BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS025C05

Length=608
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009595864.1|  PREDICTED: monosaccharide-sensing protein 2        200   2e-56   Nicotiana tomentosiformis
ref|XP_009796447.1|  PREDICTED: monosaccharide-sensing protein 2-...    200   4e-56   Nicotiana sylvestris
ref|XP_006342166.1|  PREDICTED: monosaccharide-sensing protein 2-...    199   6e-56   Solanum tuberosum [potatoes]
ref|NP_001289848.1|  monosaccharide-sensing protein 2                   199   9e-56   Solanum lycopersicum
ref|XP_011074068.1|  PREDICTED: monosaccharide-sensing protein 2-...    198   2e-55   Sesamum indicum [beniseed]
ref|XP_007135975.1|  hypothetical protein PHAVU_009G007600g             195   1e-54   Phaseolus vulgaris [French bean]
emb|CDP07261.1|  unnamed protein product                                195   2e-54   Coffea canephora [robusta coffee]
gb|KDO85211.1|  hypothetical protein CISIN_1g004673mg                   194   2e-54   Citrus sinensis [apfelsine]
ref|XP_003527273.1|  PREDICTED: monosaccharide-sensing protein 2-...    195   2e-54   Glycine max [soybeans]
gb|KHN33775.1|  Monosaccharide-sensing protein 2                        194   3e-54   Glycine soja [wild soybean]
ref|XP_006577928.1|  PREDICTED: monosaccharide-sensing protein 2-...    194   4e-54   Glycine max [soybeans]
ref|XP_010094525.1|  Monosaccharide-sensing protein 2                   194   4e-54   Morus notabilis
ref|XP_006435423.1|  hypothetical protein CICLE_v10000400mg             193   1e-53   Citrus clementina [clementine]
gb|KDO85208.1|  hypothetical protein CISIN_1g004673mg                   192   1e-53   Citrus sinensis [apfelsine]
ref|XP_011100175.1|  PREDICTED: monosaccharide-sensing protein 2-...    192   2e-53   Sesamum indicum [beniseed]
ref|XP_007018119.1|  Tonoplast monosaccharide transporter2 isoform 1    189   2e-52   
ref|XP_007018122.1|  Tonoplast monosaccharide transporter2 isoform 4    189   2e-52   
gb|KDP36756.1|  hypothetical protein JCGZ_08047                         189   3e-52   Jatropha curcas
ref|XP_003603868.1|  Monosaccharide-sensing protein                     189   4e-52   Medicago truncatula
gb|KJB14183.1|  hypothetical protein B456_002G113400                    187   4e-52   Gossypium raimondii
gb|KJB14182.1|  hypothetical protein B456_002G113400                    186   4e-52   Gossypium raimondii
ref|XP_010061214.1|  PREDICTED: monosaccharide-sensing protein 2-...    188   6e-52   Eucalyptus grandis [rose gum]
gb|KHG10189.1|  Monosaccharide-sensing 2 -like protein                  188   7e-52   Gossypium arboreum [tree cotton]
dbj|BAK00015.1|  predicted protein                                      177   2e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004500833.1|  PREDICTED: monosaccharide-sensing protein 2-...    186   3e-51   Cicer arietinum [garbanzo]
gb|KJB14177.1|  hypothetical protein B456_002G113400                    186   4e-51   Gossypium raimondii
ref|XP_004300112.1|  PREDICTED: monosaccharide-sensing protein 2        186   4e-51   Fragaria vesca subsp. vesca
ref|XP_006416357.1|  hypothetical protein EUTSA_v10006916mg             185   5e-51   Eutrema salsugineum [saltwater cress]
dbj|BAJ33724.1|  unnamed protein product                                185   6e-51   Eutrema halophilum
ref|XP_010539774.1|  PREDICTED: monosaccharide-sensing protein 1-...    185   8e-51   Tarenaya hassleriana [spider flower]
gb|AAX47312.1|  hexose transporter 6                                    185   9e-51   Vitis vinifera
emb|CAN59780.1|  hypothetical protein VITISV_024656                     184   9e-51   Vitis vinifera
emb|CBI40753.3|  unnamed protein product                                184   1e-50   Vitis vinifera
ref|XP_002510716.1|  sugar transporter, putative                        184   1e-50   Ricinus communis
ref|NP_001267873.1|  hexose transporter-like                            184   1e-50   Vitis vinifera
emb|CDY31497.1|  BnaC05g16060D                                          183   1e-50   Brassica napus [oilseed rape]
ref|XP_008373385.1|  PREDICTED: monosaccharide-sensing protein 2-...    184   2e-50   
ref|XP_009149562.1|  PREDICTED: monosaccharide-sensing protein 1        183   3e-50   Brassica rapa
emb|CDY29502.1|  BnaA06g14680D                                          183   3e-50   Brassica napus [oilseed rape]
ref|XP_010537220.1|  PREDICTED: monosaccharide-sensing protein 1-...    182   4e-50   Tarenaya hassleriana [spider flower]
emb|CDY33650.1|  BnaC08g19500D                                          182   6e-50   Brassica napus [oilseed rape]
ref|XP_011034826.1|  PREDICTED: monosaccharide-sensing protein 2-...    181   1e-49   Populus euphratica
gb|AIQ77649.1|  tonoplastic transporter 1                               181   2e-49   Vitis vinifera
ref|XP_009372620.1|  PREDICTED: monosaccharide-sensing protein 2        181   3e-49   Pyrus x bretschneideri [bai li]
ref|XP_002307812.1|  hypothetical protein POPTR_0005s27680g             180   3e-49   Populus trichocarpa [western balsam poplar]
emb|CAA90628.1|  sugar transporter                                      180   3e-49   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173508.1|  tonoplast monosaccharide transporter1                 180   3e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009110209.1|  PREDICTED: monosaccharide-sensing protein 1        180   3e-49   Brassica rapa
ref|XP_011041174.1|  PREDICTED: monosaccharide-sensing protein 2-...    180   4e-49   Populus euphratica
ref|XP_006306868.1|  hypothetical protein CARUB_v10008415mg             180   4e-49   
gb|AAD30608.1|AC007369_18  Sugar transporter                            180   4e-49   Arabidopsis thaliana [mouse-ear cress]
emb|CDX96618.1|  BnaA08g21610D                                          180   4e-49   
emb|CBI21577.3|  unnamed protein product                                179   4e-49   Vitis vinifera
ref|XP_002300629.1|  hypothetical protein POPTR_0002s00760g             180   5e-49   Populus trichocarpa [western balsam poplar]
ref|XP_002893133.1|  hypothetical protein ARALYDRAFT_472320             180   5e-49   
ref|XP_002276373.1|  PREDICTED: monosaccharide-sensing protein 2        179   6e-49   Vitis vinifera
ref|XP_010686712.1|  PREDICTED: monosaccharide-sensing protein 2        179   7e-49   Beta vulgaris subsp. vulgaris [field beet]
gb|EAY85098.1|  hypothetical protein OsI_06450                          179   1e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_003571780.1|  PREDICTED: monosaccharide-sensing protein 2-...    179   1e-48   Brachypodium distachyon [annual false brome]
gb|EMT06669.1|  Monosaccharide-sensing protein 2                        179   1e-48   
gb|EAZ22316.1|  hypothetical protein OsJ_05971                          179   1e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010477336.1|  PREDICTED: monosaccharide-sensing protein 1        178   2e-48   Camelina sativa [gold-of-pleasure]
gb|EMS49950.1|  Monosaccharide-sensing protein 2                        178   2e-48   Triticum urartu
dbj|BAJ89532.1|  predicted protein                                      178   2e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDI66591.1|  putative sugar transporter type 2a protein             178   2e-48   Saccharum hybrid cultivar R570
emb|CDI66586.1|  putative sugar transporter type 2a protein             177   3e-48   Saccharum hybrid cultivar R570
ref|NP_001046359.1|  Os02g0229400                                       177   3e-48   
ref|XP_009390770.1|  PREDICTED: monosaccharide-sensing protein 2-...    177   4e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009401004.1|  PREDICTED: monosaccharide-sensing protein 2-...    177   5e-48   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU43534.1|  hypothetical protein MIMGU_mgv1a001953mg                177   5e-48   Erythranthe guttata [common monkey flower]
ref|XP_009397963.1|  PREDICTED: monosaccharide-sensing protein 2-...    177   5e-48   
ref|XP_010063149.1|  PREDICTED: monosaccharide-sensing protein 2-...    177   5e-48   Eucalyptus grandis [rose gum]
ref|XP_006855646.1|  hypothetical protein AMTR_s00044p00110510          176   9e-48   
ref|XP_010909820.1|  PREDICTED: monosaccharide-sensing protein 2-...    176   9e-48   Elaeis guineensis
ref|XP_006647093.1|  PREDICTED: monosaccharide-sensing protein 2-...    175   3e-47   Oryza brachyantha
gb|AJO70165.1|  tonoplast monosaccharide transporters 1                 174   4e-47   Camellia sinensis [black tea]
ref|XP_007204446.1|  hypothetical protein PRUPE_ppa026426mg             174   5e-47   Prunus persica
ref|XP_008242106.1|  PREDICTED: monosaccharide-sensing protein 2-...    174   6e-47   Prunus mume [ume]
ref|XP_008237926.1|  PREDICTED: monosaccharide-sensing protein 2        174   6e-47   Prunus mume [ume]
ref|XP_010029562.1|  PREDICTED: monosaccharide-sensing protein 2-...    174   6e-47   Eucalyptus grandis [rose gum]
ref|XP_010940242.1|  PREDICTED: monosaccharide-sensing protein 2-...    174   7e-47   Elaeis guineensis
ref|XP_008778122.1|  PREDICTED: monosaccharide-sensing protein 2-...    174   8e-47   
ref|XP_008351570.1|  PREDICTED: monosaccharide-sensing protein 2-...    164   1e-46   
gb|KJB79727.1|  hypothetical protein B456_013G064200                    172   2e-46   Gossypium raimondii
emb|CDP14489.1|  unnamed protein product                                172   2e-46   Coffea canephora [robusta coffee]
gb|EMT29091.1|  Monosaccharide-sensing protein 2                        172   3e-46   
gb|EMS63940.1|  Monosaccharide-sensing protein 2                        172   3e-46   Triticum urartu
gb|AAP54842.2|  hexose transporter, putative, expressed                 169   3e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006364349.1|  PREDICTED: monosaccharide-sensing protein 2-...    164   4e-46   
ref|XP_007210337.1|  hypothetical protein PRUPE_ppa001932mg             171   5e-46   Prunus persica
gb|KJB79728.1|  hypothetical protein B456_013G064200                    171   6e-46   Gossypium raimondii
gb|KHG05233.1|  Monosaccharide-sensing 2 -like protein                  171   6e-46   Gossypium arboreum [tree cotton]
ref|XP_004951395.1|  PREDICTED: monosaccharide-sensing protein 2-...    171   7e-46   Setaria italica
ref|XP_010906859.1|  PREDICTED: monosaccharide-sensing protein 2-...    169   2e-45   
dbj|BAJ90138.1|  predicted protein                                      170   2e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAD58958.1|  hexose transporter                                     170   2e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007142576.1|  hypothetical protein PHAVU_008G292400g             170   2e-45   Phaseolus vulgaris [French bean]
ref|XP_010680636.1|  PREDICTED: monosaccharide-sensing protein 2-...    169   3e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002467580.1|  hypothetical protein SORBIDRAFT_01g030430          169   3e-45   Sorghum bicolor [broomcorn]
ref|XP_010266258.1|  PREDICTED: monosaccharide-sensing protein 2 ...    168   4e-45   
ref|NP_001065182.1|  Os10g0539900                                       169   5e-45   
ref|XP_011000869.1|  PREDICTED: monosaccharide-sensing protein 2-...    169   5e-45   Populus euphratica
gb|EEC67373.1|  hypothetical protein OsI_34495                          168   6e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_009763350.1|  PREDICTED: monosaccharide-sensing protein 2-...    168   7e-45   Nicotiana sylvestris
ref|XP_009608796.1|  PREDICTED: monosaccharide-sensing protein 2-...    168   7e-45   Nicotiana tomentosiformis
ref|XP_010266257.1|  PREDICTED: monosaccharide-sensing protein 2 ...    167   1e-44   Nelumbo nucifera [Indian lotus]
ref|XP_007043079.1|  Tonoplast monosaccharide transporter2              167   1e-44   
ref|XP_003574265.1|  PREDICTED: monosaccharide-sensing protein 2-...    167   1e-44   Brachypodium distachyon [annual false brome]
ref|XP_008645619.1|  PREDICTED: monosaccharide-sensing protein 2-...    166   3e-44   Zea mays [maize]
ref|XP_002520608.1|  sugar transporter, putative                        166   6e-44   Ricinus communis
gb|EMT28528.1|  Monosaccharide-sensing protein 3                        164   6e-44   
gb|KJB77474.1|  hypothetical protein B456_012G139000                    165   6e-44   Gossypium raimondii
ref|XP_008349018.1|  PREDICTED: monosaccharide-sensing protein 2-...    158   7e-44   
ref|XP_010090703.1|  Monosaccharide-sensing protein 2                   165   1e-43   Morus notabilis
gb|KHG04801.1|  Monosaccharide-sensing protein 2                        165   1e-43   Gossypium arboreum [tree cotton]
gb|KDO68405.1|  hypothetical protein CISIN_1g004750mg                   164   1e-43   Citrus sinensis [apfelsine]
gb|KJB77472.1|  hypothetical protein B456_012G139000                    164   1e-43   Gossypium raimondii
gb|KJB12352.1|  hypothetical protein B456_002G014400                    163   2e-43   Gossypium raimondii
ref|XP_002282975.1|  PREDICTED: monosaccharide-sensing protein 2        164   2e-43   Vitis vinifera
emb|CAN80213.1|  hypothetical protein VITISV_042076                     164   2e-43   Vitis vinifera
gb|AFP89954.1|  tonoplastic transporter 2                               164   2e-43   Vitis vinifera
ref|XP_002312798.1|  transporter-related family protein                 164   2e-43   
emb|CBI37732.3|  unnamed protein product                                163   2e-43   Vitis vinifera
ref|XP_010548175.1|  PREDICTED: monosaccharide-sensing protein 2        164   2e-43   Tarenaya hassleriana [spider flower]
ref|XP_006486570.1|  PREDICTED: monosaccharide-sensing protein 2-...    164   2e-43   Citrus sinensis [apfelsine]
dbj|BAI94493.1|  sugar transporter                                      164   2e-43   Dianthus caryophyllus [carnation]
gb|KCW64229.1|  hypothetical protein EUGRSUZ_G01880                     164   2e-43   Eucalyptus grandis [rose gum]
gb|KDP47010.1|  hypothetical protein JCGZ_10737                         164   3e-43   Jatropha curcas
ref|XP_010066352.1|  PREDICTED: monosaccharide-sensing protein 2-...    164   3e-43   Eucalyptus grandis [rose gum]
ref|NP_001151936.1|  LOC100285573                                       164   3e-43   Zea mays [maize]
ref|XP_009776539.1|  PREDICTED: monosaccharide-sensing protein 2-...    164   3e-43   Nicotiana sylvestris
ref|XP_006422393.1|  hypothetical protein CICLE_v10027893mg             164   3e-43   
gb|KDO68402.1|  hypothetical protein CISIN_1g004750mg                   164   3e-43   Citrus sinensis [apfelsine]
ref|XP_010678631.1|  PREDICTED: monosaccharide-sensing protein 2-...    163   4e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008812559.1|  PREDICTED: monosaccharide-sensing protein 2-...    163   4e-43   Phoenix dactylifera
gb|KJB12351.1|  hypothetical protein B456_002G014400                    163   4e-43   Gossypium raimondii
gb|EPS65490.1|  hypothetical protein M569_09283                         163   4e-43   Genlisea aurea
ref|XP_007201798.1|  hypothetical protein PRUPE_ppa001957mg             163   4e-43   Prunus persica
ref|XP_009340799.1|  PREDICTED: monosaccharide-sensing protein 2-...    163   5e-43   Pyrus x bretschneideri [bai li]
gb|KJB12354.1|  hypothetical protein B456_002G014400                    163   5e-43   Gossypium raimondii
gb|AAO37640.1|  putative sugar transporter type 2a                      163   5e-43   Saccharum hybrid cultivar Q117
ref|NP_190717.1|  tonoplast monosaccharide transporter3                 162   7e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195256.3|  monosaccharide-sensing protein 2                      162   7e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_849565.1|  monosaccharide-sensing protein 2                      162   7e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190054.1|  tonoplast monosaccharide transporter3              162   7e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008235816.1|  PREDICTED: monosaccharide-sensing protein 2        162   7e-43   Prunus mume [ume]
gb|KFK34392.1|  hypothetical protein AALP_AA5G139300                    162   8e-43   Arabis alpina [alpine rockcress]
ref|XP_006283193.1|  hypothetical protein CARUB_v10004225mg             162   8e-43   Capsella rubella
ref|XP_009333794.1|  PREDICTED: monosaccharide-sensing protein 2-...    162   8e-43   
ref|XP_009341490.1|  PREDICTED: monosaccharide-sensing protein 2-...    162   9e-43   Pyrus x bretschneideri [bai li]
ref|XP_002867077.1|  hypothetical protein ARALYDRAFT_491117             162   1e-42   
gb|EYU40481.1|  hypothetical protein MIMGU_mgv1a001997mg                162   1e-42   Erythranthe guttata [common monkey flower]
ref|XP_006384856.1|  transporter-related family protein                 162   1e-42   
ref|XP_002877807.1|  predicted protein                                  161   2e-42   
ref|XP_011099908.1|  PREDICTED: monosaccharide-sensing protein 2-...    161   2e-42   Sesamum indicum [beniseed]
ref|XP_009589978.1|  PREDICTED: monosaccharide-sensing protein 2-...    161   2e-42   Nicotiana tomentosiformis
ref|XP_009775817.1|  PREDICTED: monosaccharide-sensing protein 2-...    160   3e-42   Nicotiana sylvestris
ref|XP_004144248.1|  PREDICTED: monosaccharide-sensing protein 2-...    161   3e-42   Cucumis sativus [cucumbers]
gb|AIN39841.1|  hypothetical protein                                    161   3e-42   Zoysia matrella [Japanese carpet grass]
emb|CDX69128.1|  BnaC01g03250D                                          160   3e-42   
emb|CDY65623.1|  BnaCnng48010D                                          160   3e-42   Brassica napus [oilseed rape]
ref|XP_009622210.1|  PREDICTED: monosaccharide-sensing protein 2-...    160   3e-42   Nicotiana tomentosiformis
ref|XP_009103100.1|  PREDICTED: monosaccharide-sensing protein 2        160   4e-42   
ref|XP_004983796.1|  PREDICTED: monosaccharide-sensing protein 2-...    160   4e-42   Setaria italica
emb|CDP01766.1|  unnamed protein product                                160   5e-42   Coffea canephora [robusta coffee]
ref|XP_008464819.1|  PREDICTED: monosaccharide-sensing protein 2-...    160   7e-42   Cucumis melo [Oriental melon]
ref|NP_001280690.1|  monosaccharide-sensing protein 2-like              159   9e-42   Solanum lycopersicum
ref|XP_008382498.1|  PREDICTED: monosaccharide-sensing protein 2-...    159   1e-41   
ref|XP_010270527.1|  PREDICTED: monosaccharide-sensing protein 2        159   1e-41   Nelumbo nucifera [Indian lotus]
ref|XP_006343319.1|  PREDICTED: monosaccharide-sensing protein 2-...    159   1e-41   Solanum tuberosum [potatoes]
ref|XP_004139974.1|  PREDICTED: monosaccharide-sensing protein 2-...    159   1e-41   
ref|XP_011098017.1|  PREDICTED: monosaccharide-sensing protein 2-...    158   2e-41   Sesamum indicum [beniseed]
ref|XP_004289029.1|  PREDICTED: monosaccharide-sensing protein 2-...    159   2e-41   Fragaria vesca subsp. vesca
ref|XP_011040809.1|  PREDICTED: monosaccharide-sensing protein 2-...    158   2e-41   Populus euphratica
ref|XP_011022133.1|  PREDICTED: monosaccharide-sensing protein 2-...    158   3e-41   Populus euphratica
ref|XP_006412119.1|  hypothetical protein EUTSA_v10024517mg             158   3e-41   Eutrema salsugineum [saltwater cress]
ref|XP_002306419.1|  hypothetical protein POPTR_0005s10180g             158   3e-41   
ref|XP_009359630.1|  PREDICTED: monosaccharide-sensing protein 2-...    158   3e-41   
ref|XP_003526737.1|  PREDICTED: monosaccharide-sensing protein 2-...    158   4e-41   Glycine max [soybeans]
ref|XP_009392211.1|  PREDICTED: monosaccharide-sensing protein 2-...    158   4e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008448165.1|  PREDICTED: monosaccharide-sensing protein 2        157   4e-41   Cucumis melo [Oriental melon]
ref|XP_009359631.1|  PREDICTED: monosaccharide-sensing protein 2-...    158   4e-41   
ref|XP_009359629.1|  PREDICTED: monosaccharide-sensing protein 2-...    158   4e-41   Pyrus x bretschneideri [bai li]
gb|EAY80902.1|  hypothetical protein OsI_36080                          157   6e-41   Oryza sativa Indica Group [Indian rice]
ref|NP_001067890.1|  Os11g0475600                                       157   6e-41   
ref|XP_010446942.1|  PREDICTED: monosaccharide-sensing protein 2        157   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010437493.1|  PREDICTED: monosaccharide-sensing protein 2-...    157   1e-40   
ref|XP_004154526.1|  PREDICTED: monosaccharide-sensing protein 2-...    156   1e-40   
gb|KHN33643.1|  Monosaccharide-sensing protein 2                        156   1e-40   Glycine soja [wild soybean]
ref|XP_003543932.1|  PREDICTED: monosaccharide-sensing protein 2-...    156   1e-40   
ref|XP_010432297.1|  PREDICTED: monosaccharide-sensing protein 2-...    156   1e-40   Camelina sativa [gold-of-pleasure]
gb|EYU30848.1|  hypothetical protein MIMGU_mgv1a001984mg                155   2e-40   Erythranthe guttata [common monkey flower]
ref|XP_003560303.1|  PREDICTED: monosaccharide-sensing protein 2-...    155   4e-40   Brachypodium distachyon [annual false brome]
ref|XP_010690557.1|  PREDICTED: monosaccharide-sensing protein 2        154   6e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007137297.1|  hypothetical protein PHAVU_009G115500g             154   6e-40   Phaseolus vulgaris [French bean]
gb|KJB31963.1|  hypothetical protein B456_005G216600                    154   1e-39   Gossypium raimondii
ref|XP_004500684.1|  PREDICTED: monosaccharide-sensing protein 2-...    153   2e-39   
gb|KHN46863.1|  Monosaccharide-sensing protein 2                        152   3e-39   Glycine soja [wild soybean]
ref|XP_008377843.1|  PREDICTED: monosaccharide-sensing protein 2-...    152   4e-39   
ref|XP_010028861.1|  PREDICTED: LOW QUALITY PROTEIN: monosacchari...    152   5e-39   
emb|CDY33275.1|  BnaA01g19420D                                          140   1e-38   Brassica napus [oilseed rape]
gb|KGN49001.1|  hypothetical protein Csa_6G509700                       151   1e-38   
ref|XP_004289030.1|  PREDICTED: monosaccharide-sensing protein 2        150   1e-38   Fragaria vesca subsp. vesca
gb|KHG14026.1|  Monosaccharide-sensing 2 -like protein                  150   2e-38   Gossypium arboreum [tree cotton]
ref|XP_003518591.1|  PREDICTED: monosaccharide-sensing protein 2-...    149   5e-38   Glycine max [soybeans]
ref|XP_004954530.1|  PREDICTED: monosaccharide-sensing protein 2-...    147   2e-37   Setaria italica
ref|XP_004169167.1|  PREDICTED: LOW QUALITY PROTEIN: monosacchari...    147   3e-37   
ref|XP_004134823.1|  PREDICTED: monosaccharide-sensing protein 2-...    147   3e-37   
ref|XP_008440928.1|  PREDICTED: LOW QUALITY PROTEIN: monosacchari...    147   4e-37   
ref|XP_010029563.1|  PREDICTED: monosaccharide-sensing protein 2-...    145   1e-36   Eucalyptus grandis [rose gum]
gb|KDP43790.1|  hypothetical protein JCGZ_22417                         144   2e-36   Jatropha curcas
ref|XP_009359632.1|  PREDICTED: monosaccharide-sensing protein 2-...    144   3e-36   Pyrus x bretschneideri [bai li]
gb|EPS57524.1|  hypothetical protein M569_17293                         144   4e-36   Genlisea aurea
ref|XP_004978456.1|  PREDICTED: monosaccharide-sensing protein 2-...    143   6e-36   
ref|XP_010097645.1|  Monosaccharide-sensing protein 3                   143   9e-36   Morus notabilis
ref|XP_006403910.1|  hypothetical protein EUTSA_v10011113mg             142   1e-35   Eutrema salsugineum [saltwater cress]
ref|XP_004290074.1|  PREDICTED: monosaccharide-sensing protein 2        142   2e-35   Fragaria vesca subsp. vesca
ref|XP_006292750.1|  hypothetical protein CARUB_v10018997mg             142   2e-35   
ref|XP_008242155.1|  PREDICTED: monosaccharide-sensing protein 2-...    142   2e-35   Prunus mume [ume]
ref|XP_007203009.1|  hypothetical protein PRUPE_ppa017631mg             142   3e-35   Prunus persica
emb|CDY33276.1|  BnaA01g19430D                                          141   3e-35   Brassica napus [oilseed rape]
ref|XP_009148978.1|  PREDICTED: monosaccharide-sensing protein 3        141   3e-35   Brassica rapa
ref|XP_002532480.1|  sugar transporter, putative                        139   4e-35   
ref|XP_010503840.1|  PREDICTED: monosaccharide-sensing protein 3-...    141   5e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010426703.1|  PREDICTED: monosaccharide-sensing protein 3-...    141   5e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010515555.1|  PREDICTED: monosaccharide-sensing protein 3        140   6e-35   Camelina sativa [gold-of-pleasure]
emb|CDX73717.1|  BnaC08g22860D                                          139   1e-34   
emb|CDY16303.1|  BnaC01g23380D                                          139   1e-34   Brassica napus [oilseed rape]
ref|XP_009115837.1|  PREDICTED: monosaccharide-sensing protein 3        140   1e-34   Brassica rapa
emb|CDX78009.1|  BnaA09g32040D                                          139   1e-34   
ref|XP_008786687.1|  PREDICTED: monosaccharide-sensing protein 2-...    137   1e-33   Phoenix dactylifera
gb|KEH36403.1|  tonoplast monosaccharide transporter 2                  135   3e-33   Medicago truncatula
ref|XP_003537696.1|  PREDICTED: monosaccharide-sensing protein 2-...    135   7e-33   Glycine max [soybeans]
ref|XP_003604104.1|  Monosaccharide-sensing protein                     135   8e-33   Medicago truncatula
ref|XP_003517121.1|  PREDICTED: monosaccharide-sensing protein 2-...    133   3e-32   
ref|XP_006649210.1|  PREDICTED: monosaccharide-sensing protein 2-...    132   3e-32   
ref|XP_004964709.1|  PREDICTED: monosaccharide-sensing protein 2-...    133   4e-32   Setaria italica
dbj|BAK02857.1|  predicted protein                                      133   4e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002439068.1|  hypothetical protein SORBIDRAFT_10g031000          132   8e-32   Sorghum bicolor [broomcorn]
ref|NP_001147067.1|  hexose transporter                                 132   1e-31   Zea mays [maize]
gb|EMS60524.1|  Monosaccharide-sensing protein 3                        129   1e-31   Triticum urartu
gb|ACG25339.1|  hexose transporter                                      132   1e-31   Zea mays [maize]
ref|XP_007158028.1|  hypothetical protein PHAVU_002G118100g             130   2e-31   Phaseolus vulgaris [French bean]
gb|EAY88138.1|  hypothetical protein OsI_09573                          130   2e-31   Oryza sativa Indica Group [Indian rice]
dbj|BAD23011.1|  putative hexose transporter                            130   2e-31   Oryza sativa Japonica Group [Japonica rice]
gb|KHN20087.1|  Monosaccharide-sensing protein 2                        128   1e-30   Glycine soja [wild soybean]
gb|KHN19961.1|  Monosaccharide-sensing protein 2                        128   2e-30   Glycine soja [wild soybean]
ref|XP_007156262.1|  hypothetical protein PHAVU_003G271500g             127   3e-30   Phaseolus vulgaris [French bean]
ref|XP_003629095.1|  Monosaccharide-sensing protein                     127   4e-30   
ref|XP_003573173.1|  PREDICTED: monosaccharide-sensing protein 2-...    127   5e-30   Brachypodium distachyon [annual false brome]
ref|XP_009387331.1|  PREDICTED: monosaccharide-sensing protein 1-...    123   3e-29   
ref|XP_003603869.1|  Monosaccharide-sensing protein                     122   2e-28   
ref|XP_004509464.1|  PREDICTED: monosaccharide-sensing protein 2-...    122   2e-28   Cicer arietinum [garbanzo]
ref|XP_002453100.1|  hypothetical protein SORBIDRAFT_04g038460          120   3e-28   
gb|AAN17390.1|  Putative sugar transporter protein                      122   3e-28   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA85398.1|  unnamed protein product                                122   3e-28   Oryza sativa Japonica Group [Japonica rice]
gb|EAY88374.1|  hypothetical protein OsI_09831                          120   8e-28   Oryza sativa Indica Group [Indian rice]
gb|AES95370.2|  tonoplast monosaccharide transporter 2                  119   2e-27   Medicago truncatula
ref|XP_004512287.1|  PREDICTED: monosaccharide-sensing protein 2-...    119   2e-27   Cicer arietinum [garbanzo]
ref|XP_002981960.1|  hypothetical protein SELMODRAFT_179172             116   2e-26   Selaginella moellendorffii
ref|XP_003614108.1|  Monosaccharide-sensing protein                     117   2e-26   Medicago truncatula
ref|XP_002982939.1|  hypothetical protein SELMODRAFT_445340             116   2e-26   Selaginella moellendorffii
ref|XP_002986014.1|  hypothetical protein SELMODRAFT_182142             117   2e-26   Selaginella moellendorffii
ref|XP_002981894.1|  hypothetical protein SELMODRAFT_179271             116   3e-26   Selaginella moellendorffii
ref|XP_003548779.1|  PREDICTED: monosaccharide-sensing protein 3-...    116   3e-26   Glycine max [soybeans]
gb|EYU43535.1|  hypothetical protein MIMGU_mgv1a002513mg                115   3e-26   Erythranthe guttata [common monkey flower]
gb|EMS63099.1|  Monosaccharide-sensing protein 3                        115   4e-26   Triticum urartu
ref|XP_003562146.1|  PREDICTED: monosaccharide-sensing protein 2-...    115   5e-26   
gb|EMT02609.1|  Monosaccharide-sensing protein 3                        115   5e-26   
ref|XP_006662557.1|  PREDICTED: monosaccharide-sensing protein 2-...    115   6e-26   
gb|KJB14185.1|  hypothetical protein B456_002G113400                    114   1e-25   Gossypium raimondii
gb|KHG00737.1|  Monosaccharide-sensing 2 -like protein                  112   6e-25   Gossypium arboreum [tree cotton]
gb|KHG04802.1|  Monosaccharide-sensing protein 2                        110   2e-24   Gossypium arboreum [tree cotton]
ref|XP_010237535.1|  PREDICTED: monosaccharide-sensing protein 2-...    107   7e-24   
ref|XP_003577342.1|  PREDICTED: monosaccharide-sensing protein 2-...    107   3e-23   Brachypodium distachyon [annual false brome]
ref|XP_001761207.1|  predicted protein                                  107   3e-23   
ref|XP_002979533.1|  hypothetical protein SELMODRAFT_111167             107   6e-23   
ref|XP_002977746.1|  hypothetical protein SELMODRAFT_10582              107   6e-23   
ref|XP_001784511.1|  predicted protein                                  102   2e-21   
ref|XP_001773057.1|  predicted protein                                  101   5e-21   
ref|XP_002970170.1|  hypothetical protein SELMODRAFT_231525             100   9e-21   
ref|XP_002978337.1|  hypothetical protein SELMODRAFT_268165             100   1e-20   
ref|XP_003612412.1|  Monosaccharide-sensing protein                   99.4    2e-20   
ref|XP_006653836.1|  PREDICTED: monosaccharide-sensing protein 2-...  98.2    5e-20   
gb|AAM94321.1|  putative sugar transporter                            92.0    8e-18   
ref|XP_002449882.1|  hypothetical protein SORBIDRAFT_05g024860        92.0    9e-18   
ref|NP_001173250.1|  Os03g0128900                                     85.1    9e-17   
ref|XP_008676723.1|  PREDICTED: uncharacterized protein LOC100272...  88.6    1e-16   
gb|ABA94776.1|  Sugar transporter, putative, expressed                87.0    3e-16   
gb|ABA94777.1|  Sugar transporter, putative, expressed                87.0    3e-16   
ref|XP_006663052.1|  PREDICTED: monosaccharide-sensing protein 2-...  86.3    6e-16   
ref|XP_001754179.1|  predicted protein                                84.7    2e-15   
gb|EEC68553.1|  hypothetical protein OsI_36866                        84.0    3e-15   
ref|XP_004979746.1|  PREDICTED: monosaccharide-sensing protein 3-...  82.4    1e-14   
gb|AAN40021.1|  putative sugar transporter protein                    80.9    4e-14   
gb|EKE07916.1|  D-xylose-proton symporter                             74.7    1e-13   
ref|WP_041063194.1|  MFS transporter                                  76.6    6e-13   
ref|WP_014679839.1|  sugar:proton symporter                           75.9    1e-12   
ref|WP_022021988.1|  sugar transporter                                75.5    1e-12   
emb|CDR33502.1|  putative D-xylose-proton symporter                   75.5    1e-12   
ref|WP_013201166.1|  major facilitator transporter                    75.5    2e-12   
dbj|GAF38784.1|  D-xylose proton-symporter XylT                       71.6    2e-12   
ref|WP_035174295.1|  MFS transporter                                  72.4    3e-12   
ref|WP_041017256.1|  major facilitator transporter                    74.3    3e-12   
ref|XP_006584348.1|  PREDICTED: monosaccharide-sensing protein 3-...  69.7    5e-12   
ref|WP_038109522.1|  major facilitator transporter                    73.6    7e-12   
gb|ETI82942.1|  MFS transporter, sugar porter family protein          73.6    7e-12   
dbj|GAF37031.1|  D-xylose proton-symporter XylT                       68.9    8e-12   
ref|WP_012945178.1|  major facilitator transporter                    73.2    9e-12   
ref|WP_007141639.1|  major facilitator transporter                    73.2    1e-11   
ref|WP_013644894.1|  major facilitator transporter                    72.8    1e-11   
ref|WP_021946815.1|  d-xylose-proton symporter                        72.4    2e-11   
gb|KHN26180.1|  Cyanogenic beta-glucosidase                           69.7    2e-11   
emb|CDL07154.1|  Arabinose-proton symporter                           68.9    2e-11   
ref|WP_008385733.1|  sugar transporter                                72.4    2e-11   
ref|WP_008420814.1|  sugar transporter                                72.0    2e-11   
ref|WP_012945458.1|  major facilitator transporter                    72.0    3e-11   
ref|WP_003326866.1|  MULTISPECIES: MFS transporter                    71.6    3e-11   
gb|AHG00573.1|  major facilitator transporter                         71.6    3e-11   
ref|WP_010964648.1|  MFS transporter                                  71.6    3e-11   
ref|WP_034583448.1|  MFS transporter                                  71.6    3e-11   
ref|WP_002460768.1|  major facilitator transporter                    71.6    3e-11   
ref|WP_002492575.1|  major facilitator transporter                    71.6    3e-11   
ref|WP_006165530.1|  sugar transporter                                71.6    3e-11   
emb|CCC56913.1|  D-xylose proton-symporter                            71.2    4e-11   
gb|KDE57191.1|  major facilitator transporter                         71.2    4e-11   
ref|WP_006431848.1|  sugar transporter                                70.5    4e-11   
ref|WP_023321203.1|  hypothetical protein                             71.2    4e-11   
gb|AFN32965.1|  Arabinose-proton symporter                            71.2    4e-11   
ref|WP_010789976.1|  Arabinose-proton symporter                       71.2    4e-11   
gb|EUC92385.1|  MFS transporter, SP family                            71.2    4e-11   
ref|WP_021292418.1|  MULTISPECIES: hypothetical protein               71.2    4e-11   
ref|WP_010290008.1|  MFS transporter                                  71.2    4e-11   
ref|WP_004121890.1|  major facilitator transporter                    71.2    4e-11   
gb|EUC85721.1|  MFS transporter, SP family                            71.2    4e-11   
ref|WP_032718856.1|  major facilitator transporter                    71.2    5e-11   
ref|XP_002524977.1|  sugar transporter, putative                      71.2    5e-11   
ref|WP_025108435.1|  major facilitator transporter                    71.2    5e-11   
ref|WP_004133618.1|  MULTISPECIES: sugar transporter                  71.2    5e-11   
gb|EJU34208.1|  MFS transporter, SP family                            71.2    5e-11   
ref|WP_004851937.1|  MULTISPECIES: major facilitator transporter      71.2    5e-11   
ref|WP_004113687.1|  MULTISPECIES: major facilitator transporter      71.2    5e-11   
ref|WP_014229776.1|  MULTISPECIES: major facilitator transporter      71.2    5e-11   
ref|WP_039063669.1|  MFS transporter                                  70.9    5e-11   
ref|WP_032876389.1|  MULTISPECIES: MFS transporter                    70.9    5e-11   
ref|WP_004103185.1|  major facilitator transporter                    70.9    5e-11   
ref|WP_014418911.1|  MULTISPECIES: MFS transporter                    70.9    5e-11   
ref|WP_003151605.1|  MULTISPECIES: MFS transporter                    70.9    5e-11   
ref|WP_032743580.1|  major facilitator transporter                    70.9    5e-11   
ref|WP_032867015.1|  MULTISPECIES: MFS transporter                    70.9    5e-11   
ref|WP_040444514.1|  hypothetical protein                             70.9    5e-11   
ref|XP_004509557.1|  PREDICTED: inositol transporter 1-like           70.5    5e-11   
gb|EQB38059.1|  major facilitator transporter                         70.9    5e-11   
ref|WP_017261050.1|  major facilitator transporter                    70.9    6e-11   
gb|ACB93764.1|  sugar transporter                                     70.9    6e-11   
emb|CDQ38429.1|  putative metabolite transport protein CsbC           70.9    6e-11   
ref|WP_041777850.1|  MFS sugar transporter                            70.9    6e-11   
gb|EFH86020.1|  sugar transporter                                     70.9    6e-11   
ref|WP_032816497.1|  hypothetical protein                             68.9    6e-11   
ref|WP_042737659.1|  major facilitator transporter                    70.5    6e-11   
ref|WP_044170325.1|  sugar:proton symporter                           70.5    6e-11   
ref|WP_044801856.1|  MFS transporter                                  70.5    6e-11   
ref|WP_042456037.1|  major facilitator transporter                    70.5    7e-11   
ref|WP_037544280.1|  major facilitator transporter                    70.5    8e-11   
ref|WP_035888480.1|  hypothetical protein                             70.1    8e-11   
ref|XP_004509515.1|  PREDICTED: inositol transporter 1-like           70.5    9e-11   
ref|WP_017895285.1|  major facilitator transporter                    70.1    9e-11   
ref|WP_041707370.1|  major facilitator transporter                    70.1    1e-10   
gb|AFV88196.1|  MFS family major facilitator transporter              70.1    1e-10   
ref|WP_003557282.1|  MULTISPECIES: major facilitator transporter      70.1    1e-10   
ref|WP_034881951.1|  hypothetical protein                             70.1    1e-10   
gb|EDP46643.1|  D-xylose-proton symporter                             70.1    1e-10   
ref|WP_035895259.1|  hypothetical protein                             70.1    1e-10   
ref|WP_003551797.1|  major facilitator transporter                    70.1    1e-10   
ref|WP_040615275.1|  major facilitator transporter                    70.1    1e-10   
ref|WP_039398794.1|  major facilitator transporter                    70.1    1e-10   
ref|WP_036475808.1|  hypothetical protein                             70.1    1e-10   
ref|WP_014465940.1|  MFS transporter                                  69.7    1e-10   
ref|WP_018631168.1|  hypothetical protein                             69.7    1e-10   
ref|WP_005185558.1|  major facilitator transporter                    69.7    1e-10   
ref|WP_003715948.1|  major facilitator transporter                    69.7    1e-10   
ref|WP_026018007.1|  major facilitator transporter                    69.7    1e-10   
ref|WP_031335148.1|  major facilitator transporter                    69.3    1e-10   
ref|WP_006665058.1|  sugar transporter                                69.7    1e-10   
ref|WP_003712779.1|  major facilitator transporter                    69.3    1e-10   
gb|EKA28326.1|  putative transporter protein                          69.3    1e-10   
emb|CBY26656.1|  arabinose-proton symporter                           69.3    2e-10   
ref|WP_035166342.1|  major facilitator transporter                    69.3    2e-10   
ref|WP_008910298.1|  putative transporter protein                     69.3    2e-10   
ref|WP_021296563.1|  hypothetical protein                             69.3    2e-10   
ref|WP_035444646.1|  major facilitator transporter                    69.3    2e-10   
ref|XP_010686705.1|  PREDICTED: inositol transporter 4-like isofo...  69.7    2e-10   
ref|WP_038244820.1|  major facilitator transporter                    69.3    2e-10   
ref|WP_011816648.1|  major facilitator transporter                    69.3    2e-10   
gb|AAF91431.1|  putative Na+/myo-inositol symporter                   69.7    2e-10   
gb|EEI70980.1|  MFS transporter, SP family                            69.3    2e-10   
gb|ACJ85869.1|  unknown                                               69.3    2e-10   
ref|XP_003603886.1|  Mannitol transporter                             69.3    2e-10   
ref|WP_044545434.1|  major facilitator transporter                    69.3    2e-10   
ref|WP_005179466.1|  major facilitator transporter                    69.3    2e-10   
ref|XP_007135989.1|  hypothetical protein PHAVU_009G008900g           69.3    2e-10   
gb|KDS34774.1|  MFS transporter, sugar porter family protein          68.9    2e-10   
ref|WP_005863324.1|  MULTISPECIES: major facilitator transporter      68.9    2e-10   
ref|WP_026059771.1|  IolT                                             68.9    2e-10   
gb|EPS65606.1|  hypothetical protein M569_09171                       66.6    2e-10   
ref|WP_036615943.1|  major facilitator transporter                    68.9    2e-10   
ref|WP_013353664.1|  MFS transporter                                  68.9    2e-10   
ref|WP_019203988.1|  hypothetical protein                             68.9    2e-10   
ref|WP_042545614.1|  major facilitator transporter                    68.9    2e-10   
ref|WP_013879135.1|  major facilitator transporter                    68.9    2e-10   
ref|WP_003463798.1|  putative sugar-proton symporter                  68.9    2e-10   
ref|WP_025318950.1|  major facilitator transporter                    68.9    2e-10   
ref|WP_008772978.1|  major facilitator transporter                    68.9    2e-10   
ref|WP_009016583.1|  major facilitator transporter                    68.9    2e-10   
ref|XP_006347568.1|  PREDICTED: D-xylose-proton symporter-like 2-...  68.9    3e-10   
ref|WP_025320564.1|  major facilitator transporter                    68.9    3e-10   
ref|WP_024708848.1|  hypothetical protein                             68.6    3e-10   
ref|WP_025286678.1|  major facilitator transporter                    68.6    3e-10   
ref|WP_010332110.1|  major facilitator transporter                    68.9    3e-10   
ref|WP_005555141.1|  sugar transporter                                68.6    3e-10   
ref|WP_007123566.1|  major facilitator transporter                    68.9    3e-10   
ref|XP_008309518.1|  PREDICTED: proton myo-inositol cotransporter...  68.9    3e-10   
ref|WP_006185197.1|  sugar transporter                                68.9    3e-10   
ref|XP_008309519.1|  PREDICTED: proton myo-inositol cotransporter...  68.9    3e-10   
ref|XP_008309517.1|  PREDICTED: proton myo-inositol cotransporter...  68.9    3e-10   
ref|NP_001288106.1|  D-xylose-proton symporter-like 2-like            68.9    3e-10   
ref|WP_009112156.1|  major facilitator transporter                    68.6    3e-10   
ref|WP_035341121.1|  MFS transporter                                  68.6    3e-10   
ref|WP_032417115.1|  major facilitator transporter                    68.6    3e-10   
ref|WP_029372974.1|  major facilitator transporter                    68.6    3e-10   
ref|WP_007109838.1|  sugar transporter                                68.6    3e-10   
gb|EWE41665.1|  hypothetical protein L472_01258                       67.4    3e-10   
ref|WP_024525904.1|  major facilitator transporter                    68.6    3e-10   
ref|WP_024747385.1|  major facilitator transporter                    68.6    3e-10   
ref|WP_040234683.1|  major facilitator transporter                    67.4    3e-10   
gb|EFI10255.1|  D-xylose-proton symporter                             68.6    3e-10   
ref|WP_041339107.1|  major facilitator transporter                    68.6    3e-10   
gb|EFE53222.1|  MFS transporter, SP family                            68.6    3e-10   
ref|WP_004913304.1|  putative transporter protein                     68.6    3e-10   
dbj|GAE29417.1|  arabinose-proton symporter                           68.6    3e-10   
ref|WP_020089467.1|  major facilitator transporter                    68.6    3e-10   
gb|AAO74897.1|  putative Na+/myo-inositol symporter                   68.6    4e-10   
ref|WP_027603375.1|  major facilitator transporter                    68.6    4e-10   
ref|WP_043022080.1|  major facilitator transporter                    68.6    4e-10   
ref|WP_021742415.1|  MFS transporter, SP family                       68.6    4e-10   
ref|WP_015473104.1|  D-xylose-proton symporter                        68.6    4e-10   
ref|WP_024855255.1|  major facilitator transporter                    68.2    4e-10   
ref|WP_024526135.1|  major facilitator transporter                    68.2    4e-10   
ref|WP_039106327.1|  major facilitator transporter                    68.2    4e-10   
ref|WP_008893404.1|  sugar transporter                                68.2    4e-10   
sp|O52733.1|XYLT_LACBR  RecName: Full=D-xylose-proton symporter; ...  68.2    4e-10   
ref|WP_011967260.1|  major facilitator transporter                    68.2    4e-10   
ref|WP_034526431.1|  major facilitator transporter                    68.2    4e-10   
ref|WP_043167604.1|  hypothetical protein                             68.2    4e-10   
ref|XP_004990085.1|  solute carrier family 2                          68.6    4e-10   
emb|CAG05594.1|  unnamed protein product                              65.5    4e-10   
ref|WP_040734328.1|  sugar transporter                                68.2    4e-10   
ref|WP_017900389.1|  MULTISPECIES: major facilitator transporter      68.2    4e-10   
ref|WP_030243706.1|  major facilitator transporter                    68.2    4e-10   
ref|WP_023318217.1|  hypothetical protein                             68.2    4e-10   
ref|WP_030303597.1|  major facilitator transporter                    68.2    4e-10   
ref|WP_004205904.1|  galactose-proton symport of transport system     68.2    4e-10   
gb|EKT55669.1|  putative transporter protein                          68.2    4e-10   
ref|WP_012086188.1|  major facilitator transporter                    68.2    4e-10   
ref|WP_019168203.1|  major facilitator transporter                    68.2    4e-10   
ref|WP_006110627.1|  sugar transporter                                68.2    4e-10   
ref|WP_003326676.1|  MULTISPECIES: major facilitator transporter      68.2    4e-10   
ref|WP_022486233.1|  sugar transporter                                68.2    4e-10   
ref|XP_006349557.1|  PREDICTED: polyol transporter 5-like             68.2    4e-10   
ref|WP_006053328.1|  major facilitator transporter                    68.2    5e-10   
ref|WP_010790115.1|  Major myo-inositol transporter IolT              68.2    5e-10   
ref|WP_022793052.1|  major facilitator transporter                    68.2    5e-10   
ref|WP_043892705.1|  major facilitator transporter                    68.2    5e-10   
ref|WP_026260274.1|  sugar:proton symporter                           68.2    5e-10   
ref|WP_004701071.1|  major facilitator transporter                    68.2    5e-10   
ref|WP_011631971.1|  major facilitator transporter                    67.8    5e-10   
ref|WP_006826745.1|  sugar transporter                                68.2    5e-10   
gb|KDL39791.1|  hypothetical protein AF50_01714                       67.0    5e-10   
ref|WP_032730352.1|  major facilitator transporter                    68.2    5e-10   
gb|KFI54641.1|  transport protein                                     68.2    5e-10   
ref|WP_018178242.1|  hypothetical protein                             67.8    5e-10   
ref|WP_044244344.1|  major facilitator transporter                    68.2    5e-10   
ref|WP_012968234.1|  major facilitator transporter                    68.2    5e-10   
ref|WP_044612847.1|  major facilitator transporter                    67.8    5e-10   
ref|WP_012944770.1|  major facilitator transporter                    67.8    5e-10   
ref|WP_012541737.1|  major facilitator transporter                    67.8    5e-10   
ref|WP_023340130.1|  MULTISPECIES: hypothetical protein               67.8    5e-10   
gb|KEI35833.1|  hypothetical protein FRA_27c02890                     67.8    5e-10   
ref|WP_032817496.1|  major facilitator transporter                    67.8    5e-10   
gb|ERI58867.1|  major myo-inositol transporter                        67.8    5e-10   
ref|WP_023322608.1|  MULTISPECIES: hypothetical protein               67.8    5e-10   
ref|WP_037956567.1|  major facilitator transporter                    67.8    5e-10   
ref|WP_032733030.1|  major facilitator transporter                    67.8    5e-10   
ref|WP_018064360.1|  hypothetical protein                             67.8    5e-10   
ref|WP_044649960.1|  major facilitator transporter                    67.8    5e-10   
ref|WP_022066173.1|  MULTISPECIES: sugar transporter                  67.8    5e-10   
ref|WP_032700968.1|  major facilitator transporter                    67.8    5e-10   
ref|WP_023289676.1|  hypothetical protein                             67.8    5e-10   
ref|WP_016161016.1|  hypothetical protein                             67.8    5e-10   
ref|WP_032452833.1|  MULTISPECIES: major facilitator transporter      67.8    5e-10   



>ref|XP_009595864.1| PREDICTED: monosaccharide-sensing protein 2 [Nicotiana tomentosiformis]
 ref|XP_009595865.1| PREDICTED: monosaccharide-sensing protein 2 [Nicotiana tomentosiformis]
 ref|XP_009595866.1| PREDICTED: monosaccharide-sensing protein 2 [Nicotiana tomentosiformis]
Length=738

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/111 (90%), Positives = 106/111 (95%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            MNGAVLVA+AATIGNFLQGWDNATIAGAVVYIKKEL L+  +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVALAATIGNFLQGWDNATIAGAVVYIKKELTLDASVEGLVVAMSLIGATLVTTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG+I+D  GRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA
Sbjct  61   SGTISDSFGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  111



>ref|XP_009796447.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009796448.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009796450.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=738

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 100/111 (90%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            MNGAVLVA+AATIGNFLQGWDNATIAGAVVYIKKEL L+  +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVALAATIGNFLQGWDNATIAGAVVYIKKELTLDASVEGLVVAMSLIGATLVTTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG I+D  GRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA
Sbjct  61   SGPISDSFGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  111



>ref|XP_006342166.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006342167.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Solanum 
tuberosum]
Length=737

 Score =   199 bits (506),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 100/111 (90%), Positives = 106/111 (95%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            MNGAVLVA+AATIGNFLQGWDNATIAGAVVYIKKEL L+  +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVALAATIGNFLQGWDNATIAGAVVYIKKELALDASVEGLVVAMSLIGATLVTTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SGSIAD +GRRPMLI+SSM YFLSGLIMLWSPNVYVLLIARLLDGFGIGLA
Sbjct  61   SGSIADSIGRRPMLIMSSMLYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  111



>ref|NP_001289848.1| monosaccharide-sensing protein 2 [Solanum lycopersicum]
 dbj|BAO96237.1| tonoplast monosaccharide transporter 2 [Solanum lycopersicum]
Length=738

 Score =   199 bits (505),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 99/111 (89%), Positives = 106/111 (95%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            MNGAVLVA+AATIGNFLQGWDNATIAGAVVYIKKEL L+  +EGL+VAMSLIGATL+TTC
Sbjct  1    MNGAVLVALAATIGNFLQGWDNATIAGAVVYIKKELTLDASVEGLIVAMSLIGATLVTTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SGSIAD +GRRPMLI+SSM YFLSGLIMLWSPNVYVLLIARLLDGFGIGLA
Sbjct  61   SGSIADSIGRRPMLIMSSMLYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  111



>ref|XP_011074068.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011074069.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=739

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 106/111 (95%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            MNGA LVAIAATIGNFLQGWDNATIAGAVVYIKKEL L   +EGL+VAMSLIGAT+ITTC
Sbjct  1    MNGAALVAIAATIGNFLQGWDNATIAGAVVYIKKELELGAAIEGLIVAMSLIGATVITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG+I+DW+GRRPMLILSS+FYFLSGLIMLWSPNVYVLL+ARLLDGFGIGLA
Sbjct  61   SGTISDWIGRRPMLILSSIFYFLSGLIMLWSPNVYVLLLARLLDGFGIGLA  111



>ref|XP_007135975.1| hypothetical protein PHAVU_009G007600g [Phaseolus vulgaris]
 gb|ESW07969.1| hypothetical protein PHAVU_009G007600g [Phaseolus vulgaris]
Length=736

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GAVLVAIAA+IGNFLQGWDNATIAGA+VYIKK+L L+T MEGLVVAMSLIGATLITTC
Sbjct  1    MKGAVLVAIAASIGNFLQGWDNATIAGAIVYIKKDLALQTTMEGLVVAMSLIGATLITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG ++DWLGRRPMLI+SS+ YFL GL+MLWSPNVYVL +ARLLDGFGIGLA
Sbjct  61   SGPVSDWLGRRPMLIISSLLYFLGGLVMLWSPNVYVLCLARLLDGFGIGLA  111



>emb|CDP07261.1| unnamed protein product [Coffea canephora]
Length=737

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GAV VA++AT+GNFLQGWDNATIAGAVVY+KKEL LE  +EGLVVAMSLIGATLITTC
Sbjct  1    MKGAVFVALSATVGNFLQGWDNATIAGAVVYMKKELDLEATVEGLVVAMSLIGATLITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SGSI+DW+GRRPMLILSS FYF SGL+MLWSPNVYVLL+ARLLDGFGIGLA
Sbjct  61   SGSISDWIGRRPMLILSSSFYFFSGLVMLWSPNVYVLLLARLLDGFGIGLA  111



>gb|KDO85211.1| hypothetical protein CISIN_1g004673mg [Citrus sinensis]
Length=592

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            MNGA LVAIAATIGNFLQGWDNATIAGA+VYIKK+L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MNGAALVAIAATIGNFLQGWDNATIAGAIVYIKKDLNLGTTVEGLVVAMSLIGATAITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG I+DWLGRRPMLILSS+ YF+SGL+MLWSPNVYVL IARLLDGFG+GLA
Sbjct  61   SGPISDWLGRRPMLILSSVLYFVSGLVMLWSPNVYVLCIARLLDGFGVGLA  111



>ref|XP_003527273.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Glycine 
max]
 ref|XP_006581130.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Glycine 
max]
Length=737

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GAVLVAIAA+IGNFLQGWDNATIAGA+VYIKK+L LET MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVLVAIAASIGNFLQGWDNATIAGAIVYIKKDLALETTMEGLVVAMSLIGATVITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG +ADWLGRRPM+I+SS+ YFL GL+MLWSPNVYVL +ARLLDGFGIGLA
Sbjct  61   SGPVADWLGRRPMMIISSVLYFLGGLVMLWSPNVYVLCLARLLDGFGIGLA  111



>gb|KHN33775.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=737

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GAVLVAIAA+IGNFLQGWDNATIAGA+VYIKK+L L+T MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVLVAIAASIGNFLQGWDNATIAGAIVYIKKDLALQTTMEGLVVAMSLIGATVITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG IADWLGRRPM+I+SS+ YFL GL+MLWSPNVYVL +ARLLDGFGIGLA
Sbjct  61   SGPIADWLGRRPMMIISSVLYFLGGLVMLWSPNVYVLCLARLLDGFGIGLA  111



>ref|XP_006577928.1| PREDICTED: monosaccharide-sensing protein 2-like [Glycine max]
Length=738

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GAVLVAIAA+IGNFLQGWDNATIAGA+VYIKK+L L+T MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVLVAIAASIGNFLQGWDNATIAGAIVYIKKDLALQTTMEGLVVAMSLIGATVITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG IADWLGRRPM+I+SS+ YFL GL+MLWSPNVYVL +ARLLDGFGIGLA
Sbjct  61   SGPIADWLGRRPMMIISSVLYFLGGLVMLWSPNVYVLCLARLLDGFGIGLA  111



>ref|XP_010094525.1| Monosaccharide-sensing protein 2 [Morus notabilis]
 gb|EXB56279.1| Monosaccharide-sensing protein 2 [Morus notabilis]
Length=739

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GA LVAIAATIGNFLQGWDNATIAGA+VYIKK+LVLE+ +EGLVVAMSLIGAT ITTC
Sbjct  1    MKGAALVAIAATIGNFLQGWDNATIAGAIVYIKKDLVLESSVEGLVVAMSLIGATAITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG+++DWLGRRPMLI+SS+ YF+SGL+MLWSPNVYVL IARLLDGFGIGLA
Sbjct  61   SGAVSDWLGRRPMLIISSVLYFISGLVMLWSPNVYVLCIARLLDGFGIGLA  111



>ref|XP_006435423.1| hypothetical protein CICLE_v10000400mg [Citrus clementina]
 ref|XP_006473839.1| PREDICTED: monosaccharide-sensing protein 2-like [Citrus sinensis]
 gb|ESR48663.1| hypothetical protein CICLE_v10000400mg [Citrus clementina]
 gb|KDO85209.1| hypothetical protein CISIN_1g004673mg [Citrus sinensis]
Length=738

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            MNGA LVAIAATIGNFLQGWDNATIAGA+VYIKK+L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MNGAALVAIAATIGNFLQGWDNATIAGAIVYIKKDLNLGTTVEGLVVAMSLIGATAITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG I+DWLGRRPMLILSS+ YF+SGL+MLWSPNVYVL IARLLDGFG+GLA
Sbjct  61   SGPISDWLGRRPMLILSSVLYFVSGLVMLWSPNVYVLCIARLLDGFGVGLA  111



>gb|KDO85208.1| hypothetical protein CISIN_1g004673mg [Citrus sinensis]
Length=706

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            MNGA LVAIAATIGNFLQGWDNATIAGA+VYIKK+L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MNGAALVAIAATIGNFLQGWDNATIAGAIVYIKKDLNLGTTVEGLVVAMSLIGATAITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG I+DWLGRRPMLILSS+ YF+SGL+MLWSPNVYVL IARLLDGFG+GLA
Sbjct  61   SGPISDWLGRRPMLILSSVLYFVSGLVMLWSPNVYVLCIARLLDGFGVGLA  111



>ref|XP_011100175.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=740

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GA LVAIAATIGNFLQGWDNATIAGAVVYIKKEL L   +EGL+VAMSLIGATLITTC
Sbjct  1    MKGAALVAIAATIGNFLQGWDNATIAGAVVYIKKELQLGAAIEGLIVAMSLIGATLITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG+I+D +GRRPMLI SSMFYFLSGLIMLWSPNVYVLL+ARLLDGFGIGLA
Sbjct  61   SGTISDLIGRRPMLISSSMFYFLSGLIMLWSPNVYVLLLARLLDGFGIGLA  111



>ref|XP_007018119.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 ref|XP_007018120.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 ref|XP_007018121.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 gb|EOY15344.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 gb|EOY15345.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 gb|EOY15346.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
Length=739

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GA LVAIAATIGNFLQGWDNATIAGA+VYIK++L L T +EGLVVAMSLIGAT+ITTC
Sbjct  1    MRGAALVAIAATIGNFLQGWDNATIAGAIVYIKEDLNLGTSVEGLVVAMSLIGATVITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG+I+DWLGRRPMLI+SS+ YF+SGL+MLWSPNVYVL IARLLDGFGIGLA
Sbjct  61   SGAISDWLGRRPMLIISSILYFVSGLVMLWSPNVYVLCIARLLDGFGIGLA  111



>ref|XP_007018122.1| Tonoplast monosaccharide transporter2 isoform 4 [Theobroma cacao]
 gb|EOY15347.1| Tonoplast monosaccharide transporter2 isoform 4 [Theobroma cacao]
Length=740

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GA LVAIAATIGNFLQGWDNATIAGA+VYIK++L L T +EGLVVAMSLIGAT+ITTC
Sbjct  1    MRGAALVAIAATIGNFLQGWDNATIAGAIVYIKEDLNLGTSVEGLVVAMSLIGATVITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG+I+DWLGRRPMLI+SS+ YF+SGL+MLWSPNVYVL IARLLDGFGIGLA
Sbjct  61   SGAISDWLGRRPMLIISSILYFVSGLVMLWSPNVYVLCIARLLDGFGIGLA  111



>gb|KDP36756.1| hypothetical protein JCGZ_08047 [Jatropha curcas]
Length=739

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            MNGAVLVAIAA IG+FLQGWDNATIAGA+VYIK +L L+T +EGLVVAMSLIGAT ITTC
Sbjct  1    MNGAVLVAIAACIGSFLQGWDNATIAGAIVYIKDDLDLQTTVEGLVVAMSLIGATAITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG+I+DWLGRRPMLI+SSM YF+SGLIM+WSPNVYVL IARLLDGF IGLA
Sbjct  61   SGAISDWLGRRPMLIMSSMLYFVSGLIMIWSPNVYVLCIARLLDGFAIGLA  111



>ref|XP_003603868.1| Monosaccharide-sensing protein [Medicago truncatula]
 gb|AES74119.1| tonoplast monosaccharide transporter 2 [Medicago truncatula]
Length=730

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GAVLVAIAA+IGNFLQGWDNATIAG+++YIKK+L L+T MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVLVAIAASIGNFLQGWDNATIAGSILYIKKDLALQTTMEGLVVAMSLIGATVITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG I+DWLGRRPM+I+SS+ YFL  L+MLWSPNVYVL +ARLLDGFGIGLA
Sbjct  61   SGPISDWLGRRPMMIISSVLYFLGSLVMLWSPNVYVLCLARLLDGFGIGLA  111



>gb|KJB14183.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
Length=557

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GA  VAIAATIGNFLQGWDNATIAGA+VYIK +L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MRGAAFVAIAATIGNFLQGWDNATIAGAIVYIKNDLNLGTSVEGLVVAMSLIGATAITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG+I+DW+GRRPMLI+SSM YF+SGL+MLWSPNVY+L +ARLLDGFGIGLA
Sbjct  61   SGAISDWIGRRPMLIMSSMLYFVSGLVMLWSPNVYILCLARLLDGFGIGLA  111



>gb|KJB14182.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
Length=548

 Score =   186 bits (473),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GA  VAIAATIGNFLQGWDNATIAGA+VYIK +L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MRGAAFVAIAATIGNFLQGWDNATIAGAIVYIKNDLNLGTSVEGLVVAMSLIGATAITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG+I+DW+GRRPMLI+SSM YF+SGL+MLWSPNVY+L +ARLLDGFGIGLA
Sbjct  61   SGAISDWIGRRPMLIMSSMLYFVSGLVMLWSPNVYILCLARLLDGFGIGLA  111



>ref|XP_010061214.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW68134.1| hypothetical protein EUGRSUZ_F01805 [Eucalyptus grandis]
Length=735

 Score =   188 bits (477),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GAV VAIAATIGNFLQGWDNATIAGA++YIK++L L T +EGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVWVAIAATIGNFLQGWDNATIAGAIIYIKEDLDLGTTVEGLVVAMSLIGATVITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG+I+DW+GRRPMLILSS+ YF+SGL+MLWSPNVYVL IARLLDGFGIGLA
Sbjct  61   SGAISDWVGRRPMLILSSLLYFISGLVMLWSPNVYVLCIARLLDGFGIGLA  111



>gb|KHG10189.1| Monosaccharide-sensing 2 -like protein [Gossypium arboreum]
Length=739

 Score =   188 bits (477),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GA LVAIAATIGNFLQGWDNATIAGA+VYIK +L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MRGAALVAIAATIGNFLQGWDNATIAGAIVYIKNDLDLGTSVEGLVVAMSLIGATAITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG+I+DWLGRRPMLI+SSM YF+SGL+MLWSPNVY+L +ARLLDGFGIGLA
Sbjct  61   SGAISDWLGRRPMLIMSSMLYFVSGLVMLWSPNVYILCLARLLDGFGIGLA  111



>dbj|BAK00015.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=236

 Score =   177 bits (449),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 102/113 (90%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFQLENDPTVEGLIVAMSLIGATIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++DW+GRRPMLILSS+ YFLSGLIMLWSPNVYVLL+ARL+DGFGIGLA
Sbjct  61   TFSGPVSDWVGRRPMLILSSILYFLSGLIMLWSPNVYVLLLARLVDGFGIGLA  113



>ref|XP_004500833.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004500834.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Cicer 
arietinum]
Length=736

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GAV VAI A+IGNFLQGWDNATIAGA++YIKK+L L T MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVFVAIVASIGNFLQGWDNATIAGAILYIKKDLALHTTMEGLVVAMSLIGATVITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG I+DWLGRRPM+I+SS+ YFL  L+MLWSPNVYVL +ARLLDGFGIGLA
Sbjct  61   SGPISDWLGRRPMMIISSVLYFLGSLVMLWSPNVYVLCLARLLDGFGIGLA  111



>gb|KJB14177.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14178.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14179.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14180.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14181.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14184.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
Length=739

 Score =   186 bits (471),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GA  VAIAATIGNFLQGWDNATIAGA+VYIK +L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MRGAAFVAIAATIGNFLQGWDNATIAGAIVYIKNDLNLGTSVEGLVVAMSLIGATAITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG+I+DW+GRRPMLI+SSM YF+SGL+MLWSPNVY+L +ARLLDGFGIGLA
Sbjct  61   SGAISDWIGRRPMLIMSSMLYFVSGLVMLWSPNVYILCLARLLDGFGIGLA  111



>ref|XP_004300112.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
 ref|XP_011465026.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
Length=738

 Score =   186 bits (471),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GAV VAIAATIGNFLQGWDNATIAGA+VYI  +  L++ +EGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVFVAIAATIGNFLQGWDNATIAGAIVYITDDFALDSSVEGLVVAMSLIGATVITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG+++DWLGRRPMLI SS+ YF+SGL+MLWSPNVYVL IARLLDGFGIGLA
Sbjct  61   SGAVSDWLGRRPMLITSSVLYFVSGLVMLWSPNVYVLCIARLLDGFGIGLA  111



>ref|XP_006416357.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
 ref|XP_006416358.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
 gb|ESQ34710.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
 gb|ESQ34711.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
Length=733

 Score =   185 bits (470),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLPTSVQGLVVAMSLIGATVITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG I+DWLGRRPMLILSS+ YFLSGLIMLWSPNVYVL +ARLLDGFG GLA
Sbjct  61   SGPISDWLGRRPMLILSSIMYFLSGLIMLWSPNVYVLCLARLLDGFGAGLA  111



>dbj|BAJ33724.1| unnamed protein product [Thellungiella halophila]
Length=733

 Score =   185 bits (470),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLPTSVQGLVVAMSLIGATVITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG I+DWLGRRPMLILSS+ YFLSGLIMLWSPNVYVL +ARLLDGFG GLA
Sbjct  61   SGPISDWLGRRPMLILSSIMYFLSGLIMLWSPNVYVLCLARLLDGFGAGLA  111



>ref|XP_010539774.1| PREDICTED: monosaccharide-sensing protein 1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010539775.1| PREDICTED: monosaccharide-sensing protein 1-like isoform X2 [Tarenaya 
hassleriana]
Length=723

 Score =   185 bits (469),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GA LVA+AATIGNFLQGWDNATIAGA+VYIK E+ L T ++GLVVAMSLIGAT ITTC
Sbjct  1    MKGAALVALAATIGNFLQGWDNATIAGAMVYIKNEMNLATSVQGLVVAMSLIGATAITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG I DWLGRRPMLI SS+ YF+SGLIMLWSPNVYVL +ARLLDGFGIGLA
Sbjct  61   SGPITDWLGRRPMLIFSSILYFISGLIMLWSPNVYVLCLARLLDGFGIGLA  111



>gb|AAX47312.1| hexose transporter 6 [Vitis vinifera]
Length=740

 Score =   185 bits (469),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 107/111 (96%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            MNGAVLVAIAA IGNFLQGWDNATIAGA+VYIKKEL LE+ +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVAIAAAIGNFLQGWDNATIAGAIVYIKKELDLESTVEGLVVAMSLIGATLVTTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG+I+DW+GRRPMLI+SSM YF+SGLIMLWSPNVYVLLIARLLDGFGIGLA
Sbjct  61   SGAISDWIGRRPMLIVSSMLYFISGLIMLWSPNVYVLLIARLLDGFGIGLA  111



>emb|CAN59780.1| hypothetical protein VITISV_024656 [Vitis vinifera]
Length=740

 Score =   184 bits (468),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 107/111 (96%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            MNGAVLVAIAA IGNFLQGWDNATIAGA+VYIKKEL LE+ +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVAIAAAIGNFLQGWDNATIAGAIVYIKKELDLESTVEGLVVAMSLIGATLVTTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG+I+DW+GRRPMLI+SSM YF+SGLIMLWSPNVYVLLIARLLDGFGIGLA
Sbjct  61   SGAISDWIGRRPMLIVSSMLYFISGLIMLWSPNVYVLLIARLLDGFGIGLA  111



>emb|CBI40753.3| unnamed protein product [Vitis vinifera]
Length=662

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 107/111 (96%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            MNGAVLVAIAA IGNFLQGWDNATIAGA+VYIKKEL LE+ +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVAIAAAIGNFLQGWDNATIAGAIVYIKKELDLESTVEGLVVAMSLIGATLVTTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG+I+DW+GRRPMLI+SSM YF+SGLIMLWSPNVYVLLIARLLDGFGIGLA
Sbjct  61   SGAISDWIGRRPMLIVSSMLYFISGLIMLWSPNVYVLLIARLLDGFGIGLA  111



>ref|XP_002510716.1| sugar transporter, putative [Ricinus communis]
 gb|EEF52903.1| sugar transporter, putative [Ricinus communis]
Length=739

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GAVLVAI A IG+FLQGWDNATIAGA+VYIKK+L L+T +EGLVVAMSLIGAT ITTC
Sbjct  1    MKGAVLVAITACIGSFLQGWDNATIAGAIVYIKKDLNLQTTVEGLVVAMSLIGATTITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG+I+DWLGRRPMLI+SS  YF+SGLIMLWSP+VYVL IARLLDGF IGLA
Sbjct  61   SGAISDWLGRRPMLIISSTLYFVSGLIMLWSPDVYVLCIARLLDGFAIGLA  111



>ref|NP_001267873.1| hexose transporter-like [Vitis vinifera]
 gb|AAY40466.1| putative hexose transporter [Vitis vinifera]
 gb|ADP37147.1| putative tonoplastic monosaccharide transporter [Vitis vinifera]
Length=740

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 107/111 (96%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            MNGAVLVAIAA IGNFLQGWDNATIAGA+VYIKKEL LE+ +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVAIAAAIGNFLQGWDNATIAGAIVYIKKELDLESTVEGLVVAMSLIGATLVTTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG+I+DW+GRRPMLI+SSM YF+SGLIMLWSPNVYVLLIARLLDGFGIGLA
Sbjct  61   SGAISDWIGRRPMLIVSSMLYFISGLIMLWSPNVYVLLIARLLDGFGIGLA  111



>emb|CDY31497.1| BnaC05g16060D [Brassica napus]
Length=632

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLATSVQGLVVAMSLIGATVITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG I+DWLGRRPMLIL+S+ YFLSGLIMLWSPNVYVL +ARLLDGFG GLA
Sbjct  61   SGPISDWLGRRPMLILASVMYFLSGLIMLWSPNVYVLCLARLLDGFGAGLA  111



>ref|XP_008373385.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=739

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +1

Query  277  NGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTCS  456
             GAVLVAIAATIGN LQGWDNATIAGA+VYI KE  L + +EGLVVAMSLIGAT+ITTCS
Sbjct  3    KGAVLVAIAATIGNLLQGWDNATIAGAIVYITKEFDLGSSLEGLVVAMSLIGATIITTCS  62

Query  457  GSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            G+I+DW+GRRPMLI SS+FYF+SGL+M+WSPNVYVL IARLLDGFGIGLA
Sbjct  63   GAISDWIGRRPMLIASSVFYFVSGLVMVWSPNVYVLCIARLLDGFGIGLA  112



>ref|XP_009149562.1| PREDICTED: monosaccharide-sensing protein 1 [Brassica rapa]
 ref|XP_009149563.1| PREDICTED: monosaccharide-sensing protein 1 [Brassica rapa]
Length=721

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLATSVQGLVVAMSLIGATVITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG I+DWLGRRPMLIL+S+ YFLSGLIMLWSPNVYVL +ARLLDGFG GLA
Sbjct  61   SGPISDWLGRRPMLILASVMYFLSGLIMLWSPNVYVLCLARLLDGFGAGLA  111



>emb|CDY29502.1| BnaA06g14680D [Brassica napus]
Length=659

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLATSVQGLVVAMSLIGATVITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG I+DWLGRRPMLIL+S+ YFLSGLIMLWSPNVYVL +ARLLDGFG GLA
Sbjct  61   SGPISDWLGRRPMLILASVMYFLSGLIMLWSPNVYVLCLARLLDGFGAGLA  111



>ref|XP_010537220.1| PREDICTED: monosaccharide-sensing protein 1-like [Tarenaya hassleriana]
 ref|XP_010537221.1| PREDICTED: monosaccharide-sensing protein 1-like [Tarenaya hassleriana]
 ref|XP_010537222.1| PREDICTED: monosaccharide-sensing protein 1-like [Tarenaya hassleriana]
Length=735

 Score =   182 bits (463),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GA LVA+AATIGNFLQGWDNATIAGA+VYIK ++ L T ++GLVVAMSLIGAT ITTC
Sbjct  1    MKGAALVALAATIGNFLQGWDNATIAGAMVYIKNDMNLATSVQGLVVAMSLIGATAITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG I+DWLGRRPMLI SS+ YF+SGLIM+WSPNVYVL +ARLLDGFGIGLA
Sbjct  61   SGPISDWLGRRPMLIFSSILYFISGLIMVWSPNVYVLCLARLLDGFGIGLA  111



>emb|CDY33650.1| BnaC08g19500D [Brassica napus]
Length=697

 Score =   182 bits (462),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLPTSVQGLVVAMSLIGATVITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG I+DWLGRRPMLILSS+ YFLSGLIM WSPNVYVL +ARLLDGFG GLA
Sbjct  61   SGPISDWLGRRPMLILSSVMYFLSGLIMWWSPNVYVLCLARLLDGFGAGLA  111



>ref|XP_011034826.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011034827.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011034828.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011034829.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=738

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GA LVAIAA +GNFLQGWDNATIAGAV+Y+KK+L L++ +EGLVVAMSLIGA  ITTC
Sbjct  1    MKGASLVAIAACVGNFLQGWDNATIAGAVIYVKKDLKLQSSVEGLVVAMSLIGAAAITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SGSI+DW+GRRPMLI SS+ YF+SGL+M WSPNVYVL I RLLDGFG+GLA
Sbjct  61   SGSISDWIGRRPMLISSSILYFVSGLVMFWSPNVYVLCIGRLLDGFGVGLA  111



>gb|AIQ77649.1| tonoplastic transporter 1 [Vitis vinifera]
Length=740

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 106/111 (95%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            MNGAVLVAIAA IGNFLQGW NATIAGA+VYIKKEL LE+ +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVAIAAAIGNFLQGWGNATIAGAIVYIKKELDLESTVEGLVVAMSLIGATLVTTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG+I+DW+GRRPMLI+SSM YF+SGLIMLWSPNVYVLLIARLLDGFGIGLA
Sbjct  61   SGAISDWIGRRPMLIVSSMLYFISGLIMLWSPNVYVLLIARLLDGFGIGLA  111



>ref|XP_009372620.1| PREDICTED: monosaccharide-sensing protein 2 [Pyrus x bretschneideri]
Length=739

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +1

Query  277  NGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTCS  456
             GAVLVA+AATIGN LQGWDNATIAGA+VYI ++  L + +EGLVVAMSLIGAT ITTCS
Sbjct  3    KGAVLVAVAATIGNLLQGWDNATIAGAIVYITEDFSLGSSLEGLVVAMSLIGATFITTCS  62

Query  457  GSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            G+I+DW+GRRPMLI SS+FYF+SGL+M+WSPNVYVL IARLLDGFGIGLA
Sbjct  63   GAISDWIGRRPMLIASSVFYFVSGLVMVWSPNVYVLCIARLLDGFGIGLA  112



>ref|XP_002307812.1| hypothetical protein POPTR_0005s27680g [Populus trichocarpa]
 gb|EEE94808.1| hypothetical protein POPTR_0005s27680g [Populus trichocarpa]
Length=738

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GA LVAIAA IGNFLQGWDNATIAGA++Y+ K+L L+  +EGLVVAMSLIGA  ITTC
Sbjct  1    MKGAALVAIAACIGNFLQGWDNATIAGAIIYVNKDLKLQASVEGLVVAMSLIGAAAITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG I+DWLGRRPMLI+SS+ YF+SGL+M WSPNVYVL I RLLDGFGIGLA
Sbjct  61   SGPISDWLGRRPMLIISSILYFVSGLVMFWSPNVYVLCIGRLLDGFGIGLA  111



>emb|CAA90628.1| sugar transporter [Arabidopsis thaliana]
Length=734

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K+L L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDLNLPTSVQGLVVAMSLIGATVITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG I+DWLGRRPMLILSS+ YF+ GLIMLWSPNVYVL  ARLL+GFG GLA
Sbjct  61   SGPISDWLGRRPMLILSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLA  111



>ref|NP_173508.1| tonoplast monosaccharide transporter1 [Arabidopsis thaliana]
 sp|Q96290.2|MSSP1_ARATH RecName: Full=Monosaccharide-sensing protein 1; AltName: Full=Monosaccharide 
transporter 1; AltName: Full=Sugar transporter 
MSSP1; AltName: Full=Sugar transporter MT1 [Arabidopsis thaliana]
 gb|AAF80627.1|AC069251_20 F2D10.36 [Arabidopsis thaliana]
 gb|AEE30030.1| tonoplast monosaccharide transporter1 [Arabidopsis thaliana]
Length=734

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K+L L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDLNLPTSVQGLVVAMSLIGATVITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG I+DWLGRRPMLILSS+ YF+ GLIMLWSPNVYVL  ARLL+GFG GLA
Sbjct  61   SGPISDWLGRRPMLILSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLA  111



>ref|XP_009110209.1| PREDICTED: monosaccharide-sensing protein 1 [Brassica rapa]
Length=726

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLPTSVQGLVVAMSLIGATVITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG I+DWLGRRPMLILSS+ YFLSGLIM WSP+VYVL +ARLLDGFG GLA
Sbjct  61   SGPISDWLGRRPMLILSSVMYFLSGLIMWWSPSVYVLCLARLLDGFGAGLA  111



>ref|XP_011041174.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=740

 Score =   180 bits (457),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GA LVAIAA IGNFLQGWDNATIAGA++Y+ K+L L+  +EGLVVAMSLIGA  ITTC
Sbjct  1    MKGAALVAIAACIGNFLQGWDNATIAGAIIYVNKDLKLQASVEGLVVAMSLIGAAAITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG I+DWLGRRPMLI+SS+ YF+SGL+M WSPNVYVL I RLLDGFGIGLA
Sbjct  61   SGPISDWLGRRPMLIISSVLYFVSGLVMFWSPNVYVLCIGRLLDGFGIGLA  111



>ref|XP_006306868.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 ref|XP_006306869.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 ref|XP_006306870.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 gb|EOA39766.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 gb|EOA39767.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 gb|EOA39768.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
Length=736

 Score =   180 bits (457),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K+L L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDLNLPTSVQGLVVAMSLIGATVITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG I+DWLGRRPMLILSS+ YF+ GLIMLWSPNVYVL  ARLL+GFG GLA
Sbjct  61   SGPISDWLGRRPMLILSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLA  111



>gb|AAD30608.1|AC007369_18 Sugar transporter [Arabidopsis thaliana]
Length=734

 Score =   180 bits (457),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K+L L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDLNLPTSVQGLVVAMSLIGATVITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG I+DWLGRRPMLILSS+ YF+ GLIMLWSPNVYVL  ARLL+GFG GLA
Sbjct  61   SGPISDWLGRRPMLILSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLA  111



>emb|CDX96618.1| BnaA08g21610D [Brassica napus]
Length=725

 Score =   180 bits (456),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLPTSVQGLVVAMSLIGATVITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG I+DWLGRRPMLILSS+ YFLSGLIM WSP+VYVL +ARLLDGFG GLA
Sbjct  61   SGPISDWLGRRPMLILSSVMYFLSGLIMWWSPSVYVLCLARLLDGFGAGLA  111



>emb|CBI21577.3| unnamed protein product [Vitis vinifera]
Length=627

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 101/113 (89%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            MNGAVLVAI A IGN LQGWDNATIAGAV+YIK+E  L+T   +EGL+VAMSLIGAT IT
Sbjct  1    MNGAVLVAITAAIGNLLQGWDNATIAGAVLYIKREFHLQTEPTIEGLIVAMSLIGATAIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG +ADWLGRRPMLI+SS+ YFLSGL+MLWSPNVYVLL+ARLLDGFGIGLA
Sbjct  61   TFSGPVADWLGRRPMLIISSVLYFLSGLVMLWSPNVYVLLLARLLDGFGIGLA  113



>ref|XP_002300629.1| hypothetical protein POPTR_0002s00760g [Populus trichocarpa]
 gb|EEE79902.1| hypothetical protein POPTR_0002s00760g [Populus trichocarpa]
Length=738

 Score =   180 bits (456),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GA LVAIAA +GNFLQGWDNATIAGAV+Y+KK+L L++ +EGLVVAMSLIGA  ITTC
Sbjct  1    MKGASLVAIAACVGNFLQGWDNATIAGAVIYVKKDLKLQSSVEGLVVAMSLIGAAAITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG I+DW+GRRPMLI SS+ YF+SGL+M WSPNVYVL I RLLDGFG+GLA
Sbjct  61   SGPISDWIGRRPMLISSSILYFVSGLVMFWSPNVYVLCIGRLLDGFGVGLA  111



>ref|XP_002893133.1| hypothetical protein ARALYDRAFT_472320 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69392.1| hypothetical protein ARALYDRAFT_472320 [Arabidopsis lyrata subsp. 
lyrata]
Length=735

 Score =   180 bits (456),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K+L L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDLNLPTSVQGLVVAMSLIGATVITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG I+DWLGRRPMLILSS+ YF+ GLIMLWSPNVYVL  ARLL+GFG GLA
Sbjct  61   SGPISDWLGRRPMLILSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLA  111



>ref|XP_002276373.1| PREDICTED: monosaccharide-sensing protein 2 [Vitis vinifera]
 gb|ADP37149.1| putative tonoplastic monosaccharide transporter [Vitis vinifera]
Length=742

 Score =   179 bits (455),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 101/113 (89%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            MNGAVLVAI A IGN LQGWDNATIAGAV+YIK+E  L+T   +EGL+VAMSLIGAT IT
Sbjct  1    MNGAVLVAITAAIGNLLQGWDNATIAGAVLYIKREFHLQTEPTIEGLIVAMSLIGATAIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG +ADWLGRRPMLI+SS+ YFLSGL+MLWSPNVYVLL+ARLLDGFGIGLA
Sbjct  61   TFSGPVADWLGRRPMLIISSVLYFLSGLVMLWSPNVYVLLLARLLDGFGIGLA  113



>ref|XP_010686712.1| PREDICTED: monosaccharide-sensing protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=735

 Score =   179 bits (455),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GAVLVA+AATIGNFLQGWDNATIAG+++YIKKEL L T MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVLVALAATIGNFLQGWDNATIAGSILYIKKELELSTAMEGLVVAMSLIGATVITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG+++D +GRRP+L+LS+  YF+  L+MLWSPNVY+LL+ARLLDGFGIGLA
Sbjct  61   SGAVSDAVGRRPLLMLSASLYFIGSLVMLWSPNVYILLLARLLDGFGIGLA  111



>gb|EAY85098.1| hypothetical protein OsI_06450 [Oryza sativa Indica Group]
Length=689

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 105/119 (88%), Gaps = 2/119 (2%)
 Frame = +1

Query  256  DSGLLRMNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLI  429
            D   ++M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLI
Sbjct  24   DRRGVKMSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFKLESEPTVEGLIVAMSLI  83

Query  430  GATLITTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            GAT+ITT SG ++DW+GRRPMLILSS+ YFLS LIMLWSPNVYVLL+ARL+DGFGIGLA
Sbjct  84   GATIITTFSGPVSDWIGRRPMLILSSILYFLSSLIMLWSPNVYVLLLARLIDGFGIGLA  142



>ref|XP_003571780.1| PREDICTED: monosaccharide-sensing protein 2-like [Brachypodium 
distachyon]
Length=749

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 103/115 (90%), Gaps = 2/115 (2%)
 Frame = +1

Query  268  LRMNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATL  441
            ++M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+
Sbjct  3    VKMSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFKLENDPTLEGLIVAMSLIGATI  62

Query  442  ITTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            ITT SG ++DW+GRRPMLILSS+ YF SGLIMLWSPNVYVLL+ARL+DGFGIGLA
Sbjct  63   ITTFSGPVSDWVGRRPMLILSSILYFFSGLIMLWSPNVYVLLLARLVDGFGIGLA  117



>gb|EMT06669.1| Monosaccharide-sensing protein 2 [Aegilops tauschii]
Length=787

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 103/114 (90%), Gaps = 2/114 (2%)
 Frame = +1

Query  271  RMNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLI  444
            +M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+I
Sbjct  43   KMSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFQLENNPTVEGLIVAMSLIGATII  102

Query  445  TTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TT SG ++DW+GRRPMLILSS+ YFLSGLIMLWSPNVYVLL+ARL+DGFGIGLA
Sbjct  103  TTFSGPVSDWVGRRPMLILSSLLYFLSGLIMLWSPNVYVLLLARLVDGFGIGLA  156



>gb|EAZ22316.1| hypothetical protein OsJ_05971 [Oryza sativa Japonica Group]
Length=775

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 105/119 (88%), Gaps = 2/119 (2%)
 Frame = +1

Query  256  DSGLLRMNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLI  429
            D   ++M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLI
Sbjct  24   DRRGVKMSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFKLESEPTVEGLIVAMSLI  83

Query  430  GATLITTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            GAT+ITT SG ++DW+GRRPMLILSS+ YFLS LIMLWSPNVYVLL+ARL+DGFGIGLA
Sbjct  84   GATIITTFSGPVSDWIGRRPMLILSSILYFLSSLIMLWSPNVYVLLLARLIDGFGIGLA  142



>ref|XP_010477336.1| PREDICTED: monosaccharide-sensing protein 1 [Camelina sativa]
 ref|XP_010477338.1| PREDICTED: monosaccharide-sensing protein 1 [Camelina sativa]
Length=734

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI  +L L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINNDLNLPTSVQGLVVAMSLIGATVITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG I+DWLGRRPMLILSS+ YF+ GLIMLWSPNVYVL  ARLL+GFG GLA
Sbjct  61   SGPISDWLGRRPMLILSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLA  111



>gb|EMS49950.1| Monosaccharide-sensing protein 2 [Triticum urartu]
Length=686

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 102/113 (90%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFQLENNPTVEGLIVAMSLIGATIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++DW+GRRPMLILSS+ YFLSGLIMLWSPNVYVLL+ARL+DGFGIGLA
Sbjct  61   TFSGPVSDWVGRRPMLILSSLLYFLSGLIMLWSPNVYVLLLARLVDGFGIGLA  113



>dbj|BAJ89532.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 102/113 (90%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFQLENDPTVEGLIVAMSLIGATIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++DW+GRRPMLILSS+ YFLSGLIMLWSPNVYVLL+ARL+DGFGIGLA
Sbjct  61   TFSGPVSDWVGRRPMLILSSILYFLSGLIMLWSPNVYVLLLARLVDGFGIGLA  113



>emb|CDI66591.1| putative sugar transporter type 2a protein [Saccharum hybrid 
cultivar R570]
Length=745

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 102/113 (90%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  447
            M+GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFQLQSEPTVEGLIVAMSLIGATIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++DW+GRRPMLILSS+ YFLS LIMLWSPNVYVLL+ARL+DGFGIGLA
Sbjct  61   TFSGPVSDWIGRRPMLILSSVLYFLSSLIMLWSPNVYVLLLARLVDGFGIGLA  113



>emb|CDI66586.1| putative sugar transporter type 2a protein [Saccharum hybrid 
cultivar R570]
 emb|CDI66607.1| putative sugar transporter type 2a protein [Saccharum hybrid 
cultivar R570]
Length=745

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 102/113 (90%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  447
            M+GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFQLQSEPTVEGLIVAMSLIGATIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++DW+GRRPMLILSS+ YFLS LIMLWSPNVYVLL+ARL+DGFGIGLA
Sbjct  61   TFSGPVSDWIGRRPMLILSSVLYFLSSLIMLWSPNVYVLLLARLVDGFGIGLA  113



>ref|NP_001046359.1| Os02g0229400 [Oryza sativa Japonica Group]
 dbj|BAD26163.1| putative hexose transporter [Oryza sativa Japonica Group]
 dbj|BAF08273.1| Os02g0229400 [Oryza sativa Japonica Group]
 gb|ADG21983.1| tonoplast monosaccharide transporter 2 [Oryza sativa Japonica 
Group]
Length=746

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 102/113 (90%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFKLESEPTVEGLIVAMSLIGATIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++DW+GRRPMLILSS+ YFLS LIMLWSPNVYVLL+ARL+DGFGIGLA
Sbjct  61   TFSGPVSDWIGRRPMLILSSILYFLSSLIMLWSPNVYVLLLARLIDGFGIGLA  113



>ref|XP_009390770.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=741

 Score =   177 bits (449),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 103/113 (91%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAVLVA+AA+IGN LQGWDNATIAGAV+YIKKE  LET   MEGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAVAASIGNLLQGWDNATIAGAVLYIKKEFKLETQPTMEGLIVAMSLIGATIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG+++D +GRRPMLI+SS+ YF+SGL+MLWSPNVYVLL+ARL+DGFGIGLA
Sbjct  61   TFSGAVSDMVGRRPMLIISSVLYFVSGLVMLWSPNVYVLLLARLIDGFGIGLA  113



>ref|XP_009401004.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009401005.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=738

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 102/113 (90%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  447
            M GAVLVAIAA+IGN LQGWDNATIAG+++YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAASIGNLLQGWDNATIAGSILYIKKEFKLDSEPTIEGLIVAMSLIGATIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++DW+GRRPMLI+SS+ YFLSGL+MLWSPNVYVLL+ARL+DGFGIGLA
Sbjct  61   TFSGPVSDWVGRRPMLIISSILYFLSGLVMLWSPNVYVLLLARLIDGFGIGLA  113



>gb|EYU43534.1| hypothetical protein MIMGU_mgv1a001953mg [Erythranthe guttata]
Length=734

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            MNGA L+AIAATIGNFLQGWDNATIAGAVVYIKKEL L   +EGL+VAMSLIGATLITTC
Sbjct  1    MNGAALIAIAATIGNFLQGWDNATIAGAVVYIKKELELGAAIEGLIVAMSLIGATLITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG+I+D +GRRPMLI SSMFYFLSGLIMLWSPNVYVLL+ARLLDGFGIGLA
Sbjct  61   SGTISDSIGRRPMLIASSMFYFLSGLIMLWSPNVYVLLLARLLDGFGIGLA  111



>ref|XP_009397963.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397964.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397965.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=738

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 102/113 (90%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GA LVAI A+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MQGAALVAIVASIGNLLQGWDNATIAGAVLYIKKEFKLESEPTIEGLIVAMSLIGATIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG+++DW+GRRPMLI+SS+ YFLSGL+MLWSPNVYVLL+ARL+DGFGIGLA
Sbjct  61   TFSGAVSDWVGRRPMLIISSVLYFLSGLVMLWSPNVYVLLLARLIDGFGIGLA  113



>ref|XP_010063149.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW70342.1| hypothetical protein EUGRSUZ_F03585 [Eucalyptus grandis]
Length=740

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GAV VA+AATIGNFLQGWDNATIAG +VYIK++L L + +EGLVVAMSLIGAT+ITT 
Sbjct  1    MRGAVFVALAATIGNFLQGWDNATIAGGIVYIKEDLDLGSTVEGLVVAMSLIGATVITTS  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG I+DWLGRRPMLI+SS+ YF+ GL+MLWSPNVYVL + RLLDGFGIGLA
Sbjct  61   SGPISDWLGRRPMLIMSSILYFIGGLVMLWSPNVYVLCLGRLLDGFGIGLA  111



>ref|XP_006855646.1| hypothetical protein AMTR_s00044p00110510 [Amborella trichopoda]
 gb|ERN17113.1| hypothetical protein AMTR_s00044p00110510 [Amborella trichopoda]
Length=743

 Score =   176 bits (447),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 99/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  447
            M GAVLVAIAA+IGN LQGWDNATIA AV+YIK+E  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAASIGNLLQGWDNATIAAAVLYIKEEFDLDNEPTLEGLIVAMSLIGATIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG I+DW+GRRPMLI SS+ YF+S LIM WSPNVYVLL+ARLLDGFGIGLA
Sbjct  61   TCSGPISDWIGRRPMLIFSSILYFVSALIMFWSPNVYVLLLARLLDGFGIGLA  113



>ref|XP_010909820.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909821.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909822.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909823.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909824.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909825.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909826.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909827.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909828.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909829.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
Length=747

 Score =   176 bits (447),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 103/112 (92%), Gaps = 2/112 (2%)
 Frame = +1

Query  277  NGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITT  450
             GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+ITT
Sbjct  3    RGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFKLETEPTVEGLIVAMSLIGATIITT  62

Query  451  CSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
             SG+++DW+GRRP+LILSS+ YFLSGL+MLWSPNV++LL+ARL+DGFGIGLA
Sbjct  63   FSGAVSDWIGRRPILILSSVLYFLSGLVMLWSPNVHILLLARLIDGFGIGLA  114



>ref|XP_006647093.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Oryza 
brachyantha]
 ref|XP_006647094.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Oryza 
brachyantha]
Length=746

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 101/113 (89%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLESEPTVEGLIVAMSLIGATIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++DW+GRRPMLILSS+ YFL  LIMLWSPNVYVLL+ARL+DGFGIGLA
Sbjct  61   TFSGPVSDWIGRRPMLILSSILYFLGSLIMLWSPNVYVLLLARLIDGFGIGLA  113



>gb|AJO70165.1| tonoplast monosaccharide transporters 1 [Camellia sinensis]
Length=736

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +1

Query  313  GNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTCSGSIADWLGRRPM  492
            GNFLQGWDNATIAGA+VYIK++L LET +EGLVVAMSLIGATL+TTCSG I+D +GRRPM
Sbjct  14   GNFLQGWDNATIAGAIVYIKEDLSLETTIEGLVVAMSLIGATLVTTCSGPISDLIGRRPM  73

Query  493  LILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            LI+SSMFYF+SGL+MLWSPNVYVLL+ARL+DGFGIGLA
Sbjct  74   LIMSSMFYFVSGLVMLWSPNVYVLLVARLIDGFGIGLA  111



>ref|XP_007204446.1| hypothetical protein PRUPE_ppa026426mg [Prunus persica]
 gb|EMJ05645.1| hypothetical protein PRUPE_ppa026426mg [Prunus persica]
Length=742

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 101/111 (91%), Gaps = 2/111 (2%)
 Frame = +1

Query  280  GAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTC  453
            G+VLVAIAATIGN LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT+ITT 
Sbjct  3    GSVLVAIAATIGNLLQGWDNATIAGAVLYIKREFKLETQPTIEGLIVAMSLIGATVITTF  62

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG ++D LGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLA
Sbjct  63   SGPVSDSLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLA  113



>ref|XP_008242106.1| PREDICTED: monosaccharide-sensing protein 2-like [Prunus mume]
Length=742

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 101/111 (91%), Gaps = 2/111 (2%)
 Frame = +1

Query  280  GAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTC  453
            G+VLVAIAATIGN LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT+ITT 
Sbjct  3    GSVLVAIAATIGNLLQGWDNATIAGAVLYIKREFKLETQPTIEGLIVAMSLIGATVITTF  62

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG ++D LGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLA
Sbjct  63   SGPVSDSLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLA  113



>ref|XP_008237926.1| PREDICTED: monosaccharide-sensing protein 2 [Prunus mume]
Length=739

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M  A++VAIAATIGN LQGWDNATIAGA+VYI ++  L + +EGLVVAMSLIGAT ITTC
Sbjct  1    MRSAMMVAIAATIGNLLQGWDNATIAGAIVYITEDFDLGSSLEGLVVAMSLIGATAITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG+I+DW+GR+PMLI SS+ YF+SGL+M+WSPNVYVL IARLLDGFGIGLA
Sbjct  61   SGAISDWIGRKPMLIASSVLYFVSGLVMVWSPNVYVLCIARLLDGFGIGLA  111



>ref|XP_010029562.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW56480.1| hypothetical protein EUGRSUZ_I02208 [Eucalyptus grandis]
Length=731

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 101/113 (89%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  447
            M GAVLVA+AATIGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAVAATIGNLLQGWDNATIAGAVLYIKKEFDLEGQPTIEGLIVAMSLIGATVIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D +GRRPM+I+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLA
Sbjct  61   TFSGPVSDSIGRRPMMIISSILYFLSGLVMLWAPNVYVLLLARLLDGFGIGLA  113



>ref|XP_010940242.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
Length=745

 Score =   174 bits (440),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 101/113 (89%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLESEPTIEGLIVAMSLIGATIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
              SG+I+DW GRRPMLI+SS+FYF SGL+MLWSPNVY+LL+ARL+DGFG+GLA
Sbjct  61   MFSGAISDWGGRRPMLIVSSIFYFFSGLVMLWSPNVYILLLARLIDGFGVGLA  113



>ref|XP_008778122.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778123.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778124.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778125.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778126.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
Length=747

 Score =   174 bits (440),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 102/113 (90%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAVLVAI A+IGN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+IT
Sbjct  2    MQGAVLVAIVASIGNLLQGWDNATIAGAVLYIKKEFKLETEPTIEGLIVAMSLIGATIIT  61

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG+++D +GRRP+LILSS+ YFLSGL+MLWSPNVY+LL+ARL+DGFGIGLA
Sbjct  62   TFSGAVSDCIGRRPILILSSVLYFLSGLVMLWSPNVYILLLARLIDGFGIGLA  114



>ref|XP_008351570.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=216

 Score =   164 bits (415),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 104/113 (92%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEPAVEGLIVAMSLIGATVVT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
             CSG++ADWLGRRPMLI+SS+FYFLSG++MLWSPNVY+LL+ARLLDGFGIGLA
Sbjct  61   FCSGAVADWLGRRPMLIISSVFYFLSGIVMLWSPNVYILLLARLLDGFGIGLA  113



>gb|KJB79727.1| hypothetical protein B456_013G064200 [Gossypium raimondii]
Length=592

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 103/113 (91%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            MNGAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MNGAVLVALAAAIGNMLQGWDNATIAGAVLYIKKEFKLESAPTIEGLIVAMSLIGATCIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG I+DWLGRRPMLI+SS+ YFLSGL+M+WSPNVY+LL+ARLLDGFGIGLA
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYFLSGLVMVWSPNVYILLLARLLDGFGIGLA  113



>emb|CDP14489.1| unnamed protein product [Coffea canephora]
Length=742

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 101/113 (89%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M+GAVLVAI ATIGN LQGWDNATIAGAV++IK+EL LE+   +EGL+VAMSLIGA L+T
Sbjct  1    MSGAVLVAIGATIGNLLQGWDNATIAGAVLFIKRELKLESDPTVEGLIVAMSLIGAVLVT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T +G +ADWLGRRPMLI+SS+ YF+SGL+M WSPNVYVLL+ RLLDGFG+GLA
Sbjct  61   TFAGGVADWLGRRPMLIVSSVLYFVSGLVMFWSPNVYVLLLGRLLDGFGVGLA  113



>gb|EMT29091.1| Monosaccharide-sensing protein 2 [Aegilops tauschii]
Length=743

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 103/113 (91%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFSLETQPLIEGLIVAMSLIGATVIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG++AD +GRRP+LI SS+ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLA
Sbjct  61   TFSGAVADAVGRRPLLIASSVLYFVSGLVMLWAPNVYVLLLARLIDGFGIGLA  113



>gb|EMS63940.1| Monosaccharide-sensing protein 2 [Triticum urartu]
Length=743

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 103/113 (91%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFSLETQPLIEGLIVAMSLIGATVIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG++AD +GRRP+LI SS+ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLA
Sbjct  61   TFSGAVADAVGRRPLLIASSVLYFVSGLVMLWAPNVYVLLLARLIDGFGIGLA  113



>gb|AAP54842.2| hexose transporter, putative, expressed [Oryza sativa Japonica 
Group]
Length=445

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  447
            M GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MAGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLIGATIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG++AD  GRRPMLI S++ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLA
Sbjct  61   TFSGAVADSFGRRPMLIASAVLYFVSGLVMLWAPNVYVLLLARLIDGFGIGLA  113



>ref|XP_006364349.1| PREDICTED: monosaccharide-sensing protein 2-like [Solanum tuberosum]
Length=257

 Score =   164 bits (414),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 104/113 (92%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA IG+FLQGWDNATIAG+++YIKKE  LET   MEGL+VAMSL+GA L+T
Sbjct  1    MSGAVLVAVAAAIGSFLQGWDNATIAGSILYIKKEFNLETQPTMEGLIVAMSLVGAVLMT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG+IADWLGRRP+LI SS+ YF+SGL+MLWSPN+YVLL+ARLL+GFG+GLA
Sbjct  61   TCSGAIADWLGRRPLLITSSVLYFVSGLVMLWSPNIYVLLLARLLNGFGVGLA  113



>ref|XP_007210337.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
 ref|XP_007210338.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
 gb|EMJ11536.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
 gb|EMJ11537.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
Length=739

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GAV+VAIAATIGN LQGWDNATIAGA+VYI ++  L + +EGLVVAMSLIGAT ITTC
Sbjct  1    MRGAVMVAIAATIGNLLQGWDNATIAGAIVYITEDFDLGSSLEGLVVAMSLIGATAITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG I+D +GR+PMLI SS+ YF+SGL+M+WSPNVYVL IARLLDGFGIGLA
Sbjct  61   SGVISDSIGRKPMLIASSVLYFVSGLVMVWSPNVYVLCIARLLDGFGIGLA  111



>gb|KJB79728.1| hypothetical protein B456_013G064200 [Gossypium raimondii]
Length=739

 Score =   171 bits (433),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 103/113 (91%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            MNGAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MNGAVLVALAAAIGNMLQGWDNATIAGAVLYIKKEFKLESAPTIEGLIVAMSLIGATCIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG I+DWLGRRPMLI+SS+ YFLSGL+M+WSPNVY+LL+ARLLDGFGIGLA
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYFLSGLVMVWSPNVYILLLARLLDGFGIGLA  113



>gb|KHG05233.1| Monosaccharide-sensing 2 -like protein [Gossypium arboreum]
Length=739

 Score =   171 bits (433),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 103/113 (91%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            MNGAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MNGAVLVALAAAIGNMLQGWDNATIAGAVLYIKKEFKLESAPTIEGLIVAMSLIGATCIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG I+DWLGRRPMLI+SS+ YFLSGL+M+WSPNVY+LL+ARLLDGFGIGLA
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYFLSGLVMVWSPNVYILLLARLLDGFGIGLA  113



>ref|XP_004951395.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=745

 Score =   171 bits (433),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  447
            M+GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPTVEGLIVAMSLIGATIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D +GRRPMLILSS+ YF S LIMLWSPNVYVLL+ARL+DGFGIGLA
Sbjct  61   TFSGPVSDLIGRRPMLILSSILYFCSSLIMLWSPNVYVLLLARLVDGFGIGLA  113



>ref|XP_010906859.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
Length=549

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 102/113 (90%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAVLVA+AATIGN LQGWDN+TIAGAV++IK+E  LE+   +EGL++AMSLIGAT+IT
Sbjct  1    MRGAVLVALAATIGNLLQGWDNSTIAGAVLFIKREFQLESEPTIEGLIIAMSLIGATIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG+++DW GRRPMLI +++F FLSGL+MLWSPNVY+LL+ARL++GFG+GLA
Sbjct  61   TFSGAVSDWFGRRPMLIAAAVFTFLSGLVMLWSPNVYILLLARLINGFGVGLA  113



>dbj|BAJ90138.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=743

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 102/112 (91%), Gaps = 2/112 (2%)
 Frame = +1

Query  277  NGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITT  450
            +GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+ITT
Sbjct  3    SGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFSLETQPLIEGLIVAMSLIGATVITT  62

Query  451  CSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
             SG++AD +GRRP+LI SS+ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLA
Sbjct  63   FSGAVADAVGRRPLLIASSVLYFVSGLVMLWAPNVYVLLLARLIDGFGIGLA  114



>emb|CAD58958.1| hexose transporter [Hordeum vulgare subsp. vulgare]
Length=743

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 102/112 (91%), Gaps = 2/112 (2%)
 Frame = +1

Query  277  NGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITT  450
            +GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+ITT
Sbjct  3    SGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFSLETQPLIEGLIVAMSLIGATVITT  62

Query  451  CSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
             SG++AD +GRRP+LI SS+ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLA
Sbjct  63   FSGAVADAVGRRPLLIASSVLYFVSGLVMLWAPNVYVLLLARLIDGFGIGLA  114



>ref|XP_007142576.1| hypothetical protein PHAVU_008G292400g [Phaseolus vulgaris]
 gb|ESW14570.1| hypothetical protein PHAVU_008G292400g [Phaseolus vulgaris]
Length=732

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 103/113 (91%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA IGNFLQGWDNATIAG+++YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVALAAAIGNFLQGWDNATIAGSILYIKREFQLESEPTIEGLIVAMSLIGATVVT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG I+DWLGRRPMLI+SSM YFLS L+MLWSPNVY+LL ARLLDGFGIGLA
Sbjct  61   TCSGPISDWLGRRPMLIISSMLYFLSSLVMLWSPNVYILLFARLLDGFGIGLA  113



>ref|XP_010680636.1| PREDICTED: monosaccharide-sensing protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=728

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 98/113 (87%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAV  A+AAT+GN LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVFAALAATMGNLLQGWDNATIAGAVIYIKREFSLETQPTLEGLIVAMSLIGATVIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D +GRRPMLI+SS+ YFL GL+MLWSPNVYVLL+ RLLDGFG+GLA
Sbjct  61   TFSGPVSDSVGRRPMLIISSILYFLGGLVMLWSPNVYVLLLGRLLDGFGVGLA  113



>ref|XP_002467580.1| hypothetical protein SORBIDRAFT_01g030430 [Sorghum bicolor]
 gb|EER94578.1| hypothetical protein SORBIDRAFT_01g030430 [Sorghum bicolor]
Length=740

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 101/113 (89%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  447
            M GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MGGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLIGATVIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG++AD +GRRPMLI S++ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLA
Sbjct  61   TFSGAVADSVGRRPMLIASAILYFVSGLVMLWAPNVYVLLLARLIDGFGIGLA  113



>ref|XP_010266258.1| PREDICTED: monosaccharide-sensing protein 2 isoform X2 [Nelumbo 
nucifera]
Length=653

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 101/113 (89%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAV VAIAA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MKGAVFVAIAAAVGNLLQGWDNATIAGAVLYIKKEFQLESEPTIEGLIVAMSLIGATIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG ++DWLGRRPMLI+SS+ YF+SGLIM WSPNVY+LL+ARLLDGFGIGLA
Sbjct  61   TCSGPVSDWLGRRPMLIISSVLYFVSGLIMFWSPNVYILLLARLLDGFGIGLA  113



>ref|NP_001065182.1| Os10g0539900 [Oryza sativa Japonica Group]
 gb|AAG46115.1|AC073166_13 putative sugar transporter [Oryza sativa Japonica Group]
 gb|ABB47937.2| hexose transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27096.1| Os10g0539900 [Oryza sativa Japonica Group]
 gb|EAZ16837.1| hypothetical protein OsJ_32308 [Oryza sativa Japonica Group]
 gb|ADG21982.1| tonoplast monosaccharide transporter 1 [Oryza sativa Japonica 
Group]
Length=740

 Score =   169 bits (427),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  447
            M GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MAGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLIGATIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG++AD  GRRPMLI S++ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLA
Sbjct  61   TFSGAVADSFGRRPMLIASAVLYFVSGLVMLWAPNVYVLLLARLIDGFGIGLA  113



>ref|XP_011000869.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011000870.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011000871.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=740

 Score =   169 bits (427),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 103/113 (91%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            MNGAVLVA+AA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VA SL+GATLIT
Sbjct  1    MNGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKREFHLESEPTIEGLIVATSLVGATLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG I+DWLGRRP+LI+SS+ YF+SGL+MLWSPNVYVLL+ARLLDGFGIGLA
Sbjct  61   TCSGPISDWLGRRPLLIISSILYFVSGLVMLWSPNVYVLLLARLLDGFGIGLA  113



>gb|EEC67373.1| hypothetical protein OsI_34495 [Oryza sativa Indica Group]
Length=718

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  447
            M GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MAGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLIGATIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG++AD  GRRPMLI S++ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLA
Sbjct  61   TFSGAVADSFGRRPMLIASAVLYFVSGLVMLWAPNVYVLLLARLIDGFGIGLA  113



>ref|XP_009763350.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009763351.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009763352.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=734

 Score =   168 bits (425),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 103/113 (91%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA IG+FLQGWDNATIAG ++YIKKE  LET   MEGL+V+MSLIGA LIT
Sbjct  1    MSGAVLVAVAAAIGSFLQGWDNATIAGGILYIKKEFKLETQPTMEGLIVSMSLIGAVLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG+IADWLGRRP+LI SS+ YF+SGL+MLWSPNVYVLL+ARLLDGFG+GLA
Sbjct  61   TCSGAIADWLGRRPLLITSSVLYFISGLVMLWSPNVYVLLLARLLDGFGVGLA  113



>ref|XP_009608796.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009608797.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009608798.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
Length=734

 Score =   168 bits (425),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 103/113 (91%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA IG+FLQGWDNATIAG ++YIKKE  LET   MEGL+V+MSLIGA LIT
Sbjct  1    MSGAVLVAVAAAIGSFLQGWDNATIAGGILYIKKEFKLETQPTMEGLIVSMSLIGAVLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG+IADWLGRRP+LI SS+ YF+SGL+MLWSPNVYVLL+ARLLDGFG+GLA
Sbjct  61   TCSGAIADWLGRRPLLITSSVLYFVSGLVMLWSPNVYVLLLARLLDGFGVGLA  113



>ref|XP_010266257.1| PREDICTED: monosaccharide-sensing protein 2 isoform X1 [Nelumbo 
nucifera]
Length=742

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 101/113 (89%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAV VAIAA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MKGAVFVAIAAAVGNLLQGWDNATIAGAVLYIKKEFQLESEPTIEGLIVAMSLIGATIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG ++DWLGRRPMLI+SS+ YF+SGLIM WSPNVY+LL+ARLLDGFGIGLA
Sbjct  61   TCSGPVSDWLGRRPMLIISSVLYFVSGLIMFWSPNVYILLLARLLDGFGIGLA  113



>ref|XP_007043079.1| Tonoplast monosaccharide transporter2 [Theobroma cacao]
 gb|EOX98910.1| Tonoplast monosaccharide transporter2 [Theobroma cacao]
Length=739

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 102/113 (90%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   MEGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKKEFKLESDPTMEGLIVAMSLIGATCIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG I+DWLGRRPMLI+SS+ Y +SGL+MLWSPNVY+LL+ARLLDGFG+GLA
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYIISGLVMLWSPNVYILLLARLLDGFGVGLA  113



>ref|XP_003574265.1| PREDICTED: monosaccharide-sensing protein 2-like [Brachypodium 
distachyon]
Length=741

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 103/113 (91%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFSLESQPLIEGLIVAMSLIGATVIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG++AD +GRRP+LI S++ YF+SGL+MLW+P+VYVLL+ARL+DGFGIGLA
Sbjct  61   TFSGAVADAVGRRPLLIASAVLYFVSGLVMLWAPSVYVLLLARLIDGFGIGLA  113



>ref|XP_008645619.1| PREDICTED: monosaccharide-sensing protein 2-like [Zea mays]
 ref|XP_008645620.1| PREDICTED: monosaccharide-sensing protein 2-like [Zea mays]
 gb|AFW59275.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_154299 [Zea 
mays]
 gb|AFW71237.1| hypothetical protein ZEAMMB73_210614 [Zea mays]
Length=745

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 98/113 (87%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  447
            M+GAVLVAI A+IGN LQGWDNATIA AV+YIKKE  L  E  +EGL+V+MSLIGAT++T
Sbjct  1    MSGAVLVAIVASIGNLLQGWDNATIAAAVLYIKKEFQLQNEPTVEGLIVSMSLIGATIVT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D +GRRPMLILSS+ YF SGLIMLWSPNVYVLL+AR +DGFGIGLA
Sbjct  61   TFSGPLSDSIGRRPMLILSSILYFFSGLIMLWSPNVYVLLLARFVDGFGIGLA  113



>ref|XP_002520608.1| sugar transporter, putative [Ricinus communis]
 gb|EEF41781.1| sugar transporter, putative [Ricinus communis]
Length=740

 Score =   166 bits (419),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 104/113 (92%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA +GN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VA SLIGATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKREFNLESEPTIEGLIVATSLIGATLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG+I+DWLGRRPMLI+SS+ YFLSG++MLWSPNVY+LL+ARLLDGFGIGLA
Sbjct  61   TCSGAISDWLGRRPMLIISSVLYFLSGVVMLWSPNVYILLLARLLDGFGIGLA  113



>gb|EMT28528.1| Monosaccharide-sensing protein 3 [Aegilops tauschii]
Length=531

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 96/113 (85%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAVLVAI A IGN LQG DNATIAGAV+YIK+E  LET   +EGLVVA SLIGAT+IT
Sbjct  1    MRGAVLVAITAAIGNMLQGVDNATIAGAVMYIKREFHLETQPAVEGLVVATSLIGATIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG +AD +GRRPMLI SS+ YFL GL+MLWSPNVYVLLIARL+DGFG+GLA
Sbjct  61   TFSGPVADIVGRRPMLIASSLLYFLGGLVMLWSPNVYVLLIARLIDGFGVGLA  113



>gb|KJB77474.1| hypothetical protein B456_012G139000 [Gossypium raimondii]
Length=629

 Score =   165 bits (417),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 102/113 (90%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKREFSLESEPTIEGLIVAMSLIGATCIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG I+DWLGRRPMLI+SS+ Y +SGL+MLWSPNVY+LL+ARLLDGFG+GLA
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYCVSGLVMLWSPNVYILLLARLLDGFGVGLA  113



>ref|XP_008349018.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=254

 Score =   158 bits (399),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 101/112 (90%), Gaps = 2/112 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEPAVEGLIVAMSLIGATVVT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGL  603
             CSG++ADWLGRRP LI+SS+ YFLSGL+MLWSPNVY+LL+ARLLDGFGIGL
Sbjct  61   FCSGAVADWLGRRPTLIVSSVLYFLSGLVMLWSPNVYILLLARLLDGFGIGL  112



>ref|XP_010090703.1| Monosaccharide-sensing protein 2 [Morus notabilis]
 gb|EXB40422.1| Monosaccharide-sensing protein 2 [Morus notabilis]
Length=740

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 103/113 (91%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VA SLIGATLIT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFHLESQPTLEGLIVATSLIGATLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG+IADWLGRRP+LI+SS+ YFLSG++MLWSPNVY LL+ARLLDGFG+GLA
Sbjct  61   TCSGAIADWLGRRPLLIISSILYFLSGILMLWSPNVYFLLLARLLDGFGVGLA  113



>gb|KHG04801.1| Monosaccharide-sensing protein 2 [Gossypium arboreum]
 gb|KHG22589.1| Monosaccharide-sensing protein 2 [Gossypium arboreum]
Length=740

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 102/113 (90%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKREFSLESEPTIEGLIVAMSLIGATCIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG I+DWLGRRPMLI+SS+ Y +SGL+MLWSPNVY+LL+ARLLDGFG+GLA
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYCVSGLVMLWSPNVYILLLARLLDGFGVGLA  113



>gb|KDO68405.1| hypothetical protein CISIN_1g004750mg [Citrus sinensis]
Length=560

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 90/99 (91%), Gaps = 2/99 (2%)
 Frame = +1

Query  316  NFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRP  489
            N LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT ITTCSG+IADWLGRRP
Sbjct  15   NLLQGWDNATIAGAVLYIKREFHLETEPTIEGLIVAMSLIGATCITTCSGAIADWLGRRP  74

Query  490  MLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            MLI+SS+ YF+ GL+MLWSPNVYVLL+ARLLDGFGIGLA
Sbjct  75   MLIVSSVLYFIGGLVMLWSPNVYVLLLARLLDGFGIGLA  113



>gb|KJB77472.1| hypothetical protein B456_012G139000 [Gossypium raimondii]
 gb|KJB77475.1| hypothetical protein B456_012G139000 [Gossypium raimondii]
Length=740

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 102/113 (90%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKREFSLESEPTIEGLIVAMSLIGATCIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG I+DWLGRRPMLI+SS+ Y +SGL+MLWSPNVY+LL+ARLLDGFG+GLA
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYCVSGLVMLWSPNVYILLLARLLDGFGVGLA  113



>gb|KJB12352.1| hypothetical protein B456_002G014400 [Gossypium raimondii]
Length=592

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 102/113 (90%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAVLVA+AA IGNFLQGWD ATIAGAV+Y+K+E  LE+   +EGL++AMSLIGAT IT
Sbjct  1    MGGAVLVAVAAAIGNFLQGWDTATIAGAVLYVKREFKLESEPTIEGLIIAMSLIGATCIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG I+DWLGRRP+LI+SS+FYFLSG++M+WSPNVY+LL+ RL+DGFG+GLA
Sbjct  61   TCSGYISDWLGRRPLLIISSVFYFLSGIVMIWSPNVYILLLGRLMDGFGVGLA  113



>ref|XP_002282975.1| PREDICTED: monosaccharide-sensing protein 2 [Vitis vinifera]
 gb|ADP37148.1| putative tonoplastic monosaccharide transporter [Vitis vinifera]
Length=739

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 103/113 (91%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  447
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLQGEPTVEGLIVAMSLIGATFIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG+++DWLGRRPMLI+SS+FYF+SGL+MLWSPNVYVLL+ARLLDGFG+GL+
Sbjct  61   TISGAVSDWLGRRPMLIISSLFYFVSGLVMLWSPNVYVLLLARLLDGFGVGLS  113



>emb|CAN80213.1| hypothetical protein VITISV_042076 [Vitis vinifera]
Length=739

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 103/113 (91%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  447
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLQGEPTVEGLIVAMSLIGATFIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG+++DWLGRRPMLI+SS+FYF+SGL+MLWSPNVYVLL+ARLLDGFG+GL+
Sbjct  61   TISGAVSDWLGRRPMLIISSLFYFVSGLVMLWSPNVYVLLLARLLDGFGVGLS  113



>gb|AFP89954.1| tonoplastic transporter 2 [Vitis vinifera]
Length=739

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 103/113 (91%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  447
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLQGEPTVEGLIVAMSLIGATFIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG+++DWLGRRPMLI+SS+FYF+SGL+MLWSPNVYVLL+ARLLDGFG+GL+
Sbjct  61   TISGAVSDWLGRRPMLIISSLFYFVSGLVMLWSPNVYVLLLARLLDGFGVGLS  113



>ref|XP_002312798.1| transporter-related family protein [Populus trichocarpa]
 gb|EEE86753.1| transporter-related family protein [Populus trichocarpa]
Length=740

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 102/113 (90%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            MNGAVLVA+AA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VA SL+GATLIT
Sbjct  1    MNGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKREFHLESEPTIEGLIVATSLVGATLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG I+D LGRRP+LI+SS+ YF+SGL+MLWSPNVYVLL+ARLLDGFGIGLA
Sbjct  61   TCSGPISDCLGRRPLLIISSILYFVSGLVMLWSPNVYVLLLARLLDGFGIGLA  113



>emb|CBI37732.3| unnamed protein product [Vitis vinifera]
Length=644

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 103/113 (91%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  447
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLQGEPTVEGLIVAMSLIGATFIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG+++DWLGRRPMLI+SS+FYF+SGL+MLWSPNVYVLL+ARLLDGFG+GL+
Sbjct  61   TISGAVSDWLGRRPMLIISSLFYFVSGLVMLWSPNVYVLLLARLLDGFGVGLS  113



>ref|XP_010548175.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
 ref|XP_010548176.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
 ref|XP_010548177.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
 ref|XP_010548178.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
Length=742

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA IGNFLQGWDNATIAGAV+YIKKE  LE+   +EGL+VA SLIGATLIT
Sbjct  1    MSGAVLVAVAAAIGNFLQGWDNATIAGAVLYIKKEFDLESEPTIEGLIVATSLIGATLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG I+DWLGRRPMLI+SS+ YF+  L MLWSPNVYVLL+ RLLDGFG+GLA
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYFVGALTMLWSPNVYVLLLGRLLDGFGVGLA  113



>ref|XP_006486570.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006486571.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Citrus 
sinensis]
Length=732

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 90/99 (91%), Gaps = 2/99 (2%)
 Frame = +1

Query  316  NFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRP  489
            N LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT ITTCSG+IADWLGRRP
Sbjct  15   NLLQGWDNATIAGAVLYIKREFHLETEPTIEGLIVAMSLIGATCITTCSGAIADWLGRRP  74

Query  490  MLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            MLI+SS+ YF+ GL+MLWSPNVYVLL+ARLLDGFGIGLA
Sbjct  75   MLIISSVLYFIGGLVMLWSPNVYVLLLARLLDGFGIGLA  113



>dbj|BAI94493.1| sugar transporter [Dianthus caryophyllus]
Length=733

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 101/113 (89%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M+GAV VAIAATIGNFLQGWDNATIAGAV+YIKKE  LE+   MEG+++AM+LIG+T+IT
Sbjct  1    MSGAVWVAIAATIGNFLQGWDNATIAGAVLYIKKEFHLESDPKMEGILLAMALIGSTIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSGS++DWLGRR M+I S++ + +S +IMLWSPN+YVLL+ARL+DGFG GLA
Sbjct  61   TCSGSVSDWLGRRLMMISSAICFIVSAVIMLWSPNIYVLLLARLVDGFGGGLA  113



>gb|KCW64229.1| hypothetical protein EUGRSUZ_G01880 [Eucalyptus grandis]
Length=739

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 101/113 (89%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAV VA+AA +GN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGATL+T
Sbjct  1    MSGAVWVAVAAAVGNLLQGWDNATIAGAVLYIKREFDLESEPALEGLIVAMSLIGATLVT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG+IADWLGRRP+LI+SS+FYF  GL+MLWSPNVYVLL+AR LDG G+GLA
Sbjct  61   TCSGAIADWLGRRPLLIISSVFYFAGGLVMLWSPNVYVLLLARFLDGLGVGLA  113



>gb|KDP47010.1| hypothetical protein JCGZ_10737 [Jatropha curcas]
Length=740

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 102/113 (90%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVLVA+ A +GN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVVAAVGNLLQGWDNATIAGAVLYIKREFQLESEPTIEGLIVAMSLIGATLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG+I+DWLGRRPMLI+SS+ Y +SG++M WSPNVYVLL+ARLLDGFGIGLA
Sbjct  61   TCSGAISDWLGRRPMLIISSVLYCVSGIVMFWSPNVYVLLLARLLDGFGIGLA  113



>ref|XP_010066352.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 ref|XP_010066353.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 ref|XP_010066354.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 ref|XP_010066355.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW64228.1| hypothetical protein EUGRSUZ_G01880 [Eucalyptus grandis]
Length=740

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 101/113 (89%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAV VA+AA +GN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGATL+T
Sbjct  1    MSGAVWVAVAAAVGNLLQGWDNATIAGAVLYIKREFDLESEPALEGLIVAMSLIGATLVT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG+IADWLGRRP+LI+SS+FYF  GL+MLWSPNVYVLL+AR LDG G+GLA
Sbjct  61   TCSGAIADWLGRRPLLIISSVFYFAGGLVMLWSPNVYVLLLARFLDGLGVGLA  113



>ref|NP_001151936.1| LOC100285573 [Zea mays]
 ref|XP_008680244.1| PREDICTED: LOC100285573 isoform X1 [Zea mays]
 gb|ACG45075.1| hexose transporter [Zea mays]
 tpg|DAA46098.1| TPA: hexose transporter isoform 1 [Zea mays]
 tpg|DAA46099.1| TPA: hexose transporter isoform 2 [Zea mays]
Length=747

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  447
            M GAV+VAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MGGAVMVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLIGATVIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG+ AD +GRRPML+ S++ YF+SGL+MLW+P+VY+LL+ARL+DGFGIGLA
Sbjct  61   TFSGAAADCVGRRPMLVASAVLYFVSGLVMLWAPSVYILLLARLIDGFGIGLA  113



>ref|XP_009776539.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009776540.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=722

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 103/113 (91%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAV+VA+AA IGN LQGWDNATIAGAV+YIKKE  L+T   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVVVALAAAIGNLLQGWDNATIAGAVLYIKKEFNLQTQPTIEGLIVAMSLIGATVIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SGS++D  GRRPMLI+SS+FYFLSGL+MLW+PNVYVLL+ARLLDGFGIGLA
Sbjct  61   TFSGSVSDMFGRRPMLIISSVFYFLSGLVMLWAPNVYVLLLARLLDGFGIGLA  113



>ref|XP_006422393.1| hypothetical protein CICLE_v10027893mg [Citrus clementina]
 gb|ESR35633.1| hypothetical protein CICLE_v10027893mg [Citrus clementina]
Length=732

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 90/99 (91%), Gaps = 2/99 (2%)
 Frame = +1

Query  316  NFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRP  489
            N LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT ITTCSG+IADWLGRRP
Sbjct  15   NLLQGWDNATIAGAVLYIKREFHLETEPTIEGLIVAMSLIGATCITTCSGAIADWLGRRP  74

Query  490  MLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            MLI+SS+ YF+ GL+MLWSPNVYVLL+ARLLDGFGIGLA
Sbjct  75   MLIVSSVLYFIGGLVMLWSPNVYVLLLARLLDGFGIGLA  113



>gb|KDO68402.1| hypothetical protein CISIN_1g004750mg [Citrus sinensis]
 gb|KDO68403.1| hypothetical protein CISIN_1g004750mg [Citrus sinensis]
 gb|KDO68404.1| hypothetical protein CISIN_1g004750mg [Citrus sinensis]
Length=732

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 90/99 (91%), Gaps = 2/99 (2%)
 Frame = +1

Query  316  NFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRP  489
            N LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT ITTCSG+IADWLGRRP
Sbjct  15   NLLQGWDNATIAGAVLYIKREFHLETEPTIEGLIVAMSLIGATCITTCSGAIADWLGRRP  74

Query  490  MLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            MLI+SS+ YF+ GL+MLWSPNVYVLL+ARLLDGFGIGLA
Sbjct  75   MLIVSSVLYFIGGLVMLWSPNVYVLLLARLLDGFGIGLA  113



>ref|XP_010678631.1| PREDICTED: monosaccharide-sensing protein 2-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010678632.1| PREDICTED: monosaccharide-sensing protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=735

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 97/113 (86%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+ AVLVAIAAT+G+ L GWDNATIAGAV+YIKKE  LE+   +EGL+VA S+IGATLIT
Sbjct  1    MSAAVLVAIAATVGDLLYGWDNATIAGAVLYIKKEFNLESSPTLEGLIVATSIIGATLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG IAD LGRRPM+I+SS+ +F+S LIMLWSPNVYVLL  RLLDGFG GLA
Sbjct  61   TCSGPIADRLGRRPMMIISSVCFFVSALIMLWSPNVYVLLFGRLLDGFGSGLA  113



>ref|XP_008812559.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008812567.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008812574.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008812580.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
Length=745

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 98/113 (87%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAVLVAIAA+IGN LQGWDNATIA AV+YIK+E  LE+   MEGL+VAMSLIGA +IT
Sbjct  1    MRGAVLVAIAASIGNLLQGWDNATIAVAVLYIKREFNLESEPTMEGLIVAMSLIGAMIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
              SG+I+DW GRRPMLI+SS+FY  SGL+MLWSPNV +LL+ARL+DGFG+GLA
Sbjct  61   MFSGAISDWGGRRPMLIVSSIFYLFSGLVMLWSPNVCILLLARLIDGFGVGLA  113



>gb|KJB12351.1| hypothetical protein B456_002G014400 [Gossypium raimondii]
 gb|KJB12353.1| hypothetical protein B456_002G014400 [Gossypium raimondii]
Length=734

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 102/113 (90%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAVLVA+AA IGNFLQGWD ATIAGAV+Y+K+E  LE+   +EGL++AMSLIGAT IT
Sbjct  1    MGGAVLVAVAAAIGNFLQGWDTATIAGAVLYVKREFKLESEPTIEGLIIAMSLIGATCIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG I+DWLGRRP+LI+SS+FYFLSG++M+WSPNVY+LL+ RL+DGFG+GLA
Sbjct  61   TCSGYISDWLGRRPLLIISSVFYFLSGIVMIWSPNVYILLLGRLMDGFGVGLA  113



>gb|EPS65490.1| hypothetical protein M569_09283 [Genlisea aurea]
Length=734

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GA LVAIAA IGNFLQGWDNATIA AVVYIK+E  L   +EGLVVA SLIGAT+ITTC
Sbjct  1    MKGAALVAIAAAIGNFLQGWDNATIAAAVVYIKREEHLGASVEGLVVATSLIGATVITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG+I+D +GRRPML+LSS+FYF+ GLIMLWSPNVY+LL+ARLLDGFGIGLA
Sbjct  61   SGTISDAVGRRPMLVLSSVFYFIGGLIMLWSPNVYILLLARLLDGFGIGLA  111



>ref|XP_007201798.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 ref|XP_007201799.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 ref|XP_007201800.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 gb|EMJ02997.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 gb|EMJ02998.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 gb|EMJ02999.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
Length=736

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 101/112 (90%), Gaps = 2/112 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVLVA+ A IGN LQGWDNATIA +V+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVVAAIGNLLQGWDNATIAASVLYIKKEFKLESEPAVEGLIVAMSLIGATLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGL  603
            TCSG+IADWLGRRP+LI+SS+ YF SG++MLW+PNVY+LL+ARLLDGFGIGL
Sbjct  61   TCSGAIADWLGRRPVLIISSVLYFFSGIVMLWAPNVYILLLARLLDGFGIGL  112



>ref|XP_009340799.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
 ref|XP_009340800.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   163 bits (412),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 102/113 (90%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIK+E  LE+   MEGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEPAMEGLIVAMSLIGATVVT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
             CSG++ADWLGRRP LI+SS+ YFLSGL+MLWSPNVY+LL+ARLLDGFGIGLA
Sbjct  61   FCSGAVADWLGRRPTLIVSSVLYFLSGLVMLWSPNVYILLLARLLDGFGIGLA  113



>gb|KJB12354.1| hypothetical protein B456_002G014400 [Gossypium raimondii]
Length=758

 Score =   163 bits (413),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 102/113 (90%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAVLVA+AA IGNFLQGWD ATIAGAV+Y+K+E  LE+   +EGL++AMSLIGAT IT
Sbjct  25   MGGAVLVAVAAAIGNFLQGWDTATIAGAVLYVKREFKLESEPTIEGLIIAMSLIGATCIT  84

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG I+DWLGRRP+LI+SS+FYFLSG++M+WSPNVY+LL+ RL+DGFG+GLA
Sbjct  85   TCSGYISDWLGRRPLLIISSVFYFLSGIVMIWSPNVYILLLGRLMDGFGVGLA  137



>gb|AAO37640.1| putative sugar transporter type 2a [Saccharum hybrid cultivar 
Q117]
Length=745

 Score =   163 bits (412),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 99/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GA LVAI A+IGN LQGWDNATI+ A++YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAALVAIVASIGNLLQGWDNATISAALLYIKKEFKLESEPTVEGLIVAMSLIGATIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++DW+GR PMLILSS+ YF+S LIMLWSPNVYVLL+ARL++GFG+GLA
Sbjct  61   TFSGPVSDWIGRLPMLILSSVLYFVSSLIMLWSPNVYVLLLARLINGFGVGLA  113



>ref|NP_190717.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
 sp|Q9SD00.1|MSSP3_ARATH RecName: Full=Monosaccharide-sensing protein 3; AltName: Full=Sugar 
transporter MSSP3 [Arabidopsis thaliana]
 emb|CAB63013.1| sugar transporter-like protein [Arabidopsis thaliana]
 emb|CAD58693.1| monosaccharide sensing protein 3 [Arabidopsis thaliana]
 gb|AEE78798.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
Length=729

 Score =   162 bits (411),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGATLIT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLA
Sbjct  61   TFSGPVSDKVGRRSMLILSSVLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLA  113



>ref|NP_195256.3| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 ref|NP_001154287.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 sp|Q8LPQ8.2|MSSP2_ARATH RecName: Full=Monosaccharide-sensing protein 2; AltName: Full=Sugar 
transporter MSSP2 [Arabidopsis thaliana]
 emb|CAA18739.1| putative sugar transporter protein [Arabidopsis thaliana]
 emb|CAB80247.1| putative sugar transporter protein [Arabidopsis thaliana]
 emb|CAD58692.1| monosaccharide sensing protein 2 [Arabidopsis thaliana]
 gb|AEE86494.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 gb|AEE86495.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
Length=729

 Score =   162 bits (411),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 100/112 (89%), Gaps = 2/112 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGL  603
            TCSG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+GL
Sbjct  61   TCSGGVADWLGRRPMLILSSILYFVGSLVMLWSPNVYVLLLGRLLDGFGVGL  112



>ref|NP_849565.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 ref|NP_001190923.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 gb|AAM19835.1| AT4g35300/F23E12_140 [Arabidopsis thaliana]
 gb|AEE86493.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 gb|AEE86497.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
Length=739

 Score =   162 bits (411),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 100/112 (89%), Gaps = 2/112 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGL  603
            TCSG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+GL
Sbjct  61   TCSGGVADWLGRRPMLILSSILYFVGSLVMLWSPNVYVLLLGRLLDGFGVGL  112



>ref|NP_001190054.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
 gb|AEE78799.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
Length=737

 Score =   162 bits (411),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGATLIT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLA
Sbjct  61   TFSGPVSDKVGRRSMLILSSVLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLA  113



>ref|XP_008235816.1| PREDICTED: monosaccharide-sensing protein 2 [Prunus mume]
 ref|XP_008235817.1| PREDICTED: monosaccharide-sensing protein 2 [Prunus mume]
Length=736

 Score =   162 bits (411),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 103/112 (92%), Gaps = 2/112 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKKEFKLESDPAVEGLIVAMSLIGATLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGL  603
            TC+G+IADWLGRRP+LI+SS+ YFLSG++MLW+PNVY+LL+ARLLDGFGIGL
Sbjct  61   TCAGAIADWLGRRPVLIISSVLYFLSGIVMLWAPNVYILLLARLLDGFGIGL  112



>gb|KFK34392.1| hypothetical protein AALP_AA5G139300 [Arabis alpina]
Length=739

 Score =   162 bits (411),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 95/113 (84%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGATLIT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D +GRR MLILSS+ YF+S ++M WSPNVYVLL+ARLLDGFGIGLA
Sbjct  61   TFSGPVSDRVGRRSMLILSSLLYFVSSIVMFWSPNVYVLLLARLLDGFGIGLA  113



>ref|XP_006283193.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
 ref|XP_006283194.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
 gb|EOA16091.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
 gb|EOA16092.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
Length=740

 Score =   162 bits (411),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 100/112 (89%), Gaps = 2/112 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGL  603
            TCSG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+GL
Sbjct  61   TCSGGVADWLGRRPMLILSSILYFVGSLVMLWSPNVYVLLLGRLLDGFGVGL  112



>ref|XP_009333794.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   162 bits (410),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 103/113 (91%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEPAVEGLIVAMSLIGATVVT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
             CSG++ADWLGRRPMLI+SS+ YFLSG++MLWSPNVY+LL+ARLLDGFGIGLA
Sbjct  61   FCSGAVADWLGRRPMLIISSVLYFLSGIVMLWSPNVYILLLARLLDGFGIGLA  113



>ref|XP_009341490.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   162 bits (410),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 103/113 (91%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEPAVEGLIVAMSLIGATVVT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
             CSG++ADWLGRRPMLI+SS+ YFLSG++MLWSPNVY+LL+ARLLDGFGIGLA
Sbjct  61   FCSGAVADWLGRRPMLIISSVLYFLSGIVMLWSPNVYILLLARLLDGFGIGLA  113



>ref|XP_002867077.1| hypothetical protein ARALYDRAFT_491117 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43336.1| hypothetical protein ARALYDRAFT_491117 [Arabidopsis lyrata subsp. 
lyrata]
Length=739

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 100/112 (89%), Gaps = 2/112 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGL  603
            TCSG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+GL
Sbjct  61   TCSGGVADWLGRRPMLILSSILYFVGSLVMLWSPNVYVLLLGRLLDGFGVGL  112



>gb|EYU40481.1| hypothetical protein MIMGU_mgv1a001997mg [Erythranthe guttata]
Length=728

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 87/100 (87%), Gaps = 2/100 (2%)
 Frame = +1

Query  313  GNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRR  486
            GN LQGWDNAT+AGA++YIKKE   E    MEGL VAMSLIGATLIT CSG I+DWLGRR
Sbjct  14   GNLLQGWDNATMAGAIIYIKKEFEWENEPTMEGLSVAMSLIGATLITLCSGGISDWLGRR  73

Query  487  PMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            PMLI+SSMFYF+SG++MLWSPNVY LL ARLLDGFGIGLA
Sbjct  74   PMLIVSSMFYFVSGVLMLWSPNVYSLLCARLLDGFGIGLA  113



>ref|XP_006384856.1| transporter-related family protein [Populus trichocarpa]
 gb|ERP62653.1| transporter-related family protein [Populus trichocarpa]
Length=739

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 102/113 (90%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSL+GATLIT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKKEFHLESEPAIEGLIVAMSLVGATLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
             CSG I+D LGRRP+LI+SS+ YF+SGLIMLWSPNVYVLL+ARLLDGFGIGL+
Sbjct  61   MCSGPISDLLGRRPLLIISSVLYFVSGLIMLWSPNVYVLLLARLLDGFGIGLS  113



>ref|XP_002877807.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54066.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=730

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 93/113 (82%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M   V VA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGATLIT
Sbjct  1    MRSVVFVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLA
Sbjct  61   TFSGPVSDKVGRRSMLILSSVLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLA  113



>ref|XP_011099908.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011099909.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=709

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  447
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIK+E  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVLYIKREFHLQSEPTIEGLIVAMSLIGATVIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG ++DWLGRRPMLILSS+ Y LSGL+MLWSPNV VLL+ARL+DGFGIGLA
Sbjct  61   TCSGPVSDWLGRRPMLILSSVLYCLSGLVMLWSPNVSVLLLARLMDGFGIGLA  113



>ref|XP_009589978.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009589979.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
Length=721

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 102/113 (90%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVL+A+AA IGN LQGWDNATIAG+V+YIKKE  L+T   MEGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLIALAAAIGNLLQGWDNATIAGSVLYIKKEFNLQTQPTMEGLIVAMSLIGATVIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLWSPNVYVLL+ARLLDGFGIGLA
Sbjct  61   TFSGPVSDMLGRRPMLIISSVLYFLSGLVMLWSPNVYVLLLARLLDGFGIGLA  113



>ref|XP_009775817.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009775879.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009775941.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=721

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 102/113 (90%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVL+A+AA IGN LQGWDNATIAG+V+YIKKE  L+T   MEGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLIALAAAIGNLLQGWDNATIAGSVLYIKKEFNLQTQPTMEGLIVAMSLIGATVIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLWSPNVYVLL+ARLLDGFGIGLA
Sbjct  61   TFSGPVSDMLGRRPMLIISSVLYFLSGLVMLWSPNVYVLLLARLLDGFGIGLA  113



>ref|XP_004144248.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
 ref|XP_004171132.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
 gb|KGN47521.1| hypothetical protein Csa_6G355400 [Cucumis sativus]
Length=729

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GAVLVA+AA++GNFLQGWDNATIAGA+VYIKK++VL + +EGL+VA+SLIGAT+ITTC
Sbjct  1    MKGAVLVALAASVGNFLQGWDNATIAGAMVYIKKDMVLNSSVEGLIVAISLIGATIITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG ++DW+GRRPMLILSS+ Y LSGLIMLWSPNV VL IARLLDGFGIGLA
Sbjct  61   SGPVSDWVGRRPMLILSSLLYILSGLIMLWSPNVLVLCIARLLDGFGIGLA  111



>gb|AIN39841.1| hypothetical protein [Zoysia matrella]
Length=744

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 92/102 (90%), Gaps = 2/102 (2%)
 Frame = +1

Query  307  TIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLG  480
            +IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+ITT SG ++DW+G
Sbjct  12   SIGNLLQGWDNATIAGAVLYIKKEFKLESEPTVEGLIVAMSLIGATIITTFSGPVSDWIG  71

Query  481  RRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            RRPMLILSS+ YF+S LIMLWSPNVYVLL+ARL+DGFGIGLA
Sbjct  72   RRPMLILSSVLYFVSSLIMLWSPNVYVLLLARLIDGFGIGLA  113



>emb|CDX69128.1| BnaC01g03250D [Brassica napus]
Length=683

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 99/112 (88%), Gaps = 2/112 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   MEGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKKEFHLESNPSMEGLIVAMSLIGATLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGL  603
            T SG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+GL
Sbjct  61   TWSGGVADWLGRRPMLILSSVLYFVGSLVMLWSPNVYVLLLGRLLDGFGVGL  112



>emb|CDY65623.1| BnaCnng48010D [Brassica napus]
Length=675

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 99/112 (88%), Gaps = 2/112 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   MEGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKKEFHLESNPSMEGLIVAMSLIGATLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGL  603
            T SG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+GL
Sbjct  61   TWSGGVADWLGRRPMLILSSVLYFVGSLVMLWSPNVYVLLLGRLLDGFGVGL  112



>ref|XP_009622210.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009622211.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009622212.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
Length=722

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 102/113 (90%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  L+T   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVALAAAIGNLLQGWDNATIAGAVLYIKKEFNLQTQPTIEGLIVAMSLIGATVIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLA
Sbjct  61   TFSGPVSDMLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLA  113



>ref|XP_009103100.1| PREDICTED: monosaccharide-sensing protein 2 [Brassica rapa]
 ref|XP_009103156.1| PREDICTED: monosaccharide-sensing protein 2 [Brassica rapa]
 emb|CDX75492.1| BnaA01g02100D [Brassica napus]
Length=740

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 99/112 (88%), Gaps = 2/112 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   MEGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKKEFHLESNPSMEGLIVAMSLIGATLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGL  603
            T SG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+GL
Sbjct  61   TWSGGVADWLGRRPMLILSSVLYFVGSLVMLWSPNVYVLLLGRLLDGFGVGL  112



>ref|XP_004983796.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=739

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 98/113 (87%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  447
            M GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSL GAT++T
Sbjct  1    MGGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLFGATVVT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG++AD +GRRPMLI S++ YF+SGL MLW+P+VYVLL+ARL+DG GIGLA
Sbjct  61   TFSGALADSIGRRPMLIASAVLYFVSGLFMLWAPSVYVLLLARLIDGLGIGLA  113



>emb|CDP01766.1| unnamed protein product [Coffea canephora]
Length=724

 Score =   160 bits (405),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 102/113 (90%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAVLVAIAA +GNF+QGWDNATIAG+V+YIK+E  L+T   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAVVGNFVQGWDNATIAGSVLYIKREFNLQTQPTVEGLIVAMSLIGATVIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SGS+ADWLGRRPML++SS+ YFL GL+MLW+PNVYVLL+ RLLDGFG+GLA
Sbjct  61   TFSGSVADWLGRRPMLVISSVLYFLGGLVMLWAPNVYVLLLGRLLDGFGVGLA  113



>ref|XP_008464819.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
 ref|XP_008464820.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
 ref|XP_008464821.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
 ref|XP_008464822.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
Length=729

 Score =   160 bits (404),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GA+LVA+AA++GNFLQGWDNATIAGA+VYIKK++VL + +EGL+VA+SLIGAT+ITTC
Sbjct  1    MKGALLVALAASVGNFLQGWDNATIAGAMVYIKKDMVLNSSVEGLIVAISLIGATIITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG ++DW+GRRPMLILSS+ Y LSGLIMLWSPNV VL IARLLDGFGIGLA
Sbjct  61   SGPVSDWVGRRPMLILSSLLYILSGLIMLWSPNVLVLCIARLLDGFGIGLA  111



>ref|NP_001280690.1| monosaccharide-sensing protein 2-like [Solanum lycopersicum]
 dbj|BAO96236.1| tonoplast monosaccharide transporter 1 [Solanum lycopersicum]
Length=725

 Score =   159 bits (403),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 101/113 (89%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAVL+A+AA IGN LQGWDNATIAG+V+YIKKE  L+T   MEGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLIALAAAIGNMLQGWDNATIAGSVLYIKKEFNLQTQPTMEGLIVAMSLIGATVIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLA
Sbjct  61   TFSGPVSDMLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLA  113



>ref|XP_008382498.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
 ref|XP_008382499.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=736

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 101/112 (90%), Gaps = 2/112 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEPAVEGLIVAMSLIGATVVT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGL  603
             CSG++ADWLGRRP LI+SS+ YFLSGL+MLWSPNVY+LL+ARLLDGFGIGL
Sbjct  61   FCSGAVADWLGRRPTLIVSSVLYFLSGLVMLWSPNVYILLLARLLDGFGIGL  112



>ref|XP_010270527.1| PREDICTED: monosaccharide-sensing protein 2 [Nelumbo nucifera]
 ref|XP_010270528.1| PREDICTED: monosaccharide-sensing protein 2 [Nelumbo nucifera]
Length=740

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAVLVA+AA IGN LQGWDNATIAG+++YIK+E  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MRGAVLVAVAAAIGNLLQGWDNATIAGSILYIKREFKLESEPTIEGLIVAMSLIGATFIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++DWLGRRPM+I+SS+ YF+S +IMLWSPNVYVLL+ARLLDGFGIGLA
Sbjct  61   TFSGPVSDWLGRRPMMIISSVLYFISSIIMLWSPNVYVLLLARLLDGFGIGLA  113



>ref|XP_006343319.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006343320.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Solanum 
tuberosum]
Length=722

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 101/113 (89%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAVL+A+AA IGN LQGWDNATIAG+V+YIKKE  L+T   MEGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLIALAAAIGNMLQGWDNATIAGSVLYIKKEFNLQTQPTMEGLIVAMSLIGATVIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLA
Sbjct  61   TFSGPVSDMLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLA  113



>ref|XP_004139974.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
 gb|KGN46648.1| hypothetical protein Csa_6G118280 [Cucumis sativus]
Length=733

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 102/113 (90%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+G+VLVA+AA +GNFLQGWDNATIAGAV+YIKKE  LE+   +EGL+VA SLIGAT+IT
Sbjct  1    MSGSVLVAVAAAVGNFLQGWDNATIAGAVLYIKKEFNLESSPTVEGLIVATSLIGATVIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG+I+DWLGRR +LILSS+ YF+ G+IMLWSPNVY+LL+ RLLDGFGIGLA
Sbjct  61   TCSGAISDWLGRRLLLILSSVLYFIGGIIMLWSPNVYILLLGRLLDGFGIGLA  113



>ref|XP_011098017.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011098018.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011098019.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=711

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 101/113 (89%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAVLVAIAA IGN LQGWDNATIAG+V+YIK+E  L+    +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNMLQGWDNATIAGSVLYIKREFDLQRQPTIEGLIVAMSLIGATVIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++DWLGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLA
Sbjct  61   TFSGPVSDWLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLA  113



>ref|XP_004289029.1| PREDICTED: monosaccharide-sensing protein 2-like [Fragaria vesca 
subsp. vesca]
 ref|XP_011461449.1| PREDICTED: monosaccharide-sensing protein 2-like [Fragaria vesca 
subsp. vesca]
Length=760

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 90/100 (90%), Gaps = 2/100 (2%)
 Frame = +1

Query  313  GNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRR  486
            GN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+ITT SG ++D LGRR
Sbjct  14   GNLLQGWDNATIAGAVLYIKKEFKLETQPTIEGLIVAMSLIGATVITTFSGPVSDSLGRR  73

Query  487  PMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            PMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLA
Sbjct  74   PMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLA  113



>ref|XP_011040809.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011040810.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011040811.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=738

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 101/113 (89%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSL+GATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFHLESEPAIEGLIVAMSLVGATLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
             CSG I+D LGRRP+LI+SS+ YF+SGLIMLWSPNV VLL+ARLLDGFGIGLA
Sbjct  61   MCSGPISDMLGRRPLLIISSVLYFISGLIMLWSPNVSVLLLARLLDGFGIGLA  113



>ref|XP_011022133.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011022134.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=719

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 98/113 (87%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAVLVA+AAT+GN LQGWDN+TIAG++ YIK+EL L++   +EGL+VAMS+IG T IT
Sbjct  1    MRGAVLVALAATVGNLLQGWDNSTIAGSIPYIKEELNLQSQPAVEGLIVAMSIIGGTTIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG+++D  GRRPMLI+SS+ Y LS +I+LW+PNVYVLL+ARLLDGFG+GLA
Sbjct  61   TFSGTVSDIFGRRPMLIMSSILYLLSSIIILWAPNVYVLLLARLLDGFGVGLA  113



>ref|XP_006412119.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 ref|XP_006412120.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 ref|XP_006412121.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 gb|ESQ53572.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 gb|ESQ53573.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 gb|ESQ53574.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
Length=734

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 99/112 (88%), Gaps = 2/112 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   MEGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFHLESNPSMEGLIVAMSLIGATLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGL  603
            T SG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+G+
Sbjct  61   TWSGGVADWLGRRPMLILSSVLYFVGSLVMLWSPNVYVLLLGRLLDGFGVGI  112



>ref|XP_002306419.1| hypothetical protein POPTR_0005s10180g [Populus trichocarpa]
 gb|EEE93415.1| hypothetical protein POPTR_0005s10180g [Populus trichocarpa]
Length=719

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 98/113 (87%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAVLVA+AAT+GN LQGWDN+TIAG++ YIK+EL L++   +EGL+VAMS+IG T IT
Sbjct  1    MRGAVLVALAATVGNLLQGWDNSTIAGSIPYIKEELNLQSQPAVEGLIVAMSIIGGTTIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG+++D  GRRPMLI+SS+ Y LS +I+LW+PNVYVLL+ARLLDGFG+GLA
Sbjct  61   TFSGTVSDIFGRRPMLIMSSILYLLSSIIILWAPNVYVLLLARLLDGFGVGLA  113



>ref|XP_009359630.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Pyrus 
x bretschneideri]
Length=743

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAV VAIAA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVFVAIAAAIGNLLQGWDNATIAGAVLYIKREFKLESQPTIEGLIVAMSLIGATVIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLA
Sbjct  61   TFSGPVSDSLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLA  113



>ref|XP_003526737.1| PREDICTED: monosaccharide-sensing protein 2-like isoform 1 [Glycine 
max]
Length=738

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA IGN LQGWDNATIAG+++YIKKE  LE    +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGSILYIKKEFQLENEPTVEGLIVAMSLIGATVVT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG+++D LGRRPMLI+SSM YF+S L+MLWSPNVY+LL ARLLDG GIGLA
Sbjct  61   TCSGALSDLLGRRPMLIISSMLYFVSSLVMLWSPNVYILLFARLLDGLGIGLA  113



>ref|XP_009392211.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=732

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 101/113 (89%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  447
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIK+E  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MQGAVLVAIAAAIGNMLQGWDNATIAGAVLYIKREFKLEGQPTIEGLIVAMSLIGATVIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG+++DW+GRRPMLI+SS+ YF+SGLIM WSPNVY+LL+ARL+DGFGIGLA
Sbjct  61   TFSGAVSDWIGRRPMLIISSVLYFISGLIMFWSPNVYMLLLARLIDGFGIGLA  113



>ref|XP_008448165.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448166.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448167.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448168.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448169.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448170.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448171.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
Length=733

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 101/113 (89%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+G+VLVA+AA +GNFLQGWDNATIAGAV+YIKKE  LE+   +EGL+VA SLIGAT+IT
Sbjct  1    MSGSVLVAVAAAVGNFLQGWDNATIAGAVLYIKKEFNLESSPTVEGLIVATSLIGATVIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG+I+DWLGRR +LI SS+ YF+ G+IMLWSPNVY+LL+ RLLDGFGIGLA
Sbjct  61   TCSGAISDWLGRRLLLIFSSVLYFIGGIIMLWSPNVYILLLGRLLDGFGIGLA  113



>ref|XP_009359631.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X3 [Pyrus 
x bretschneideri]
Length=742

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAV VAIAA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVFVAIAAAIGNLLQGWDNATIAGAVLYIKREFKLESQPTIEGLIVAMSLIGATVIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLA
Sbjct  61   TFSGPVSDSLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLA  113



>ref|XP_009359629.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=753

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAV VAIAA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVFVAIAAAIGNLLQGWDNATIAGAVLYIKREFKLESQPTIEGLIVAMSLIGATVIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLA
Sbjct  61   TFSGPVSDSLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLA  113



>gb|EAY80902.1| hypothetical protein OsI_36080 [Oryza sativa Indica Group]
Length=763

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 99/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAVLVA+AA IGN+LQGWDNATIAGAV+YIK+E  LET   +EGLVVAMSLIGAT+IT
Sbjct  1    MRGAVLVAVAAAIGNYLQGWDNATIAGAVLYIKREFALETQPAVEGLVVAMSLIGATIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D +GRRPMLI SS+ YF  GLIMLWSPNVYVLL+ARL+DGFG+GLA
Sbjct  61   TFSGPVSDLVGRRPMLIASSLLYFAGGLIMLWSPNVYVLLLARLVDGFGVGLA  113



>ref|NP_001067890.1| Os11g0475600 [Oryza sativa Japonica Group]
 gb|ABA93553.1| hexose transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28253.1| Os11g0475600 [Oryza sativa Japonica Group]
 gb|EAZ18344.1| hypothetical protein OsJ_33873 [Oryza sativa Japonica Group]
 dbj|BAH00841.1| unnamed protein product [Oryza sativa Japonica Group]
Length=757

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 99/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAVLVA+AA IGN+LQGWDNATIAGAV+YIK+E  LET   +EGLVVAMSLIGAT+IT
Sbjct  1    MRGAVLVAVAAAIGNYLQGWDNATIAGAVLYIKREFALETQPAVEGLVVAMSLIGATIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D +GRRPMLI SS+ YF  GLIMLWSPNVYVLL+ARL+DGFG+GLA
Sbjct  61   TFSGPVSDLVGRRPMLIASSLLYFAGGLIMLWSPNVYVLLLARLVDGFGVGLA  113



>ref|XP_010446942.1| PREDICTED: monosaccharide-sensing protein 2 [Camelina sativa]
 ref|XP_010446943.1| PREDICTED: monosaccharide-sensing protein 2 [Camelina sativa]
 ref|XP_010446944.1| PREDICTED: monosaccharide-sensing protein 2 [Camelina sativa]
Length=739

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 99/112 (88%), Gaps = 2/112 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGL  603
            TCSG +AD LGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+G+
Sbjct  61   TCSGGVADLLGRRPMLILSSILYFVGSLVMLWSPNVYVLLLGRLLDGFGVGI  112



>ref|XP_010437493.1| PREDICTED: monosaccharide-sensing protein 2-like [Camelina sativa]
Length=739

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 99/112 (88%), Gaps = 2/112 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGL  603
            TCSG +AD LGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+G+
Sbjct  61   TCSGGVADLLGRRPMLILSSILYFVGSLVMLWSPNVYVLLLGRLLDGFGVGI  112



>ref|XP_004154526.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
Length=733

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 101/113 (89%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+G+VLVA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VA SLIGAT+IT
Sbjct  1    MSGSVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFNLESSPTVEGLIVATSLIGATVIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG+I+DWLGRR +LILSS+ YF+ G+IMLWSPNVY+LL+ RLLDGFGIGLA
Sbjct  61   TCSGAISDWLGRRLLLILSSVLYFIGGIIMLWSPNVYILLLGRLLDGFGIGLA  113



>gb|KHN33643.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=734

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA IGN LQGWDNATIAG+++YIK+E  L  E  +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGSILYIKREFQLQSEPTVEGLIVAMSLIGATVVT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG+++D LGRRPMLI+SSM YF+S L+MLWSPNVY+LL ARLLDG GIGLA
Sbjct  61   TCSGALSDLLGRRPMLIISSMLYFVSSLVMLWSPNVYILLFARLLDGLGIGLA  113



>ref|XP_003543932.1| PREDICTED: monosaccharide-sensing protein 2-like [Glycine max]
Length=734

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA IGN LQGWDNATIAG+++YIK+E  L  E  +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGSILYIKREFQLQSEPTVEGLIVAMSLIGATVVT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG+++D LGRRPMLI+SSM YF+S L+MLWSPNVY+LL ARLLDG GIGLA
Sbjct  61   TCSGALSDLLGRRPMLIISSMLYFVSSLVMLWSPNVYILLFARLLDGLGIGLA  113



>ref|XP_010432297.1| PREDICTED: monosaccharide-sensing protein 2-like [Camelina sativa]
 ref|XP_010432298.1| PREDICTED: monosaccharide-sensing protein 2-like [Camelina sativa]
Length=739

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 98/112 (88%), Gaps = 2/112 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGL  603
            TCSG +AD LGRRPMLILSS  YF+  L+MLWSPNVYVLL+ RLLDGFG+G+
Sbjct  61   TCSGGVADLLGRRPMLILSSFLYFVGSLVMLWSPNVYVLLLGRLLDGFGVGI  112



>gb|EYU30848.1| hypothetical protein MIMGU_mgv1a001984mg [Erythranthe guttata]
Length=730

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIK+E  L++   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVLYIKREFDLQSQPKIEGLIVAMSLIGATVIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++DWLGRRPMLI SS+ YFLSGL+MLW+PNV +LL+ARLLDGFGIGLA
Sbjct  61   TFSGPVSDWLGRRPMLIASSILYFLSGLVMLWAPNVEILLLARLLDGFGIGLA  113



>ref|XP_003560303.1| PREDICTED: monosaccharide-sensing protein 2-like [Brachypodium 
distachyon]
Length=770

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 99/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIK+E  LET+  +EGLVVA SLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVLYIKREFHLETHPAIEGLVVATSLIGATIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG +AD +GRRPMLI SS+ YFL GLIMLWSPNVYVLL+ARL+DGFG+GLA
Sbjct  61   TFSGPVADMVGRRPMLIASSILYFLGGLIMLWSPNVYVLLLARLVDGFGVGLA  113



>ref|XP_010690557.1| PREDICTED: monosaccharide-sensing protein 2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010690558.1| PREDICTED: monosaccharide-sensing protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=739

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 97/113 (86%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  447
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  LE    MEGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLEGAPTMEGLIVAMSLIGATIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG ++D  GRRPM+I+SS+ +F S LIMLWSPNVYVLL+ RLLDGFG GLA
Sbjct  61   TCSGPVSDRFGRRPMMIISSICFFFSALIMLWSPNVYVLLLGRLLDGFGSGLA  113



>ref|XP_007137297.1| hypothetical protein PHAVU_009G115500g [Phaseolus vulgaris]
 gb|ESW09291.1| hypothetical protein PHAVU_009G115500g [Phaseolus vulgaris]
Length=739

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 101/113 (89%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GA+LVA+AA IGN LQGWDNATIAG+++YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAILVAVAAAIGNLLQGWDNATIAGSILYIKREFQLESQPTVEGLIVAMSLIGATVVT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG+++D LGRRPMLI+SS+ YF+S L+MLWSPNVY+LL ARLLDG GIGLA
Sbjct  61   TCSGALSDLLGRRPMLIISSLLYFVSSLVMLWSPNVYILLFARLLDGLGIGLA  113



>gb|KJB31963.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31964.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31965.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31966.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31967.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
Length=737

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 101/113 (89%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVLVA+ ATIGN LQGWD+ATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVALTATIGNLLQGWDSATIAGAVMYIKKEFKLESEPAIEGLIVAMSLIGATCIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSGS++DWLGRRP+LI+SS+ YFLSG++MLW+PNV  LL+ARLLDG GIGLA
Sbjct  61   TCSGSLSDWLGRRPILIISSLLYFLSGIVMLWAPNVPTLLLARLLDGLGIGLA  113



>ref|XP_004500684.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004500685.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Cicer 
arietinum]
Length=740

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 99/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAV+VA+AA IGN LQGWDNATIAG+++YIKKE  LE    +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVIVAVAAAIGNLLQGWDNATIAGSILYIKKEFQLENEPTVEGLIVAMSLIGATVVT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG+++D LGRRPMLI+SS+ YF+S L+M WSPNVY+LL ARLLDG GIGLA
Sbjct  61   TCSGALSDLLGRRPMLIISSVLYFVSSLVMFWSPNVYILLFARLLDGLGIGLA  113



>gb|KHN46863.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=717

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 98/113 (87%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA IGN LQGWDNATIAG+++YIK+E  L  E  +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGSILYIKREFNLQSEPTIEGLIVAMSLIGATVVT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG ++D LGRRPMLI+SS+ YF+  L+MLWSPNVY+LL ARLLDG GIGLA
Sbjct  61   TCSGPLSDLLGRRPMLIISSILYFVGSLVMLWSPNVYILLFARLLDGLGIGLA  113



>ref|XP_008377843.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
 ref|XP_008377844.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=736

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 99/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEXAVEGLIVAMSLIGATVVT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
             CSG++ADWLGRRPMLI+SS+FYFLSG++MLW    Y+LL+AR LDGFGIGLA
Sbjct  61   FCSGAVADWLGRRPMLIISSVFYFLSGIVMLWXXXXYILLLARXLDGFGIGLA  113



>ref|XP_010028861.1| PREDICTED: LOW QUALITY PROTEIN: monosaccharide-sensing protein 
2 [Eucalyptus grandis]
Length=730

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 94/112 (84%), Gaps = 2/112 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+ AVL+A+ A  GN LQGWDNATIAGA++YIK+E  LE+   +EGL+VA+SL+GA L+T
Sbjct  1    MSRAVLIAVVAAFGNLLQGWDNATIAGAILYIKREFHLESEPAVEGLIVAISLLGAILVT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGL  603
            TCSG++AD +GRRPML++SS FY +SGL+M WSPN+Y LL+AR + GFG+GL
Sbjct  61   TCSGAMADCIGRRPMLVMSSHFYLISGLLMFWSPNLYALLLARFVGGFGVGL  112



>emb|CDY33275.1| BnaA01g19420D [Brassica napus]
Length=119

 Score =   140 bits (353),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLA
Sbjct  61   TFSGPVSDRVGRRSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLA  113



>gb|KGN49001.1| hypothetical protein Csa_6G509700 [Cucumis sativus]
Length=768

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 100/120 (83%), Gaps = 2/120 (2%)
 Frame = +1

Query  253  LDSGLLRMNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSL  426
            L    LRM GAVLVAIAA IGN LQGWDNATIAGAV+YIKKE  LE     EGL+VAMSL
Sbjct  40   LSPSRLRMRGAVLVAIAAAIGNLLQGWDNATIAGAVMYIKKEFKLEGDPTTEGLIVAMSL  99

Query  427  IGATLITTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            IGAT+ITT SG ++D +GRRP++I SS+ YF SGL+MLW+P+V+VLL+ARLLDGFG+GLA
Sbjct  100  IGATVITTFSGPLSDSVGRRPLMIASSILYFTSGLVMLWAPDVHVLLLARLLDGFGVGLA  159



>ref|XP_004289030.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
Length=714

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAV VA+AA IGN LQGWDN+ IAG+V+YIKKE  LE+    EGL+VA SLIGAT+IT
Sbjct  1    MRGAVYVAVAAAIGNMLQGWDNSVIAGSVLYIKKEFSLESKPTFEGLIVATSLIGATVIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG  +DWLGRR MLI+SS+ +FLSGL+MLWSPNVYVLL ARLLDGFG GLA
Sbjct  61   TFSGPASDWLGRRTMLIMSSLLFFLSGLVMLWSPNVYVLLYARLLDGFGTGLA  113



>gb|KHG14026.1| Monosaccharide-sensing 2 -like protein [Gossypium arboreum]
Length=737

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVLVA+ ATIGN LQGWD+ATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVALTATIGNLLQGWDSATIAGAVMYIKKEFKLESEPAIEGLIVAMSLIGATCIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSGS++DWLGRRP+LI+SS+ Y LSG++MLW+PNV  LL+ARLLDG GIGLA
Sbjct  61   TCSGSMSDWLGRRPILIISSLLYCLSGIVMLWAPNVPTLLLARLLDGLGIGLA  113



>ref|XP_003518591.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Glycine 
max]
 ref|XP_006575765.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Glycine 
max]
 ref|XP_006575766.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X3 [Glycine 
max]
 gb|KHN29885.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=711

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 86/99 (87%), Gaps = 2/99 (2%)
 Frame = +1

Query  316  NFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLITTCSGSIADWLGRRP  489
            N LQGWDNATIAG+++YIK+E  L  E  +EGL+VAMSLIGAT++TTCSG ++D+LGRRP
Sbjct  17   NLLQGWDNATIAGSILYIKREFNLQSEPTIEGLIVAMSLIGATVVTTCSGPLSDFLGRRP  76

Query  490  MLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            MLI+SS+ YF S L+MLWSPNVY+LL ARLLDG GIGLA
Sbjct  77   MLIISSVLYFASSLVMLWSPNVYILLFARLLDGLGIGLA  115



>ref|XP_004954530.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=707

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 97/113 (86%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIK+E  LE +  MEGLVVA SLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNMLQGWDNATIAGAVLYIKREFHLEAHPAMEGLVVATSLIGATVIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D +GRRPMLI SS+ YF +GL+MLWSPNV+VLL++RL+DGF IGLA
Sbjct  61   TFSGPVSDSVGRRPMLIASSLLYFAAGLLMLWSPNVHVLLLSRLVDGFAIGLA  113



>ref|XP_004169167.1| PREDICTED: LOW QUALITY PROTEIN: monosaccharide-sensing protein 
2-like [Cucumis sativus]
Length=722

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 97/113 (86%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  447
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIKKE  LE     EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVMYIKKEFKLEGDPTTEGLIVAMSLIGATVIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D +GRRP++I SS+ YF SGL+MLW+P+V+VLL+ARLLDGFG+GLA
Sbjct  61   TFSGPLSDSVGRRPLMIASSILYFTSGLVMLWAPDVHVLLLARLLDGFGVGLA  113



>ref|XP_004134823.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
Length=722

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 97/113 (86%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  447
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIKKE  LE     EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVMYIKKEFKLEGDPTTEGLIVAMSLIGATVIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D +GRRP++I SS+ YF SGL+MLW+P+V+VLL+ARLLDGFG+GLA
Sbjct  61   TFSGPLSDSVGRRPLMIASSILYFTSGLVMLWAPDVHVLLLARLLDGFGVGLA  113



>ref|XP_008440928.1| PREDICTED: LOW QUALITY PROTEIN: monosaccharide-sensing protein 
2 [Cucumis melo]
Length=725

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 97/113 (86%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  447
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIKKE  LE     EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVMYIKKEFKLEGDPTTEGLIVAMSLIGATVIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D +GRRP++I SS+ YF SGL+MLW+P+V++LL+ARLLDGFG+GLA
Sbjct  61   TFSGPLSDSVGRRPLMITSSILYFTSGLVMLWAPDVHILLLARLLDGFGVGLA  113



>ref|XP_010029563.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW56481.1| hypothetical protein EUGRSUZ_I02209 [Eucalyptus grandis]
Length=738

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 90/113 (80%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAVLVAIAATIG  LQGWD +TIAG+V+YIK E  L+    +EGL+VAMSLIG+T IT
Sbjct  1    MRGAVLVAIAATIGTMLQGWDGSTIAGSVLYIKGEFDLQEQPTIEGLIVAMSLIGSTAIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D LGRRPM+I+ S+  F S LIMLW+PNVYVLL+ RL  GFGIG+A
Sbjct  61   TFSGPLSDSLGRRPMMIICSVLSFASALIMLWAPNVYVLLLGRLFSGFGIGIA  113



>gb|KDP43790.1| hypothetical protein JCGZ_22417 [Jatropha curcas]
Length=729

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 97/113 (86%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAVLVA+AA +GN LQGWDN+TIAG+++YIKKE  L+T   MEGL+ AMSLIGAT+IT
Sbjct  1    MRGAVLVALAAAVGNMLQGWDNSTIAGSLLYIKKEFNLQTQPTMEGLIAAMSLIGATIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D  GRRP++I+S++ YFLSGL+M W+PNVYVLL+ RLL+GFGIGLA
Sbjct  61   TFSGPVSDIYGRRPLMIISAIMYFLSGLVMFWAPNVYVLLLGRLLNGFGIGLA  113



>ref|XP_009359632.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 91/113 (81%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAV VA+AA IGN LQGWDN+ IAG+VVYIKKE  LE+    EGL+ A SLIGAT IT
Sbjct  1    MRGAVFVAVAAAIGNLLQGWDNSVIAGSVVYIKKEFELESEPTFEGLIAASSLIGATFIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG  +DWLGRR MLI+SS+ +F+SGL+ML SPNVYVLL ARLLDGFG GLA
Sbjct  61   TFSGPASDWLGRRTMLIISSVLFFISGLVMLLSPNVYVLLFARLLDGFGTGLA  113



>gb|EPS57524.1| hypothetical protein M569_17293, partial [Genlisea aurea]
Length=693

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 96/113 (85%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAVLVAIAA +GN LQGWDNATIAGAV+Y+K+E  LE+   +EGL+VA SLIGAT IT
Sbjct  1    MKGAVLVAIAAAVGNLLQGWDNATIAGAVLYVKREFHLESQPTVEGLIVATSLIGATFIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG  +D  GRRPML+LSS+ YF+SG++MLW+P+V +LL+ARLLDGFGIGLA
Sbjct  61   TISGPASDSFGRRPMLLLSSILYFVSGIVMLWAPSVEILLLARLLDGFGIGLA  113



>ref|XP_004978456.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Setaria 
italica]
 ref|XP_004978457.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Setaria 
italica]
 ref|XP_004978458.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X3 [Setaria 
italica]
Length=710

 Score =   143 bits (361),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 97/113 (86%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  447
            M GAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VA SLIGAT +T
Sbjct  1    MGGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVATSLIGATAVT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T +G++AD +GRRP+LI S++ YF+SGL+MLW+P+VYVLL+ARL+DG GIGLA
Sbjct  61   TIAGAVADSIGRRPVLIASAVLYFVSGLVMLWAPSVYVLLLARLIDGLGIGLA  113



>ref|XP_010097645.1| Monosaccharide-sensing protein 3 [Morus notabilis]
 gb|EXB70345.1| Monosaccharide-sensing protein 3 [Morus notabilis]
Length=737

 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 93/113 (82%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAV VAI A IGN LQGWDN+ IAG+++YIKKE  LE    +EGL++A SLIG TLIT
Sbjct  1    MKGAVAVAIVAAIGNLLQGWDNSVIAGSLLYIKKEFNLERKPTLEGLIIATSLIGGTLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D +GRRPMLI+SS+ +F SGL+MLW+PNVY+LL+ARLLDGFG GLA
Sbjct  61   TVSGPVSDRVGRRPMLIMSSVLFFFSGLVMLWAPNVYMLLVARLLDGFGTGLA  113



>ref|XP_006403910.1| hypothetical protein EUTSA_v10011113mg [Eutrema salsugineum]
 gb|ESQ45363.1| hypothetical protein EUTSA_v10011113mg [Eutrema salsugineum]
Length=739

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGATLIT
Sbjct  1    MQSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D +GRR ML+LSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLA
Sbjct  61   TFSGPVSDRVGRRSMLVLSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLA  113



>ref|XP_004290074.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
 ref|XP_011458100.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
Length=740

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 103/113 (91%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M+GAVLVAIAA +GN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGATL+T
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAASVLYIKREFNLESQPAVEGLIVAMSLIGATLVT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG++ADW+GRRPMLI+SS+ YFLSG++MLWSPNVY+LL+ARLLDG GIGLA
Sbjct  61   TCSGAVADWIGRRPMLIISSVLYFLSGIVMLWSPNVYILLLARLLDGLGIGLA  113



>ref|XP_006292750.1| hypothetical protein CARUB_v10018997mg [Capsella rubella]
 gb|EOA25648.1| hypothetical protein CARUB_v10018997mg [Capsella rubella]
Length=729

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGATLIT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLA
Sbjct  61   TFSGPVSDKVGRRSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLA  113



>ref|XP_008242155.1| PREDICTED: monosaccharide-sensing protein 2-like [Prunus mume]
Length=738

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 90/113 (80%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAV VA+AA +GN LQGWDN+ IAG+V YIKKE  LE+    EGL+VA SLIGAT IT
Sbjct  1    MRGAVFVAVAAAVGNLLQGWDNSVIAGSVHYIKKEFELESQPTFEGLIVATSLIGATFIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG  +DWLGRR MLI+SS  +F+SGL+ML SPNVYVLL ARLLDGFG GLA
Sbjct  61   TFSGPASDWLGRRTMLIISSALFFISGLVMLLSPNVYVLLFARLLDGFGTGLA  113



>ref|XP_007203009.1| hypothetical protein PRUPE_ppa017631mg [Prunus persica]
 gb|EMJ04208.1| hypothetical protein PRUPE_ppa017631mg [Prunus persica]
Length=738

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 90/113 (80%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAV VA+AA +GN LQGWDN+ IAG+V YIKKE  LE+    EGL+VA SLIGAT IT
Sbjct  1    MRGAVFVAVAAAVGNLLQGWDNSVIAGSVHYIKKEFELESQPTFEGLIVATSLIGATFIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG  +DWLGRR MLI+SS  +F+SGL+ML SPNVYVLL ARLLDGFG GLA
Sbjct  61   TFSGPASDWLGRRTMLIISSALFFISGLVMLLSPNVYVLLFARLLDGFGTGLA  113



>emb|CDY33276.1| BnaA01g19430D [Brassica napus]
Length=668

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLA
Sbjct  61   TFSGPVSDRVGRRSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLA  113



>ref|XP_009148978.1| PREDICTED: monosaccharide-sensing protein 3 [Brassica rapa]
Length=741

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLA
Sbjct  61   TFSGPVSDRVGRRSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLA  113



>ref|XP_002532480.1| sugar transporter, putative [Ricinus communis]
 gb|EEF29904.1| sugar transporter, putative [Ricinus communis]
Length=536

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 97/113 (86%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAVLVA+AA +GN LQGWDNATIAG+++YIK+E  L+T   MEGL+ A++LIGAT+IT
Sbjct  1    MRGAVLVALAAAVGNMLQGWDNATIAGSLLYIKREFNLQTQPTMEGLIAAVALIGATIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
              +G ++D LGRRPMLI+S++ YFLSGL+M+W+PNVY+L++ R+LDGFG GLA
Sbjct  61   IFTGPVSDLLGRRPMLIISAIMYFLSGLVMVWAPNVYILILGRVLDGFGTGLA  113



>ref|XP_010503840.1| PREDICTED: monosaccharide-sensing protein 3-like [Camelina sativa]
Length=740

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLA
Sbjct  61   TFSGPVSDKVGRRSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLA  113



>ref|XP_010426703.1| PREDICTED: monosaccharide-sensing protein 3-like [Camelina sativa]
Length=738

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLA
Sbjct  61   TFSGPVSDKVGRRSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLA  113



>ref|XP_010515555.1| PREDICTED: monosaccharide-sensing protein 3 [Camelina sativa]
Length=738

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLA
Sbjct  61   TFSGPVSDKVGRRSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLA  113



>emb|CDX73717.1| BnaC08g22860D [Brassica napus]
Length=681

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M   VLV++AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVSLAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D +GRR MLILSS+ YFLS L+M WSPNVYVLL ARLLDGFGIGLA
Sbjct  61   TFSGPVSDKVGRRSMLILSSLLYFLSSLVMFWSPNVYVLLFARLLDGFGIGLA  113



>emb|CDY16303.1| BnaC01g23380D [Brassica napus]
Length=670

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 93/113 (82%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M   VLVA+ A IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVALTAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLA
Sbjct  61   TFSGPVSDRVGRRSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLA  113



>ref|XP_009115837.1| PREDICTED: monosaccharide-sensing protein 3 [Brassica rapa]
Length=731

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M   VLV++AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVSLAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLA
Sbjct  61   TFSGPVSDKVGRRSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLA  113



>emb|CDX78009.1| BnaA09g32040D [Brassica napus]
Length=669

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M   VLV++AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVSLAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLA
Sbjct  61   TFSGPVSDKVGRRSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLA  113



>ref|XP_008786687.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008786688.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008786689.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008786690.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
Length=744

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 99/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  447
            M GAVLVAIAA IG+ LQGWD+AT+AGAV+YI +E  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MQGAVLVAIAAAIGSLLQGWDSATMAGAVLYINREFKLEADPTIEGLIVAMSLIGATIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            + SG+++DW+GRRP+LI++++  FLSGL+MLWSPNVY+LL+ARL+ GFG+G+A
Sbjct  61   SFSGALSDWVGRRPVLIVAAVLTFLSGLVMLWSPNVYILLLARLIYGFGVGIA  113



>gb|KEH36403.1| tonoplast monosaccharide transporter 2 [Medicago truncatula]
Length=645

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 98/113 (87%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  447
            M+GAV+VA+AA IGN LQGWDNATIAG+++YIK+E  L  E  +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVIVAVAAAIGNLLQGWDNATIAGSILYIKREFQLQSEPTVEGLIVAMSLIGATVVT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG+++D  GRRPMLI+SS+ YFLS L+M WSPNVY+LL ARLLDG GIGLA
Sbjct  61   TCSGALSDLFGRRPMLIISSLLYFLSSLVMFWSPNVYILLFARLLDGLGIGLA  113



>ref|XP_003537696.1| PREDICTED: monosaccharide-sensing protein 2-like [Glycine max]
 gb|KHN41803.1| Monosaccharide-sensing protein 3 [Glycine soja]
Length=722

 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +1

Query  286  VLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTCSGSI  465
            V+VAIAAT+GN L GWD++TIA  + YIKKE VL+  +EGL+V+MS I  T++T  SG++
Sbjct  5    VIVAIAATLGNLLMGWDSSTIAAGMTYIKKEFVLDATLEGLIVSMSFITGTIVTLFSGTV  64

Query  466  ADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            +D +GRRPMLI SS+ +FLSGL+MLW+PNV ++L+AR++DG  I LA
Sbjct  65   SDLVGRRPMLITSSIMFFLSGLVMLWAPNVVIVLLARIIDGVAIALA  111



>ref|XP_003604104.1| Monosaccharide-sensing protein [Medicago truncatula]
 gb|AES74355.1| tonoplast monosaccharide transporter 2 [Medicago truncatula]
Length=744

 Score =   135 bits (339),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 98/113 (87%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  447
            M+GAV+VA+AA IGN LQGWDNATIAG+++YIK+E  L  E  +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVIVAVAAAIGNLLQGWDNATIAGSILYIKREFQLQSEPTVEGLIVAMSLIGATVVT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TCSG+++D  GRRPMLI+SS+ YFLS L+M WSPNVY+LL ARLLDG GIGLA
Sbjct  61   TCSGALSDLFGRRPMLIISSLLYFLSSLVMFWSPNVYILLFARLLDGLGIGLA  113



>ref|XP_003517121.1| PREDICTED: monosaccharide-sensing protein 2-like [Glycine max]
Length=722

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +1

Query  286  VLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTCSGSI  465
            V+VAIAAT+GN L GWD++TIA  + YIKKE VL+  +EGL+V+MS I  T++T  SG++
Sbjct  5    VIVAIAATLGNLLMGWDSSTIAAGMTYIKKEFVLDATLEGLIVSMSFIIGTVVTIFSGTV  64

Query  466  ADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
             D +GRRPMLI SS+ +FLSGL+MLW+PNV ++L+AR++DG  I LA
Sbjct  65   CDLVGRRPMLITSSIMFFLSGLVMLWAPNVVIVLLARIIDGVAIALA  111



>ref|XP_006649210.1| PREDICTED: monosaccharide-sensing protein 2-like [Oryza brachyantha]
Length=668

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 94/114 (82%), Gaps = 3/114 (3%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKEL-VLETY--MEGLVVAMSLIGATLI  444
            M GAV+ A AA +GN LQGWDNATIAGA++YI+++L  L+ +  ++GLVVA SLIGAT++
Sbjct  1    MRGAVVAAAAAALGNMLQGWDNATIAGALLYIRRDLPALQAHPALQGLVVATSLIGATIV  60

Query  445  TTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TT SG ++D+ GRRPML+ S++ Y L+GL+MLWSP V VLL+ARL+DGF IGLA
Sbjct  61   TTLSGPLSDYRGRRPMLVASALLYSLAGLLMLWSPTVEVLLLARLVDGFAIGLA  114



>ref|XP_004964709.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=748

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 96/113 (85%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIK+E  LET   +EGLVVA SLIGAT+IT
Sbjct  1    MQGAVLVAIAAAIGNMLQGWDNATIAGAVLYIKREFHLETQPALEGLVVATSLIGATIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D +GRRPMLI SS+ YF  GLIM+WSPNV VLL+ARL+DGFG+GLA
Sbjct  61   TFSGPVSDNVGRRPMLIASSLLYFAGGLIMMWSPNVVVLLLARLVDGFGVGLA  113



>dbj|BAK02857.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=729

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 93/113 (82%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GA LVA+AA +GN LQGWDNATIAG+++YIK++  L+    ++GLVVA SLIGATLIT
Sbjct  1    MRGAALVALAAALGNMLQGWDNATIAGSLLYIKRDFGLDAQPALQGLVVATSLIGATLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D +GRRPML+ SS+ Y L+GL+MLWSP V VLL+ARL+DGF +GLA
Sbjct  61   TFSGPLSDHVGRRPMLVASSLLYALAGLLMLWSPTVGVLLLARLVDGFAVGLA  113



>ref|XP_002439068.1| hypothetical protein SORBIDRAFT_10g031000 [Sorghum bicolor]
 gb|EER90435.1| hypothetical protein SORBIDRAFT_10g031000 [Sorghum bicolor]
Length=767

 Score =   132 bits (332),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 96/113 (85%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  447
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIK+E  LET   +EGL+VA SLIGAT+IT
Sbjct  1    MQGAVLVAIAAAIGNLLQGWDNATIAGAVIYIKREFHLETQPAVEGLLVATSLIGATIIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SG ++D +GRRPML+ SS+ YF  GLIMLWSPNV VLL+ARL+DGFG+GLA
Sbjct  61   TFSGPVSDIVGRRPMLVASSLLYFAGGLIMLWSPNVLVLLLARLVDGFGVGLA  113



>ref|NP_001147067.1| hexose transporter [Zea mays]
 gb|ACN33422.1| unknown [Zea mays]
 gb|AFW69612.1| hexose transporter [Zea mays]
Length=763

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 92/113 (81%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M GAVLVAIAA IGN LQG DNA IA AV+YIK+E  LET   +EG+VVA SL GAT++T
Sbjct  1    MQGAVLVAIAAAIGNLLQGLDNAAIAAAVLYIKREFHLETDPALEGVVVATSLFGATIVT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
              SG ++D +GRRPMLI+SS+ YF  GL+MLWSP+V VLL+ARL+DGFG+GLA
Sbjct  61   IFSGPVSDVIGRRPMLIVSSLLYFAGGLLMLWSPSVPVLLVARLVDGFGVGLA  113



>gb|EMS60524.1| Monosaccharide-sensing protein 3 [Triticum urartu]
Length=407

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 93/113 (82%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  447
            M GA LVA+AA +GN LQGWDNATIAG+++YIK++  L  +  ++GLVVA SLIGATLIT
Sbjct  1    MRGAALVALAAALGNMLQGWDNATIAGSLLYIKRDFGLHGQPALQGLVVATSLIGATLIT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            T SGS++D +GRRPML+ SS+ Y L+G++MLWSP V VLL+ARL+ GF +GLA
Sbjct  61   TFSGSLSDRVGRRPMLVASSLLYTLAGMLMLWSPTVGVLLLARLVGGFAVGLA  113



>gb|ACG25339.1| hexose transporter [Zea mays]
Length=763

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 92/113 (81%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M GAVLVAIAA IGN LQG DNA IA AV+YIK+E  LET   +EG+VVA SL GAT++T
Sbjct  1    MQGAVLVAIAAAIGNLLQGLDNAAIAAAVLYIKREFHLETDPALEGVVVATSLFGATIVT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
              SG ++D +GRRPMLI+SS+ YF  GL+MLWSP+V VLL+ARL+DGFG+GLA
Sbjct  61   IFSGPVSDVIGRRPMLIVSSLLYFAGGLLMLWSPSVPVLLVARLVDGFGVGLA  113



>ref|XP_007158028.1| hypothetical protein PHAVU_002G118100g [Phaseolus vulgaris]
 gb|ESW30022.1| hypothetical protein PHAVU_002G118100g [Phaseolus vulgaris]
Length=720

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +1

Query  286  VLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTCSGSI  465
            V+VA+AATIGN L GWD++TIA  + YIKK+ +L+  +EGL+V+MS I  T++T  SG++
Sbjct  5    VIVALAATIGNLLMGWDSSTIAAGMTYIKKDFILDATIEGLIVSMSFITGTVVTIFSGAV  64

Query  466  ADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            +D +GRRPMLI SS+ +FLSGLIM W+PNV V+L+AR+++G  I LA
Sbjct  65   SDMVGRRPMLITSSVMFFLSGLIMFWAPNVAVILVARIVNGVAIALA  111



>gb|EAY88138.1| hypothetical protein OsI_09573 [Oryza sativa Indica Group]
Length=643

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 94/114 (82%), Gaps = 3/114 (3%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKEL-VLETY--MEGLVVAMSLIGATLI  444
            M GAV+ A AA +GN LQGWDNATIAGA++Y++++L  L+ +  ++GLVVA SLIGAT++
Sbjct  1    MRGAVVAAAAAAVGNMLQGWDNATIAGALLYMRRDLPALQAHPALQGLVVATSLIGATIV  60

Query  445  TTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TT SG ++D  GRRPMLI S++ Y L+GL+MLWSPNV +LL+ARL+DGF IGLA
Sbjct  61   TTFSGPLSDSRGRRPMLIASALLYSLAGLLMLWSPNVPILLLARLVDGFAIGLA  114



>dbj|BAD23011.1| putative hexose transporter [Oryza sativa Japonica Group]
 gb|EAZ25202.1| hypothetical protein OsJ_09002 [Oryza sativa Japonica Group]
Length=652

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 94/114 (82%), Gaps = 3/114 (3%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKEL-VLETY--MEGLVVAMSLIGATLI  444
            M GAV+ A AA +GN LQGWDNATIAGA++Y++++L  L+ +  ++GLVVA SLIGAT++
Sbjct  1    MRGAVVAAAAAAVGNMLQGWDNATIAGALLYMRRDLPALQAHPALQGLVVATSLIGATIV  60

Query  445  TTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            TT SG ++D  GRRPMLI S++ Y L+GL+MLWSPNV +LL+ARL+DGF IGLA
Sbjct  61   TTFSGPLSDSRGRRPMLIASALLYSLAGLLMLWSPNVPILLLARLVDGFAIGLA  114



>gb|KHN20087.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=712

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 77/111 (69%), Gaps = 25/111 (23%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  453
            M GAVLVAIAA+IGNFLQGWDNATIAGA+VYIKK+L LET MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVLVAIAASIGNFLQGWDNATIAGAIVYIKKDLALETTMEGLVVAMSLIGATVITTC  60

Query  454  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            SG +ADW                              LI+RLLDGFGIGLA
Sbjct  61   SGPVADWTHDD-------------------------NLISRLLDGFGIGLA  86



>gb|KHN19961.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=723

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 76/87 (87%), Gaps = 2/87 (2%)
 Frame = +1

Query  352  GAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRPMLILSSMFYFLS  525
            G+++YIKKE  LE    +EGL+VAMSLIGAT++TTCSG+++D LGRRPMLI+SSM YF+S
Sbjct  14   GSIMYIKKEFQLENEPTVEGLIVAMSLIGATVVTTCSGALSDLLGRRPMLIISSMLYFVS  73

Query  526  GLIMLWSPNVYVLLIARLLDGFGIGLA  606
             L+MLWSPNVY+LL ARLLDG GIGLA
Sbjct  74   SLVMLWSPNVYILLFARLLDGLGIGLA  100



>ref|XP_007156262.1| hypothetical protein PHAVU_003G271500g [Phaseolus vulgaris]
 gb|ESW28256.1| hypothetical protein PHAVU_003G271500g [Phaseolus vulgaris]
Length=687

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 86/113 (76%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M   V+VAIAAT+GN L GWD++TIAG + YIKKE  LET   +EGL+++ S +  T++T
Sbjct  1    MREVVIVAIAATVGNVLVGWDSSTIAGGMSYIKKEFKLETDPTLEGLIMSTSFLTGTVVT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
              SG++ D LGRRPMLI++S  +FLSGL+MLW+PNV V+L +RLL+G  + LA
Sbjct  61   IFSGTVCDMLGRRPMLIVASTMFFLSGLVMLWAPNVTVILFSRLLNGIALALA  113



>ref|XP_003629095.1| Monosaccharide-sensing protein [Medicago truncatula]
 gb|AET03571.1| tonoplast monosaccharide transporter 2 [Medicago truncatula]
Length=716

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 85/113 (75%), Gaps = 2/113 (2%)
 Frame = +1

Query  274  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  447
            M   V++A AAT+GN L GWD++TIAG + YIK+E  LET   +EGL+V+MS +  T +T
Sbjct  1    MREIVMIATAATLGNLLVGWDSSTIAGGMRYIKQEFNLETDPTLEGLIVSMSFLTGTFVT  60

Query  448  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
              SG+++D  GRRPMLI SS+ +FLSGL+MLW+PNV V+L +RLL+G  I LA
Sbjct  61   IFSGTVSDMFGRRPMLITSSIMFFLSGLVMLWAPNVPVVLFSRLLNGIAIALA  113



>ref|XP_003573173.1| PREDICTED: monosaccharide-sensing protein 2-like [Brachypodium 
distachyon]
Length=709

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 82/99 (83%), Gaps = 2/99 (2%)
 Frame = +1

Query  316  NFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRP  489
            N LQGWDNATIAG+++YIK+E  LE +  +EGLVVA SLIGAT++TT SG ++D +GRRP
Sbjct  16   NMLQGWDNATIAGSLLYIKREFRLEGHPALEGLVVATSLIGATVVTTFSGPLSDSVGRRP  75

Query  490  MLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  606
            ML+ SS+ Y L+GL+MLWSPNV +LL++RL+ G  +GLA
Sbjct  76   MLVASSLLYALAGLLMLWSPNVQLLLLSRLVGGLAVGLA  114



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 815770585800