana sylvestris
ref|XP_003578458.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  85.5    1e-15   Brachypodium distachyon [annual false brome]
gb|EAZ09787.1|  hypothetical protein OsI_32075                        85.5    1e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_004957391.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  85.5    1e-15   Setaria italica
ref|XP_006660856.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  85.5    1e-15   Oryza brachyantha
ref|XP_011076505.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  85.9    1e-15   
ref|XP_002460541.1|  hypothetical protein SORBIDRAFT_02g030210        85.1    2e-15   Sorghum bicolor [broomcorn]
gb|KDO65345.1|  hypothetical protein CISIN_1g005470mg                 84.3    2e-15   Citrus sinensis [apfelsine]
ref|XP_002866477.1|  hypothetical protein ARALYDRAFT_496396           84.7    2e-15   Arabidopsis lyrata subsp. lyrata
gb|KDO65346.1|  hypothetical protein CISIN_1g005470mg                 84.3    2e-15   Citrus sinensis [apfelsine]
ref|XP_011101144.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  84.7    2e-15   Sesamum indicum [beniseed]
gb|KDO65344.1|  hypothetical protein CISIN_1g005470mg                 84.3    3e-15   Citrus sinensis [apfelsine]
gb|KDO65342.1|  hypothetical protein CISIN_1g005470mg                 84.3    3e-15   Citrus sinensis [apfelsine]
ref|XP_006421777.1|  hypothetical protein CICLE_v10004459mg           84.3    3e-15   Citrus clementina [clementine]
ref|XP_002269873.2|  PREDICTED: DEAD-box ATP-dependent RNA helica...  84.3    3e-15   Vitis vinifera
ref|XP_010275981.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  84.3    3e-15   Nelumbo nucifera [Indian lotus]
gb|ACF80743.1|  unknown                                               83.6    4e-15   Zea mays [maize]
gb|KJB39372.1|  hypothetical protein B456_007G009400                  83.6    5e-15   Gossypium raimondii
gb|KJB39373.1|  hypothetical protein B456_007G009400                  83.2    5e-15   Gossypium raimondii
ref|XP_008652955.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  83.6    5e-15   Zea mays [maize]
gb|KJB39371.1|  hypothetical protein B456_007G009400                  83.2    5e-15   Gossypium raimondii
gb|KJB39369.1|  hypothetical protein B456_007G009400                  83.2    7e-15   Gossypium raimondii
gb|KJB39370.1|  hypothetical protein B456_007G009400                  83.2    7e-15   Gossypium raimondii
ref|XP_008652954.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  83.2    7e-15   
ref|XP_008652953.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  83.2    7e-15   Zea mays [maize]
gb|KHG06829.1|  DEAD-box ATP-dependent RNA helicase 7                 83.2    7e-15   Gossypium arboreum [tree cotton]
gb|KHG06828.1|  DEAD-box ATP-dependent RNA helicase 7                 83.2    8e-15   Gossypium arboreum [tree cotton]
ref|XP_010940916.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  82.8    9e-15   Elaeis guineensis
ref|XP_004506292.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  82.8    1e-14   Cicer arietinum [garbanzo]
ref|XP_006394423.1|  hypothetical protein EUTSA_v10003756mg           82.8    1e-14   Eutrema salsugineum [saltwater cress]
emb|CDP05280.1|  unnamed protein product                              82.4    1e-14   Coffea canephora [robusta coffee]
ref|XP_004496645.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  82.0    2e-14   
ref|NP_001063702.1|  Os09g0520700                                     82.0    2e-14   
ref|XP_001764376.1|  predicted protein                                82.0    2e-14   
ref|XP_002318863.2|  DEAD box RNA helicase family protein             82.0    2e-14   
ref|XP_011030003.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  82.0    2e-14   Populus euphratica
ref|XP_004496646.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  82.0    2e-14   Cicer arietinum [garbanzo]
gb|EAZ45398.1|  hypothetical protein OsJ_30047                        82.0    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004308148.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  82.0    2e-14   Fragaria vesca subsp. vesca
sp|Q41382.1|RH7_SPIOL  RecName: Full=DEAD-box ATP-dependent RNA h...  81.6    2e-14   Spinacia oleracea
ref|XP_007038495.1|  DEAD-box ATP-dependent RNA helicase 7            81.6    4e-14   
ref|XP_009407947.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  80.9    4e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007143335.1|  hypothetical protein PHAVU_007G063700g           80.9    4e-14   Phaseolus vulgaris [French bean]
ref|XP_010109082.1|  DEAD-box ATP-dependent RNA helicase 7            80.9    5e-14   Morus notabilis
ref|XP_009628541.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  80.9    5e-14   Nicotiana tomentosiformis
ref|XP_009628542.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  80.5    5e-14   
ref|XP_002510890.1|  dead box ATP-dependent RNA helicase, putative    80.5    5e-14   Ricinus communis
gb|KDP22369.1|  hypothetical protein JCGZ_26200                       80.5    6e-14   Jatropha curcas
ref|XP_009781160.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  80.1    8e-14   Nicotiana sylvestris
ref|XP_008812489.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  80.1    8e-14   Phoenix dactylifera
ref|XP_009343503.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  80.1    8e-14   Pyrus x bretschneideri [bai li]
ref|XP_009349718.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  80.1    9e-14   Pyrus x bretschneideri [bai li]
gb|KFK27951.1|  hypothetical protein AALP_AA8G452500                  79.7    9e-14   Arabis alpina [alpine rockcress]
ref|NP_201025.1|  DEAD/DEAH box RNA helicase PRH75                    79.7    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008234340.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  79.7    1e-13   Prunus mume [ume]
emb|CAA68194.1|  RNA helicase                                         79.7    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007220217.1|  hypothetical protein PRUPE_ppa002304mg           79.7    1e-13   Prunus persica
ref|XP_008376504.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  79.7    1e-13   Malus domestica [apple tree]
ref|XP_003592391.1|  DEAD-box ATP-dependent RNA helicase              79.3    1e-13   Medicago truncatula
ref|XP_009398738.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  79.7    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006348047.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  79.7    1e-13   Solanum tuberosum [potatoes]
ref|XP_008467258.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  79.3    1e-13   Cucumis melo [Oriental melon]
ref|XP_004234150.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  79.3    1e-13   Solanum lycopersicum
ref|XP_006858006.1|  hypothetical protein AMTR_s00069p00191130        79.0    2e-13   Amborella trichopoda
ref|XP_009130201.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  78.6    2e-13   Brassica rapa
ref|XP_010934579.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  78.6    2e-13   Elaeis guineensis
gb|AAF40306.1|AF156667_1  RNA helicase                                78.6    3e-13   Vigna radiata [mung bean]
ref|XP_010483921.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  78.2    3e-13   Camelina sativa [gold-of-pleasure]
gb|EMT03655.1|  DEAD-box ATP-dependent RNA helicase 7                 78.2    3e-13   
ref|XP_010444062.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  78.2    3e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010458375.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  78.2    3e-13   Camelina sativa [gold-of-pleasure]
gb|KJB52899.1|  hypothetical protein B456_008G282800                  78.2    3e-13   Gossypium raimondii
gb|KJB52898.1|  hypothetical protein B456_008G282800                  78.2    4e-13   Gossypium raimondii
ref|XP_002322430.2|  DEAD box RNA helicase family protein             78.2    4e-13   Populus trichocarpa [western balsam poplar]
ref|XP_008364874.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  77.8    4e-13   
ref|XP_010034995.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  77.8    4e-13   Eucalyptus grandis [rose gum]
ref|XP_011041667.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  77.8    4e-13   Populus euphratica
gb|KEH26427.1|  DEAD-box ATP-dependent RNA helicase                   77.8    4e-13   Medicago truncatula
gb|AAK62631.1|  AT5g62190/mmi9_10                                     77.8    5e-13   Arabidopsis thaliana [mouse-ear cress]
emb|CDX87236.1|  BnaC09g05510D                                        77.0    7e-13   
ref|XP_009112011.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...  77.0    7e-13   Brassica rapa
emb|CDY16789.1|  BnaA09g05930D                                        77.0    7e-13   Brassica napus [oilseed rape]
ref|XP_009345013.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  77.0    9e-13   
ref|XP_010693660.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  77.0    9e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006279587.1|  hypothetical protein CARUB_v10026032mg           75.9    2e-12   Capsella rubella
ref|XP_004172086.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  75.9    2e-12   
ref|XP_004143712.1|  PREDICTED: uncharacterized protein LOC101209696  75.9    3e-12   
ref|XP_010555319.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  73.2    1e-11   Tarenaya hassleriana [spider flower]
ref|XP_009346936.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  72.8    2e-11   
ref|XP_002975210.1|  hypothetical protein SELMODRAFT_150370           72.0    3e-11   
ref|XP_002977618.1|  hypothetical protein SELMODRAFT_107027           72.0    3e-11   
ref|XP_005854803.1|  dead deah box rna                                70.9    7e-11   Nannochloropsis gaditana CCMP526
ref|XP_010059508.1|  PREDICTED: nucleolar RNA helicase 2-like         70.1    1e-10   
gb|ETK72184.1|  hypothetical protein L915_20663                       66.2    6e-10   Phytophthora parasitica
gb|EWM21167.1|  dead deah box rna                                     67.8    8e-10   Nannochloropsis gaditana
gb|ETP29814.1|  hypothetical protein F442_21078                       66.6    2e-09   Phytophthora parasitica P10297
ref|XP_008914911.1|  hypothetical protein PPTG_18629                  66.6    2e-09   Phytophthora parasitica INRA-310
gb|ETI31844.1|  hypothetical protein F443_21248                       66.6    2e-09   Phytophthora parasitica P1569
ref|XP_010068038.1|  PREDICTED: acetyl-coenzyme A synthetase, chl...  65.1    4e-09   
ref|XP_002904811.1|  DEAD/DEAH box RNA helicase, putative             65.5    5e-09   Phytophthora infestans T30-4
ref|XP_005645158.1|  DEAD-domain-containing protein                   65.5    5e-09   Coccomyxa subellipsoidea C-169
gb|EMS52016.1|  DEAD-box ATP-dependent RNA helicase 7                 65.1    6e-09   Triticum urartu
ref|XP_011399479.1|  DEAD-box ATP-dependent RNA helicase 7            63.9    1e-08   Auxenochlorella protothecoides
gb|KCW88483.1|  hypothetical protein EUGRSUZ_A00875                   63.2    2e-08   Eucalyptus grandis [rose gum]
ref|XP_005849733.1|  hypothetical protein CHLNCDRAFT_20835            63.2    2e-08   Chlorella variabilis
ref|XP_003058076.1|  predicted protein                                62.8    4e-08   Micromonas pusilla CCMP1545
emb|CEP17128.1|  hypothetical protein                                 62.0    6e-08   Parasitella parasitica
ref|XP_001417262.1|  predicted protein                                61.6    7e-08   Ostreococcus lucimarinus CCE9901
ref|XP_008364905.1|  PREDICTED: uncharacterized protein LOC103428569  59.3    8e-08   
ref|XP_010938270.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  59.7    2e-07   Elaeis guineensis
emb|CDS09503.1|  hypothetical protein LRAMOSA10863                    60.1    2e-07   Lichtheimia ramosa
ref|XP_004300425.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  59.3    3e-07   Fragaria vesca subsp. vesca
dbj|GAN03042.1|  nucleolar RNA helicase 2-like isoform X2             59.7    3e-07   Mucor ambiguus
gb|EPB89647.1|  hypothetical protein HMPREF1544_03579                 59.7    4e-07   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_002507890.1|  predicted protein                                59.3    4e-07   Micromonas commoda
emb|CDH59679.1|  nucleolar rna helicase 2-like                        59.3    5e-07   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_007054740.1|  PREDICTED: nucleolar RNA helicase 2-like         58.9    5e-07   
gb|EMP40574.1|  Nucleolar RNA helicase 2                              58.9    6e-07   Chelonia mydas [green seaturtle]
emb|CEG79803.1|  hypothetical protein RMATCC62417_14224               58.5    7e-07   Rhizopus microsporus
gb|EIE87311.1|  hypothetical protein RO3G_12022                       58.5    7e-07   Rhizopus delemar RA 99-880
ref|XP_009837773.1|  hypothetical protein H257_12310                  58.5    8e-07   Aphanomyces astaci
ref|XP_006630629.1|  PREDICTED: nucleolar RNA helicase 2-like         58.5    8e-07   Lepisosteus oculatus
ref|XP_009496395.1|  hypothetical protein H696_04240                  58.5    8e-07   Fonticula alba
ref|XP_005297367.1|  PREDICTED: nucleolar RNA helicase 2              58.5    9e-07   
emb|CEI86541.1|  hypothetical protein RMCBS344292_00980               58.2    9e-07   Rhizopus microsporus
emb|CEG65973.1|  hypothetical protein RMATCC62417_02639               57.8    1e-06   Rhizopus microsporus
ref|XP_006273547.1|  PREDICTED: nucleolar RNA helicase 2-like         57.8    1e-06   Alligator mississippiensis
ref|XP_003078811.1|  putative RNA helicase (ISS)                      57.8    2e-06   Ostreococcus tauri
ref|NP_001120807.1|  nucleolar RNA helicase 2                         57.0    2e-06   
ref|XP_006125341.1|  PREDICTED: nucleolar RNA helicase 2              57.0    3e-06   
ref|XP_010789411.1|  PREDICTED: nucleolar RNA helicase 2-like         55.8    4e-06   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_007512398.1|  predicted protein                                56.2    5e-06   Bathycoccus prasinos
ref|XP_008873274.1|  hypothetical protein H310_09087                  56.2    5e-06   Aphanomyces invadans
ref|XP_005815128.1|  PREDICTED: nucleolar RNA helicase 2-like         55.8    6e-06   Xiphophorus maculatus
ref|XP_007549868.1|  PREDICTED: nucleolar RNA helicase 2-like         55.8    6e-06   Poecilia formosa
ref|XP_002502509.1|  DEAD/DEAH box RNA helicase                       55.8    6e-06   Micromonas commoda
ref|XP_005733301.1|  PREDICTED: nucleolar RNA helicase 2-like         55.5    8e-06   Pundamilia nyererei
ref|XP_005467227.1|  PREDICTED: nucleolar RNA helicase 2-like         55.5    8e-06   
ref|XP_006023203.1|  PREDICTED: nucleolar RNA helicase 2-like         55.5    8e-06   
ref|XP_010887236.1|  PREDICTED: nucleolar RNA helicase 2-like         55.5    9e-06   Esox lucius
ref|XP_005915179.1|  PREDICTED: nucleolar RNA helicase 2-like         55.5    9e-06   Haplochromis burtoni
ref|XP_004539930.1|  PREDICTED: nucleolar RNA helicase 2-like         55.5    9e-06   
ref|XP_008290699.1|  PREDICTED: nucleolar RNA helicase 2-like         55.1    1e-05   Stegastes partitus
ref|XP_003056927.1|  DEAD/DEAH box RNA helicase                       55.1    1e-05   Micromonas pusilla CCMP1545
emb|CBK20101.2|  unnamed protein product                              55.1    1e-05   Blastocystis hominis
ref|XP_002112077.1|  hypothetical protein TRIADDRAFT_55752            55.1    1e-05   Trichoplax adhaerens
ref|XP_006780037.1|  PREDICTED: nucleolar RNA helicase 2-like         55.1    1e-05   Neolamprologus brichardi [lyretail cichlid]
ref|XP_007253243.1|  PREDICTED: nucleolar RNA helicase 2-like iso...  54.7    1e-05   
ref|XP_007253242.1|  PREDICTED: nucleolar RNA helicase 2-like iso...  54.7    2e-05   
emb|CEI94647.1|  hypothetical protein RMCBS344292_08852               54.7    2e-05   Rhizopus microsporus
emb|CDQ75565.1|  unnamed protein product                              54.3    2e-05   Oncorhynchus mykiss
gb|ACH85363.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 21             54.3    2e-05   Salmo salar
ref|XP_010753600.1|  PREDICTED: nucleolar RNA helicase 2-like iso...  54.3    2e-05   
ref|XP_009520796.1|  hypothetical protein PHYSODRAFT_326516           54.3    2e-05   Phytophthora sojae
ref|XP_003976441.1|  PREDICTED: nucleolar RNA helicase 2-like         53.9    3e-05   
ref|XP_005838835.1|  hypothetical protein GUITHDRAFT_102470           53.5    3e-05   Guillardia theta CCMP2712
ref|XP_006820781.1|  PREDICTED: nucleolar RNA helicase 2-like iso...  53.5    3e-05   Saccoglossus kowalevskii
ref|XP_002738237.2|  PREDICTED: nucleolar RNA helicase 2-like iso...  53.5    3e-05   Saccoglossus kowalevskii
ref|XP_001702450.1|  RNA helicase                                     53.5    4e-05   Chlamydomonas reinhardtii
ref|XP_002163120.1|  PREDICTED: nucleolar RNA helicase 2-like         50.1    4e-05   Hydra vulgaris
ref|XP_009309382.1|  putative nucleolar RNA helicase II               53.1    5e-05   Trypanosoma grayi
ref|XP_004067286.1|  PREDICTED: nucleolar RNA helicase 2-like iso...  52.8    6e-05   
ref|XP_011490446.1|  PREDICTED: nucleolar RNA helicase 2-like iso...  52.8    6e-05   
ref|XP_002913778.1|  PREDICTED: nucleolar RNA helicase 2              52.8    7e-05   Ailuropoda melanoleuca
gb|EFB22545.1|  hypothetical protein PANDA_001614                     52.8    7e-05   Ailuropoda melanoleuca
ref|XP_006406182.1|  hypothetical protein EUTSA_v10020290mg           52.4    8e-05   Eutrema salsugineum [saltwater cress]
emb|CDY46329.1|  BnaC01g31630D                                        52.4    9e-05   Brassica napus [oilseed rape]
ref|XP_002883355.1|  hypothetical protein ARALYDRAFT_479746           52.0    1e-04   
ref|NP_188872.2|  putative mitochondrial RNA helicase 2               52.0    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011406566.1|  PREDICTED: ATP-dependent RNA helicase DDX50-...  51.6    1e-04   
ref|XP_006297190.1|  hypothetical protein CARUB_v10013195mg           52.0    1e-04   Capsella rubella
ref|XP_005297366.1|  PREDICTED: nucleolar RNA helicase 2-like         52.0    1e-04   Chrysemys picta bellii
ref|XP_009145390.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  52.0    1e-04   Brassica rapa
emb|CDY10634.1|  BnaA05g17280D                                        51.6    1e-04   Brassica napus [oilseed rape]
ref|XP_007054739.1|  PREDICTED: nucleolar RNA helicase 2-like         51.6    1e-04   
ref|XP_009993187.1|  PREDICTED: nucleolar RNA helicase 2-like         51.6    1e-04   Chaetura pelagica
ref|XP_010295282.1|  PREDICTED: nucleolar RNA helicase 2-like         51.2    2e-04   Phaethon lepturus
ref|XP_009990339.1|  PREDICTED: nucleolar RNA helicase 2-like         51.2    2e-04   Tauraco erythrolophus
ref|XP_003079318.1|  ATP-dependent RNA helicase (ISS)                 51.2    2e-04   
ref|XP_002955657.1|  hypothetical protein VOLCADRAFT_66087            51.2    2e-04   Volvox carteri f. nagariensis
ref|XP_009674650.1|  PREDICTED: nucleolar RNA helicase 2-like         51.2    2e-04   Struthio camelus australis
ref|XP_010511251.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  51.2    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010488258.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  51.2    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010488257.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  51.2    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010511255.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  51.2    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_008611506.1|  hypothetical protein SDRG_07451                  51.2    2e-04   Saprolegnia diclina VS20
emb|CEF97957.1|  Helicase, C-terminal                                 51.2    2e-04   Ostreococcus tauri
ref|XP_006297246.1|  hypothetical protein CARUB_v10013251mg           51.2    2e-04   Capsella rubella
ref|XP_004334405.1|  DEAD/DEAH box helicase domain containing pro...  51.2    2e-04   Acanthamoeba castellanii str. Neff
gb|KDO19871.1|  hypothetical protein SPRG_14901                       50.8    2e-04   Saprolegnia parasitica CBS 223.65
ref|XP_010488255.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  50.8    3e-04   
ref|XP_010488254.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  50.8    3e-04   Camelina sativa [gold-of-pleasure]
gb|KFK39521.1|  hypothetical protein AALP_AA3G255300                  50.8    3e-04   Arabis alpina [alpine rockcress]
ref|XP_009865080.1|  PREDICTED: nucleolar RNA helicase 2-like         50.8    3e-04   Apaloderma vittatum
ref|XP_005009180.1|  PREDICTED: nucleolar RNA helicase 2              50.8    3e-04   
ref|XP_009108947.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  50.4    3e-04   Brassica rapa
gb|EOB09008.1|  Nucleolar RNA helicase 2                              50.4    3e-04   Anas platyrhynchos [duck]
gb|KFH66922.1|  hypothetical protein MVEG_07447                       50.4    3e-04   Mortierella verticillata NRRL 6337
ref|XP_009919521.1|  PREDICTED: nucleolar RNA helicase 2-like         50.1    3e-04   Haliaeetus albicilla
gb|EDL92964.1|  rCG22008, isoform CRA_a                               50.1    4e-04   Rattus norvegicus [brown rat]
ref|XP_010158185.1|  PREDICTED: nucleolar RNA helicase 2-like         50.4    4e-04   Eurypyga helias
ref|XP_009487807.1|  PREDICTED: nucleolar RNA helicase 2-like         50.4    4e-04   Pelecanus crispus
ref|XP_008943828.1|  PREDICTED: nucleolar RNA helicase 2-like         50.4    4e-04   Merops nubicus
ref|XP_004386445.1|  PREDICTED: nucleolar RNA helicase 2              50.4    4e-04   Trichechus manatus latirostris
ref|XP_009892319.1|  PREDICTED: nucleolar RNA helicase 2-like         50.4    4e-04   Charadrius vociferus
gb|ERE87186.1|  nucleolar RNA helicase 2-like protein                 50.4    4e-04   Cricetulus griseus [Chinese hamsters]
ref|XP_010164383.1|  PREDICTED: nucleolar RNA helicase 2-like         50.1    5e-04   
gb|EPY22928.1|  nucleolar RNA helicase II                             50.1    5e-04   Strigomonas culicis
ref|XP_845112.1|  nucleolar RNA helicase II                           50.1    5e-04   Trypanosoma brucei brucei TREU927
ref|XP_003409350.1|  PREDICTED: nucleolar RNA helicase 2              50.1    5e-04   Loxodonta africana [African bush elephant]
ref|NP_188870.1|  DEAD-box ATP-dependent RNA helicase                 50.1    5e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466510.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  50.1    5e-04   Camelina sativa [gold-of-pleasure]
ref|XP_001519340.2|  PREDICTED: nucleolar RNA helicase 2              50.1    5e-04   
ref|XP_005235246.1|  PREDICTED: nucleolar RNA helicase 2-like         50.1    5e-04   Falco peregrinus [peregrine]
emb|CCA17723.1|  DEAD/DEAH box RNA helicase putative                  50.1    5e-04   Albugo laibachii Nc14
ref|XP_009814524.1|  PREDICTED: nucleolar RNA helicase 2-like         50.1    5e-04   Gavia stellata
ref|XP_005433605.1|  PREDICTED: nucleolar RNA helicase 2-like         50.1    5e-04   
ref|XP_009635263.1|  PREDICTED: nucleolar RNA helicase 2-like         50.1    6e-04   Egretta garzetta
gb|EGV93789.1|  Nucleolar RNA helicase 2                              50.1    6e-04   Cricetulus griseus [Chinese hamsters]
ref|XP_007638831.1|  PREDICTED: nucleolar RNA helicase 2              50.1    6e-04   Cricetulus griseus [Chinese hamsters]
ref|XP_002130533.1|  PREDICTED: nucleolar RNA helicase 2              50.1    6e-04   Ciona intestinalis [sea vase]
ref|XP_006889064.1|  PREDICTED: nucleolar RNA helicase 2              50.1    6e-04   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_010197456.1|  PREDICTED: nucleolar RNA helicase 2-like         49.7    6e-04   Colius striatus
ref|XP_009288813.1|  PREDICTED: nucleolar RNA helicase 2-like         49.7    6e-04   
ref|XP_009324263.1|  PREDICTED: nucleolar RNA helicase 2-like         49.7    6e-04   Pygoscelis adeliae
ref|XP_002461445.1|  hypothetical protein SORBIDRAFT_02g002790        49.7    7e-04   Sorghum bicolor [broomcorn]
ref|XP_010153144.1|  PREDICTED: nucleolar RNA helicase 2-like         49.7    7e-04   Eurypyga helias
ref|XP_005153742.1|  PREDICTED: nucleolar RNA helicase 2-like         49.7    7e-04   Melopsittacus undulatus
ref|XP_010297376.1|  PREDICTED: nucleolar RNA helicase 2-like         49.7    7e-04   Balearica regulorum gibbericeps
ref|XP_006972790.1|  PREDICTED: nucleolar RNA helicase 2              49.7    7e-04   Peromyscus maniculatus bairdii
ref|XP_010578315.1|  PREDICTED: nucleolar RNA helicase 2-like         49.7    7e-04   Haliaeetus leucocephalus
ref|XP_010466515.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  49.7    7e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010466514.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  49.7    7e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010466512.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  49.7    7e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010011653.1|  PREDICTED: nucleolar RNA helicase 2-like         49.7    7e-04   Nestor notabilis
ref|XP_009949129.1|  PREDICTED: nucleolar RNA helicase 2-like         49.7    7e-04   Leptosomus discolor
ref|XP_009905459.1|  PREDICTED: nucleolar RNA helicase 2-like         49.7    8e-04   Picoides pubescens
ref|XP_004624414.1|  PREDICTED: nucleolar RNA helicase 2              49.7    8e-04   
ref|XP_008694185.1|  PREDICTED: nucleolar RNA helicase 2              49.7    8e-04   Ursus maritimus [white bear]
ref|XP_010168437.1|  PREDICTED: nucleolar RNA helicase 2-like         49.7    8e-04   Antrostomus carolinensis
ref|XP_010511242.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  49.7    8e-04   Camelina sativa [gold-of-pleasure]
ref|XP_002883354.1|  hypothetical protein ARALYDRAFT_479744           49.7    8e-04   
gb|EPY83760.1|  hypothetical protein CB1_000533042                    49.7    8e-04   Camelus ferus
ref|XP_008830862.1|  PREDICTED: nucleolar RNA helicase 2              49.7    8e-04   Nannospalax galili
ref|XP_009703721.1|  PREDICTED: nucleolar RNA helicase 2-like         49.3    8e-04   Cariama cristata
ref|XP_005005365.1|  PREDICTED: nucleolar RNA helicase 2              49.7    8e-04   Cavia porcellus [guinea pig]
ref|XP_007423216.1|  PREDICTED: nucleolar RNA helicase 2              49.3    8e-04   
ref|XP_786504.3|  PREDICTED: nucleolar RNA helicase 2-like            49.7    8e-04   
ref|XP_008771332.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar RN...  49.7    8e-04   
ref|XP_004701442.1|  PREDICTED: nucleolar RNA helicase 2              49.3    9e-04   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_008756606.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar RN...  49.3    9e-04   Rattus norvegicus [brown rat]
ref|NP_001032278.1|  nucleolar RNA helicase 2                         49.3    9e-04   Rattus norvegicus [brown rat]
gb|AAH59237.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 21             49.3    9e-04   Mus musculus [mouse]
ref|XP_006835901.1|  PREDICTED: nucleolar RNA helicase 2              49.3    9e-04   Chrysochloris asiatica
ref|XP_009464338.1|  PREDICTED: nucleolar RNA helicase 2-like         49.3    9e-04   Nipponia nippon
ref|NP_062426.2|  nucleolar RNA helicase 2                            49.3    9e-04   Mus musculus [mouse]
gb|AAF61690.1|AF220365_1  nucleolar RNA helicase II/Gu                49.3    9e-04   Mus musculus [mouse]
ref|XP_007938866.1|  PREDICTED: nucleolar RNA helicase 2              49.3    0.001   Orycteropus afer afer
ref|XP_004344972.1|  nucleolar RNA helicase 2                         49.3    0.001   Capsaspora owczarzaki ATCC 30864
gb|AAD43959.3|AF159131_1  nucleolar RNA helicase II/Gu                49.3    0.001   Mus musculus [mouse]
ref|XP_010578254.1|  PREDICTED: nucleolar RNA helicase 2-like iso...  49.3    0.001   Haliaeetus leucocephalus
ref|XP_010578253.1|  PREDICTED: nucleolar RNA helicase 2-like iso...  49.3    0.001   Haliaeetus leucocephalus
gb|EPQ14283.1|  Nucleolar RNA helicase 2                              49.3    0.001   Myotis brandtii
ref|XP_009695874.1|  PREDICTED: nucleolar RNA helicase 2-like         49.3    0.001   Cariama cristata
dbj|BAE26522.1|  unnamed protein product                              49.3    0.001   Mus musculus [mouse]
dbj|BAB26817.2|  unnamed protein product                              49.3    0.001   Mus musculus [mouse]
ref|XP_007505939.1|  PREDICTED: nucleolar RNA helicase 2              49.3    0.001   Monodelphis domestica
ref|WP_013170431.1|  DNA helicase                                     49.3    0.001   



>gb|EYU19497.1| hypothetical protein MIMGU_mgv1a002250mg [Erythranthe guttata]
Length=695

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  463  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EDP A++NFRISKPL++ALKAKGIESLF IQAMTF  VLDG+D+VGRARTG
Sbjct  116  EDPNAVSNFRISKPLKDALKAKGIESLFPIQAMTFNLVLDGSDLVGRARTG  166



>ref|XP_003536498.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Glycine 
max]
Length=697

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  451  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +E+++DP AI+NFRIS+PLRE LK KGIESLF IQAMTF+ VLDG+D+VGRARTG
Sbjct  111  EEKKDDPNAISNFRISEPLREKLKEKGIESLFPIQAMTFDTVLDGSDLVGRARTG  165



>gb|KHN02770.1| DEAD-box ATP-dependent RNA helicase 7 [Glycine soja]
Length=701

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  451  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +E+++DP AI+NFRIS+PLRE LK KGIESLF IQAMTF+ VLDG+D+VGRARTG
Sbjct  111  EEKKDDPNAISNFRISEPLREKLKEKGIESLFPIQAMTFDTVLDGSDLVGRARTG  165



>gb|KHN15708.1| DEAD-box ATP-dependent RNA helicase 7 [Glycine soja]
Length=694

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +1

Query  454  EEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E++EDP A++NFRIS+PLR+ LK KGIESLF IQAMTF+ VLDG+D+VGRARTG
Sbjct  108  EKKEDPNALSNFRISEPLRQKLKEKGIESLFPIQAMTFDTVLDGSDLVGRARTG  161



>ref|XP_003556075.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Glycine 
max]
Length=693

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +1

Query  454  EEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E++EDP A++NFRIS+PLR+ LK KGIESLF IQAMTF+ VLDG+D+VGRARTG
Sbjct  107  EKKEDPNALSNFRISEPLRQKLKEKGIESLFPIQAMTFDTVLDGSDLVGRARTG  160



>tpg|DAA40575.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=671

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +1

Query  445  GGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            G DE+  DP A+TNFRIS+PLR++L++KGI++LF IQA TF+ VLDG+D+VGRARTG
Sbjct  114  GSDEDPADPNALTNFRISEPLRQSLRSKGIKALFPIQATTFDLVLDGSDLVGRARTG  170



>ref|XP_008670328.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Zea mays]
 tpg|DAA40576.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=704

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +1

Query  445  GGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            G DE+  DP A+TNFRIS+PLR++L++KGI++LF IQA TF+ VLDG+D+VGRARTG
Sbjct  114  GSDEDPADPNALTNFRISEPLRQSLRSKGIKALFPIQATTFDLVLDGSDLVGRARTG  170



>gb|EPS64456.1| hypothetical protein M569_10323 [Genlisea aurea]
Length=693

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            DP AI NFRISKPLREALKAKGIE+LF IQA TF  +LDG+D+VGRARTG
Sbjct  100  DPNAIVNFRISKPLREALKAKGIEALFPIQAKTFTMILDGSDLVGRARTG  149



>gb|EYU25021.1| hypothetical protein MIMGU_mgv1a027128mg [Erythranthe guttata]
Length=591

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  454  EEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EE+E P A++NFRISKPLREALK KGIESLF IQA TF+ +L G+D+VGRARTG
Sbjct  7    EEDETPNAVSNFRISKPLREALKEKGIESLFPIQATTFDTILHGSDLVGRARTG  60



>ref|XP_006357902.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Solanum 
tuberosum]
Length=679

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 7/62 (11%)
 Frame = +1

Query  451  DEEE-------EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRAR  609
            DEEE       EDP A++NFRISKPL+EAL +KGIE+LF IQAMTF+ +LDG D+VGRAR
Sbjct  96   DEEEVMVEKKVEDPNALSNFRISKPLKEALNSKGIEALFPIQAMTFDDILDGCDLVGRAR  155

Query  610  TG  615
            TG
Sbjct  156  TG  157



>ref|XP_004240751.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Solanum lycopersicum]
Length=683

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  436  EAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E V  +++ EDP A++NFRISKPL+EAL +KGIE+LF IQAMTF+ +LDG D+VGRARTG
Sbjct  98   EQVMVEKKVEDPNALSNFRISKPLKEALNSKGIEALFPIQAMTFDDILDGCDLVGRARTG  157



>ref|XP_009587639.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Nicotiana 
tomentosiformis]
Length=692

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            DP  ++NFRISKPLREAL AKGIE+LF IQAMTF+ +LDG+D+VGRARTG
Sbjct  118  DPNVLSNFRISKPLREALNAKGIEALFPIQAMTFDDILDGSDLVGRARTG  167



>ref|XP_009767597.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Nicotiana 
sylvestris]
Length=692

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            DP  ++NFRISKPLREAL AKGIE+LF IQAMTF+ +LDG+D+VGRARTG
Sbjct  118  DPNVLSNFRISKPLREALNAKGIEALFPIQAMTFDDILDGSDLVGRARTG  167



>ref|XP_003578458.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Brachypodium 
distachyon]
Length=694

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  433  MEAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRART  612
            + A GGDE+  DP A+ NFRIS+PL++ LK+KGI +LF IQA TF  VLDG D+VGRART
Sbjct  105  LTASGGDEDPADPNALANFRISEPLKQKLKSKGINALFPIQATTFGLVLDGHDLVGRART  164

Query  613  G  615
            G
Sbjct  165  G  165



>gb|EAZ09787.1| hypothetical protein OsI_32075 [Oryza sativa Indica Group]
Length=685

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  448  GDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            GDE+  DP A+ NFRIS+PLRE LK+KGI++LF IQA TF+ VLDG D+VGRARTG
Sbjct  96   GDEDPADPNALANFRISEPLREKLKSKGIKALFPIQATTFDLVLDGHDLVGRARTG  151



>ref|XP_004957391.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Setaria 
italica]
Length=708

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  451  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            DE+  DP A+TNFRIS+PLR+ LK+KGI++LF IQA TF+ VLDG+D+VGRARTG
Sbjct  113  DEDPADPNALTNFRISEPLRQRLKSKGIKALFPIQATTFDLVLDGSDLVGRARTG  167



>ref|XP_006660856.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Oryza 
brachyantha]
 gb|ABG73436.1| DEAD/DEAH box helicase family protein [Oryza brachyantha]
Length=688

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  448  GDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            GDE+  DP A+ NFRIS+PLRE LK+KGI++LF IQA TF+ VLDG D+VGRARTG
Sbjct  98   GDEDPADPNALANFRISEPLREKLKSKGIKALFPIQATTFDLVLDGHDLVGRARTG  153



>ref|XP_011076505.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Sesamum indicum]
Length=1167

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  445  GGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            G   E++ P A+++FRIS PL+EALK KGIESLF IQAMTF AVLDG+D+VGRARTG
Sbjct  548  GVKPEDDTPNAVSSFRISNPLKEALKEKGIESLFPIQAMTFNAVLDGSDLVGRARTG  604



>ref|XP_002460541.1| hypothetical protein SORBIDRAFT_02g030210 [Sorghum bicolor]
 gb|EER97062.1| hypothetical protein SORBIDRAFT_02g030210 [Sorghum bicolor]
Length=711

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  451  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            DE+  DP A+TNFRIS+PLR++L++KGI++LF IQA TF+ VLDG D+VGRARTG
Sbjct  115  DEDPADPNALTNFRISEPLRQSLRSKGIKALFPIQATTFDLVLDGNDLVGRARTG  169



>gb|KDO65345.1| hypothetical protein CISIN_1g005470mg [Citrus sinensis]
Length=546

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E E P A++ FRIS PLRE LK+KGIESLF IQAMTF+ VLDG+D+VGRARTG
Sbjct  104  ESEHPNAVSRFRISVPLREKLKSKGIESLFPIQAMTFDMVLDGSDLVGRARTG  156



>ref|XP_002866477.1| hypothetical protein ARALYDRAFT_496396 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42736.1| hypothetical protein ARALYDRAFT_496396 [Arabidopsis lyrata subsp. 
lyrata]
Length=669

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  451  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            D E ++P A++NFRIS PLRE LKAKGIE+LF IQA TF+ VLDG D+VGRARTG
Sbjct  89   DVEVDNPNAVSNFRISAPLREKLKAKGIEALFPIQATTFDMVLDGADLVGRARTG  143



>gb|KDO65346.1| hypothetical protein CISIN_1g005470mg [Citrus sinensis]
 gb|KDO65347.1| hypothetical protein CISIN_1g005470mg [Citrus sinensis]
Length=574

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E E P A++ FRIS PLRE LK+KGIESLF IQAMTF+ VLDG+D+VGRARTG
Sbjct  104  ESEHPNAVSRFRISVPLREKLKSKGIESLFPIQAMTFDMVLDGSDLVGRARTG  156



>ref|XP_011101144.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Sesamum 
indicum]
Length=701

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +P A++NFRIS PLREALK+KGIESLF IQAMTF  +LDG+D+VGRARTG
Sbjct  120  NPNALSNFRISVPLREALKSKGIESLFPIQAMTFGMILDGSDLVGRARTG  169



>gb|KDO65344.1| hypothetical protein CISIN_1g005470mg [Citrus sinensis]
Length=620

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E E P A++ FRIS PLRE LK+KGIESLF IQAMTF+ VLDG+D+VGRARTG
Sbjct  104  ESEHPNAVSRFRISVPLREKLKSKGIESLFPIQAMTFDMVLDGSDLVGRARTG  156



>gb|KDO65342.1| hypothetical protein CISIN_1g005470mg [Citrus sinensis]
Length=652

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E E P A++ FRIS PLRE LK+KGIESLF IQAMTF+ VLDG+D+VGRARTG
Sbjct  104  ESEHPNAVSRFRISVPLREKLKSKGIESLFPIQAMTFDMVLDGSDLVGRARTG  156



>ref|XP_006421777.1| hypothetical protein CICLE_v10004459mg [Citrus clementina]
 ref|XP_006490269.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Citrus 
sinensis]
 gb|ESR35017.1| hypothetical protein CICLE_v10004459mg [Citrus clementina]
 gb|KDO65343.1| hypothetical protein CISIN_1g005470mg [Citrus sinensis]
Length=695

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E E P A++ FRIS PLRE LK+KGIESLF IQAMTF+ VLDG+D+VGRARTG
Sbjct  104  ESEHPNAVSRFRISVPLREKLKSKGIESLFPIQAMTFDMVLDGSDLVGRARTG  156



>ref|XP_002269873.2| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Vitis vinifera]
Length=711

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +P A++NFRIS+PLRE LK+KGIE+LF IQAMTF+ +LDG+D+VGRARTG
Sbjct  117  NPNALSNFRISEPLREKLKSKGIEALFPIQAMTFDTILDGSDLVGRARTG  166



>ref|XP_010275981.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Nelumbo nucifera]
Length=745

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +P A++NFRISK LRE LK+KGIESLF IQAMTF+ ++DG+DMVGRARTG
Sbjct  154  NPNAVSNFRISKALREQLKSKGIESLFPIQAMTFDTIVDGSDMVGRARTG  203



>gb|ACF80743.1| unknown [Zea mays]
Length=506

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  451  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            DE+  DP A+TNFRIS+ LR++L++KGI+SLF IQA TF+ VLDG+D+VGRARTG
Sbjct  114  DEDPADPNALTNFRISESLRQSLRSKGIKSLFPIQATTFDLVLDGSDLVGRARTG  168



>gb|KJB39372.1| hypothetical protein B456_007G009400 [Gossypium raimondii]
Length=605

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            + EDP AI+ FRIS+ LRE LK+KGIE+LF IQAMTF+ +LDGTD+VGRARTG
Sbjct  108  KSEDPNAISRFRISEALREKLKSKGIEALFPIQAMTFDMILDGTDLVGRARTG  160



>gb|KJB39373.1| hypothetical protein B456_007G009400 [Gossypium raimondii]
Length=544

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            + EDP AI+ FRIS+ LRE LK+KGIE+LF IQAMTF+ +LDGTD+VGRARTG
Sbjct  108  KSEDPNAISRFRISEALREKLKSKGIEALFPIQAMTFDMILDGTDLVGRARTG  160



>ref|XP_008652955.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X3 [Zea mays]
Length=634

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  451  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            DE+  DP A+TNFRIS+ LR++L++KGI+SLF IQA TF+ VLDG+D+VGRARTG
Sbjct  114  DEDPADPNALTNFRISESLRQSLRSKGIKSLFPIQATTFDLVLDGSDLVGRARTG  168



>gb|KJB39371.1| hypothetical protein B456_007G009400 [Gossypium raimondii]
Length=571

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            + EDP AI+ FRIS+ LRE LK+KGIE+LF IQAMTF+ +LDGTD+VGRARTG
Sbjct  108  KSEDPNAISRFRISEALREKLKSKGIEALFPIQAMTFDMILDGTDLVGRARTG  160



>gb|KJB39369.1| hypothetical protein B456_007G009400 [Gossypium raimondii]
Length=697

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            + EDP AI+ FRIS+ LRE LK+KGIE+LF IQAMTF+ +LDGTD+VGRARTG
Sbjct  108  KSEDPNAISRFRISEALREKLKSKGIEALFPIQAMTFDMILDGTDLVGRARTG  160



>gb|KJB39370.1| hypothetical protein B456_007G009400 [Gossypium raimondii]
Length=687

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            + EDP AI+ FRIS+ LRE LK+KGIE+LF IQAMTF+ +LDGTD+VGRARTG
Sbjct  108  KSEDPNAISRFRISEALREKLKSKGIEALFPIQAMTFDMILDGTDLVGRARTG  160



>ref|XP_008652954.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X2 [Zea mays]
Length=641

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  451  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            DE+  DP A+TNFRIS+ LR++L++KGI+SLF IQA TF+ VLDG+D+VGRARTG
Sbjct  114  DEDPADPNALTNFRISESLRQSLRSKGIKSLFPIQATTFDLVLDGSDLVGRARTG  168



>ref|XP_008652953.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X1 [Zea mays]
 tpg|DAA62342.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=707

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  451  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            DE+  DP A+TNFRIS+ LR++L++KGI+SLF IQA TF+ VLDG+D+VGRARTG
Sbjct  114  DEDPADPNALTNFRISESLRQSLRSKGIKSLFPIQATTFDLVLDGSDLVGRARTG  168



>gb|KHG06829.1| DEAD-box ATP-dependent RNA helicase 7 [Gossypium arboreum]
Length=695

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            + EDP AI+ FRIS+ LRE LK+KGIE+LF IQAMTF+ +LDGTD+VGRARTG
Sbjct  106  KSEDPNAISRFRISEALREKLKSKGIEALFPIQAMTFDMILDGTDLVGRARTG  158



>gb|KHG06828.1| DEAD-box ATP-dependent RNA helicase 7 [Gossypium arboreum]
Length=722

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            + EDP AI+ FRIS+ LRE LK+KGIE+LF IQAMTF+ +LDGTD+VGRARTG
Sbjct  106  KSEDPNAISRFRISEALREKLKSKGIEALFPIQAMTFDMILDGTDLVGRARTG  158



>ref|XP_010940916.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Elaeis 
guineensis]
Length=711

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  439  AVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A G +E   +P A++ FRISK LRE LK+KGIESLF IQAMTF+++LDG+D+VGRARTG
Sbjct  117  ARGENEGAANPNAVSKFRISKVLREKLKSKGIESLFPIQAMTFDSILDGSDLVGRARTG  175



>ref|XP_004506292.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Cicer 
arietinum]
Length=680

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +++DP A+TNFRIS+PL+  LK KGIE+LF IQAMTF  +LDG+D+VGRARTG
Sbjct  100  KKDDPNAVTNFRISEPLKMKLKEKGIEALFPIQAMTFNTILDGSDLVGRARTG  152



>ref|XP_006394423.1| hypothetical protein EUTSA_v10003756mg [Eutrema salsugineum]
 gb|ESQ31709.1| hypothetical protein EUTSA_v10003756mg [Eutrema salsugineum]
Length=679

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  451  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            D E ++P A++ FRIS PLRE LK KGIE+LF IQAMTF+ VLDG D+VGRARTG
Sbjct  102  DVEVDNPNAVSRFRISAPLREKLKQKGIEALFPIQAMTFDMVLDGADLVGRARTG  156



>emb|CDP05280.1| unnamed protein product [Coffea canephora]
Length=720

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +EE P A+T FRIS+ LREALK KGIE LF IQAMTF+ +LDG+D+VGRARTG
Sbjct  123  KEEHPNALTKFRISERLREALKVKGIEYLFPIQAMTFDTILDGSDLVGRARTG  175



>ref|XP_004496645.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X1 [Cicer arietinum]
Length=666

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +1

Query  463  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +DP A++ FRIS+PLRE LK KGIESLF IQAMTF+ VL+G+D+VGRARTG
Sbjct  44   DDPNAVSKFRISEPLREKLKEKGIESLFPIQAMTFDLVLNGSDLVGRARTG  94



>ref|NP_001063702.1| Os09g0520700 [Oryza sativa Japonica Group]
 sp|Q650T9.1|RH7_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 7 [Oryza sativa 
Japonica Group]
 dbj|BAD46678.1| putative RNA helicase [Oryza sativa Japonica Group]
 dbj|BAF25616.1| Os09g0520700 [Oryza sativa Japonica Group]
Length=696

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  448  GDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            GDE+  DP A+ NFRIS+ LRE LK+KGI++LF IQA TF+ VLDG D+VGRARTG
Sbjct  107  GDEDPADPNALANFRISESLREKLKSKGIKALFPIQATTFDLVLDGHDLVGRARTG  162



>ref|XP_001764376.1| predicted protein [Physcomitrella patens]
 gb|EDQ70930.1| predicted protein [Physcomitrella patens]
Length=689

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            DP A++NF I K LR+ LKAKGIESLF IQA TFEAV DG DMVGRARTG
Sbjct  108  DPMAVSNFNIGKALRDKLKAKGIESLFPIQAQTFEAVFDGNDMVGRARTG  157



>ref|XP_002318863.2| DEAD box RNA helicase family protein [Populus trichocarpa]
 gb|EEE97083.2| DEAD box RNA helicase family protein [Populus trichocarpa]
Length=687

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +1

Query  463  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EDP A+T FRIS+PLREALK +GIE+LF IQA TFE +L+G D+VGRARTG
Sbjct  95   EDPNAVTRFRISEPLREALKKRGIEALFPIQARTFEDILNGCDLVGRARTG  145



>ref|XP_011030003.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Populus 
euphratica]
Length=685

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +1

Query  463  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EDP A+T FRIS+PLREALK +GIE+LF IQA TFE +L+G D+VGRARTG
Sbjct  95   EDPNAVTRFRISEPLREALKKRGIEALFPIQARTFEDILNGCDLVGRARTG  145



>ref|XP_004496646.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X2 [Cicer arietinum]
Length=631

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +1

Query  463  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +DP A++ FRIS+PLRE LK KGIESLF IQAMTF+ VL+G+D+VGRARTG
Sbjct  44   DDPNAVSKFRISEPLREKLKEKGIESLFPIQAMTFDLVLNGSDLVGRARTG  94



>gb|EAZ45398.1| hypothetical protein OsJ_30047 [Oryza sativa Japonica Group]
Length=685

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  448  GDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            GDE+  DP A+ NFRIS+ LRE LK+KGI++LF IQA TF+ VLDG D+VGRARTG
Sbjct  96   GDEDPADPNALANFRISESLREKLKSKGIKALFPIQATTFDLVLDGHDLVGRARTG  151



>ref|XP_004308148.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Fragaria vesca 
subsp. vesca]
Length=680

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  463  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +DP A+T FRIS PLR  LK KGIE+LF IQAMTF+ +LDG+D+VGRARTG
Sbjct  105  DDPNAVTKFRISAPLRAKLKEKGIEALFSIQAMTFDTILDGSDLVGRARTG  155



>sp|Q41382.1|RH7_SPIOL RecName: Full=DEAD-box ATP-dependent RNA helicase 7 [Spinacia 
oleracea]
 emb|CAA68193.1| RNA helicase [Spinacia oleracea]
Length=685

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E EDP +++NFRISKPL++ L +KGI++LF IQAMTF+ V+DG D+VGRARTG
Sbjct  102  EAEDPNSLSNFRISKPLKDVLISKGIKALFPIQAMTFDNVIDGCDLVGRARTG  154



>ref|XP_007038495.1| DEAD-box ATP-dependent RNA helicase 7 [Theobroma cacao]
 gb|EOY22996.1| DEAD-box ATP-dependent RNA helicase 7 [Theobroma cacao]
Length=1077

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            DP AI+ FRIS+ +RE LK+KGIESLF IQAMTF+ VLDGTD+VGRARTG
Sbjct  481  DPNAISRFRISEAVREKLKSKGIESLFPIQAMTFDIVLDGTDLVGRARTG  530



>ref|XP_009407947.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Musa acuminata 
subsp. malaccensis]
Length=712

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  451  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            D   +DP A++NFRISK LRE L +KGI++LF IQAMTF+ +LDG D+VGRARTG
Sbjct  114  DNAADDPNALSNFRISKVLRETLNSKGIKALFPIQAMTFDLILDGFDLVGRARTG  168



>ref|XP_007143335.1| hypothetical protein PHAVU_007G063700g [Phaseolus vulgaris]
 gb|ESW15329.1| hypothetical protein PHAVU_007G063700g [Phaseolus vulgaris]
Length=713

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            DP A++ FRIS+PLR  LK KGIESLF IQAMTF+ VLDG+D+VGRARTG
Sbjct  127  DPNAVSKFRISEPLRLKLKEKGIESLFPIQAMTFDLVLDGSDLVGRARTG  176



>ref|XP_010109082.1| DEAD-box ATP-dependent RNA helicase 7 [Morus notabilis]
 gb|EXC20882.1| DEAD-box ATP-dependent RNA helicase 7 [Morus notabilis]
Length=703

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = +1

Query  445  GGDEE-EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            GG+E+ EE P AI+ FRIS PL+  LK KGIESLF IQAMT + +LDG+D+VGRARTG
Sbjct  104  GGEEKSEEHPNAISKFRISAPLKAKLKEKGIESLFPIQAMTLDTILDGSDLVGRARTG  161



>ref|XP_009628541.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X1 [Nicotiana tomentosiformis]
Length=691

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +1

Query  469  PYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            P A++NFRIS PLREAL AKGI++LF IQAMTF+ V DG D+VGRARTG
Sbjct  120  PNALSNFRISVPLREALIAKGIQALFPIQAMTFDTVFDGNDLVGRARTG  168



>ref|XP_009628542.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X2 [Nicotiana tomentosiformis]
Length=655

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +1

Query  469  PYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            P A++NFRIS PLREAL AKGI++LF IQAMTF+ V DG D+VGRARTG
Sbjct  120  PNALSNFRISVPLREALIAKGIQALFPIQAMTFDTVFDGNDLVGRARTG  168



>ref|XP_002510890.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF51492.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=690

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 59/83 (71%), Gaps = 5/83 (6%)
 Frame = +1

Query  382  LVEPVNFkaekkkkakLMEAVGGD-----EEEEDPYAITNFRISKPLREALKAKGIESLF  546
            LVEPVN K +KK K   +     D      EE+ P AI+ +RIS+ LRE LK+KGI+SLF
Sbjct  70   LVEPVNLKTKKKNKKAKIADENEDGEVETAEEDHPNAISKYRISESLREKLKSKGIQSLF  129

Query  547  KIQAMTFEAVLDGTDMVGRARTG  615
             IQAMTF+ +LDG+D+VGRARTG
Sbjct  130  PIQAMTFDDILDGSDLVGRARTG  152



>gb|KDP22369.1| hypothetical protein JCGZ_26200 [Jatropha curcas]
Length=709

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  463  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EDP A + FRIS PLRE LK++GIE+LF IQAMTF  +LDG D+VGRARTG
Sbjct  120  EDPNATSKFRISLPLREKLKSRGIEALFPIQAMTFNDILDGCDLVGRARTG  170



>ref|XP_009781160.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Nicotiana 
sylvestris]
Length=682

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +1

Query  469  PYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            P A++NFRIS PLREAL AKGI++LF IQAMTF+ + DG D+VGRARTG
Sbjct  111  PNALSNFRISVPLREALIAKGIQALFPIQAMTFDTIFDGNDLVGRARTG  159



>ref|XP_008812489.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Phoenix 
dactylifera]
Length=718

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +P A++ FRISK LRE LK+KGIESLF IQAMTF  +LDG+D+VGRARTG
Sbjct  134  NPNAVSKFRISKVLREKLKSKGIESLFPIQAMTFNLILDGSDLVGRARTG  183



>ref|XP_009343503.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Pyrus 
x bretschneideri]
Length=683

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +1

Query  460  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +EDP A++ FRIS PLR  LK  GIESLF IQAMTF+ +LDG D+VGRARTG
Sbjct  105  KEDPNAVSKFRISAPLRAKLKENGIESLFPIQAMTFDTILDGLDLVGRARTG  156



>ref|XP_009349718.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Pyrus 
x bretschneideri]
Length=683

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +1

Query  460  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +EDP A++ FRIS PLR  LK  GIESLF IQAMTF+ +LDG D+VGRARTG
Sbjct  105  KEDPNAVSKFRISAPLRAKLKENGIESLFPIQAMTFDTILDGLDLVGRARTG  156



>gb|KFK27951.1| hypothetical protein AALP_AA8G452500 [Arabis alpina]
Length=683

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +P A++ FRIS PLRE LK KGIE+LF IQAMTF+ VLDG D+VGRARTG
Sbjct  108  NPNAVSKFRISDPLREQLKKKGIEALFPIQAMTFDMVLDGADLVGRARTG  157



>ref|NP_201025.1| DEAD/DEAH box RNA helicase PRH75 [Arabidopsis thaliana]
 sp|Q39189.2|RH7_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 7 [Arabidopsis 
thaliana]
 dbj|BAA97183.1| RNA helicase [Arabidopsis thaliana]
 gb|AAL07216.1| putative RNA helicase [Arabidopsis thaliana]
 gb|AAP40408.1| putative DEAD/DEAH box RNA helicase PRH75 [Arabidopsis thaliana]
 gb|AED97579.1| DEAD/DEAH box RNA helicase PRH75 [Arabidopsis thaliana]
Length=671

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  451  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            D E ++P A++ FRIS PLRE LKA GIE+LF IQA TF+ VLDG D+VGRARTG
Sbjct  89   DVEVDNPNAVSKFRISAPLREKLKANGIEALFPIQASTFDMVLDGADLVGRARTG  143



>ref|XP_008234340.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Prunus mume]
Length=690

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            DP A++ FRIS+PL+  LK KGIESLF IQAMTF+ +LDG+D+VGRARTG
Sbjct  109  DPNAVSRFRISEPLKAKLKEKGIESLFSIQAMTFDTILDGSDLVGRARTG  158



>emb|CAA68194.1| RNA helicase [Arabidopsis thaliana]
Length=671

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  451  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            D E ++P A++ FRIS PLRE LKA GIE+LF IQA TF+ VLDG D+VGRARTG
Sbjct  89   DVEVDNPNAVSKFRISAPLREKLKANGIEALFPIQASTFDMVLDGADLVGRARTG  143



>ref|XP_007220217.1| hypothetical protein PRUPE_ppa002304mg [Prunus persica]
 gb|EMJ21416.1| hypothetical protein PRUPE_ppa002304mg [Prunus persica]
Length=690

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            DP A++ FRIS+PL+  LK KGIESLF IQAMTF+ +LDG+D+VGRARTG
Sbjct  109  DPNAVSRFRISEPLKAKLKEKGIESLFSIQAMTFDTILDGSDLVGRARTG  158



>ref|XP_008376504.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Malus domestica]
Length=686

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +1

Query  460  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +EDP A++ FRIS PLR  LK  GIESLF IQAMTF+ +LDG D+VGRARTG
Sbjct  108  KEDPNAVSKFRISVPLRAKLKENGIESLFPIQAMTFDTILDGLDLVGRARTG  159



>ref|XP_003592391.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|AES62642.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=641

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  463  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EDP  I+ F+IS+PLRE LK KGIESLF IQAMTF+ +L G D+VGRARTG
Sbjct  40   EDPNGISKFKISEPLREKLKEKGIESLFPIQAMTFDIILQGCDLVGRARTG  90



>ref|XP_009398738.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Musa acuminata 
subsp. malaccensis]
Length=716

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +1

Query  463  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +DP A++NFRISK LRE L +KGI++LF IQAMTF+ +LDG D+VGRARTG
Sbjct  122  DDPNALSNFRISKVLRETLNSKGIKALFPIQAMTFDLILDGFDLVGRARTG  172



>ref|XP_006348047.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Solanum 
tuberosum]
Length=683

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +1

Query  469  PYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            P A++NFRIS PLREAL  KGI +LF IQAMTF+ +LDG+D++GRARTG
Sbjct  106  PNALSNFRISVPLREALITKGIHALFPIQAMTFDTILDGSDLIGRARTG  154



>ref|XP_008467258.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Cucumis melo]
Length=698

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  451  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            ++E E+P A+T FRIS+PL+  LK KGI SLF IQAMTF+ V DG+D+VGRARTG
Sbjct  98   EKEAENPNAVTRFRISEPLKAKLKEKGISSLFPIQAMTFDTVYDGSDLVGRARTG  152



>ref|XP_004234150.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Solanum 
lycopersicum]
Length=682

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +1

Query  469  PYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            P A++NFRIS PL+E L AKGI +LF IQAMTF+ +LDG+D+VGRARTG
Sbjct  112  PNALSNFRISVPLKEVLNAKGINALFPIQAMTFDTILDGSDLVGRARTG  160



>ref|XP_006858006.1| hypothetical protein AMTR_s00069p00191130 [Amborella trichopoda]
 gb|ERN19473.1| hypothetical protein AMTR_s00069p00191130 [Amborella trichopoda]
Length=722

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +1

Query  460  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E +P A+ NF ISK LRE LK+KGIESLF IQAMTF+ +  GTD+VGRARTG
Sbjct  132  EANPNAVVNFNISKVLREKLKSKGIESLFPIQAMTFDTIFGGTDLVGRARTG  183



>ref|XP_009130201.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Brassica rapa]
Length=667

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  463  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E+P A++ FRIS PLRE LK KGIE+LF IQA TF+ VLDG D+VGRARTG
Sbjct  99   ENPNAVSKFRISDPLREKLKEKGIEALFPIQATTFDMVLDGADLVGRARTG  149



>ref|XP_010934579.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Elaeis 
guineensis]
Length=720

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +P A++ FRIS+ LRE LK+KGIESLF IQAMTF+ +LDG+D+VGRARTG
Sbjct  134  NPNAVSKFRISEVLREKLKSKGIESLFPIQAMTFDLILDGSDLVGRARTG  183



>gb|AAF40306.1|AF156667_1 RNA helicase [Vigna radiata]
Length=713

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            DP A++  RIS+PLR  LK KGIESLF IQAMTF+ VLDG+D+VGRARTG
Sbjct  127  DPNAVSKLRISEPLRLKLKEKGIESLFPIQAMTFDLVLDGSDLVGRARTG  176



>ref|XP_010483921.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Camelina 
sativa]
Length=681

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  451  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            D E ++P A++ FRIS PLRE LK  GIE+LF IQA TF+ VLDG D+VGRARTG
Sbjct  93   DVEVDNPNAVSKFRISAPLREMLKKNGIEALFPIQATTFDMVLDGADLVGRARTG  147



>gb|EMT03655.1| DEAD-box ATP-dependent RNA helicase 7 [Aegilops tauschii]
Length=687

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  433  MEAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRART  612
            + A G +EE  DP A+ NFRIS+ L++ LK+KGI +LF IQA TF  VLDG D+VGRART
Sbjct  95   LTASGEEEEPADPNALANFRISEKLKDKLKSKGINALFPIQATTFALVLDGNDLVGRART  154

Query  613  G  615
            G
Sbjct  155  G  155



>ref|XP_010444062.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Camelina 
sativa]
Length=670

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  451  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            D E ++P A++ FRIS PLRE LK  GIE+LF IQA TF+ VLDG D+VGRARTG
Sbjct  90   DVEVDNPNAVSKFRISAPLREMLKKNGIEALFPIQATTFDMVLDGADLVGRARTG  144



>ref|XP_010458375.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X1 [Camelina sativa]
 ref|XP_010458382.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X2 [Camelina sativa]
Length=679

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  451  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            D E ++P A++ FRIS PLRE LK  GIE+LF IQA TF+ VLDG D+VGRARTG
Sbjct  95   DVEVDNPNAVSKFRISAPLREMLKKNGIEALFPIQATTFDMVLDGADLVGRARTG  149



>gb|KJB52899.1| hypothetical protein B456_008G282800 [Gossypium raimondii]
Length=705

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            + EDP  ++ FRIS+ +R+ LK+KGIESLF IQA+TF+ +LDGTD+VGRARTG
Sbjct  111  KSEDPNLVSRFRISEAVRKKLKSKGIESLFPIQALTFDVILDGTDLVGRARTG  163



>gb|KJB52898.1| hypothetical protein B456_008G282800 [Gossypium raimondii]
Length=704

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            + EDP  ++ FRIS+ +R+ LK+KGIESLF IQA+TF+ +LDGTD+VGRARTG
Sbjct  111  KSEDPNLVSRFRISEAVRKKLKSKGIESLFPIQALTFDVILDGTDLVGRARTG  163



>ref|XP_002322430.2| DEAD box RNA helicase family protein [Populus trichocarpa]
 gb|EEF06557.2| DEAD box RNA helicase family protein [Populus trichocarpa]
Length=680

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            DP A+T FRIS+PLRE LK +GIE+LF IQA TFE +L+G D+VGRARTG
Sbjct  100  DPNAVTRFRISEPLREVLKKRGIEALFPIQARTFEDILNGGDLVGRARTG  149



>ref|XP_008364874.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Malus 
domestica]
Length=683

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            DP A++ FRIS PLR  LK  GIESLF IQAMTF+ +LDG D+VGRARTG
Sbjct  104  DPNAVSKFRISAPLRAKLKENGIESLFPIQAMTFDTILDGLDLVGRARTG  153



>ref|XP_010034995.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Eucalyptus 
grandis]
 gb|KCW46257.1| hypothetical protein EUGRSUZ_K00136 [Eucalyptus grandis]
Length=703

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 3/59 (5%)
 Frame = +1

Query  448  GDEE---EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            GD+E   EE+P A++NFRIS  LR  LK   IE+LF IQAMTF+ VLDGTD+VGRARTG
Sbjct  115  GDDEVAQEENPNAVSNFRISDSLRLKLKDNKIEALFPIQAMTFDIVLDGTDLVGRARTG  173



>ref|XP_011041667.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Populus 
euphratica]
Length=684

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            DP A+T FRIS+PLRE LK +GIE+LF IQA TFE +L+G D+VGRARTG
Sbjct  98   DPNAVTRFRISEPLRETLKKRGIEALFPIQARTFEDILNGGDLVGRARTG  147



>gb|KEH26427.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=681

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +++DP A++NFRIS+PLR  LK   IE+LF IQAMTF  +LDG+D+VGRARTG
Sbjct  97   KKDDPNAVSNFRISEPLRMKLKENKIEALFPIQAMTFNTILDGSDLVGRARTG  149



>gb|AAK62631.1| AT5g62190/mmi9_10 [Arabidopsis thaliana]
Length=671

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  451  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            D E ++P A++ FRI  PLRE LKA GIE+LF IQA TF+ VLDG D+VGRARTG
Sbjct  89   DVEVDNPNAVSKFRIPAPLREKLKANGIEALFPIQASTFDMVLDGADLVGRARTG  143



>emb|CDX87236.1| BnaC09g05510D [Brassica napus]
Length=637

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  451  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            D + ++P A++NFRIS PL+  LK KGIE+LF IQA TF+ VLDG D+VGRARTG
Sbjct  80   DVKVDNPNAVSNFRISDPLKAKLKEKGIEALFPIQATTFDMVLDGADLVGRARTG  134



>ref|XP_009112011.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
7-like [Brassica rapa]
Length=655

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  451  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            D + ++P A++NFRIS PL+  LK KGIE+LF IQA TF+ VLDG D+VGRARTG
Sbjct  80   DVKVDNPNAVSNFRISDPLKAKLKEKGIEALFPIQATTFDMVLDGADLVGRARTG  134



>emb|CDY16789.1| BnaA09g05930D [Brassica napus]
Length=635

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  451  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            D + ++P A++NFRIS PL+  LK KGIE+LF IQA TF+ VLDG D+VGRARTG
Sbjct  79   DVKVDNPNAVSNFRISDPLKAKLKEKGIEALFPIQATTFDMVLDGADLVGRARTG  133



>ref|XP_009345013.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Pyrus 
x bretschneideri]
Length=858

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            DP A+  FRIS PLR  LK  GIESLF IQAMTF+ +LDG D+VGRARTG
Sbjct  280  DPNAVLKFRISAPLRAKLKENGIESLFPIQAMTFDTILDGLDLVGRARTG  329



>ref|XP_010693660.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Beta vulgaris 
subsp. vulgaris]
Length=684

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +P +++NFRISKPL++AL +KGI++LF IQAMTF+ V+DG D+V RARTG
Sbjct  99   NPNSLSNFRISKPLKDALISKGIQALFPIQAMTFDIVIDGCDLVARARTG  148



>ref|XP_006279587.1| hypothetical protein CARUB_v10026032mg [Capsella rubella]
 gb|EOA12485.1| hypothetical protein CARUB_v10026032mg [Capsella rubella]
Length=668

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  451  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            D E ++P AI+ FRIS  LRE LK +GIE+LF IQA TF+ VLDG D+VGRARTG
Sbjct  89   DVEVDNPNAISKFRISPSLREKLKERGIEALFPIQATTFDMVLDGADLVGRARTG  143



>ref|XP_004172086.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Cucumis 
sativus]
 gb|KGN50393.1| hypothetical protein Csa_5G171750 [Cucumis sativus]
Length=696

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  451  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            ++E E+P A+T FRIS+PL+  L+ KGI SLF IQA TF+ V DG+D+VGRARTG
Sbjct  98   EKEAENPNAVTQFRISEPLKAKLREKGITSLFPIQATTFDTVYDGSDLVGRARTG  152



>ref|XP_004143712.1| PREDICTED: uncharacterized protein LOC101209696 [Cucumis sativus]
Length=1247

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  451  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            ++E E+P A+T FRIS+PL+  L+ KGI SLF IQA TF+ V DG+D+VGRARTG
Sbjct  649  EKEAENPNAVTQFRISEPLKAKLREKGITSLFPIQATTFDTVYDGSDLVGRARTG  703



>ref|XP_010555319.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Tarenaya hassleriana]
Length=687

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +P A+T FRIS P+   LK KGI +LF IQAMTF+ VLDG+D+VGRARTG
Sbjct  107  NPNAVTKFRISTPVVNKLKEKGIAALFPIQAMTFDMVLDGSDLVGRARTG  156



>ref|XP_009346936.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Pyrus 
x bretschneideri]
Length=860

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A+  FRIS PLR  LK  GIESLF IQAMTF+ +LDG D+VGRARTG
Sbjct  285  AVLKFRISAPLRAKLKENGIESLFPIQAMTFDTILDGLDLVGRARTG  331



>ref|XP_002975210.1| hypothetical protein SELMODRAFT_150370 [Selaginella moellendorffii]
 gb|EFJ23995.1| hypothetical protein SELMODRAFT_150370 [Selaginella moellendorffii]
Length=626

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  451  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            D + E+PYA+ NFRIS  ++  L+ KGI++LF+IQA +F+ VLDG D+VGRARTG
Sbjct  36   DIDVENPYALENFRISDAVKGMLREKGIKALFQIQAQSFDIVLDGDDLVGRARTG  90



>ref|XP_002977618.1| hypothetical protein SELMODRAFT_107027 [Selaginella moellendorffii]
 gb|EFJ21622.1| hypothetical protein SELMODRAFT_107027 [Selaginella moellendorffii]
Length=663

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  451  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            D + E+PYA+ NFRIS  ++  L+ KGI++LF+IQA +F+ VLDG D+VGRARTG
Sbjct  73   DIDVENPYALENFRISDAVKGMLREKGIKALFQIQAQSFDIVLDGDDLVGRARTG  127



>ref|XP_005854803.1| dead deah box rna [Nannochloropsis gaditana CCMP526]
 gb|EKU21559.1| dead deah box rna [Nannochloropsis gaditana CCMP526]
Length=737

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            DP A++NF+IS+  R  L+A+GI+SLF IQ+MT + +LDG D++GRARTG
Sbjct  140  DPNALSNFKISQATRTRLEARGIKSLFPIQSMTLQKILDGCDLIGRARTG  189



>ref|XP_010059508.1| PREDICTED: nucleolar RNA helicase 2-like [Eucalyptus grandis]
Length=584

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRART  612
            +EE+P A++NFRI   LR  LK  GIE+LF IQAMTF+ ++DG D+VGRA T
Sbjct  218  QEENPNALSNFRILNTLRLKLKDNGIEALFPIQAMTFDIIVDGADLVGRAHT  269



>gb|ETK72184.1| hypothetical protein L915_20663 [Phytophthora parasitica]
Length=269

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 44/58 (76%), Gaps = 4/58 (7%)
 Frame = +1

Query  442  VGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            VGG   EE+P ++ NFRI    ++ L+A+GI +LF IQAMTF+ +LDG D++GRARTG
Sbjct  99   VGG---EENP-SLDNFRICDETKKNLQARGIHTLFPIQAMTFDKILDGKDLMGRARTG  152



>gb|EWM21167.1| dead deah box rna [Nannochloropsis gaditana]
Length=737

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            DP A++NF+IS+     L+A+GI+SLF IQ+MT + +LDG D++GRARTG
Sbjct  140  DPNALSNFKISQATCTRLEARGIKSLFPIQSMTLQKILDGCDLIGRARTG  189



>gb|ETP29814.1| hypothetical protein F442_21078 [Phytophthora parasitica P10297]
Length=684

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 44/58 (76%), Gaps = 4/58 (7%)
 Frame = +1

Query  442  VGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            VGG   EE+P ++ NFRI    ++ L+A+GI +LF IQAMTF+ +LDG D++GRARTG
Sbjct  99   VGG---EENP-SLDNFRICDETKKNLQARGIHTLFPIQAMTFDKILDGKDLMGRARTG  152



>ref|XP_008914911.1| hypothetical protein PPTG_18629 [Phytophthora parasitica INRA-310]
 gb|ETM99820.1| hypothetical protein PPTG_18629 [Phytophthora parasitica INRA-310]
Length=684

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 44/58 (76%), Gaps = 4/58 (7%)
 Frame = +1

Query  442  VGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            VGG   EE+P ++ NFRI    ++ L+A+GI +LF IQAMTF+ +LDG D++GRARTG
Sbjct  99   VGG---EENP-SLDNFRICDETKKNLQARGIHTLFPIQAMTFDKILDGKDLMGRARTG  152



>gb|ETI31844.1| hypothetical protein F443_21248 [Phytophthora parasitica P1569]
 gb|ETL25637.1| hypothetical protein L916_20525 [Phytophthora parasitica]
 gb|ETL78851.1| hypothetical protein L917_20399 [Phytophthora parasitica]
 gb|ETM32130.1| hypothetical protein L914_20404 [Phytophthora parasitica]
 gb|ETO60560.1| hypothetical protein F444_21264 [Phytophthora parasitica P1976]
 gb|ETP01634.1| hypothetical protein F441_21133 [Phytophthora parasitica CJ01A1]
Length=684

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 44/58 (76%), Gaps = 4/58 (7%)
 Frame = +1

Query  442  VGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            VGG   EE+P ++ NFRI    ++ L+A+GI +LF IQAMTF+ +LDG D++GRARTG
Sbjct  99   VGG---EENP-SLDNFRICDETKKNLQARGIHTLFPIQAMTFDKILDGKDLMGRARTG  152



>ref|XP_010068038.1| PREDICTED: acetyl-coenzyme A synthetase, chloroplastic/glyoxysomal-like 
[Eucalyptus grandis]
Length=346

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +P A+ NFRIS  LR  LK  GIE+LF I  MTF+ V DGTD+VGRA TG
Sbjct  8    NPNAVLNFRISDSLRLKLKDNGIEALFPIHPMTFDNVHDGTDLVGRACTG  57



>ref|XP_002904811.1| DEAD/DEAH box RNA helicase, putative [Phytophthora infestans 
T30-4]
 gb|EEY53193.1| DEAD/DEAH box RNA helicase, putative [Phytophthora infestans 
T30-4]
Length=681

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 44/58 (76%), Gaps = 4/58 (7%)
 Frame = +1

Query  442  VGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            VGG   EE+P ++ NFRI    ++ L+A+GI +LF IQAMTF+ ++DG D++GRARTG
Sbjct  100  VGG---EENP-SLDNFRICDETKKNLQARGIHTLFPIQAMTFDKIVDGKDLMGRARTG  153



>ref|XP_005645158.1| DEAD-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE20614.1| DEAD-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=698

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            DP A+ NFR+S  ++  L+ KGIE+LF IQA T   +LDG D+VGRARTG
Sbjct  102  DPLAVDNFRLSDKVKALLREKGIEALFSIQAHTLNHLLDGFDLVGRARTG  151



>gb|EMS52016.1| DEAD-box ATP-dependent RNA helicase 7 [Triticum urartu]
Length=925

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  433  MEAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRART  612
            + A G +EE  DP A+ NFRIS  L++ LK+KGI +LF IQA TF  VLDG D+VGRART
Sbjct  333  LTASGEEEEPADPNALANFRISDKLKDKLKSKGINALFPIQATTFALVLDGNDLVGRART  392

Query  613  G  615
            G
Sbjct  393  G  393



>ref|XP_011399479.1| DEAD-box ATP-dependent RNA helicase 7 [Auxenochlorella protothecoides]
 gb|KFM26541.1| DEAD-box ATP-dependent RNA helicase 7 [Auxenochlorella protothecoides]
Length=764

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +1

Query  469  PYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            P+A+ NF +S PL+  L++KGIESLF IQA     +L+G D+VGRARTG
Sbjct  52   PHALDNFALSAPLKSMLRSKGIESLFDIQAACLTPLLEGRDLVGRARTG  100



>gb|KCW88483.1| hypothetical protein EUGRSUZ_A00875 [Eucalyptus grandis]
Length=435

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 50/75 (67%), Gaps = 3/75 (4%)
 Frame = +1

Query  382  LVEPVNFkaekkkkakLMEAVGGDEE---EEDPYAITNFRISKPLREALKAKGIESLFKI  552
            LV+P N K +KKKK K      GD+E   EE+P  ++NFRIS  LR  LK  GI++LF I
Sbjct  97   LVDPENLKGKKKKKKKKTRLSDGDDEVAQEENPTVVSNFRISDSLRLKLKDNGIDALFPI  156

Query  553  QAMTFEAVLDGTDMV  597
            Q M F+ VLDGTD+V
Sbjct  157  QTMRFDIVLDGTDLV  171



>ref|XP_005849733.1| hypothetical protein CHLNCDRAFT_20835, partial [Chlorella variabilis]
 gb|EFN57631.1| hypothetical protein CHLNCDRAFT_20835, partial [Chlorella variabilis]
Length=608

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +1

Query  469  PYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            P A+ NF++S+P++  L+AKGIE+LF IQA     +L+G D+VGRARTG
Sbjct  2    PLALDNFKLSEPVKSLLRAKGIEALFDIQAQCLPPLLEGQDLVGRARTG  50



>ref|XP_003058076.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58027.1| predicted protein [Micromonas pusilla CCMP1545]
Length=748

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +1

Query  460  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E+DP  ++NF IS+ +   L+ KGI SL+ IQA TF+ VLDG D+V RA+TG
Sbjct  123  EDDPLRVSNFNISREVCARLETKGITSLYGIQAQTFQHVLDGKDIVARAKTG  174



>emb|CEP17128.1| hypothetical protein [Parasitella parasitica]
Length=708

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +1

Query  442  VGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +  DE  E+   ++NFRIS+   + LKAKGI+SLF+IQA TF+ + DG D++ RARTG
Sbjct  84   INSDEVPEN-LRLSNFRISQGTVDNLKAKGIKSLFEIQAATFDTIFDGNDVLARARTG  140



>ref|XP_001417262.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95555.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=654

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EE +P A+ NF +S+P++  L+ KG ++LF IQA T E  L G D+VGRARTG
Sbjct  78   EEPNPLALDNFALSEPVKATLRKKGFDALFAIQAETLEIALSGKDVVGRARTG  130



>ref|XP_008364905.1| PREDICTED: uncharacterized protein LOC103428569 [Malus domestica]
Length=206

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  505  LREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            LR  LK  GIESLF IQAMTF+ +LDG D+VGRARTG
Sbjct  166  LRAKLKENGIESLFPIQAMTFDTILDGLDLVGRARTG  202



>ref|XP_010938270.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Elaeis 
guineensis]
Length=318

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  487  FRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
             RISK LRE LK+KGIES+F IQ MTF+++ DG+++V + RTG
Sbjct  84   MRISKVLREKLKSKGIESMFPIQTMTFDSIFDGSNLVCQERTG  126



>emb|CDS09503.1| hypothetical protein LRAMOSA10863 [Absidia idahoensis var. thermophila]
Length=681

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 44/64 (69%), Gaps = 2/64 (3%)
 Frame = +1

Query  430  LMEAVGGDEEEEDP--YAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGR  603
            ++E  G   EE+ P    ++ FRIS+   E L+A+GI+SLF IQA TF+++ DG D++ R
Sbjct  64   VVEETGKHNEEDVPEHLKLSKFRISQGTVENLEARGIKSLFDIQAATFDSIFDGNDVLAR  123

Query  604  ARTG  615
            ARTG
Sbjct  124  ARTG  127



>ref|XP_004300425.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Fragaria 
vesca subsp. vesca]
Length=329

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +1

Query  460  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRA  606
            EE P A++ FRIS+PLR  LK +GI+SL  IQA TF+ +LDG D++ +A
Sbjct  70   EETPNAVSKFRISEPLRAKLKERGIKSLSPIQARTFDTILDGFDLLAQA  118



>dbj|GAN03042.1| nucleolar RNA helicase 2-like isoform X2 [Mucor ambiguus]
Length=705

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +1

Query  478  ITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            ++NFRIS+   + L+AKGI+SLF+IQA TF+ + DG D++ RARTG
Sbjct  90   LSNFRISQGTIDNLEAKGIKSLFEIQAATFDTIFDGNDVLARARTG  135



>gb|EPB89647.1| hypothetical protein HMPREF1544_03579 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=704

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +1

Query  478  ITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            ++NFRIS+   + L+AKGI+SLF+IQA TF+ + DG D++ RARTG
Sbjct  92   LSNFRISQGTIDNLEAKGIKSLFEIQAATFDTIFDGNDVLARARTG  137



>ref|XP_002507890.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69148.1| predicted protein [Micromonas sp. RCC299]
Length=631

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = +1

Query  436  EAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EA  GD   ++ + ++NF +SK +   L+ KGI SL+ IQA  F+ +LDG D+VGRARTG
Sbjct  15   EASDGDASVDENH-VSNFNLSKEVCARLETKGITSLYSIQAQCFQPILDGKDLVGRARTG  73



>emb|CDH59679.1| nucleolar rna helicase 2-like [Lichtheimia corymbifera JMRC:FSU:9682]
Length=684

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 45/64 (70%), Gaps = 2/64 (3%)
 Frame = +1

Query  430  LMEAVGGDEEEEDP--YAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGR  603
            ++E  G  E+++ P    ++ FRIS+   E L+A+GI+SLF IQA TF+++ DG D++ R
Sbjct  64   VVEESGKHEDDQVPEHLQLSKFRISQGTVENLEARGIKSLFDIQAATFDSIFDGNDVLAR  123

Query  604  ARTG  615
            ARTG
Sbjct  124  ARTG  127



>ref|XP_007054740.1| PREDICTED: nucleolar RNA helicase 2-like [Chelonia mydas]
Length=681

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EEE   A +NF ISK   E LKA+G++ LF +QA TF+ + DG D++ +ARTG
Sbjct  105  EEEKEGAFSNFSISKETTELLKARGVKYLFSVQAKTFQPIYDGKDVIAQARTG  157



>gb|EMP40574.1| Nucleolar RNA helicase 2, partial [Chelonia mydas]
Length=1143

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EEE   A +NF ISK   E LKA+G++ LF +QA TF+ + DG D++ +ARTG
Sbjct  574  EEEKEGAFSNFSISKETTELLKARGVKYLFSVQAKTFQPIYDGKDVIAQARTG  626


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NF ISK   E L+A+G+  LF +Q  TF+ + DG D+V +ARTG
Sbjct  11   AFSNFCISKETIELLRARGVTYLFPVQVKTFKHIYDGKDVVAQARTG  57



>emb|CEG79803.1| hypothetical protein RMATCC62417_14224 [Rhizopus microsporus]
Length=476

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            D   ++NFRIS+   + L+ KGI+SLF IQA TF+ + DG D++ RARTG
Sbjct  72   DHLLLSNFRISQSTIDNLEKKGIKSLFDIQAATFDTIFDGKDVLARARTG  121



>gb|EIE87311.1| hypothetical protein RO3G_12022 [Rhizopus delemar RA 99-880]
Length=665

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A++NFRIS+   E L+ KGI SLF+IQA TF+ + DG D++ RARTG
Sbjct  70   ALSNFRISEGTIENLEKKGISSLFEIQAATFDTIYDGKDVLARARTG  116



>ref|XP_009837773.1| hypothetical protein H257_12310 [Aphanomyces astaci]
 gb|ETV72987.1| hypothetical protein H257_12310 [Aphanomyces astaci]
Length=683

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +1

Query  463  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            ED   ++NFRIS    + L+ +GI +LF IQAMTF+++ D  D++GRARTG
Sbjct  87   EDNPPLSNFRISAATIDNLEKRGIPTLFPIQAMTFDSIYDKKDLIGRARTG  137



>ref|XP_006630629.1| PREDICTED: nucleolar RNA helicase 2-like [Lepisosteus oculatus]
Length=777

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NFRISK   + L+A+G+  LF IQ  TF+ V DG D+VG+ARTG
Sbjct  184  AFSNFRISKETIQLLQARGVTYLFDIQVKTFDFVFDGNDVVGQARTG  230



>ref|XP_009496395.1| hypothetical protein H696_04240 [Fonticula alba]
 gb|KCV68824.1| hypothetical protein H696_04240 [Fonticula alba]
Length=712

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +P A+TNFRISK        + I +LF IQA T++A+ DG D++G+ARTG
Sbjct  101  NPLALTNFRISKETVSQFAKRNITALFPIQAQTYDAIYDGKDVIGQARTG  150



>ref|XP_005297367.1| PREDICTED: nucleolar RNA helicase 2 [Chrysemys picta bellii]
Length=813

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EEE   A +NF ISK   E LKA+G++ LF +QA TF+ + DG D++ +ARTG
Sbjct  237  EEEREGAFSNFSISKETTELLKARGVKYLFSVQAKTFQPIYDGKDVIAQARTG  289



>emb|CEI86541.1| hypothetical protein RMCBS344292_00980 [Rhizopus microsporus]
Length=674

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            D   ++NFRIS+   + L+ KGI+SLF+IQA TF+ + DG D++ RARTG
Sbjct  72   DHLLLSNFRISQSTIDNLEKKGIKSLFEIQAATFDTIFDGKDVLARARTG  121



>emb|CEG65973.1| hypothetical protein RMATCC62417_02639 [Rhizopus microsporus]
Length=674

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            D   ++NFRIS+   + L+ KGI+SLF IQA TF+ + DG D++ RARTG
Sbjct  72   DHLLLSNFRISQSTIDNLEKKGIKSLFDIQAATFDTIFDGKDVLARARTG  121



>ref|XP_006273547.1| PREDICTED: nucleolar RNA helicase 2-like [Alligator mississippiensis]
Length=692

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NF ISK   E LKA+G++ LF IQA TF+ + DG DM+ +ARTG
Sbjct  128  AFSNFSISKETAELLKARGVKYLFSIQAKTFQPIYDGKDMIVQARTG  174



>ref|XP_003078811.1| putative RNA helicase (ISS) [Ostreococcus tauri]
 emb|CAL51691.1| Helicase, C-terminal [Ostreococcus tauri]
Length=693

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = +1

Query  457  EEEDPYAITNFR-ISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EE +P A+ NF+ ++ P++  L+ KG ++LF+IQA T E  L G D+VGRARTG
Sbjct  75   EEPNPLALDNFKGLTDPVKTTLRKKGYDALFQIQAETLEIALGGRDVVGRARTG  128



>ref|NP_001120807.1| nucleolar RNA helicase 2 [Danio rerio]
 gb|AAI60629.1| Ddx21 protein [Danio rerio]
Length=759

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 39/59 (66%), Gaps = 4/59 (7%)
 Frame = +1

Query  451  DEEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            ++E+E P     A +NFRIS    + L+A+G+  LF IQ  TF AV DG D++G+ARTG
Sbjct  155  EQEKETPEQREGAFSNFRISPNTIKLLQARGVSYLFDIQVKTFNAVYDGKDLIGQARTG  213



>ref|XP_006125341.1| PREDICTED: nucleolar RNA helicase 2 [Pelodiscus sinensis]
Length=728

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EEE   A +NF ISK   E LKA+G++ LF +Q  TF+ + DG D++ +ARTG
Sbjct  154  EEEKEGAFSNFSISKETIELLKARGVKYLFSVQVKTFQPIYDGKDVIAQARTG  206



>ref|XP_010789411.1| PREDICTED: nucleolar RNA helicase 2-like [Notothenia coriiceps]
Length=275

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NFRIS+   + LKA+G+  LF IQ+ TF +V DG D++ +ARTG
Sbjct  156  AFSNFRISQVTIDKLKARGVTYLFDIQSKTFNSVFDGEDVIAQARTG  202



>ref|XP_007512398.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16998.1| predicted protein [Bathycoccus prasinos]
Length=689

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +1

Query  451  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            D    +P A+ NF +S  +  AL+ KGI++LF IQA T +  L G D+VGRARTG
Sbjct  75   DARTPNPLALENFSLSPEVVSALQKKGIDALFAIQAQTLDTALSGKDIVGRARTG  129



>ref|XP_008873274.1| hypothetical protein H310_09087 [Aphanomyces invadans]
 gb|ETV98399.1| hypothetical protein H310_09087 [Aphanomyces invadans]
Length=675

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +1

Query  463  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +D   ++NFR+S    + L+ +GI +LF IQAMTF+++ D  D++GRARTG
Sbjct  82   DDNPPLSNFRVSAVTIKNLEKRGIATLFPIQAMTFDSIYDKKDLIGRARTG  132



>ref|XP_005815128.1| PREDICTED: nucleolar RNA helicase 2-like [Xiphophorus maculatus]
Length=745

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NFRISK   + LKA+G+  LF IQ  +F AV DG D++ +ARTG
Sbjct  160  AFSNFRISKVTIDKLKARGVTYLFDIQVKSFNAVYDGEDVIAQARTG  206



>ref|XP_007549868.1| PREDICTED: nucleolar RNA helicase 2-like [Poecilia formosa]
Length=743

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NFRISK   + LKA+G+  LF IQ  +F AV DG D++ +ARTG
Sbjct  160  AFSNFRISKVTIDKLKARGVTYLFDIQVKSFNAVYDGEDVIAQARTG  206



>ref|XP_002502509.1| DEAD/DEAH box RNA helicase [Micromonas sp. RCC299]
 gb|ACO63767.1| DEAD/DEAH box RNA helicase [Micromonas sp. RCC299]
Length=790

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
             + DP  + NF +S   + AL+ +GIE+LF IQA   E  L G D+VGRARTG
Sbjct  128  NKRDPMHVDNFPLSDITKAALRKRGIETLFPIQASVLEPALQGRDVVGRARTG  180



>ref|XP_005733301.1| PREDICTED: nucleolar RNA helicase 2-like [Pundamilia nyererei]
Length=754

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 4/58 (7%)
 Frame = +1

Query  454  EEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E EE P     A +NFRISK   + LKA+G+  LF IQ  TF  V DG D++ +ARTG
Sbjct  149  ETEETPEQKEGAFSNFRISKVTIDKLKARGVSYLFDIQVKTFNHVYDGEDVIAQARTG  206



>ref|XP_005467227.1| PREDICTED: nucleolar RNA helicase 2-like [Oreochromis niloticus]
Length=757

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NFRISK   + LKA+G+  LF IQ  TF  V DG D++ +ARTG
Sbjct  161  AFSNFRISKVTIDKLKARGVSYLFDIQVKTFNHVYDGEDVIAQARTG  207



>ref|XP_006023203.1| PREDICTED: nucleolar RNA helicase 2-like [Alligator sinensis]
Length=689

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NF ISK   E LKA+G++ LF IQA TF+ + DG DM+ +ARTG
Sbjct  127  AFSNFSISKETAELLKARGVKYLFSIQAKTFQPIYDGKDMIAQARTG  173



>ref|XP_010887236.1| PREDICTED: nucleolar RNA helicase 2-like [Esox lucius]
Length=766

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +1

Query  460  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E+   A +NFRIS    + L+A+GI  LF IQ  TF +V DG D++G+ARTG
Sbjct  160  EQKSGAFSNFRISPNTIKLLEARGISFLFDIQTQTFNSVYDGKDVIGQARTG  211



>ref|XP_005915179.1| PREDICTED: nucleolar RNA helicase 2-like [Haplochromis burtoni]
Length=796

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 4/58 (7%)
 Frame = +1

Query  454  EEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E EE P     A +NFRISK   + LKA+G+  LF IQ  TF  V DG D++ +ARTG
Sbjct  190  ETEETPEQKEGAFSNFRISKVTIDKLKARGVSYLFDIQVKTFNHVYDGEDVIAQARTG  247



>ref|XP_004539930.1| PREDICTED: nucleolar RNA helicase 2-like [Maylandia zebra]
Length=797

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 4/58 (7%)
 Frame = +1

Query  454  EEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E EE P     A +NFRISK   + LKA+G+  LF IQ  TF  V DG D++ +ARTG
Sbjct  191  ETEETPEQKEGAFSNFRISKVTIDKLKARGVSYLFDIQVKTFNHVYDGEDVIAQARTG  248



>ref|XP_008290699.1| PREDICTED: nucleolar RNA helicase 2-like [Stegastes partitus]
Length=754

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 4/58 (7%)
 Frame = +1

Query  454  EEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E+EE P     A +NFRIS+   + LKA+G+  LF IQ  TF+ V DG D++ +ARTG
Sbjct  152  EKEETPEQREGAFSNFRISQVTIDKLKARGVSYLFDIQVKTFDPVYDGEDVIAQARTG  209



>ref|XP_003056927.1| DEAD/DEAH box RNA helicase [Micromonas pusilla CCMP1545]
 gb|EEH58572.1| DEAD/DEAH box RNA helicase [Micromonas pusilla CCMP1545]
Length=803

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +  DP  I NF IS   + AL+ +GIESLF IQ+      L+G D+VGRARTG
Sbjct  139  KNSDPNHIDNFPISVLTKAALRKRGIESLFPIQSAVLAPALEGRDIVGRARTG  191



>emb|CBK20101.2| unnamed protein product [Blastocystis hominis]
Length=553

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E E  YA+  +RIS      L +KGI  LF IQA++F+A+ DG D++GRA TG
Sbjct  10   ESESLYAMHRYRISPETIGILHSKGITELFPIQALSFDAIYDGKDLIGRAPTG  62



>ref|XP_002112077.1| hypothetical protein TRIADDRAFT_55752 [Trichoplax adhaerens]
 gb|EDV26044.1| hypothetical protein TRIADDRAFT_55752 [Trichoplax adhaerens]
Length=633

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  487  FRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            FRIS  + ++LK +GI  LF IQA TF+ V DG D++G+ARTG
Sbjct  57   FRISSAIADSLKERGITYLFPIQAQTFDYVYDGQDVIGQARTG  99



>ref|XP_006780037.1| PREDICTED: nucleolar RNA helicase 2-like [Neolamprologus brichardi]
Length=794

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NFRISK   + LKA+G+  LF IQ  TF  V DG D++ +ARTG
Sbjct  200  AFSNFRISKVTIDKLKARGVAYLFDIQVKTFNHVYDGEDVIAQARTG  246



>ref|XP_007253243.1| PREDICTED: nucleolar RNA helicase 2-like isoform X2 [Astyanax 
mexicanus]
Length=777

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NF+IS+   + L+A+G+  LF IQ  TF  V DG D++G+ARTG
Sbjct  173  AFSNFKISQKTIQLLQARGVTYLFDIQVKTFNPVYDGKDVIGQARTG  219



>ref|XP_007253242.1| PREDICTED: nucleolar RNA helicase 2-like isoform X1 [Astyanax 
mexicanus]
Length=737

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NF+IS+   + L+A+G+  LF IQ  TF  V DG D++G+ARTG
Sbjct  133  AFSNFKISQKTIQLLQARGVTYLFDIQVKTFNPVYDGKDVIGQARTG  179



>emb|CEI94647.1| hypothetical protein RMCBS344292_08852 [Rhizopus microsporus]
Length=694

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            D   ++NFRIS+   + L+ KGI+SLF IQA TF+ + DG D++ RARTG
Sbjct  230  DHLLLSNFRISQSTIDNLEKKGIKSLFDIQAATFDTIFDGKDVLARARTG  279



>emb|CDQ75565.1| unnamed protein product [Oncorhynchus mykiss]
Length=749

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NFRIS    + L+A+GI  LF IQ  TF +V +G D++G+ARTG
Sbjct  172  AFSNFRISPNTIKLLQARGISYLFDIQTQTFNSVYEGKDVIGQARTG  218



>gb|ACH85363.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 21 [Salmo salar]
Length=611

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NFRIS    + L+A+GI  LF IQ  TF +V +G D++G+ARTG
Sbjct  34   AFSNFRISPNTIKLLQARGISYLFDIQTQTFNSVYEGKDVIGQARTG  80



>ref|XP_010753600.1| PREDICTED: nucleolar RNA helicase 2-like isoform X1 [Larimichthys 
crocea]
 ref|XP_010753601.1| PREDICTED: nucleolar RNA helicase 2-like isoform X2 [Larimichthys 
crocea]
Length=754

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NFRIS+   + LKA+G+  LF IQ  TF  V DG D++ +ARTG
Sbjct  157  AFSNFRISQVTIDKLKARGVSYLFDIQVKTFNPVYDGEDVIAQARTG  203



>ref|XP_009520796.1| hypothetical protein PHYSODRAFT_326516 [Phytophthora sojae]
 gb|EGZ25508.1| hypothetical protein PHYSODRAFT_326516 [Phytophthora sojae]
Length=962

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 4/58 (7%)
 Frame = +1

Query  442  VGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            VGG    E+P  + +F I     + LKA+GI +LF IQAMTF+ +L G D++GRARTG
Sbjct  94   VGG---TENP-PLESFDICAETVKNLKARGIHTLFPIQAMTFDKILAGKDLMGRARTG  147



>ref|XP_003976441.1| PREDICTED: nucleolar RNA helicase 2-like [Takifugu rubripes]
Length=713

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NFRIS      LKA+G+  LF IQ  TF++V DG D++ +ARTG
Sbjct  131  AFSNFRISPVTINKLKARGVSYLFDIQVKTFDSVYDGEDVIAQARTG  177



>ref|XP_005838835.1| hypothetical protein GUITHDRAFT_102470 [Guillardia theta CCMP2712]
 gb|EKX51855.1| hypothetical protein GUITHDRAFT_102470 [Guillardia theta CCMP2712]
Length=589

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +I NFRIS+   +AL  +GI++LF IQ  TF+ + +G D++ RARTG
Sbjct  138  SIRNFRISEKTIKALSEQGIQTLFPIQVATFDIIYEGYDLIARARTG  184



>ref|XP_006820781.1| PREDICTED: nucleolar RNA helicase 2-like isoform X2 [Saccoglossus 
kowalevskii]
Length=707

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +EE   A +NFR+S     +LKA+ I  LF IQA TF+ V DG D++ +ARTG
Sbjct  120  KEEKAGAFSNFRLSPQTIASLKARSITHLFPIQAKTFDYVYDGHDVIAQARTG  172



>ref|XP_002738237.2| PREDICTED: nucleolar RNA helicase 2-like isoform X1 [Saccoglossus 
kowalevskii]
Length=708

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +EE   A +NFR+S     +LKA+ I  LF IQA TF+ V DG D++ +ARTG
Sbjct  121  KEEKAGAFSNFRLSPQTIASLKARSITHLFPIQAKTFDYVYDGHDVIAQARTG  173



>ref|XP_001702450.1| RNA helicase [Chlamydomonas reinhardtii]
 gb|EDO96945.1| RNA helicase [Chlamydomonas reinhardtii]
Length=737

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
             +  F++S+ ++  L+++ IESLF IQAMT E  ++G D+VGRARTG
Sbjct  105  GLDRFKLSEQVKSMLRSQNIESLFPIQAMTLEPAMEGLDVVGRARTG  151



>ref|XP_002163120.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Hydra vulgaris]
Length=95

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +1

Query  460  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRA  606
            EEDP   +NF+ISK   + L A G+  LF +Q  T+ A+LDG+D++ +A
Sbjct  47   EEDPGDFSNFKISKKTVKKLIANGVNKLFPVQYTTYNAILDGSDVIVQA  95



>ref|XP_009309382.1| putative nucleolar RNA helicase II [Trypanosoma grayi]
 gb|KEG12393.1| putative nucleolar RNA helicase II [Trypanosoma grayi]
Length=648

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +1

Query  478  ITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
             T+F IS    +AL+++GIE+LF +QA+T+EA++ GTD++ +ARTG
Sbjct  58   FTDFGISDGTVKALRSQGIETLFPVQALTYEAIMKGTDVLVQARTG  103



>ref|XP_004067286.1| PREDICTED: nucleolar RNA helicase 2-like isoform X1 [Oryzias 
latipes]
Length=775

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NFRIS+     LKA+G+  LF IQ  TF  V DG D++ +ARTG
Sbjct  183  AFSNFRISQVTINKLKARGVSYLFDIQVKTFNPVYDGEDVLAQARTG  229



>ref|XP_011490446.1| PREDICTED: nucleolar RNA helicase 2-like isoform X2 [Oryzias 
latipes]
Length=740

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NFRIS+     LKA+G+  LF IQ  TF  V DG D++ +ARTG
Sbjct  148  AFSNFRISQVTINKLKARGVSYLFDIQVKTFNPVYDGEDVLAQARTG  194



>ref|XP_002913778.1| PREDICTED: nucleolar RNA helicase 2 [Ailuropoda melanoleuca]
Length=794

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NF IS+P  + LKA+G+  LF IQA TF  V  G D++ +ARTG
Sbjct  189  AFSNFPISEPTIKLLKARGVTFLFPIQAKTFHHVYSGKDLIAQARTG  235



>gb|EFB22545.1| hypothetical protein PANDA_001614 [Ailuropoda melanoleuca]
Length=765

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +1

Query  460  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E+   A +NF IS+P  + LKA+G+  LF IQA TF  V  G D++ +ARTG
Sbjct  155  EQKEGAFSNFPISEPTIKLLKARGVTFLFPIQAKTFHHVYSGKDLIAQARTG  206



>ref|XP_006406182.1| hypothetical protein EUTSA_v10020290mg [Eutrema salsugineum]
 gb|ESQ47635.1| hypothetical protein EUTSA_v10020290mg [Eutrema salsugineum]
Length=632

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 40/78 (51%), Gaps = 0/78 (0%)
 Frame = +1

Query  382  LVEPVNFkaekkkkakLMEAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAM  561
            +V P  F   +     + ++        D  AI+   IS  + +ALK+KGIE LF IQ  
Sbjct  85   MVSPAGFAISESSDRGIGDSESVGSSSADGLAISELGISPEIVKALKSKGIEKLFPIQKA  144

Query  562  TFEAVLDGTDMVGRARTG  615
              E  + G DM+GRARTG
Sbjct  145  VLEPAMQGRDMIGRARTG  162



>emb|CDY46329.1| BnaC01g31630D [Brassica napus]
Length=549

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 33/60 (55%), Gaps = 0/60 (0%)
 Frame = +1

Query  436  EAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
             A+   E   D  AI    IS  + +AL AKGIE LF IQ    E  + G DM+GRARTG
Sbjct  92   RAIADSESSGDGLAIAELGISPEIVKALSAKGIEKLFPIQKAVLEPAMQGRDMIGRARTG  151



>ref|XP_002883355.1| hypothetical protein ARALYDRAFT_479746 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59614.1| hypothetical protein ARALYDRAFT_479746 [Arabidopsis lyrata subsp. 
lyrata]
Length=612

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +1

Query  454  EEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            + E D  AI+   IS  + +AL +KGIE LF IQ    E  ++G DM+GRARTG
Sbjct  95   DSESDGLAISELGISPEIVKALSSKGIEKLFPIQKAVLEPAMEGRDMIGRARTG  148



>ref|NP_188872.2| putative mitochondrial RNA helicase 2 [Arabidopsis thaliana]
 sp|Q9LUW5.1|RH53_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 53 [Arabidopsis 
thaliana]
 dbj|BAB01770.1| DEAD-Box RNA helicase-like protein [Arabidopsis thaliana]
 gb|AAL32580.1| DEAD-Box RNA helicase-like protein [Arabidopsis thaliana]
 gb|AAM13255.1| DEAD-Box RNA helicase-like protein [Arabidopsis thaliana]
 gb|AEE76622.1| putative mitochondrial RNA helicase 2 [Arabidopsis thaliana]
Length=616

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 37/60 (62%), Gaps = 5/60 (8%)
 Frame = +1

Query  436  EAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E+VGGD       AI+   IS  + +AL +KGIE LF IQ    E  ++G DM+GRARTG
Sbjct  97   ESVGGDG-----LAISELGISPEIVKALSSKGIEKLFPIQKAVLEPAMEGRDMIGRARTG  151



>ref|XP_011406566.1| PREDICTED: ATP-dependent RNA helicase DDX50-like [Amphimedon 
queenslandica]
Length=371

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  487  FRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +RISK  R+ LK++GI  LF IQ  TF+ + D  D++G+ARTG
Sbjct  44   YRISKVSRKTLKSRGITHLFPIQYKTFDPIYDNKDVIGQARTG  86



>ref|XP_006297190.1| hypothetical protein CARUB_v10013195mg [Capsella rubella]
 gb|EOA30088.1| hypothetical protein CARUB_v10013195mg [Capsella rubella]
Length=636

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 36/60 (60%), Gaps = 1/60 (2%)
 Frame = +1

Query  436  EAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E V GD E  D  AI+   IS  + +AL +KGIE LF IQ    E  + G DM+GRARTG
Sbjct  91   ERVIGDSES-DGLAISELGISPEIVKALSSKGIEKLFPIQKAVLEPAMQGRDMIGRARTG  149



>ref|XP_005297366.1| PREDICTED: nucleolar RNA helicase 2-like [Chrysemys picta bellii]
Length=699

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NF ISK   E L+A+G+  LF +Q  TF+ + DG D+V +ARTG
Sbjct  134  AFSNFCISKGTIELLRARGVTYLFPVQVKTFKHIYDGKDVVAQARTG  180



>ref|XP_009145390.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9 [Brassica rapa]
Length=602

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = +1

Query  436  EAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E+VG      D  AI+   IS  + +AL  +GI+ LF IQ    E  + G DM+GRARTG
Sbjct  103  ESVGSSSNGGDGLAISELGISPEIVKALSGRGIDKLFPIQKAVLEPAMQGRDMIGRARTG  162



>emb|CDY10634.1| BnaA05g17280D [Brassica napus]
Length=602

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = +1

Query  436  EAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E+VG      D  AI+   IS  + +AL  +GI+ LF IQ    E  + G DM+GRARTG
Sbjct  103  ESVGSSSNGGDGLAISELGISPEIVKALSGRGIDKLFPIQKAVLEPAMQGRDMIGRARTG  162



>ref|XP_007054739.1| PREDICTED: nucleolar RNA helicase 2-like [Chelonia mydas]
Length=678

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NF ISK   E L+A+G+  LF +Q  TF+ + DG D+V +ARTG
Sbjct  113  AFSNFCISKETIELLRARGVTYLFPVQVKTFKHIYDGKDVVAQARTG  159



>ref|XP_009993187.1| PREDICTED: nucleolar RNA helicase 2-like [Chaetura pelagica]
Length=681

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NF +S+   + LKA+G++ LF +QA TF+ + DG D++ +ARTG
Sbjct  110  AFSNFPLSQNTIDLLKARGVKYLFPVQAKTFQPIYDGKDLIAQARTG  156



>ref|XP_010295282.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Phaethon lepturus]
Length=703

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EE    A TNF +S+     LKA+G++ LF +Q  TF+ + DG D++ +ARTG
Sbjct  102  EEAKEGAFTNFPLSQDTINLLKARGVKYLFPVQVKTFQPIYDGKDLIAQARTG  154



>ref|XP_009990339.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Tauraco erythrolophus]
Length=581

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EE    A +NF +S+     LKA+G++ LF +QA TF+ + DG D++ +ARTG
Sbjct  4    EEAKEGAFSNFPLSQNTINLLKARGVKYLFPVQAKTFQPIYDGKDLIAQARTG  56



>ref|XP_003079318.1| ATP-dependent RNA helicase (ISS) [Ostreococcus tauri]
Length=683

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +1

Query  460  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            + DP  + NF +S+   +AL+ +G+++LF IQ       +DG D+VGRARTG
Sbjct  21   DADPADVDNFGMSETTVQALRKRGVDALFPIQQAVLRPAMDGQDVVGRARTG  72



>ref|XP_002955657.1| hypothetical protein VOLCADRAFT_66087 [Volvox carteri f. nagariensis]
 gb|EFJ43297.1| hypothetical protein VOLCADRAFT_66087 [Volvox carteri f. nagariensis]
Length=727

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +1

Query  478  ITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +  F +S+ ++  L+++ IESLF IQAMT E  L G D+VGRARTG
Sbjct  104  LDRFPLSEQVKSMLRSQNIESLFPIQAMTLEPGLAGVDVVGRARTG  149



>ref|XP_009674650.1| PREDICTED: nucleolar RNA helicase 2-like [Struthio camelus australis]
Length=597

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 37/62 (60%), Gaps = 3/62 (5%)
 Frame = +1

Query  439  AVGGDEE---EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRAR  609
              GG EE   E    A +NF +SK     LKA+G++ LF +Q  TF+ + DG D++ +AR
Sbjct  11   CAGGPEELTEEAREGAFSNFPLSKNTINLLKARGVKYLFPVQVKTFQPIYDGKDLIAQAR  70

Query  610  TG  615
            TG
Sbjct  71   TG  72



>ref|XP_010511251.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X1 [Camelina sativa]
Length=616

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +1

Query  460  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E D  AI+   IS  + +AL +KGIE LF IQ    E  + G DM+GRARTG
Sbjct  94   ESDGLAISELGISPEIVKALSSKGIEKLFPIQKAVLEPAMQGRDMIGRARTG  145



>ref|XP_010488258.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53 isoform X2 
[Camelina sativa]
Length=628

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +1

Query  460  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E D  AI+   IS  + +AL +KGIE LF IQ    E  + G DM+GRARTG
Sbjct  97   ESDGLAISELGISPEIVKALSSKGIEKLFPIQKAVLEPAMQGRDMIGRARTG  148



>ref|XP_010488257.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53 isoform X1 
[Camelina sativa]
Length=638

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +1

Query  460  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E D  AI+   IS  + +AL +KGIE LF IQ    E  + G DM+GRARTG
Sbjct  97   ESDGLAISELGISPEIVKALSSKGIEKLFPIQKAVLEPAMQGRDMIGRARTG  148



>ref|XP_010511255.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X2 [Camelina sativa]
Length=640

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +1

Query  460  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E D  AI+   IS  + +AL +KGIE LF IQ    E  + G DM+GRARTG
Sbjct  94   ESDGLAISELGISPEIVKALSSKGIEKLFPIQKAVLEPAMQGRDMIGRARTG  145



>ref|XP_008611506.1| hypothetical protein SDRG_07451 [Saprolegnia diclina VS20]
 gb|EQC35222.1| hypothetical protein SDRG_07451 [Saprolegnia diclina VS20]
Length=662

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +1

Query  478  ITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +++FR+      AL+ +GI +LF IQ+MTF+ + D  D++GRARTG
Sbjct  82   VSDFRVGDITIAALEKRGISTLFPIQSMTFDKIYDEFDLIGRARTG  127



>emb|CEF97957.1| Helicase, C-terminal [Ostreococcus tauri]
Length=765

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +1

Query  460  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            + DP  + NF +S+   +AL+ +G+++LF IQ       +DG D+VGRARTG
Sbjct  98   DADPADVDNFGMSETTVQALRKRGVDALFPIQQAVLRPAMDGQDVVGRARTG  149



>ref|XP_006297246.1| hypothetical protein CARUB_v10013251mg [Capsella rubella]
 gb|EOA30144.1| hypothetical protein CARUB_v10013251mg [Capsella rubella]
Length=609

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            AI+   IS  + +ALKA+GIE LF IQ    E  + G DM+GRARTG
Sbjct  119  AISELGISPEIVKALKARGIEKLFPIQKAVLEPAMQGRDMIGRARTG  165



>ref|XP_004334405.1| DEAD/DEAH box helicase domain containing protein [Acanthamoeba 
castellanii str. Neff]
 gb|ELR12392.1| DEAD/DEAH box helicase domain containing protein [Acanthamoeba 
castellanii str. Neff]
Length=723

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +1

Query  481  TNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            ++FRIS    + L+ +G + LF IQA T++ + DG D++GRARTG
Sbjct  119  SDFRISPTTVKLLQDRGFKCLFAIQAQTYDHIYDGKDIIGRARTG  163



>gb|KDO19871.1| hypothetical protein SPRG_14901 [Saprolegnia parasitica CBS 223.65]
Length=648

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +1

Query  478  ITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            +++FR+      AL+ +GI +LF IQ+MTF+ + D  D++GRARTG
Sbjct  83   VSDFRVGDITIAALEKRGISTLFPIQSMTFDKIYDEFDLIGRARTG  128



>ref|XP_010488255.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9-like isoform 
X2 [Camelina sativa]
Length=594

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            AI+   IS  + +ALKA+GIE LF IQ    E  + G DM+GRARTG
Sbjct  120  AISELGISPEIVKALKARGIEKLFPIQKAVLEPAMQGRDMIGRARTG  166



>ref|XP_010488254.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9-like isoform 
X1 [Camelina sativa]
Length=606

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            AI+   IS  + +ALKA+GIE LF IQ    E  + G DM+GRARTG
Sbjct  120  AISELGISPEIVKALKARGIEKLFPIQKAVLEPAMQGRDMIGRARTG  166



>gb|KFK39521.1| hypothetical protein AALP_AA3G255300 [Arabis alpina]
Length=606

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +1

Query  466  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            D  AI+   IS  + +ALK +GIE LF IQ    E  + G DM+GRARTG
Sbjct  117  DGLAISELGISPEIVKALKGRGIEKLFPIQKAVLEPAMQGRDMIGRARTG  166



>ref|XP_009865080.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Apaloderma 
vittatum]
Length=575

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EE    A +NF +S+     LKA+G++ LF +Q  TFE + DG D++ +ARTG
Sbjct  4    EEAKEGAFSNFPLSQNTINLLKARGVKYLFPVQVRTFEPIYDGKDLIAQARTG  56



>ref|XP_005009180.1| PREDICTED: nucleolar RNA helicase 2 [Anas platyrhynchos]
Length=728

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EE+   A +NF ISK   E L+A+G+  LF +Q  TF  V  G D++ +ARTG
Sbjct  148  EEQKEGAFSNFPISKGTVELLQARGVTYLFPVQVKTFHPVFSGKDVIAQARTG  200



>ref|XP_009108947.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Brassica 
rapa]
Length=617

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 32/60 (53%), Gaps = 0/60 (0%)
 Frame = +1

Query  436  EAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
             A+   E   D  AI    IS  + +AL AKGIE LF IQ    E    G DM+GRARTG
Sbjct  88   RAIADSESSGDGLAIAELGISPEIVKALSAKGIEKLFPIQKAVLEPATQGRDMIGRARTG  147



>gb|EOB09008.1| Nucleolar RNA helicase 2, partial [Anas platyrhynchos]
Length=592

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EE+   A +NF ISK   E L+A+G+  LF +Q  TF  V  G D++ +ARTG
Sbjct  94   EEQKEGAFSNFPISKGTVELLQARGVTYLFPVQVKTFHPVFSGKDVIAQARTG  146



>gb|KFH66922.1| hypothetical protein MVEG_07447 [Mortierella verticillata NRRL 
6337]
Length=687

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 37/59 (63%), Gaps = 2/59 (3%)
 Frame = +1

Query  445  GGDEEEEDP--YAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            G   E E P    +T+++IS    +AL  +GI+SLF IQA  F  + +G D++GRARTG
Sbjct  104  GATVENEIPENLRLTSYKISLSTVDALAKRGIKSLFPIQAEVFNPIYNGNDVLGRARTG  162



>ref|XP_009919521.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Haliaeetus 
albicilla]
Length=238

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EE    A +NF +S+     LKA+G++ LF +Q  TF+ + DG D++ +ARTG
Sbjct  56   EEAKEGAFSNFPLSQNTINLLKARGVKYLFPVQVKTFQPIYDGKDLIAQARTG  108



>gb|EDL92964.1| rCG22008, isoform CRA_a [Rattus norvegicus]
Length=283

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NF IS+   + LKA+G+  LF IQA TF  V  G D++ +ARTG
Sbjct  183  AFSNFPISEETVKLLKARGVNFLFPIQAKTFHHVYSGKDLIAQARTG  229



>ref|XP_010158185.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Eurypyga helias]
Length=582

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EE+   A +NF ISK   + L+A+G+  LF +Q  TF++V  G D++ +ARTG
Sbjct  4    EEQKEGAFSNFPISKETVQLLQARGVTYLFPVQVKTFKSVFSGKDVIAQARTG  56



>ref|XP_009487807.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Pelecanus 
crispus]
Length=581

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EE    A +NF +S+     LKA+G++ LF +Q  TF+ V DG D++ +ARTG
Sbjct  4    EEAKEGAFSNFPLSQDTLNLLKARGVKYLFPVQVKTFQPVYDGKDLIAQARTG  56



>ref|XP_008943828.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Merops nubicus]
Length=599

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EEE   A +NF +S+     L+A+G++ LF +Q  TF+ + DG D++ +ARTG
Sbjct  21   EEEKEGAFSNFPLSQNTISLLRARGVKYLFPVQVKTFQPIYDGKDVIAQARTG  73



>ref|XP_004386445.1| PREDICTED: nucleolar RNA helicase 2 [Trichechus manatus latirostris]
Length=787

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  460  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EE   A +NF IS+   + LKA+G+  LF IQA TF  V  G D++ +ARTG
Sbjct  184  EEKEGAFSNFPISEVTVKLLKARGVNFLFPIQAKTFHHVYSGKDLIAQARTG  235



>ref|XP_009892319.1| PREDICTED: nucleolar RNA helicase 2-like [Charadrius vociferus]
Length=682

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EE+   A +NF ISK   + L+A+G+  LF +Q  TF++V  G D++ +ARTG
Sbjct  102  EEQKEGAFSNFPISKGTVQLLQARGVTYLFPVQVKTFDSVYSGKDVIAQARTG  154



>gb|ERE87186.1| nucleolar RNA helicase 2-like protein [Cricetulus griseus]
Length=648

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NF IS+   + LKA+G+  LF IQA TF  V  G D++ +ARTG
Sbjct  139  AFSNFPISQETVKLLKARGVNFLFPIQAKTFHHVYSGKDLIAQARTG  185



>ref|XP_010164383.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Caprimulgus 
carolinensis]
Length=630

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EE    A +NF IS+     LKA+G++ LF +Q  TF+ + DG D++ +ARTG
Sbjct  53   EEAKEGAFSNFPISEDTINLLKARGVKYLFPVQVKTFQPIYDGKDLIAQARTG  105



>gb|EPY22928.1| nucleolar RNA helicase II [Strigomonas culicis]
 gb|EPY23267.1| nucleolar RNA helicase II [Strigomonas culicis]
Length=672

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  487  FRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            F ++  + +ALKAKGI++LF +QA+TF+A++ G D++ +ARTG
Sbjct  87   FDLTADMVKALKAKGIDALFPVQALTFDAIMKGKDVLVQARTG  129



>ref|XP_845112.1| nucleolar RNA helicase II [Trypanosoma brucei brucei TREU927]
 gb|AAX70758.1| nucleolar RNA helicase II, putative [Trypanosoma brucei]
 gb|AAX80591.1| nucleolar RNA helicase II, putative [Trypanosoma brucei]
 gb|AAZ11553.1| nucleolar RNA helicase II, putative [Trypanosoma brucei brucei 
TREU927]
 emb|CBH11456.1| nucleolar RNA helicase Gu, putative [Trypanosoma brucei gambiense 
DAL972]
Length=632

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 43/68 (63%), Gaps = 8/68 (12%)
 Frame = +1

Query  436  EAVGGDEEEEDP--------YAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTD  591
            E  G +E +++P           + F +S  + +AL+A+GI SLF +QA+TFEA++ G D
Sbjct  25   EMTGNEETDQEPNNGSAAVGRPFSEFNLSSGMVKALEAQGIVSLFPVQALTFEAIMRGED  84

Query  592  MVGRARTG  615
            ++ +ARTG
Sbjct  85   VLVQARTG  92



>ref|XP_003409350.1| PREDICTED: nucleolar RNA helicase 2 [Loxodonta africana]
Length=787

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NF IS+   + LKA+G+  LF IQA TF  V  G D++ +ARTG
Sbjct  189  AFSNFPISEATVKLLKARGVNFLFPIQAKTFHHVYSGKDLIAQARTG  235



>ref|NP_188870.1| DEAD-box ATP-dependent RNA helicase [Arabidopsis thaliana]
 sp|Q9LUW6.1|RH9_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 9 [Arabidopsis 
thaliana]
 dbj|BAB01768.1| DEAD-Box RNA helicase-like protein [Arabidopsis thaliana]
 gb|AAM14042.1| putative RNA helicase [Arabidopsis thaliana]
 gb|AEE76620.1| DEAD-box ATP-dependent RNA helicase [Arabidopsis thaliana]
Length=610

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            AI +  IS  + +ALK +GIE LF IQ    E  ++G DM+GRARTG
Sbjct  117  AIADLGISPEIVKALKGRGIEKLFPIQKAVLEPAMEGRDMIGRARTG  163



>ref|XP_010466510.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9-like [Camelina 
sativa]
Length=605

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            AI+   IS  + ++LKA+GIE LF IQ    E  ++G DM+GRARTG
Sbjct  119  AISELGISPEIVKSLKARGIEKLFPIQKAVLEPAMEGRDMIGRARTG  165



>ref|XP_001519340.2| PREDICTED: nucleolar RNA helicase 2 [Ornithorhynchus anatinus]
Length=771

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NF ISK   + LKA+G+  LF IQA TF  V  G D++ +ARTG
Sbjct  187  AFSNFSISKETIQLLKARGVTYLFPIQAKTFGHVSSGKDVIAQARTG  233



>ref|XP_005235246.1| PREDICTED: nucleolar RNA helicase 2-like [Falco peregrinus]
Length=670

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EE    A +NF +S+     LKA+GI+ LF +Q  TF+ + DG D++ +ARTG
Sbjct  93   EEAKEGAFSNFPLSQNTINLLKARGIKYLFPVQVKTFQPIYDGKDVIAQARTG  145



>emb|CCA17723.1| DEAD/DEAH box RNA helicase putative [Albugo laibachii Nc14]
 emb|CCA18369.1| DEAD/DEAH box RNA helicase putative [Albugo laibachii Nc14]
Length=660

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            ++ +F I    ++ LK  GI +LF IQAMTF+ ++DG +++GRARTG
Sbjct  96   SLDDFAICAQTKKNLKKHGIANLFPIQAMTFDKIMDGNNLIGRARTG  142



>ref|XP_009814524.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Gavia stellata]
Length=635

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EE    A +NF +S+     LKA+G++ LF +Q  TF+ + DG D++ +ARTG
Sbjct  58   EEAKEGAFSNFPLSQNTINLLKARGVKYLFPVQVKTFQPIYDGKDLIAQARTG  110



>ref|XP_005433605.1| PREDICTED: nucleolar RNA helicase 2-like [Falco cherrug]
Length=675

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EE    A +NF +S+     LKA+GI+ LF +Q  TF+ + DG D++ +ARTG
Sbjct  98   EEAKEGAFSNFPLSQNTINLLKARGIKYLFPVQVKTFQPIYDGKDVIAQARTG  150



>ref|XP_009635263.1| PREDICTED: nucleolar RNA helicase 2-like [Egretta garzetta]
Length=617

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NF +S+   + LKA+G++ LF +Q  TF+ + DG D++ +ARTG
Sbjct  46   AFSNFPLSQNTIDLLKARGVKYLFPVQVKTFQPIYDGKDLIAQARTG  92



>gb|EGV93789.1| Nucleolar RNA helicase 2 [Cricetulus griseus]
Length=729

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NF IS+   + LKA+G+  LF IQA TF  V  G D++ +ARTG
Sbjct  139  AFSNFPISQETVKLLKARGVNFLFPIQAKTFHHVYSGKDLIAQARTG  185



>ref|XP_007638831.1| PREDICTED: nucleolar RNA helicase 2 [Cricetulus griseus]
 ref|XP_007611794.1| PREDICTED: nucleolar RNA helicase 2 [Cricetulus griseus]
Length=772

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NF IS+   + LKA+G+  LF IQA TF  V  G D++ +ARTG
Sbjct  182  AFSNFPISQETVKLLKARGVNFLFPIQAKTFHHVYSGKDLIAQARTG  228



>ref|XP_002130533.1| PREDICTED: nucleolar RNA helicase 2 [Ciona intestinalis]
Length=672

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 3/58 (5%)
 Frame = +1

Query  451  DEEEEDPYAI---TNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            D +++ P A+    NFRI++  +  LK KG+  LF IQ  +F  V DG D+V +ARTG
Sbjct  80   DIDDQSPEALGDFNNFRITEQTKVLLKKKGVAYLFPIQIQSFNHVYDGKDVVAQARTG  137



>ref|XP_006889064.1| PREDICTED: nucleolar RNA helicase 2 [Elephantulus edwardii]
Length=786

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NF IS+   + LKA+G+  LF IQA TF  V  G D++ +ARTG
Sbjct  189  AFSNFPISEVTIKLLKARGVNYLFPIQAKTFHHVYSGKDLIAQARTG  235



>ref|XP_010197456.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Colius striatus]
Length=350

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A++NF ISK   + L+A+G+  LF +Q  TF+ V  G D++ +ARTG
Sbjct  99   ALSNFPISKATVQLLQARGVTYLFPVQVKTFDPVYSGKDVIAQARTG  145



>ref|XP_009288813.1| PREDICTED: nucleolar RNA helicase 2-like [Aptenodytes forsteri]
Length=615

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EE    A +NF +S+     LKA+G++ LF +Q  TF+ + DG D++ +ARTG
Sbjct  38   EEAKEGAFSNFPLSQNTINLLKARGVKYLFPVQVKTFQPIYDGKDLIAQARTG  90



>ref|XP_009324263.1| PREDICTED: nucleolar RNA helicase 2-like [Pygoscelis adeliae]
Length=711

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EE    A +NF +S+     LKA+G++ LF +Q  TF+ + DG D++ +ARTG
Sbjct  134  EEAKEGAFSNFPLSQNTINLLKARGVKYLFPVQVKTFQPIYDGKDLIAQARTG  186



>ref|XP_002461445.1| hypothetical protein SORBIDRAFT_02g002790 [Sorghum bicolor]
 gb|EER97966.1| hypothetical protein SORBIDRAFT_02g002790 [Sorghum bicolor]
Length=602

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 32/60 (53%), Gaps = 0/60 (0%)
 Frame = +1

Query  436  EAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E VG D   E+   I    IS  + E L A+GI  LF IQ    E  + G DM+GRARTG
Sbjct  74   EGVGVDTGAEEGLEIARLWISPRIVEKLAARGITKLFPIQRAVLEPAMQGKDMIGRARTG  133



>ref|XP_010153144.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Eurypyga helias]
Length=592

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EE    A +NF +S+     LKA+G++ LF +Q  TF+ + DG D++ +ARTG
Sbjct  40   EEAKEGAFSNFPLSQNTINLLKARGVKYLFPVQVKTFQPIYDGKDLIAQARTG  92



>ref|XP_005153742.1| PREDICTED: nucleolar RNA helicase 2-like [Melopsittacus undulatus]
Length=711

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EE+   A +NF ISK   + L+A+G+  LF +Q  TF  V  G D++ +ARTG
Sbjct  128  EEQKEGAFSNFSISKGTVQLLQARGVTYLFPVQVKTFNPVYSGKDVIAQARTG  180



>ref|XP_010297376.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Balearica 
regulorum gibbericeps]
Length=556

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EE    A +NF +S+     LKA+G++ LF +Q  TF+ + DG D++ +ARTG
Sbjct  4    EEAKEGAFSNFPLSQNTINLLKARGVKYLFPVQVKTFQPIYDGKDLIAQARTG  56



>ref|XP_006972790.1| PREDICTED: nucleolar RNA helicase 2 [Peromyscus maniculatus bairdii]
Length=783

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  460  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E+   A +NF IS+   + LKA+G+  LF IQA TF  V  G D++ +ARTG
Sbjct  178  EQKEGAFSNFPISEETVKLLKARGVNFLFPIQAKTFHHVFSGKDLIAQARTG  229



>ref|XP_010578315.1| PREDICTED: nucleolar RNA helicase 2-like [Haliaeetus leucocephalus]
Length=702

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EE    A +NF +S+     LKA+G++ LF +Q  TF+ + DG D++ +ARTG
Sbjct  116  EEAKEGAFSNFPLSQNTINLLKARGVKYLFPVQVKTFQPIYDGKDLIAQARTG  168



>ref|XP_010466515.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X3 [Camelina sativa]
Length=631

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = +1

Query  460  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E D   I+   IS  + +AL +KGIE LF IQ    E  + G DM+GRARTG
Sbjct  97   ESDGLVISELGISPEIVKALSSKGIEKLFPIQKAVLEPAMQGRDMIGRARTG  148



>ref|XP_010466514.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X2 [Camelina sativa]
Length=635

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = +1

Query  460  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E D   I+   IS  + +AL +KGIE LF IQ    E  + G DM+GRARTG
Sbjct  97   ESDGLVISELGISPEIVKALSSKGIEKLFPIQKAVLEPAMQGRDMIGRARTG  148



>ref|XP_010466512.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X1 [Camelina sativa]
Length=645

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = +1

Query  460  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            E D   I+   IS  + +AL +KGIE LF IQ    E  + G DM+GRARTG
Sbjct  97   ESDGLVISELGISPEIVKALSSKGIEKLFPIQKAVLEPAMQGRDMIGRARTG  148



>ref|XP_010011653.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Nestor notabilis]
Length=675

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +1

Query  457  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            EE+   A +NF ISK   + L+A+G+  LF +Q  TF  V  G D++ +ARTG
Sbjct  93   EEQKEGAFSNFSISKGTVQLLQARGVTYLFPVQVKTFNPVYSGKDVIAQARTG  145



>ref|XP_009949129.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Leptosomus 
discolor]
Length=723

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +1

Query  478  ITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
             +NF +S+     LKA+G++ LF +QA TF+ + DG D++ +ARTG
Sbjct  107  FSNFPLSQNTINLLKARGVKYLFPVQAKTFQPIYDGKDLIAQARTG  152



>ref|XP_009905459.1| PREDICTED: nucleolar RNA helicase 2-like [Picoides pubescens]
Length=728

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NF +S+     LKA+G++ LF +Q  TF+ + DG D++ +ARTG
Sbjct  155  AFSNFPLSQNTINLLKARGVKYLFPVQVTTFQPIYDGKDVIAQARTG  201



>ref|XP_004624414.1| PREDICTED: nucleolar RNA helicase 2 [Octodon degus]
Length=801

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  475  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  615
            A +NF IS+   + LKA+G+  LF IQA TF  V  G D++ +ARTG
Sbjct  182  AFSNFPISEETVKLLKARGVTFLFPIQAKTFHHVYSGKDLIAQARTG  228



Lambda      K        H        a         alpha
   0.316    0.131    0.370    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090