BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS025A07

Length=624
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011095158.1|  PREDICTED: receptor-like protein kinase FERONIA    200   7e-56   Sesamum indicum [beniseed]
ref|XP_006341293.1|  PREDICTED: receptor-like protein kinase FERO...    195   5e-54   Solanum tuberosum [potatoes]
ref|XP_004246282.1|  PREDICTED: receptor-like protein kinase FERONIA    193   2e-53   Solanum lycopersicum
ref|XP_009791682.1|  PREDICTED: receptor-like protein kinase FERONIA    186   1e-50   Nicotiana sylvestris
ref|XP_009617447.1|  PREDICTED: receptor-like protein kinase FERONIA    185   2e-50   Nicotiana tomentosiformis
gb|KJB38065.1|  hypothetical protein B456_006G235700                    184   4e-50   Gossypium raimondii
gb|KJB29840.1|  hypothetical protein B456_005G120700                    182   1e-49   Gossypium raimondii
emb|CDX78012.1|  BnaA09g32070D                                          180   1e-48   
ref|XP_009115840.1|  PREDICTED: receptor-like protein kinase FERONIA    180   1e-48   Brassica rapa
gb|AHZ44752.1|  CrRLK1L-like protein                                    179   1e-48   Platanus x hispanica [London plane tree]
emb|CDX73714.1|  BnaC08g22890D                                          181   2e-48   
ref|XP_009337788.1|  PREDICTED: receptor-like protein kinase FERONIA    179   3e-48   Pyrus x bretschneideri [bai li]
ref|XP_010244547.1|  PREDICTED: receptor-like protein kinase FERONIA    177   1e-47   Nelumbo nucifera [Indian lotus]
ref|XP_006403905.1|  hypothetical protein EUTSA_v10010114mg             177   1e-47   Eutrema salsugineum [saltwater cress]
ref|XP_009370899.1|  PREDICTED: receptor-like protein kinase FERONIA    177   2e-47   Pyrus x bretschneideri [bai li]
gb|ABT18097.1|  FERONIA receptor-like kinase                            176   2e-47   Cardamine flexuosa
ref|XP_010252026.1|  PREDICTED: receptor-like protein kinase FERONIA    176   4e-47   Nelumbo nucifera [Indian lotus]
emb|CDP06378.1|  unnamed protein product                                176   4e-47   Coffea canephora [robusta coffee]
ref|XP_008244701.1|  PREDICTED: receptor-like protein kinase FERONIA    176   6e-47   Prunus mume [ume]
gb|ABT18095.1|  FERONIA receptor-like kinase                            175   8e-47   Cardamine flexuosa
emb|CDX90645.1|  BnaA03g41360D                                          174   1e-46   
ref|XP_007033491.1|  Malectin/receptor-like protein kinase family...    174   2e-46   Theobroma cacao [chocolate]
ref|XP_010431249.1|  PREDICTED: receptor-like protein kinase FERONIA    171   2e-46   Camelina sativa [gold-of-pleasure]
ref|XP_009136619.1|  PREDICTED: receptor-like protein kinase FERONIA    174   2e-46   Brassica rapa
emb|CDY29022.1|  BnaC07g32280D                                          173   2e-46   Brassica napus [oilseed rape]
gb|KJB71482.1|  hypothetical protein B456_011G124900                    174   3e-46   Gossypium raimondii
ref|XP_007208402.1|  hypothetical protein PRUPE_ppa001164mg             173   3e-46   Prunus persica
gb|KDO64141.1|  hypothetical protein CISIN_1g036624mg                   173   4e-46   Citrus sinensis [apfelsine]
ref|XP_008370279.1|  PREDICTED: receptor-like protein kinase FERONIA    173   5e-46   
ref|XP_010252025.1|  PREDICTED: receptor-like protein kinase FERONIA    173   5e-46   Nelumbo nucifera [Indian lotus]
gb|EPS73118.1|  hypothetical protein M569_01631                         172   1e-45   Genlisea aurea
ref|XP_006429617.1|  hypothetical protein CICLE_v10011034mg             171   2e-45   Citrus clementina [clementine]
ref|XP_010426729.1|  PREDICTED: receptor-like protein kinase FERONIA    171   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010503851.1|  PREDICTED: receptor-like protein kinase FERONIA    170   6e-45   
ref|XP_002528705.1|  kinase, putative                                   170   6e-45   
ref|XP_010515573.1|  PREDICTED: receptor-like protein kinase FERONIA    170   7e-45   Camelina sativa [gold-of-pleasure]
emb|CDY16299.1|  BnaC01g23340D                                          168   3e-44   Brassica napus [oilseed rape]
gb|ABT18094.1|  FERONIA receptor-like kinase                            168   3e-44   Brassica oleracea
emb|CDY33271.1|  BnaA01g19380D                                          167   3e-44   Brassica napus [oilseed rape]
ref|XP_009148931.1|  PREDICTED: receptor-like protein kinase FERONIA    167   4e-44   Brassica rapa
ref|XP_002279218.3|  PREDICTED: receptor-like protein kinase FERONIA    167   7e-44   
ref|XP_004302537.1|  PREDICTED: receptor-like protein kinase FERONIA    166   1e-43   Fragaria vesca subsp. vesca
ref|XP_010529939.1|  PREDICTED: receptor-like protein kinase FERONIA    166   2e-43   Tarenaya hassleriana [spider flower]
ref|NP_001238686.1|  receptor-like kinase                               165   4e-43   Glycine max [soybeans]
ref|NP_001237656.1|  FERONIA receptor-like kinase precursor             164   9e-43   Glycine max [soybeans]
gb|KHN29489.1|  Receptor-like protein kinase FERONIA                    164   1e-42   Glycine soja [wild soybean]
gb|KHN40613.1|  Receptor-like protein kinase FERONIA                    164   1e-42   Glycine soja [wild soybean]
ref|XP_004142677.1|  PREDICTED: receptor-like protein kinase FERO...    162   2e-42   Cucumis sativus [cucumbers]
gb|AAK59558.1|  putative receptor-protein kinase                        162   2e-42   Arabidopsis thaliana [mouse-ear cress]
gb|ABT18100.1|  FERONIA receptor-like kinase                            162   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|NP_190723.1|  receptor-like protein kinase FERONIA                  162   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010043538.1|  PREDICTED: receptor-like protein kinase FERONIA    162   3e-42   Eucalyptus grandis [rose gum]
ref|XP_006290584.1|  hypothetical protein CARUB_v10016673mg             162   4e-42   Capsella rubella
gb|KEH32083.1|  feronia receptor-like kinase                            160   5e-42   Medicago truncatula
ref|XP_010098025.1|  Receptor-like protein kinase FERONIA               161   7e-42   Morus notabilis
ref|XP_004492579.1|  PREDICTED: receptor-like protein kinase FERO...    161   9e-42   Cicer arietinum [garbanzo]
ref|XP_007140079.1|  hypothetical protein PHAVU_008G082400g             160   1e-41   Phaseolus vulgaris [French bean]
ref|XP_003609098.1|  FERONIA receptor-like kinase                       160   2e-41   
gb|KEH23293.1|  feronia receptor-like kinase                            160   2e-41   Medicago truncatula
gb|ABT18098.1|  FERONIA receptor-like kinase                            159   5e-41   Cardamine flexuosa
ref|XP_008463270.1|  PREDICTED: receptor-like protein kinase FERONIA    158   1e-40   Cucumis melo [Oriental melon]
ref|XP_002877809.1|  hypothetical protein ARALYDRAFT_485507             157   2e-40   Arabidopsis lyrata subsp. lyrata
ref|XP_002308259.1|  kinase family protein                              153   7e-39   
ref|XP_002323088.2|  kinase family protein                              152   8e-39   Populus trichocarpa [western balsam poplar]
ref|XP_011001679.1|  PREDICTED: receptor-like protein kinase FERONIA    151   2e-38   Populus euphratica
gb|EYU42039.1|  hypothetical protein MIMGU_mgv1a001343mg                151   2e-38   Erythranthe guttata [common monkey flower]
ref|XP_011016728.1|  PREDICTED: receptor-like protein kinase FERONIA    151   3e-38   Populus euphratica
ref|XP_007140062.1|  hypothetical protein PHAVU_008G081000g             150   4e-38   Phaseolus vulgaris [French bean]
ref|XP_010553161.1|  PREDICTED: receptor-like protein kinase FERONIA    149   8e-38   Tarenaya hassleriana [spider flower]
gb|ABT18099.1|  FERONIA receptor-like kinase                            149   1e-37   Cardamine flexuosa
ref|XP_010683454.1|  PREDICTED: receptor-like protein kinase FERONIA    147   6e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004499818.1|  PREDICTED: receptor-like protein kinase FERO...    131   5e-33   
ref|XP_004499647.1|  PREDICTED: receptor-like protein kinase FERO...    134   7e-33   Cicer arietinum [garbanzo]
ref|XP_009118021.1|  PREDICTED: receptor-like protein kinase FERO...    135   1e-32   Brassica rapa
ref|XP_010667956.1|  PREDICTED: receptor-like protein kinase FERONIA    132   1e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004499646.1|  PREDICTED: receptor-like protein kinase FERO...    135   2e-32   
ref|XP_004514615.1|  PREDICTED: uncharacterized protein LOC101497599    134   3e-32   
ref|XP_009391670.1|  PREDICTED: receptor-like protein kinase FERONIA    130   6e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010247768.1|  PREDICTED: receptor-like protein kinase FERONIA    130   8e-31   Nelumbo nucifera [Indian lotus]
ref|XP_004984479.1|  PREDICTED: receptor-like protein kinase FERO...    130   9e-31   Setaria italica
ref|XP_008660180.1|  PREDICTED: receptor-like protein kinase FERONIA    129   2e-30   Zea mays [maize]
ref|XP_010246590.1|  PREDICTED: receptor-like protein kinase FERONIA    128   3e-30   Nelumbo nucifera [Indian lotus]
gb|EMT17007.1|  Receptor-like protein kinase FERONIA                    128   3e-30   
emb|CDY26624.1|  BnaA09g46530D                                          128   5e-30   Brassica napus [oilseed rape]
ref|XP_002467915.1|  hypothetical protein SORBIDRAFT_01g036260          127   5e-30   Sorghum bicolor [broomcorn]
ref|XP_008810848.1|  PREDICTED: receptor-like protein kinase FERONIA    126   1e-29   Phoenix dactylifera
ref|XP_010938035.1|  PREDICTED: receptor-like protein kinase FERONIA    126   1e-29   Elaeis guineensis
ref|XP_010250338.1|  PREDICTED: receptor-like protein kinase FERONIA    125   2e-29   Nelumbo nucifera [Indian lotus]
emb|CBI27305.3|  unnamed protein product                                125   3e-29   Vitis vinifera
ref|XP_002273707.2|  PREDICTED: receptor-like protein kinase FERONIA    125   3e-29   Vitis vinifera
tpg|DAA45217.1|  TPA: putative receptor-like protein kinase famil...    124   9e-29   
gb|KDP27676.1|  hypothetical protein JCGZ_20096                         124   1e-28   Jatropha curcas
ref|NP_001050022.1|  Os03g0333200                                       124   1e-28   
gb|EEC75192.1|  hypothetical protein OsI_11431                          124   1e-28   Oryza sativa Indica Group [Indian rice]
gb|KDP24658.1|  hypothetical protein JCGZ_26517                         119   1e-28   Jatropha curcas
gb|KJB10568.1|  hypothetical protein B456_001G207900                    123   2e-28   Gossypium raimondii
emb|CDP15786.1|  unnamed protein product                                120   2e-28   Coffea canephora [robusta coffee]
ref|XP_003557976.1|  PREDICTED: receptor-like protein kinase FERONIA    123   2e-28   Brachypodium distachyon [annual false brome]
ref|XP_009414253.1|  PREDICTED: receptor-like protein kinase FERONIA    122   3e-28   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY75971.1|  hypothetical protein OsI_03893                          122   5e-28   Oryza sativa Indica Group [Indian rice]
ref|NP_001044372.1|  Os01g0769700                                       122   5e-28   
gb|KDP24662.1|  hypothetical protein JCGZ_26521                         121   6e-28   Jatropha curcas
ref|XP_004499645.1|  PREDICTED: receptor-like protein kinase FERO...    119   6e-28   
gb|EMT27425.1|  Receptor-like protein kinase FERONIA                    121   7e-28   
ref|XP_006373375.1|  hypothetical protein POPTR_0017s13190g             121   7e-28   
ref|XP_006373380.1|  hypothetical protein POPTR_0017s13240g             121   9e-28   
ref|XP_008813242.1|  PREDICTED: receptor-like protein kinase FERONIA    121   1e-27   Phoenix dactylifera
ref|XP_006373370.1|  hypothetical protein POPTR_0017s13150g             120   1e-27   
gb|KDP27678.1|  hypothetical protein JCGZ_20098                         118   1e-27   Jatropha curcas
ref|XP_011021061.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    119   3e-27   Populus euphratica
ref|XP_010921184.1|  PREDICTED: receptor-like protein kinase FERONIA    119   4e-27   Elaeis guineensis
ref|XP_006373383.1|  hypothetical protein POPTR_0017s13270g             119   4e-27   
ref|XP_009412649.1|  PREDICTED: receptor-like protein kinase FERONIA    118   7e-27   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP24661.1|  hypothetical protein JCGZ_26520                         119   8e-27   Jatropha curcas
ref|XP_011009252.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    117   1e-26   Populus euphratica
ref|XP_010660578.1|  PREDICTED: receptor-like protein kinase FERONIA    118   1e-26   Vitis vinifera
ref|XP_010921463.1|  PREDICTED: receptor-like protein kinase ANXUR2     117   1e-26   Elaeis guineensis
ref|XP_009118022.1|  PREDICTED: receptor-like protein kinase FERO...    117   2e-26   Brassica rapa
ref|XP_011009253.1|  PREDICTED: receptor-like protein kinase FERONIA    117   2e-26   Populus euphratica
emb|CDP05401.1|  unnamed protein product                                117   3e-26   Coffea canephora [robusta coffee]
ref|XP_009416326.1|  PREDICTED: receptor-like protein kinase FERONIA    116   6e-26   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB10595.1|  hypothetical protein B456_001G210100                    115   6e-26   Gossypium raimondii
ref|XP_007032827.1|  Malectin/receptor-like protein kinase family...    115   9e-26   
ref|XP_010660576.1|  PREDICTED: receptor-like protein kinase FERONIA    115   9e-26   
ref|XP_007032832.1|  Malectin/receptor-like protein kinase family...    115   9e-26   
gb|KDO53394.1|  hypothetical protein CISIN_1g002533mg                   115   1e-25   Citrus sinensis [apfelsine]
ref|XP_006427852.1|  hypothetical protein CICLE_v10024830mg             115   1e-25   Citrus clementina [clementine]
ref|XP_009419820.1|  PREDICTED: receptor-like protein kinase FERO...    113   1e-25   
gb|KDP27270.1|  hypothetical protein JCGZ_19969                         115   1e-25   Jatropha curcas
ref|XP_009419819.1|  PREDICTED: receptor-like protein kinase FERO...    113   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN77538.1|  hypothetical protein VITISV_025026                     115   1e-25   Vitis vinifera
ref|XP_002277584.3|  PREDICTED: receptor-like protein kinase FERONIA    115   1e-25   Vitis vinifera
emb|CBI21192.3|  unnamed protein product                                115   1e-25   Vitis vinifera
gb|KJB42940.1|  hypothetical protein B456_007G175600                    114   2e-25   Gossypium raimondii
ref|XP_008809255.1|  PREDICTED: receptor-like protein kinase ANXUR1     114   2e-25   Phoenix dactylifera
gb|KDP24278.1|  hypothetical protein JCGZ_25574                         114   2e-25   Jatropha curcas
ref|XP_007032799.1|  Malectin/receptor protein kinase family prot...    114   3e-25   
ref|XP_007032796.1|  Malectin/receptor-like protein kinase family...    107   3e-25   
ref|XP_002870806.1|  predicted protein                                  111   4e-25   
emb|CDP19885.1|  unnamed protein product                                113   7e-25   Coffea canephora [robusta coffee]
dbj|BAK00988.1|  predicted protein                                      110   7e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_198719.1|  putative receptor-like protein kinase                 112   7e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002530995.1|  kinase, putative                                   112   8e-25   Ricinus communis
emb|CDY36996.1|  BnaC06g12670D                                          112   1e-24   Brassica napus [oilseed rape]
ref|XP_007045781.1|  Malectin/receptor-like protein kinase family...    112   1e-24   
ref|NP_198718.1|  putative receptor-like protein kinase                 112   1e-24   Arabidopsis thaliana [mouse-ear cress]
emb|CDP20271.1|  unnamed protein product                                112   2e-24   Coffea canephora [robusta coffee]
ref|XP_009388012.1|  PREDICTED: receptor-like protein kinase FERONIA    110   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009588433.1|  PREDICTED: receptor-like protein kinase FERONIA    112   2e-24   Nicotiana tomentosiformis
ref|XP_009115877.1|  PREDICTED: putative receptor-like protein ki...    111   2e-24   Brassica rapa
emb|CDP17056.1|  unnamed protein product                                111   2e-24   Coffea canephora [robusta coffee]
emb|CDP19887.1|  unnamed protein product                                111   3e-24   Coffea canephora [robusta coffee]
ref|XP_006405671.1|  hypothetical protein EUTSA_v10027636mg             111   3e-24   Eutrema salsugineum [saltwater cress]
emb|CDX78036.1|  BnaA09g32310D                                          110   4e-24   
ref|XP_006844774.1|  hypothetical protein AMTR_s00016p00259140          110   4e-24   
ref|XP_006842554.1|  hypothetical protein AMTR_s00077p00138840          110   4e-24   
ref|XP_008464587.1|  PREDICTED: receptor-like protein kinase FERONIA    110   5e-24   Cucumis melo [Oriental melon]
gb|KJB10597.1|  hypothetical protein B456_001G210300                    110   6e-24   Gossypium raimondii
ref|XP_003520131.2|  PREDICTED: receptor-like protein kinase FERO...    110   6e-24   Glycine max [soybeans]
ref|XP_007153476.1|  hypothetical protein PHAVU_003G038800g             110   7e-24   Phaseolus vulgaris [French bean]
gb|KJB10602.1|  hypothetical protein B456_001G210700                    109   9e-24   Gossypium raimondii
ref|XP_006654205.1|  PREDICTED: receptor-like protein kinase FERO...    109   1e-23   Oryza brachyantha
ref|XP_011099030.1|  PREDICTED: receptor-like protein kinase FERONIA    109   1e-23   Sesamum indicum [beniseed]
emb|CDX67422.1|  BnaA07g14620D                                          108   1e-23   
gb|KJB75372.1|  hypothetical protein B456_012G038800                    109   1e-23   Gossypium raimondii
ref|XP_007032831.1|  Malectin/receptor-like protein kinase family...    109   1e-23   
gb|KDP27267.1|  hypothetical protein JCGZ_19966                         109   1e-23   Jatropha curcas
ref|XP_007045784.1|  Malectin/receptor-like protein kinase family...    108   2e-23   Theobroma cacao [chocolate]
ref|XP_009125099.1|  PREDICTED: putative receptor-like protein ki...    108   2e-23   Brassica rapa
gb|EMT01093.1|  hypothetical protein F775_16963                         106   2e-23   
ref|XP_004137258.1|  PREDICTED: receptor-like protein kinase FERO...    108   3e-23   Cucumis sativus [cucumbers]
ref|XP_002519226.1|  ATP binding protein, putative                      108   3e-23   Ricinus communis
gb|KHN29954.1|  Receptor-like protein kinase FERONIA                    108   3e-23   Glycine soja [wild soybean]
ref|XP_004154760.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    108   3e-23   
gb|EMT04378.1|  Receptor-like protein kinase FERONIA                    107   4e-23   
ref|XP_007032823.1|  Malectin/receptor-like protein kinase family...    107   4e-23   
ref|XP_007227151.1|  hypothetical protein PRUPE_ppa026453mg             107   6e-23   Prunus persica
ref|XP_003614252.1|  Kinase-like protein                                107   6e-23   
ref|XP_002272797.2|  PREDICTED: receptor-like protein kinase ANXUR1     107   6e-23   Vitis vinifera
dbj|BAK06468.1|  predicted protein                                      107   7e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_198716.1|  putative receptor-like protein kinase                 107   7e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001055089.1|  Os05g0280700                                       107   7e-23   
ref|XP_008368476.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    107   8e-23   
ref|XP_009790514.1|  PREDICTED: receptor-like protein kinase FERONIA    107   8e-23   Nicotiana sylvestris
ref|XP_008341792.1|  PREDICTED: receptor-like protein kinase FERONIA    107   8e-23   
ref|XP_009385155.1|  PREDICTED: receptor-like protein kinase ANXUR2     107   9e-23   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS48200.1|  Receptor-like protein kinase HERK 1                     106   1e-22   Triticum urartu
ref|XP_008223394.1|  PREDICTED: receptor-like protein kinase ANXUR1     106   1e-22   Prunus mume [ume]
gb|ACA25088.1|  serine/threonine protein kinase A                       100   1e-22   Populus tremula [European aspen]
gb|KJB11637.1|  hypothetical protein B456_001G269100                    105   2e-22   Gossypium raimondii
gb|ACA25086.1|  serine/threonine protein kinase A                     99.8    2e-22   Populus tremula [European aspen]
gb|EYU46822.1|  hypothetical protein MIMGU_mgv1a022107mg                105   2e-22   Erythranthe guttata [common monkey flower]
ref|XP_008341797.1|  PREDICTED: receptor-like protein kinase FERONIA    105   2e-22   
ref|XP_010914574.1|  PREDICTED: receptor-like protein kinase ANXUR2     105   2e-22   Elaeis guineensis
ref|XP_010243447.1|  PREDICTED: receptor-like protein kinase FERONIA    105   3e-22   Nelumbo nucifera [Indian lotus]
gb|KDO71938.1|  hypothetical protein CISIN_1g041565mg                   105   3e-22   Citrus sinensis [apfelsine]
ref|XP_006488842.1|  PREDICTED: receptor-like protein kinase ANXU...    105   3e-22   Citrus sinensis [apfelsine]
ref|XP_006419383.1|  hypothetical protein CICLE_v10004295mg             105   3e-22   Citrus clementina [clementine]
gb|EYU44219.1|  hypothetical protein MIMGU_mgv11b013480mg             98.2    3e-22   Erythranthe guttata [common monkey flower]
ref|XP_004962493.1|  PREDICTED: receptor-like protein kinase ANXU...    105   4e-22   Setaria italica
ref|NP_198715.1|  putative receptor-like protein kinase                 105   4e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AAM10331.1|  AT5g38990/K15E6_170                                     105   4e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010660597.1|  PREDICTED: receptor-like protein kinase FERONIA    103   4e-22   Vitis vinifera
ref|XP_003580431.1|  PREDICTED: receptor-like protein kinase FERONIA    103   4e-22   Brachypodium distachyon [annual false brome]
gb|ACA25095.1|  serine/threonine protein kinase A                     99.0    4e-22   Populus tremula [European aspen]
gb|EMT03407.1|  Receptor-like protein kinase FERONIA                    104   5e-22   
emb|CDY37883.1|  BnaC04g31230D                                          104   5e-22   Brassica napus [oilseed rape]
ref|XP_006338349.1|  PREDICTED: receptor-like protein kinase FERO...    104   5e-22   
gb|ACA25085.1|  serine/threonine protein kinase A                     98.6    5e-22   Populus tremula [European aspen]
gb|ACA25082.1|  serine/threonine protein kinase A                     98.6    5e-22   Populus tremula [European aspen]
ref|XP_003614249.1|  Kinase-like protein                                104   5e-22   Medicago truncatula
gb|ACA25099.1|  serine/threonine protein kinase A                     98.6    5e-22   Populus tremula [European aspen]
gb|ACA25100.1|  serine/threonine protein kinase A                     98.6    6e-22   Populus tremula [European aspen]
emb|CDY37884.1|  BnaC04g31220D                                          104   6e-22   Brassica napus [oilseed rape]
gb|EMT13360.1|  hypothetical protein F775_08521                         102   6e-22   
gb|ACA25080.1|  serine/threonine protein kinase A                     98.2    8e-22   Populus tremula [European aspen]
ref|XP_011071382.1|  PREDICTED: receptor-like protein kinase ANXUR1     103   9e-22   Sesamum indicum [beniseed]
ref|XP_009372137.1|  PREDICTED: receptor-like protein kinase ANXUR1     103   9e-22   
gb|ACA25089.1|  serine/threonine protein kinase A                     97.8    9e-22   Populus tremula [European aspen]
ref|XP_004976623.1|  PREDICTED: receptor-like protein kinase FERO...    102   9e-22   Setaria italica
ref|XP_008390536.1|  PREDICTED: receptor-like protein kinase ANXUR1     103   1e-21   
emb|CBI21198.3|  unnamed protein product                                103   1e-21   Vitis vinifera
gb|ACA25079.1|  serine/threonine protein kinase A                     97.8    1e-21   Populus tremula [European aspen]
ref|XP_003568703.1|  PREDICTED: receptor-like protein kinase ANXUR1     103   1e-21   Brachypodium distachyon [annual false brome]
gb|ACA25097.1|  serine/threonine protein kinase A                     97.4    1e-21   Populus tremula [European aspen]
gb|ACA25084.1|  serine/threonine protein kinase A                     97.4    1e-21   Populus tremula [European aspen]
gb|KJB80425.1|  hypothetical protein B456_013G096400                    102   1e-21   Gossypium raimondii
ref|XP_002439522.1|  hypothetical protein SORBIDRAFT_09g009320          103   1e-21   Sorghum bicolor [broomcorn]
ref|XP_010552466.1|  PREDICTED: putative receptor-like protein ki...    103   2e-21   Tarenaya hassleriana [spider flower]
ref|XP_009799586.1|  PREDICTED: receptor-like protein kinase ANXUR1     103   2e-21   Nicotiana sylvestris
ref|XP_006358215.1|  PREDICTED: receptor-like protein kinase ANXU...    103   2e-21   Solanum tuberosum [potatoes]
ref|XP_003633771.1|  PREDICTED: receptor-like protein kinase FERONIA    103   2e-21   
ref|XP_003568697.1|  PREDICTED: receptor-like protein kinase FERONIA    102   3e-21   Brachypodium distachyon [annual false brome]
ref|XP_010684237.1|  PREDICTED: receptor-like protein kinase ANXUR1     102   3e-21   Beta vulgaris subsp. vulgaris [field beet]
gb|ACA25092.1|  serine/threonine protein kinase A                     96.7    3e-21   Populus tremula [European aspen]
gb|ACA25087.1|  serine/threonine protein kinase A                     96.7    3e-21   Populus tremula [European aspen]
gb|ACA25090.1|  serine/threonine protein kinase A                     96.3    4e-21   Populus tremula [European aspen]
emb|CDX74491.1|  BnaA04g08980D                                          102   4e-21   
ref|XP_009139818.1|  PREDICTED: putative receptor-like protein ki...    102   4e-21   Brassica rapa
gb|ACA25096.1|  serine/threonine protein kinase A                     96.3    4e-21   Populus tremula [European aspen]
gb|EMT28751.1|  Receptor-like protein kinase FERONIA                    101   5e-21   
gb|AFW77551.1|  putative receptor-like protein kinase family protein    101   5e-21   
gb|ACA25098.1|  serine/threonine protein kinase A                     95.9    5e-21   Populus tremula [European aspen]
gb|KDP37883.1|  hypothetical protein JCGZ_05765                       99.4    6e-21   Jatropha curcas
ref|XP_002316044.1|  Pto-like kinase OGw family protein                 101   6e-21   
gb|ACA25081.1|  serine/threonine protein kinase A                     95.5    7e-21   Populus tremula [European aspen]
ref|XP_011099029.1|  PREDICTED: receptor-like protein kinase FERONIA    101   7e-21   Sesamum indicum [beniseed]
emb|CDP05402.1|  unnamed protein product                                101   8e-21   Coffea canephora [robusta coffee]
gb|EMS52253.1|  Receptor-like protein kinase FERONIA                    101   8e-21   Triticum urartu
ref|XP_002319081.1|  kinase family protein                              101   8e-21   Populus trichocarpa [western balsam poplar]
ref|XP_002277565.2|  PREDICTED: receptor-like protein kinase FERONIA    101   9e-21   Vitis vinifera
ref|XP_009602553.1|  PREDICTED: receptor-like protein kinase ANXUR1     100   9e-21   Nicotiana tomentosiformis
ref|XP_004243035.1|  PREDICTED: receptor-like protein kinase ANXUR1     100   1e-20   Solanum lycopersicum
ref|XP_010441030.1|  PREDICTED: putative receptor-like protein ki...  97.8    1e-20   
gb|KFK33213.1|  hypothetical protein AALP_AA6G345300                    100   1e-20   Arabis alpina [alpine rockcress]
gb|EMT16871.1|  Receptor-like protein kinase FERONIA                    100   1e-20   
ref|XP_010319813.1|  PREDICTED: receptor-like protein kinase ANXUR1     100   1e-20   
gb|ACA25101.1|  serine/threonine protein kinase A                     94.7    1e-20   Populus tremula [European aspen]
ref|XP_009139816.1|  PREDICTED: putative receptor-like protein ki...    100   1e-20   Brassica rapa
ref|XP_011079535.1|  PREDICTED: receptor-like protein kinase ANXUR1     100   2e-20   Sesamum indicum [beniseed]
emb|CDX74492.1|  BnaA04g08970D                                          100   2e-20   
ref|XP_007032792.1|  Malectin/receptor protein kinase family protein  97.4    2e-20   
ref|XP_009139815.1|  PREDICTED: putative receptor-like protein ki...    100   2e-20   Brassica rapa
gb|ACA25083.1|  serine/threonine protein kinase A                     94.7    2e-20   Populus tremula [European aspen]
dbj|BAJ88190.1|  predicted protein                                      100   2e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001055184.1|  Os05g0318700                                       100   2e-20   
ref|XP_011038554.1|  PREDICTED: receptor-like protein kinase ANXUR1     100   2e-20   Populus euphratica
ref|XP_009373799.1|  PREDICTED: receptor-like protein kinase FERONIA    100   2e-20   
gb|EEE63237.1|  hypothetical protein OsJ_18047                        99.8    2e-20   Oryza sativa Japonica Group [Japonica rice]
gb|EAY97521.1|  hypothetical protein OsI_19449                        99.8    2e-20   Oryza sativa Indica Group [Indian rice]
gb|EYU19262.1|  hypothetical protein MIMGU_mgv1a024030mg              97.4    2e-20   Erythranthe guttata [common monkey flower]
gb|KJB48087.1|  hypothetical protein B456_008G053200                  99.8    2e-20   Gossypium raimondii
ref|XP_010660579.1|  PREDICTED: receptor-like protein kinase FERONIA  98.2    4e-20   Vitis vinifera
ref|XP_002447000.1|  hypothetical protein SORBIDRAFT_06g026735        97.8    4e-20   
gb|ACA25102.1|  serine/threonine protein kinase A                     93.6    4e-20   Populus tremula [European aspen]
gb|EMS66619.1|  hypothetical protein TRIUR3_14353                     97.8    4e-20   Triticum urartu
ref|XP_002884459.1|  kinase family protein                            99.0    4e-20   Arabidopsis lyrata subsp. lyrata
ref|NP_001055179.1|  Os05g0317700                                     99.0    5e-20   
gb|EYU38427.1|  hypothetical protein MIMGU_mgv1a001092mg              99.0    5e-20   Erythranthe guttata [common monkey flower]
ref|XP_009365970.1|  PREDICTED: receptor-like protein kinase FERONIA  98.2    5e-20   
ref|XP_002311383.2|  hypothetical protein POPTR_0008s10500g           98.6    6e-20   
ref|XP_002870808.1|  hypothetical protein ARALYDRAFT_916421           98.6    7e-20   
ref|XP_002271113.1|  PREDICTED: receptor-like protein kinase ANXUR1   98.6    7e-20   
ref|NP_187120.1|  receptor-like protein kinase ANXUR1                 98.6    7e-20   
ref|XP_011032387.1|  PREDICTED: receptor-like protein kinase ANXUR1   98.6    7e-20   
ref|XP_004306057.1|  PREDICTED: receptor-like protein kinase FERONIA  98.2    8e-20   
gb|KDP27915.1|  hypothetical protein JCGZ_18995                       98.2    8e-20   
ref|XP_009790513.1|  PREDICTED: receptor-like protein kinase FERONIA  98.2    9e-20   
ref|XP_006382811.1|  serine-threonine kinase family protein           98.2    9e-20   
ref|XP_010242732.1|  PREDICTED: receptor-like protein kinase ANXUR1   98.2    9e-20   
ref|XP_004154759.1|  PREDICTED: receptor-like protein kinase FERO...  97.8    1e-19   
ref|XP_004137257.1|  PREDICTED: receptor-like protein kinase FERO...  97.8    1e-19   
ref|XP_006285765.1|  hypothetical protein CARUB_v10007239mg           97.8    1e-19   
ref|XP_007217058.1|  hypothetical protein PRUPE_ppa001157mg           97.8    1e-19   
gb|KFK33632.1|  hypothetical protein AALP_AA5G038800                  97.8    1e-19   
ref|XP_006644001.1|  PREDICTED: receptor-like protein kinase ANXU...  97.8    1e-19   
ref|NP_001238536.1|  receptor-like kinase                             97.8    1e-19   
ref|XP_004232151.1|  PREDICTED: receptor-like protein kinase FERONIA  97.4    1e-19   
ref|XP_010450843.1|  PREDICTED: putative receptor-like protein ki...  97.4    2e-19   
ref|XP_007035799.1|  Malectin/receptor-like protein kinase family...  97.4    2e-19   
ref|XP_008231015.1|  PREDICTED: receptor-like protein kinase FERONIA  95.9    2e-19   
ref|XP_008230906.1|  PREDICTED: receptor-like protein kinase FERONIA  97.4    2e-19   
ref|XP_008231019.1|  PREDICTED: receptor-like protein kinase FERONIA  94.7    2e-19   
ref|XP_002530992.1|  kinase, putative                                 97.1    2e-19   
gb|KDP41347.1|  hypothetical protein JCGZ_15754                       95.5    2e-19   
ref|XP_009385224.1|  PREDICTED: receptor-like protein kinase ANXUR1   97.1    2e-19   
gb|EMT27556.1|  Receptor-like protein kinase ANXUR1                   97.4    2e-19   
ref|XP_007215522.1|  hypothetical protein PRUPE_ppa003761mg           95.9    2e-19   
ref|XP_008341791.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  96.7    2e-19   
ref|XP_002512045.1|  conserved hypothetical protein                   96.7    3e-19   
ref|XP_006408164.1|  hypothetical protein EUTSA_v10020050mg           96.7    3e-19   
ref|XP_011019995.1|  PREDICTED: receptor-like protein kinase ANXUR1   96.7    3e-19   
ref|XP_006593699.1|  PREDICTED: receptor-like protein kinase FERO...  95.9    4e-19   
ref|XP_007147183.1|  hypothetical protein PHAVU_006G102700g           96.3    4e-19   
gb|KHN07116.1|  Receptor-like protein kinase FERONIA                  96.3    4e-19   
gb|KEH43006.1|  malectin/receptor-like kinase family protein          96.3    4e-19   
ref|XP_006604845.1|  PREDICTED: receptor-like protein kinase ANXU...  95.9    4e-19   
ref|XP_007217617.1|  hypothetical protein PRUPE_ppa016279mg           95.9    5e-19   
gb|KHN07118.1|  Receptor-like protein kinase FERONIA                  95.9    5e-19   
ref|XP_010258502.1|  PREDICTED: receptor-like protein kinase ANXUR1   95.9    5e-19   
ref|XP_003543886.1|  PREDICTED: receptor-like protein kinase FERO...  95.9    5e-19   
ref|XP_010660577.1|  PREDICTED: receptor-like protein kinase FERONIA  95.9    5e-19   
ref|XP_004962463.1|  PREDICTED: receptor-like protein kinase FERO...  95.9    6e-19   
ref|NP_001053685.1|  Os04g0586500                                     94.7    6e-19   
ref|XP_010435806.1|  PREDICTED: putative receptor-like protein ki...  95.5    6e-19   
gb|EAY95324.1|  hypothetical protein OsI_17151                        94.7    6e-19   
ref|XP_004240568.1|  PREDICTED: receptor-like protein kinase ANXUR1   95.5    6e-19   
ref|XP_006387808.1|  hypothetical protein POPTR_0554s00200g           95.1    7e-19   
ref|XP_009601576.1|  PREDICTED: receptor-like protein kinase ANXUR1   95.5    7e-19   
gb|KHN31469.1|  Receptor-like protein kinase ANXUR2                   95.5    8e-19   
ref|XP_003520841.1|  PREDICTED: receptor-like protein kinase ANXU...  95.5    8e-19   
ref|XP_003552590.2|  PREDICTED: receptor-like protein kinase FERO...  95.5    8e-19   
gb|KDP41349.1|  hypothetical protein JCGZ_15756                       94.7    8e-19   
ref|XP_002531275.1|  ATP binding protein, putative                    95.1    8e-19   
ref|XP_006593316.1|  PREDICTED: FERONIA receptor-like kinase isof...  95.1    9e-19   
ref|NP_001238431.1|  FERONIA receptor-like kinase precursor           95.1    9e-19   
emb|CDP21458.1|  unnamed protein product                              89.4    9e-19   
ref|XP_010230703.1|  PREDICTED: receptor-like protein kinase ANXUR1   95.5    9e-19   
ref|XP_006646366.1|  PREDICTED: receptor-like protein kinase FERO...  95.1    1e-18   
ref|XP_010660595.1|  PREDICTED: receptor-like protein kinase FERONIA  94.4    1e-18   
ref|XP_006654257.1|  PREDICTED: receptor-like protein kinase FERO...  95.1    1e-18   
gb|KHN07112.1|  Receptor-like protein kinase FERONIA                  94.7    1e-18   
gb|KJB80427.1|  hypothetical protein B456_013G096600                  94.7    1e-18   
emb|CDO98765.1|  unnamed protein product                              94.7    1e-18   
ref|XP_008668826.1|  PREDICTED: receptor-like protein kinase FERONIA  94.7    1e-18   
ref|XP_011009251.1|  PREDICTED: receptor-like protein kinase FERONIA  94.4    2e-18   
ref|XP_008388681.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  94.4    2e-18   
gb|KHN37916.1|  Receptor-like protein kinase FERONIA                  94.7    2e-18   
ref|XP_006593700.1|  PREDICTED: receptor-like protein kinase FERO...  94.4    2e-18   
gb|EEE63232.1|  hypothetical protein OsJ_18042                        94.4    2e-18   
ref|NP_001055180.1|  Os05g0317900                                     94.4    2e-18   
ref|XP_010485852.1|  PREDICTED: receptor-like protein kinase ANXUR1   94.4    2e-18   
gb|EEC78971.1|  hypothetical protein OsI_19445                        94.0    2e-18   
ref|XP_009785956.1|  PREDICTED: receptor-like protein kinase ANXUR1   94.0    2e-18   
ref|XP_011015035.1|  PREDICTED: receptor-like protein kinase FERONIA  94.0    2e-18   
ref|XP_010025009.1|  PREDICTED: receptor-like protein kinase ANXUR1   94.0    2e-18   
gb|EMT17367.1|  Receptor-like protein kinase FERONIA                  94.0    2e-18   
ref|XP_006405669.1|  hypothetical protein EUTSA_v10028032mg           92.8    2e-18   
gb|KJB28740.1|  hypothetical protein B456_005G067100                  94.0    2e-18   
ref|XP_008464586.1|  PREDICTED: receptor-like protein kinase FERONIA  94.0    3e-18   
gb|KHN47259.1|  Receptor-like protein kinase FERONIA                  94.0    3e-18   
ref|XP_006585798.1|  PREDICTED: receptor-like protein kinase FERO...  94.0    3e-18   
ref|XP_007216888.1|  hypothetical protein PRUPE_ppa020589mg           93.6    3e-18   
ref|XP_010417830.1|  PREDICTED: receptor-like protein kinase ANXUR1   93.6    3e-18   
ref|XP_003518179.1|  PREDICTED: receptor-like protein kinase FERO...  93.6    3e-18   
ref|XP_007216899.1|  hypothetical protein PRUPE_ppa019630mg           93.6    3e-18   
ref|XP_010463957.1|  PREDICTED: receptor-like protein kinase ANXUR1   93.6    3e-18   
ref|XP_004306059.2|  PREDICTED: receptor-like protein kinase FERO...  93.2    4e-18   
ref|XP_011467877.1|  PREDICTED: receptor-like protein kinase FERO...  93.2    4e-18   
ref|XP_006285704.1|  hypothetical protein CARUB_v10007175mg           93.2    4e-18   
ref|XP_010450844.1|  PREDICTED: putative receptor-like protein ki...  93.2    4e-18   
ref|XP_009360627.1|  PREDICTED: receptor-like protein kinase FERONIA  93.2    4e-18   
ref|XP_006595251.1|  PREDICTED: receptor-like protein kinase FERO...  92.8    5e-18   
gb|KHN04378.1|  Receptor-like protein kinase FERONIA                  92.8    5e-18   
ref|XP_006482014.1|  PREDICTED: receptor-like protein kinase FERO...  92.8    6e-18   
ref|XP_009372136.1|  PREDICTED: receptor-like protein kinase ANXUR2   90.9    6e-18   
ref|XP_008218280.1|  PREDICTED: receptor-like protein kinase ANXUR1   92.8    6e-18   
ref|NP_001241448.1|  receptor-like protein kinase FERONIA-like pr...  92.8    6e-18   
ref|XP_010441031.1|  PREDICTED: probable receptor-like protein ki...  92.4    7e-18   
ref|XP_006482013.1|  PREDICTED: receptor-like protein kinase FERO...  92.4    7e-18   
ref|XP_008390575.1|  PREDICTED: receptor-like protein kinase ANXUR1   90.9    7e-18   
ref|XP_008370712.1|  PREDICTED: receptor-like protein kinase ANXUR2   92.4    7e-18   
gb|AAV44117.1|  unknown protein                                       91.7    7e-18   
ref|XP_011013067.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  92.4    7e-18   
ref|XP_007032808.1|  Malectin/receptor-like protein kinase family...  92.4    7e-18   
ref|XP_010550913.1|  PREDICTED: receptor-like protein kinase ANXUR2   92.4    8e-18   
ref|XP_006395027.1|  hypothetical protein EUTSA_v10003639mg           92.4    8e-18   
ref|XP_008230911.1|  PREDICTED: receptor-like protein kinase FERONIA  92.4    9e-18   
ref|XP_007208221.1|  hypothetical protein PRUPE_ppa018611mg           92.4    9e-18   
ref|XP_008379440.1|  PREDICTED: receptor-like protein kinase FERONIA  92.4    9e-18   
ref|XP_010519979.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  92.0    9e-18   
ref|XP_002512044.1|  conserved hypothetical protein                   92.0    1e-17   
ref|XP_010435808.1|  PREDICTED: probable receptor-like protein ki...  92.0    1e-17   
ref|XP_008230912.1|  PREDICTED: receptor-like protein kinase FERONIA  92.0    1e-17   
ref|XP_009364589.1|  PREDICTED: receptor-like protein kinase ANXUR2   91.7    1e-17   
gb|EAY97520.1|  hypothetical protein OsI_19448                        91.7    1e-17   
ref|XP_004296245.1|  PREDICTED: receptor-like protein kinase ANXUR1   91.7    1e-17   
gb|EYU38426.1|  hypothetical protein MIMGU_mgv1a026661mg              89.7    1e-17   
ref|XP_003535370.1|  PREDICTED: receptor-like protein kinase ANXU...  91.7    1e-17   
ref|XP_007032813.1|  Malectin/receptor-like protein kinase family...  90.9    1e-17   
gb|KHN18064.1|  Receptor-like protein kinase ANXUR2                   91.7    1e-17   
ref|XP_008231022.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  91.7    1e-17   
gb|KHN14703.1|  Receptor-like protein kinase ANXUR1                   90.9    1e-17   
ref|XP_004306058.2|  PREDICTED: receptor-like protein kinase FERONIA  91.7    1e-17   
emb|CAN76103.1|  hypothetical protein VITISV_015218                   91.3    2e-17   
ref|XP_003633768.2|  PREDICTED: receptor-like protein kinase FERONIA  91.3    2e-17   
ref|XP_004495609.1|  PREDICTED: receptor-like protein kinase ANXU...  91.3    2e-17   
gb|KDP27273.1|  hypothetical protein JCGZ_19972                       91.3    2e-17   
emb|CDO99857.1|  unnamed protein product                              91.7    2e-17   
gb|KHN37921.1|  Receptor-like protein kinase FERONIA                  91.3    2e-17   
ref|XP_004494710.1|  PREDICTED: receptor-like protein kinase ANXU...  91.3    2e-17   
ref|XP_010660596.1|  PREDICTED: receptor-like protein kinase FERONIA  91.3    2e-17   
ref|XP_006286236.1|  hypothetical protein CARUB_v10007805mg           90.9    2e-17   
ref|XP_006430474.1|  hypothetical protein CICLE_v10011056mg           90.9    2e-17   
ref|XP_006289663.1|  hypothetical protein CARUB_v10003221mg           90.9    2e-17   
ref|XP_002457574.1|  hypothetical protein SORBIDRAFT_03g009660        90.9    2e-17   
ref|XP_008230910.1|  PREDICTED: receptor-like protein kinase FERONIA  90.9    2e-17   
ref|XP_002874434.1|  kinase family protein                            90.9    3e-17   
ref|XP_006606937.1|  PREDICTED: receptor-like protein kinase ANXU...  90.9    3e-17   
ref|XP_004304217.1|  PREDICTED: receptor-like protein kinase FERONIA  90.9    3e-17   
emb|CDO99859.1|  unnamed protein product                              90.9    3e-17   
ref|XP_010099331.1|  hypothetical protein L484_018194                 89.7    3e-17   
ref|XP_008367132.1|  PREDICTED: uncharacterized protein LOC103430767  90.9    3e-17   
ref|XP_002323908.2|  Pto-like kinase OGw family protein               90.5    3e-17   
ref|XP_010097803.1|  Receptor-like protein kinase FERONIA             90.5    3e-17   
ref|XP_008379865.1|  PREDICTED: receptor-like protein kinase FERONIA  90.5    3e-17   
gb|KHN07117.1|  Receptor-like protein kinase FERONIA                  90.1    4e-17   
gb|KHN37917.1|  Putative receptor-like protein kinase                 87.0    5e-17   
ref|NP_198220.1|  receptor-like protein kinase ANXUR2                 90.1    5e-17   
gb|EEE63231.1|  hypothetical protein OsJ_18041                        89.7    5e-17   
gb|KJB10587.1|  hypothetical protein B456_001G208900                  89.0    5e-17   
gb|KHN37920.1|  Receptor-like protein kinase FERONIA                  90.1    5e-17   
ref|XP_004156217.1|  PREDICTED: receptor-like protein kinase FERO...  89.7    5e-17   
ref|XP_007151348.1|  hypothetical protein PHAVU_004G038800g           89.7    6e-17   
ref|XP_004141590.1|  PREDICTED: receptor-like protein kinase FERO...  89.7    6e-17   
gb|KFK33634.1|  hypothetical protein AALP_AA5G039100                  89.0    6e-17   
ref|XP_006602953.1|  PREDICTED: receptor-like protein kinase FERO...  89.4    7e-17   
ref|XP_008459392.1|  PREDICTED: receptor-like protein kinase FERO...  89.4    7e-17   
gb|EMS57312.1|  Receptor-like protein kinase FERONIA                  89.4    7e-17   
gb|KGN52520.1|  hypothetical protein Csa_5G640540                     89.4    7e-17   
ref|XP_008459393.1|  PREDICTED: receptor-like protein kinase FERO...  89.4    8e-17   
emb|CDX88223.1|  BnaA06g28140D                                        89.4    8e-17   
ref|XP_008245502.1|  PREDICTED: receptor-like protein kinase FERONIA  87.4    9e-17   
ref|XP_007151356.1|  hypothetical protein PHAVU_004G039600g           89.0    1e-16   
ref|XP_009365907.1|  PREDICTED: receptor-like protein kinase FERONIA  89.0    1e-16   
ref|XP_008459390.1|  PREDICTED: receptor-like protein kinase FERONIA  86.3    1e-16   
dbj|BAD81103.1|  putative receptor-like protein kinase                89.0    1e-16   
tpg|DAA53962.1|  TPA: putative receptor-like protein kinase famil...  89.0    1e-16   
ref|XP_004499644.1|  PREDICTED: uncharacterized protein LOC101500653  88.2    1e-16   
ref|XP_010494105.1|  PREDICTED: receptor-like protein kinase ANXUR2   88.6    1e-16   
ref|XP_008655515.1|  PREDICTED: receptor-like protein kinase ANXUR1   88.6    1e-16   
ref|XP_004967845.1|  PREDICTED: receptor-like protein kinase FERO...  88.6    1e-16   
emb|CDY33885.1|  BnaA02g31020D                                        88.6    1e-16   
ref|XP_008341790.1|  PREDICTED: receptor-like protein kinase FERONIA  88.6    2e-16   
gb|KEH25125.1|  carbohydrate-binding protein of the ER protein        88.2    2e-16   
ref|XP_009129817.1|  PREDICTED: receptor-like protein kinase ANXUR2   88.6    2e-16   
ref|XP_010435807.1|  PREDICTED: putative receptor-like protein ki...  88.6    2e-16   
ref|XP_003552594.2|  PREDICTED: receptor-like protein kinase FERO...  88.6    2e-16   
ref|XP_009151130.1|  PREDICTED: probable receptor-like protein ki...  88.2    2e-16   
ref|XP_010455191.1|  PREDICTED: receptor-like protein kinase ANXUR2   88.2    2e-16   
gb|EEE54251.1|  hypothetical protein OsJ_01126                        88.6    2e-16   
gb|EEC70333.1|  hypothetical protein OsI_01206                        88.6    2e-16   
ref|XP_009373821.1|  PREDICTED: putative receptor-like protein ki...  88.2    2e-16   
ref|XP_010421701.1|  PREDICTED: receptor-like protein kinase ANXUR2   88.2    2e-16   
gb|KGN52521.1|  hypothetical protein Csa_5G640550                     87.4    2e-16   
emb|CDY05602.1|  BnaC02g39350D                                        88.2    2e-16   
ref|XP_007139451.1|  hypothetical protein PHAVU_008G030700g           87.8    2e-16   
gb|KHN07113.1|  Receptor-like protein kinase FERONIA                  87.8    3e-16   
ref|XP_010097778.1|  Receptor-like protein kinase                     87.8    3e-16   
ref|XP_007144836.1|  hypothetical protein PHAVU_007G188300g           87.8    3e-16   
ref|XP_008231018.1|  PREDICTED: receptor-like protein kinase FERONIA  87.8    3e-16   
dbj|BAJ93584.1|  predicted protein                                    87.8    3e-16   
ref|XP_010099322.1|  Receptor-like protein kinase FERONIA             87.8    3e-16   
ref|XP_006487877.1|  PREDICTED: receptor-like protein kinase ANXU...  87.8    3e-16   
emb|CDX86206.1|  BnaA06g29230D                                        87.4    3e-16   
ref|XP_009151260.1|  PREDICTED: receptor-like protein kinase ANXUR2   87.4    4e-16   
ref|XP_009140101.1|  PREDICTED: probable receptor-like protein ki...  87.4    4e-16   
gb|KJB10624.1|  hypothetical protein B456_001G211900                  87.0    4e-16   
emb|CDY48660.1|  BnaC07g27490D                                        86.3    6e-16   
ref|XP_010034409.1|  PREDICTED: receptor-like protein kinase FERONIA  86.7    6e-16   
ref|XP_002447169.1|  hypothetical protein SORBIDRAFT_06g029710        86.7    6e-16   
ref|XP_010102280.1|  Receptor-like protein kinase                     86.7    6e-16   
ref|XP_010441032.1|  PREDICTED: probable receptor-like protein ki...  86.7    7e-16   
ref|XP_004306062.1|  PREDICTED: receptor-like protein kinase FERONIA  86.3    7e-16   
gb|EMS60533.1|  Receptor-like protein kinase FERONIA                  86.3    8e-16   
gb|KEH24563.1|  malectin/receptor-like kinase family protein          86.3    8e-16   
ref|XP_006424004.1|  hypothetical protein CICLE_v10029897mg           86.3    8e-16   
ref|XP_010099328.1|  Receptor-like protein kinase FERONIA             86.3    1e-15   
ref|XP_007032800.1|  Malectin/receptor-like protein kinase family...  85.9    1e-15   
gb|KDO54400.1|  hypothetical protein CISIN_1g039107mg                 85.9    1e-15   
gb|EYU20621.1|  hypothetical protein MIMGU_mgv1a018196mg              85.9    1e-15   
ref|XP_007139448.1|  hypothetical protein PHAVU_008G030400g           85.9    1e-15   
ref|XP_010032549.1|  PREDICTED: receptor-like protein kinase FERONIA  85.9    1e-15   
emb|CDO99861.1|  unnamed protein product                              84.3    2e-15   
emb|CDO99867.1|  unnamed protein product                              85.5    2e-15   
gb|KCW52051.1|  hypothetical protein EUGRSUZ_J01491                   85.1    2e-15   
ref|XP_010034437.1|  PREDICTED: receptor-like protein kinase FERONIA  85.1    2e-15   
ref|XP_009365908.1|  PREDICTED: receptor-like protein kinase FERONIA  85.1    2e-15   
ref|XP_008223395.1|  PREDICTED: receptor-like protein kinase ANXUR2   84.0    2e-15   
ref|XP_009365902.1|  PREDICTED: receptor-like protein kinase FERO...  85.1    2e-15   



>ref|XP_011095158.1| PREDICTED: receptor-like protein kinase FERONIA [Sesamum indicum]
Length=883

 Score =   200 bits (509),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            DYVPTDKI LNCGGP   TD D RKWT+D+GSKF L T KSST++A  QKPSVP+VP+MT
Sbjct  29   DYVPTDKIFLNCGGPPDSTDSDGRKWTSDIGSKFALSTTKSSTATAAIQKPSVPEVPYMT  88

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR FQSEFTYSFPVASGRKF+RLYFYPASYNGLNA+N++FSV  G YTLL+NFSA  TTE
Sbjct  89   ARIFQSEFTYSFPVASGRKFVRLYFYPASYNGLNASNAIFSVTSGAYTLLRNFSAALTTE  148

Query  616  ALN  624
            ALN
Sbjct  149  ALN  151



>ref|XP_006341293.1| PREDICTED: receptor-like protein kinase FERONIA-like [Solanum 
tuberosum]
Length=889

 Score =   195 bits (495),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 106/123 (86%), Gaps = 1/123 (1%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            +YVP D ILLNCGGPD + D D RKW TD+GSK++LG+ KSSTS A  QKPSVPQVPFM+
Sbjct  29   NYVPGDDILLNCGGPDNLPDADGRKWGTDIGSKYMLGS-KSSTSDAADQKPSVPQVPFMS  87

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR FQSEFTYSFPVASGRKF+RLYFYP+SYN LNATN++F+V  G+YTLL+NFSA QT E
Sbjct  88   ARVFQSEFTYSFPVASGRKFVRLYFYPSSYNKLNATNAIFNVASGQYTLLRNFSAAQTAE  147

Query  616  ALN  624
            ALN
Sbjct  148  ALN  150



>ref|XP_004246282.1| PREDICTED: receptor-like protein kinase FERONIA [Solanum lycopersicum]
Length=889

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 104/123 (85%), Gaps = 1/123 (1%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            +YVP D ILLNCGGPD + D D RKW TDVGSK++LG+ KSS S A  QKPSVPQVPFM+
Sbjct  29   NYVPGDDILLNCGGPDNLPDADGRKWGTDVGSKYMLGS-KSSISDAADQKPSVPQVPFMS  87

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR FQSEFTYSFPVASGRKF+RLYFYP+SYN LNATN++F V  G+YTLL+NFSA QT E
Sbjct  88   ARVFQSEFTYSFPVASGRKFVRLYFYPSSYNKLNATNAIFDVASGQYTLLRNFSAAQTAE  147

Query  616  ALN  624
            ALN
Sbjct  148  ALN  150



>ref|XP_009791682.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana sylvestris]
Length=888

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = +1

Query  265  PTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTART  444
            P D ILLNCGGPDG+ D D RKW +D+GS +L G+ KSSTS A  QKPSVPQVPFM+AR 
Sbjct  32   PGDDILLNCGGPDGLKDADGRKWGSDIGSTYLKGS-KSSTSDAADQKPSVPQVPFMSARV  90

Query  445  FQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALN  624
            F+SEFTYSFPVA GRKF+RLYFYP+SYN LNATN++FSV VG Y+LL+NFSA QT EALN
Sbjct  91   FESEFTYSFPVAPGRKFVRLYFYPSSYNKLNATNAIFSVTVGPYSLLRNFSAAQTAEALN  150



>ref|XP_009617447.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana tomentosiformis]
Length=888

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = +1

Query  265  PTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTART  444
            P D ILLNCGGPDG+ D D RKW +D+GS +L G+ KSSTS A  QKPSVPQVPFM+AR 
Sbjct  32   PGDDILLNCGGPDGLKDADGRKWGSDIGSTYLKGS-KSSTSDAADQKPSVPQVPFMSARV  90

Query  445  FQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALN  624
            FQSEFTYSFPVA GRKF+RLYFYP+SYN LNATN++F V VG Y+LL+NFSA QT EALN
Sbjct  91   FQSEFTYSFPVAPGRKFVRLYFYPSSYNKLNATNAIFGVTVGPYSLLRNFSAAQTAEALN  150



>gb|KJB38065.1| hypothetical protein B456_006G235700 [Gossypium raimondii]
Length=895

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            DYVPT+KILLNCG    ++D DNRKWT DVGSKFL GT KS TS A SQ P+VP+VP+MT
Sbjct  31   DYVPTEKILLNCGEKSDLSDNDNRKWTPDVGSKFLTGTEKSVTSPASSQDPAVPEVPYMT  90

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F S FTYSFPV SGRKF+RLYFY  SY+G NATN++FSV  G YTLLKNFSA QT+E
Sbjct  91   ARVFHSNFTYSFPVVSGRKFVRLYFYANSYDGQNATNALFSVTSGSYTLLKNFSAAQTSE  150

Query  616  ALN  624
            ALN
Sbjct  151  ALN  153



>gb|KJB29840.1| hypothetical protein B456_005G120700 [Gossypium raimondii]
Length=889

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            DYVPT+KILLNCGG    TD DNRKWT DVGSKFLLG+G S  S A +Q P+VP+VP+MT
Sbjct  27   DYVPTEKILLNCGGKSEATDNDNRKWTPDVGSKFLLGSGNSVASQAATQDPAVPEVPYMT  86

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F+S FTYSFPV  GRKFLRLYFY  SY+G  A N++FSV  G YTLLKNFSA QT+E
Sbjct  87   ARVFRSNFTYSFPVVPGRKFLRLYFYANSYDGQIAANALFSVTCGSYTLLKNFSAAQTSE  146

Query  616  ALN  624
            ALN
Sbjct  147  ALN  149



>emb|CDX78012.1| BnaA09g32070D [Brassica napus]
Length=851

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            DY PTDKILLNCGG   +TD DNR W  DV SKFL  +G S TS A +Q PSVP VP+M+
Sbjct  30   DYTPTDKILLNCGGSSDLTDTDNRTWIPDVKSKFLSSSGDSKTSPAATQDPSVPTVPYMS  89

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F+S FTYSFPVASGRKF+RLYFYP SY+GLNATNS+FS+  G YTLLKNFSA QT++
Sbjct  90   ARIFRSPFTYSFPVASGRKFVRLYFYPNSYDGLNATNSLFSLSSGPYTLLKNFSAAQTSQ  149

Query  616  ALN  624
            ALN
Sbjct  150  ALN  152



>ref|XP_009115840.1| PREDICTED: receptor-like protein kinase FERONIA [Brassica rapa]
 ref|XP_009115841.1| PREDICTED: receptor-like protein kinase FERONIA [Brassica rapa]
Length=895

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            DY PTDKILLNCGG   +TD DNR W  DV SKFL  +G S TS A +Q PSVP VP+M+
Sbjct  30   DYTPTDKILLNCGGSSDLTDTDNRTWIQDVKSKFLSSSGDSKTSPAATQDPSVPTVPYMS  89

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F+S FTYSFPVASGRKF+RLYFYP SY+GLNATNS+FS+  G YTLLKNFSA QT++
Sbjct  90   ARIFRSPFTYSFPVASGRKFVRLYFYPNSYDGLNATNSLFSLSSGPYTLLKNFSAAQTSQ  149

Query  616  ALN  624
            ALN
Sbjct  150  ALN  152



>gb|AHZ44752.1| CrRLK1L-like protein, partial [Platanus x acerifolia]
Length=774

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            D++P DKILLNCG      D D RKWTTD+GSKF+     S  SSA +Q PSVP VPFMT
Sbjct  71   DFIPGDKILLNCGSAPETVDTDGRKWTTDIGSKFVAAGDNSLASSAATQDPSVPDVPFMT  130

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F+SEFTYSFPV SGRKF+RLYFYPASY+ LNA+N++FSV  G YTLL+NFSA QTTE
Sbjct  131  ARIFRSEFTYSFPVVSGRKFVRLYFYPASYDNLNASNAIFSVTSGSYTLLRNFSASQTTE  190

Query  616  ALN  624
            ALN
Sbjct  191  ALN  193



>emb|CDX73714.1| BnaC08g22890D [Brassica napus]
Length=1176

 Score =   181 bits (458),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            DY PTDKILLNCGG   +TD DNR W  DV SKFL  +G S TS A +Q PSVP VP+M+
Sbjct  342  DYTPTDKILLNCGGSSDLTDTDNRTWIPDVKSKFLSSSGDSKTSPAATQDPSVPTVPYMS  401

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F+S FTYSFPVASGRKF+RLYFYP SY+GLNATNS+FS+  G YTLLKNFSA QT++
Sbjct  402  ARIFRSPFTYSFPVASGRKFVRLYFYPNSYDGLNATNSLFSLSSGPYTLLKNFSAAQTSQ  461

Query  616  ALN  624
            ALN
Sbjct  462  ALN  464



>ref|XP_009337788.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
Length=893

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            +YVP+DKI LNCGGP   TD D  KWT+DVGSKF  G   S+TS+A +Q P+VP VPFMT
Sbjct  26   NYVPSDKIFLNCGGPPETTDSDGLKWTSDVGSKFASGGNSSTTSAAATQDPAVPDVPFMT  85

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F+S+FTY FPVASGRKF+RLYFYPASY+GLNA+N+VF+V    YT+LKNFS  QTTE
Sbjct  86   ARVFRSKFTYKFPVASGRKFIRLYFYPASYSGLNASNAVFTVTAQSYTILKNFSVAQTTE  145

Query  616  ALN  624
            AL+
Sbjct  146  ALD  148



>ref|XP_010244547.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=890

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  438
            Y PTDKILLNCG     TD D RKWT DVGSKF      + TS+A +Q PSVP VP+MTA
Sbjct  32   YFPTDKILLNCGAAQESTDSDGRKWTGDVGSKFAPAAANTLTSTAATQDPSVPDVPYMTA  91

Query  439  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEA  618
            R F+SEFTYSFPVASGRKF+RLYFYPASYNGLNA+N++FSV  G YTLLKNFS  QT EA
Sbjct  92   RVFRSEFTYSFPVASGRKFVRLYFYPASYNGLNASNALFSVTSGPYTLLKNFSVSQTAEA  151

Query  619  L  621
            L
Sbjct  152  L  152



>ref|XP_006403905.1| hypothetical protein EUTSA_v10010114mg [Eutrema salsugineum]
 gb|ESQ45358.1| hypothetical protein EUTSA_v10010114mg [Eutrema salsugineum]
Length=891

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            DY PTDKILLNCGG     D DNR W  DV SKFL  +G S TS A +Q PSVP+VPFMT
Sbjct  30   DYTPTDKILLNCGGSSDSADTDNRTWIPDVKSKFLSSSGDSKTSPAATQDPSVPEVPFMT  89

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F+S FTY+FPVA+GRKF+RLYFYP SY+GLNATNS+FSV  G YTLLKNFSA QT +
Sbjct  90   ARIFRSPFTYTFPVAAGRKFVRLYFYPNSYDGLNATNSLFSVSSGSYTLLKNFSASQTAQ  149

Query  616  AL  621
            AL
Sbjct  150  AL  151



>ref|XP_009370899.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
 ref|XP_009370904.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
Length=892

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            +YVP+DKI LNCGGP   TD +  KWT+DVGSKF  G   S+TS A +Q P+VP+VPFMT
Sbjct  26   NYVPSDKIFLNCGGPAETTDSNGVKWTSDVGSKFASGGNSSTTSPAATQDPAVPEVPFMT  85

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F+S+FTY FPVASGRKF+RLYFYPASY GLNA+N+VF+V    YT+LKNFS  QTTE
Sbjct  86   ARVFRSQFTYKFPVASGRKFIRLYFYPASYAGLNASNAVFTVAAQSYTILKNFSVAQTTE  145

Query  616  ALN  624
            AL+
Sbjct  146  ALD  148



>gb|ABT18097.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=891

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            DY PTDKILLNCGG   + D DNR W +DV SKFL  +G S TS A +Q PSV QVP+MT
Sbjct  30   DYSPTDKILLNCGGVSDLVDTDNRTWISDVKSKFLSSSGDSKTSPAATQDPSVSQVPYMT  89

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F+S FTYSFPVA+GRKF+RLYFYP +Y+GLNATN++FSV  G YTLLKNFSA QT E
Sbjct  90   ARVFRSPFTYSFPVAAGRKFVRLYFYPNTYDGLNATNALFSVSFGPYTLLKNFSAAQTAE  149

Query  616  AL  621
            AL
Sbjct  150  AL  151



>ref|XP_010252026.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=886

 Score =   176 bits (446),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  438
            YVPTDKILLNCG     TD D +KWT DVGSKF   T  +  S+A +Q PSVP VP+MTA
Sbjct  29   YVPTDKILLNCGSTSETTDTDGQKWTGDVGSKFAPSTANTLISTAATQGPSVPDVPYMTA  88

Query  439  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEA  618
            R F+SEFTY+FPVASGRKF+RLYFYPASYNGLNA+N++FSV  G YTLL NFSA QT EA
Sbjct  89   RIFRSEFTYTFPVASGRKFVRLYFYPASYNGLNASNALFSVTSGPYTLLNNFSASQTAEA  148

Query  619  LN  624
            +N
Sbjct  149  IN  150



>emb|CDP06378.1| unnamed protein product [Coffea canephora]
Length=889

 Score =   176 bits (446),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            +YVPTDKILL+CGGP   TD D RKW +D+GSKF L +  SS   A  QKPSVPQVP+M 
Sbjct  29   NYVPTDKILLSCGGPSQSTDIDGRKWYSDIGSKFALASSNSSVFPAAVQKPSVPQVPYMN  88

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR FQS +TY FPVA GRKF+RLYFYP SY GLNA+N++FSV  G + L+KNFSA QT E
Sbjct  89   ARIFQSNYTYRFPVAPGRKFIRLYFYPTSYGGLNASNAIFSVTAGRFMLMKNFSAAQTAE  148

Query  616  ALN  624
            ALN
Sbjct  149  ALN  151



>ref|XP_008244701.1| PREDICTED: receptor-like protein kinase FERONIA [Prunus mume]
Length=891

 Score =   176 bits (445),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 99/123 (80%), Gaps = 1/123 (1%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            +Y+P+DKI LNCGGP   TD D  KWT+D+GSKF  G   S+TS A +Q P+VP+VPFMT
Sbjct  28   NYIPSDKIFLNCGGPPETTDSDGLKWTSDIGSKFASG-ANSTTSPAATQDPAVPEVPFMT  86

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F+SE+TY FPVASGRKF+RLYFYPASY GLNA+N++F+V    YTLLKNFS  QTTE
Sbjct  87   ARVFRSEYTYKFPVASGRKFIRLYFYPASYAGLNASNAIFTVTAQSYTLLKNFSVAQTTE  146

Query  616  ALN  624
            AL+
Sbjct  147  ALD  149



>gb|ABT18095.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=891

 Score =   175 bits (444),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            DY PTDKILLNCGG   + D DNR W +DV SKFL  +G S TS A +Q PSV QVP+MT
Sbjct  30   DYSPTDKILLNCGGASDLVDTDNRTWISDVKSKFLSSSGDSKTSPAATQDPSVSQVPYMT  89

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F+S FTY FPVA+GRKF+RLYFYP +Y+GLNATN++FSV  G YTLLKNFSA QT E
Sbjct  90   ARVFRSPFTYPFPVAAGRKFVRLYFYPNTYDGLNATNALFSVSFGPYTLLKNFSAAQTAE  149

Query  616  AL  621
            AL
Sbjct  150  AL  151



>emb|CDX90645.1| BnaA03g41360D [Brassica napus]
Length=814

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 99/125 (79%), Gaps = 2/125 (2%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            DY PTDKILLNCGG   +TD DNR W  DV SKFL  +G S TS A +Q PSVP+VP+MT
Sbjct  30   DYTPTDKILLNCGGSSDLTDTDNRTWIPDVKSKFLSSSGDSKTSPAATQDPSVPEVPYMT  89

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVG--EYTLLKNFSAGQT  609
            AR F+S FTYSFPVASGRKF+RLYF+P SY+GLNAT S+FSV +G   YTLLKNFSA QT
Sbjct  90   ARIFRSPFTYSFPVASGRKFVRLYFHPNSYDGLNATTSLFSVTLGSSSYTLLKNFSAAQT  149

Query  610  TEALN  624
             +AL+
Sbjct  150  AQALS  154



>ref|XP_007033491.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY04417.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
Length=892

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 100/124 (81%), Gaps = 1/124 (1%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSST-SSADSQKPSVPQVPFM  432
            DYVPT+KILLNCG    +TD DNRKWT DVGSKFL+G G +S  S A +Q P+VP+VP++
Sbjct  28   DYVPTEKILLNCGEKSELTDDDNRKWTPDVGSKFLVGGGTNSVPSQAATQDPAVPEVPYL  87

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            TAR F S FTYSFPV +GRKF+RLYF+  SY+G NATN++FSV  G YTLLKNFSA QT+
Sbjct  88   TARVFLSNFTYSFPVVAGRKFVRLYFHANSYDGQNATNALFSVTCGSYTLLKNFSAAQTS  147

Query  613  EALN  624
            EALN
Sbjct  148  EALN  151



>ref|XP_010431249.1| PREDICTED: receptor-like protein kinase FERONIA [Camelina sativa]
Length=490

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 97/123 (79%), Gaps = 1/123 (1%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLG-TGKSSTSSADSQKPSVPQVPFM  432
            DY PT+KILLNCGG   + D DNR W +DV SKFL   +G S TS A +Q PSVP+VP+M
Sbjct  29   DYSPTEKILLNCGGASDLVDTDNRTWISDVKSKFLSSPSGDSKTSPALTQDPSVPEVPYM  88

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            TAR F+S FTY+FPVASGRKF+RLYFYP SY+ LNATNS+FSV  G YTLLKNFSA QT 
Sbjct  89   TARVFRSPFTYTFPVASGRKFVRLYFYPNSYDSLNATNSLFSVSSGPYTLLKNFSAAQTA  148

Query  613  EAL  621
            EAL
Sbjct  149  EAL  151



>ref|XP_009136619.1| PREDICTED: receptor-like protein kinase FERONIA [Brassica rapa]
Length=896

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            DY PTDKILLNCGG   +TD DNR W  DV SKFL  +G S TS A +Q PSVP+VP+MT
Sbjct  29   DYTPTDKILLNCGGSSDLTDTDNRTWIPDVKSKFLSSSGDSKTSPAATQDPSVPEVPYMT  88

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVG-EYTLLKNFSAGQTT  612
            AR F+S FTYSFPVASGRKF+RLYF+P SY+GLNAT S+FSV +G  YTLLKNFSA QT 
Sbjct  89   ARIFRSPFTYSFPVASGRKFVRLYFHPNSYDGLNATTSLFSVTLGSSYTLLKNFSAAQTA  148

Query  613  EALN  624
            +AL+
Sbjct  149  QALS  152



>emb|CDY29022.1| BnaC07g32280D [Brassica napus]
Length=803

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 98/124 (79%), Gaps = 1/124 (1%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            DY PTDKILLNCGG   +TD DNR W  DV SK    +G S TS A +Q PSVP+VP+MT
Sbjct  27   DYTPTDKILLNCGGSSDLTDTDNRTWIPDVKSKLFSSSGDSKTSPAATQDPSVPEVPYMT  86

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVG-EYTLLKNFSAGQTT  612
            AR F+S FTYSFPVASGRKF+RLYF+P SY+GLNATNS+FSV +G  YTLLKNFSA QT 
Sbjct  87   ARIFRSPFTYSFPVASGRKFVRLYFHPNSYDGLNATNSLFSVTLGSSYTLLKNFSAAQTA  146

Query  613  EALN  624
            +AL+
Sbjct  147  QALS  150



>gb|KJB71482.1| hypothetical protein B456_011G124900 [Gossypium raimondii]
Length=893

 Score =   174 bits (440),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            DYVPT+KILLNCG    +TD DNRKWT D GSKFL+GTG S  S A +Q P+VP+VP++T
Sbjct  31   DYVPTEKILLNCGEKSELTDNDNRKWTPDFGSKFLVGTGNSVISRAATQDPAVPEVPYLT  90

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F+S FTYSFPV +GRKF+RLYFY  SY+  N++N++FSV  G YTLLKNFSA QT+E
Sbjct  91   ARVFRSNFTYSFPVVAGRKFVRLYFYANSYDDRNSSNALFSVTSGSYTLLKNFSAAQTSE  150

Query  616  ALN  624
            A+N
Sbjct  151  AMN  153



>ref|XP_007208402.1| hypothetical protein PRUPE_ppa001164mg [Prunus persica]
 gb|EMJ09601.1| hypothetical protein PRUPE_ppa001164mg [Prunus persica]
Length=891

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 99/123 (80%), Gaps = 1/123 (1%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            +Y+P+DKI LNCGGP   TD +  KWT+D+GSKF  G   S+TS A +Q P+VP+VPFMT
Sbjct  28   NYIPSDKIFLNCGGPPETTDSNGLKWTSDIGSKFASG-ANSTTSPAATQDPAVPEVPFMT  86

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F+SE+TY FPVASGRKF+RLYFYPASY GLNA+N++F+V    YTLLKNFS  QTTE
Sbjct  87   ARVFRSEYTYKFPVASGRKFIRLYFYPASYAGLNASNAIFTVTAQSYTLLKNFSVAQTTE  146

Query  616  ALN  624
            AL+
Sbjct  147  ALD  149



>gb|KDO64141.1| hypothetical protein CISIN_1g036624mg [Citrus sinensis]
Length=893

 Score =   173 bits (439),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            DY+P+++ILLNCG    ++D D R WT D+GSKFLL T  S+TS A +Q PS P +P+MT
Sbjct  29   DYIPSEQILLNCGESSILSDDDKRSWTPDIGSKFLLSTKDSTTSKAATQDPSTPTIPYMT  88

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F+SEFTYSFPV +GRKF+RLYFYP SYN LNAT+++FSV  G YTLLKNFS  QT E
Sbjct  89   ARVFRSEFTYSFPVVAGRKFVRLYFYPNSYNRLNATDALFSVSTGPYTLLKNFSVAQTAE  148

Query  616  ALN  624
            ALN
Sbjct  149  ALN  151



>ref|XP_008370279.1| PREDICTED: receptor-like protein kinase FERONIA [Malus domestica]
Length=891

 Score =   173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            +YVP+DKI LNCGGP   TD    KWT+DVGSKF  G   S+TS A +Q P+VP+VPFMT
Sbjct  26   NYVPSDKIFLNCGGPAETTDSXGVKWTSDVGSKFASGGNSSTTSPAATQDPAVPEVPFMT  85

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F+S+FTY FPVASGRKF+RLYFYPASY  LNA+N+VF+V    YT+LKNFS  QTTE
Sbjct  86   ARVFRSQFTYKFPVASGRKFIRLYFYPASYAELNASNAVFTVTAQSYTILKNFSVAQTTE  145

Query  616  ALN  624
            AL+
Sbjct  146  ALD  148



>ref|XP_010252025.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=886

 Score =   173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  438
            YVPTDKILLNCG     TD D +KW+ DVGSKFL  +  + TS A +Q PSVP+VP+MTA
Sbjct  29   YVPTDKILLNCGAASETTDTDGQKWSGDVGSKFLPSSDNTLTSRAATQGPSVPEVPYMTA  88

Query  439  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEA  618
            R F SEFTY+FPV SGRKF+RLYFYP SYNGLN +N++FSV  G YTLL NFSA QT EA
Sbjct  89   RIFHSEFTYTFPVTSGRKFVRLYFYPTSYNGLNESNALFSVTSGPYTLLHNFSASQTAEA  148

Query  619  LN  624
            LN
Sbjct  149  LN  150



>gb|EPS73118.1| hypothetical protein M569_01631 [Genlisea aurea]
Length=873

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 98/124 (79%), Gaps = 1/124 (1%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSS-TSSADSQKPSVPQVPFM  432
            +YVPTDKI LNCGGP   TD DN+ WTTDV SKFL     +S T+SA  Q P VPQVP+M
Sbjct  27   NYVPTDKIFLNCGGPAVSTDSDNQTWTTDVLSKFLSSPSTNSLTASASVQLPDVPQVPYM  86

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            TAR F+SEFTYSFP+A+GRKFLRLYFYPASY GLNA+N +FSV  G YTLL NFSA  TT
Sbjct  87   TARIFKSEFTYSFPLAAGRKFLRLYFYPASYAGLNASNGIFSVSSGGYTLLNNFSAFITT  146

Query  613  EALN  624
            +ALN
Sbjct  147  QALN  150



>ref|XP_006429617.1| hypothetical protein CICLE_v10011034mg [Citrus clementina]
 ref|XP_006481221.1| PREDICTED: receptor-like protein kinase FERONIA-like [Citrus 
sinensis]
 gb|ESR42857.1| hypothetical protein CICLE_v10011034mg [Citrus clementina]
Length=895

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            DY+P+++ILLNCG    ++D D R WT D+GSKFLL T  S+TS A +Q PS P +P+MT
Sbjct  31   DYIPSEQILLNCGESSILSDDDKRSWTPDIGSKFLLSTKDSTTSKAATQDPSTPTIPYMT  90

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F+SEFTYSFPV +GRKF+RLYFYP SYN LNAT+++FSV  G +TLLKNFS  QT E
Sbjct  91   ARVFRSEFTYSFPVVAGRKFVRLYFYPNSYNRLNATDALFSVSTGPFTLLKNFSVAQTAE  150

Query  616  ALN  624
            ALN
Sbjct  151  ALN  153



>ref|XP_010426729.1| PREDICTED: receptor-like protein kinase FERONIA [Camelina sativa]
Length=894

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 97/123 (79%), Gaps = 1/123 (1%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLG-TGKSSTSSADSQKPSVPQVPFM  432
            DY PT+KILLNCGG   + D DNR W +DV SKFL   +G S TS A +Q PSVP+VP+M
Sbjct  29   DYSPTEKILLNCGGASDLVDTDNRTWISDVKSKFLSSPSGDSKTSPALTQDPSVPEVPYM  88

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            TAR F+S FTY+FPVASGRKF+RLYFYP SY+ LNATNS+FSV  G YTLLKNFSA QT 
Sbjct  89   TARVFRSPFTYTFPVASGRKFVRLYFYPNSYDSLNATNSLFSVSSGPYTLLKNFSAAQTA  148

Query  613  EAL  621
            EAL
Sbjct  149  EAL  151



>ref|XP_010503851.1| PREDICTED: receptor-like protein kinase FERONIA [Camelina sativa]
Length=895

 Score =   170 bits (430),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 96/123 (78%), Gaps = 1/123 (1%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLG-TGKSSTSSADSQKPSVPQVPFM  432
            DY PT+KILLNCGG   + D D R W  DV SKFL   +G S TS A +Q PSVP+VP+M
Sbjct  30   DYSPTEKILLNCGGASDLEDTDKRTWIPDVKSKFLSSPSGDSKTSPALTQDPSVPEVPYM  89

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            TAR F+S FTY+FPVASGRKF+RLYFYP SY+GLNATNS+FSV  G YTLLKNFSA QT 
Sbjct  90   TARVFRSPFTYTFPVASGRKFVRLYFYPNSYDGLNATNSLFSVSSGPYTLLKNFSAAQTA  149

Query  613  EAL  621
            EAL
Sbjct  150  EAL  152



>ref|XP_002528705.1| kinase, putative [Ricinus communis]
 gb|EEF33694.1| kinase, putative [Ricinus communis]
Length=891

 Score =   170 bits (430),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            +YVPTDKILL+CG      D D +KWT D  SKFLL +  S+ SSA +Q P+V Q+PFMT
Sbjct  26   NYVPTDKILLDCGATSDNADDDGQKWTADKNSKFLLSSDNSTISSAATQDPAVSQIPFMT  85

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F S FTYSFP+A+GRKF+RLYFYPASY+GLNA++++FSV  G YT+LKNFS  QTT+
Sbjct  86   ARVFHSNFTYSFPLAAGRKFVRLYFYPASYSGLNASDALFSVTAGSYTILKNFSVAQTTQ  145

Query  616  ALN  624
            ALN
Sbjct  146  ALN  148



>ref|XP_010515573.1| PREDICTED: receptor-like protein kinase FERONIA [Camelina sativa]
Length=896

 Score =   170 bits (430),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 96/123 (78%), Gaps = 1/123 (1%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLG-TGKSSTSSADSQKPSVPQVPFM  432
            DY PT+KILLNCGG   + D D R W  DV SKFL   +G S TS A +Q PSVP+VP+M
Sbjct  31   DYSPTEKILLNCGGASDLDDADKRTWIPDVKSKFLSSPSGDSKTSPALTQDPSVPEVPYM  90

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            TAR F+S FTY+FPVASGRKF+RLYFYP SY+GLNATNS+FSV  G YTLLKNFSA QT 
Sbjct  91   TARVFRSPFTYTFPVASGRKFVRLYFYPNSYDGLNATNSLFSVSSGPYTLLKNFSAAQTA  150

Query  613  EAL  621
            EAL
Sbjct  151  EAL  153



>emb|CDY16299.1| BnaC01g23340D [Brassica napus]
Length=866

 Score =   168 bits (425),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 93/122 (76%), Gaps = 0/122 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            DY PTD  LLNCGG   + D DNR W  DV SKFL  +  S TS A +Q PSVP VP+MT
Sbjct  31   DYSPTDNFLLNCGGSSDLPDTDNRTWIPDVKSKFLSSSADSKTSPAATQDPSVPDVPYMT  90

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F+S FTYSFPVA+GRKF+R +FYP SY+GLNATNS+FSV +G YTLLKNFSA QT +
Sbjct  91   ARIFRSPFTYSFPVAAGRKFVRFHFYPNSYDGLNATNSLFSVSLGSYTLLKNFSAAQTAQ  150

Query  616  AL  621
            AL
Sbjct  151  AL  152



>gb|ABT18094.1| FERONIA receptor-like kinase [Brassica oleracea]
Length=895

 Score =   168 bits (425),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 93/122 (76%), Gaps = 0/122 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            DY PTD   LNCGG   + D DNR W  DV SKFL  +  S TS A +Q PSVP VP+MT
Sbjct  29   DYSPTDNFFLNCGGSSDLPDTDNRTWIPDVKSKFLSSSADSKTSPAATQDPSVPDVPYMT  88

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F+S FTYSFPVA+GRKF+RL+FYP SY+GLNATNS+FSV +G YTLLKNFSA QT +
Sbjct  89   ARIFRSPFTYSFPVAAGRKFVRLHFYPNSYDGLNATNSLFSVSLGSYTLLKNFSAAQTAQ  148

Query  616  AL  621
            AL
Sbjct  149  AL  150



>emb|CDY33271.1| BnaA01g19380D [Brassica napus]
Length=856

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 93/122 (76%), Gaps = 0/122 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            DY PTD  LLNCGG   + D DNR W  DV SKFL  +  S TS A +Q PSVP VP+MT
Sbjct  27   DYSPTDNFLLNCGGSSDLPDTDNRTWIPDVKSKFLSSSADSKTSPAATQDPSVPDVPYMT  86

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F+S FTYSFPV+SGRKF+RL+FYP SY+GLNATNS+FSV +G YTLLKNFSA Q  +
Sbjct  87   ARIFRSPFTYSFPVSSGRKFVRLHFYPNSYDGLNATNSLFSVSLGSYTLLKNFSAAQMAQ  146

Query  616  AL  621
            AL
Sbjct  147  AL  148



>ref|XP_009148931.1| PREDICTED: receptor-like protein kinase FERONIA [Brassica rapa]
Length=899

 Score =   167 bits (424),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 93/122 (76%), Gaps = 0/122 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            DY PTD  LLNCGG   + D DNR W  DV SKFL  +  S TS A +Q PSVP VP+MT
Sbjct  31   DYSPTDNFLLNCGGSSDLPDTDNRTWIPDVKSKFLSSSADSKTSPAATQDPSVPDVPYMT  90

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F+S FTYSFPV+SGRKF+RL+FYP SY+GLNATNS+FSV +G YTLLKNFSA Q  +
Sbjct  91   ARIFRSPFTYSFPVSSGRKFVRLHFYPNSYDGLNATNSLFSVSLGSYTLLKNFSAAQMAQ  150

Query  616  AL  621
            AL
Sbjct  151  AL  152



>ref|XP_002279218.3| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=893

 Score =   167 bits (422),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            +YV TDKILLNCG     TD D   WTTD+GSKF++    S TS AD+Q PSVP VP+MT
Sbjct  27   NYVATDKILLNCGASSSTTDTDGLVWTTDIGSKFMVAAENSLTSEADTQDPSVPTVPYMT  86

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR  +SEF+Y FP+A GRKF+RLYFYPASY+ L+A++++FSV  G YTLLKNFS  QTTE
Sbjct  87   ARISKSEFSYRFPLAMGRKFVRLYFYPASYSNLSASDALFSVTAGSYTLLKNFSVAQTTE  146

Query  616  ALN  624
            ALN
Sbjct  147  ALN  149



>ref|XP_004302537.1| PREDICTED: receptor-like protein kinase FERONIA [Fragaria vesca 
subsp. vesca]
Length=883

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 96/123 (78%), Gaps = 1/123 (1%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            +Y+P+DKI LNCGGP   TD D +KWT+DVGSKF  G   S+TS A +Q PSVP+ PFMT
Sbjct  21   NYIPSDKIFLNCGGPQESTDADGQKWTSDVGSKFASG-ANSTTSPAATQDPSVPETPFMT  79

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F S++TY FPVASGR F+RL FYPASY GLNA+ +VFSV V  YT+LKNFS  QTTE
Sbjct  80   ARVFHSDYTYKFPVASGRIFVRLSFYPASYAGLNASGAVFSVMVESYTVLKNFSVVQTTE  139

Query  616  ALN  624
            AL+
Sbjct  140  ALD  142



>ref|XP_010529939.1| PREDICTED: receptor-like protein kinase FERONIA [Tarenaya hassleriana]
Length=892

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 92/122 (75%), Gaps = 0/122 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            D+ P DK LLNCG      D DNR W  DV SKFL  +G S  S A +Q PSVPQVP+MT
Sbjct  26   DFSPPDKFLLNCGESSEAFDTDNRTWIPDVKSKFLSSSGDSKASPASTQDPSVPQVPYMT  85

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F+S FTYSFPVASGRKF+RLYFYP SY+GLNAT+++FSV  G YTLLKNFSA QT +
Sbjct  86   ARVFRSSFTYSFPVASGRKFVRLYFYPNSYDGLNATDALFSVSFGPYTLLKNFSASQTAQ  145

Query  616  AL  621
            AL
Sbjct  146  AL  147



>ref|NP_001238686.1| receptor-like kinase [Glycine max]
 gb|ACM89482.1| receptor-like kinase [Glycine max]
Length=883

 Score =   165 bits (417),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            D+ P DKILLNCGGP   TD D R+WTTDVGSKF   T KS+TS A +Q P+VPQVP+MT
Sbjct  17   DFEPKDKILLNCGGPPSSTDTDGREWTTDVGSKFGSSTAKSATSPAATQDPAVPQVPYMT  76

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F + +TY+FPVASG KFLRL+FY ASY+ LNA++++F+V    YT+L+NFS  QTT 
Sbjct  77   ARVFHAPYTYTFPVASGWKFLRLHFYSASYSSLNASDALFAVAANSYTVLRNFSVAQTTL  136

Query  616  ALN  624
            ALN
Sbjct  137  ALN  139



>ref|NP_001237656.1| FERONIA receptor-like kinase precursor [Glycine max]
 gb|ACM89524.1| FERONIA receptor-like kinase [Glycine max]
Length=892

 Score =   164 bits (414),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            D+ PTDKILLNCGGP   TD D R+WTTD GSKF   T KS+TS A +Q P+VPQVP+MT
Sbjct  25   DFQPTDKILLNCGGPPSSTDTDGREWTTDNGSKFGSSTAKSATSPAATQDPAVPQVPYMT  84

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F + +TY+FPVASG KFLRL+FY ASY+ LNA++++F+V    YT+L+NFS  QTT 
Sbjct  85   ARVFHAPYTYTFPVASGWKFLRLHFYSASYSSLNASDALFAVAANSYTVLRNFSVAQTTL  144

Query  616  ALN  624
            ALN
Sbjct  145  ALN  147



>gb|KHN29489.1| Receptor-like protein kinase FERONIA [Glycine soja]
Length=896

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            D+ PTDKILLNCGGP   TD D R+WTTD GSKF   T KS+TS A +Q P+VPQVP+MT
Sbjct  29   DFQPTDKILLNCGGPPSSTDTDGREWTTDNGSKFGSSTAKSATSPAATQDPAVPQVPYMT  88

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F + +TY+FPVASG KFLRL+FY ASY+ LNA++++F+V    YT+L+NFS  QTT 
Sbjct  89   ARVFHAPYTYTFPVASGWKFLRLHFYSASYSSLNASDALFAVAANSYTVLRNFSVAQTTL  148

Query  616  ALN  624
            ALN
Sbjct  149  ALN  151



>gb|KHN40613.1| Receptor-like protein kinase FERONIA [Glycine soja]
Length=894

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            D+ P DKILLNCGGP   TD D R+WTTDVGSKF   T KS+TS A +Q P+VPQVP+MT
Sbjct  28   DFEPKDKILLNCGGPPSSTDTDGREWTTDVGSKFGSSTAKSATSPAATQDPAVPQVPYMT  87

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F + +TY+FPVASG KFLRL+FY ASY+ LNA++++F++    YT+L+NFS  QTT 
Sbjct  88   ARVFHAPYTYTFPVASGWKFLRLHFYSASYSSLNASDALFAMAANSYTVLRNFSVAQTTL  147

Query  616  ALN  624
            ALN
Sbjct  148  ALN  150



>ref|XP_004142677.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cucumis 
sativus]
 ref|XP_004161706.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cucumis 
sativus]
 gb|KGN54458.1| hypothetical protein Csa_4G334690 [Cucumis sativus]
Length=897

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            +Y+P D ILL+CGGP    D DNRKW TD  SKF+  TG SS S A +Q PSVP +PFMT
Sbjct  33   NYIPRDVILLDCGGPSTANDIDNRKWNTDDKSKFVPATGDSSVSKAATQDPSVPDIPFMT  92

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F S FTYSFPVA  R F+RLYFYP+SY GL+A++++FSV    YTLLKNFSA QT  
Sbjct  93   ARVFSSSFTYSFPVAPSRLFVRLYFYPSSYGGLDASDALFSVSTQSYTLLKNFSASQTAA  152

Query  616  ALN  624
            ALN
Sbjct  153  ALN  155



>gb|AAK59558.1| putative receptor-protein kinase [Arabidopsis thaliana]
Length=895

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 99/124 (80%), Gaps = 2/124 (2%)
 Frame = +1

Query  256  DYVPTDKILLNCGG-PDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS-ADSQKPSVPQVPF  429
            DY PT+KILLNCGG    +TD DNR W +DV SKFL  + + S +S A +Q PSVP+VP+
Sbjct  29   DYSPTEKILLNCGGGASNLTDTDNRIWISDVKSKFLSSSSEDSKTSPALTQDPSVPEVPY  88

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  609
            MTAR F+S FTY+FPVASGRKF+RLYFYP SY+GLNATNS+FSV  G YTLLKNFSA QT
Sbjct  89   MTARVFRSPFTYTFPVASGRKFVRLYFYPNSYDGLNATNSLFSVSFGPYTLLKNFSASQT  148

Query  610  TEAL  621
             EAL
Sbjct  149  AEAL  152



>gb|ABT18100.1| FERONIA receptor-like kinase [Arabidopsis thaliana]
Length=893

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 99/124 (80%), Gaps = 2/124 (2%)
 Frame = +1

Query  256  DYVPTDKILLNCGG-PDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS-ADSQKPSVPQVPF  429
            DY PT+KILLNCGG    +TD DNR W +DV SKFL  + + S +S A +Q PSVP+VP+
Sbjct  27   DYSPTEKILLNCGGGASNLTDTDNRIWISDVKSKFLSSSSEDSKTSPALTQDPSVPEVPY  86

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  609
            MTAR F+S FTY+FPVASGRKF+RLYFYP SY+GLNATNS+FSV  G YTLLKNFSA QT
Sbjct  87   MTARVFRSPFTYTFPVASGRKFVRLYFYPNSYDGLNATNSLFSVSFGPYTLLKNFSASQT  146

Query  610  TEAL  621
             EAL
Sbjct  147  AEAL  150



>ref|NP_190723.1| receptor-like protein kinase FERONIA [Arabidopsis thaliana]
 sp|Q9SCZ4.1|FERON_ARATH RecName: Full=Receptor-like protein kinase FERONIA; AltName: 
Full=Protein SIRENE; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB63019.1| receptor-protein kinase-like protein [Arabidopsis thaliana]
 gb|AEE78805.1| receptor-like protein kinase FERONIA [Arabidopsis thaliana]
Length=895

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 99/124 (80%), Gaps = 2/124 (2%)
 Frame = +1

Query  256  DYVPTDKILLNCGG-PDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS-ADSQKPSVPQVPF  429
            DY PT+KILLNCGG    +TD DNR W +DV SKFL  + + S +S A +Q PSVP+VP+
Sbjct  29   DYSPTEKILLNCGGGASNLTDTDNRIWISDVKSKFLSSSSEDSKTSPALTQDPSVPEVPY  88

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  609
            MTAR F+S FTY+FPVASGRKF+RLYFYP SY+GLNATNS+FSV  G YTLLKNFSA QT
Sbjct  89   MTARVFRSPFTYTFPVASGRKFVRLYFYPNSYDGLNATNSLFSVSFGPYTLLKNFSASQT  148

Query  610  TEAL  621
             EAL
Sbjct  149  AEAL  152



>ref|XP_010043538.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
 ref|XP_010043545.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
 gb|KCW88392.1| hypothetical protein EUGRSUZ_A00782 [Eucalyptus grandis]
Length=897

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            DY P D+ILL+CG     TD D + WT+++GSK    T  +  ++A +Q PSVPQVP+MT
Sbjct  31   DYKPADRILLDCGAASQTTDADGQVWTSEIGSKIPASTANAIMATAATQDPSVPQVPYMT  90

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR FQS FTYSFPVASGRKF+RLYFYP+ YN  NA+N++FSV    YTLLKNFS  QTTE
Sbjct  91   ARIFQSNFTYSFPVASGRKFVRLYFYPSVYNTYNASNAIFSVSAEGYTLLKNFSVAQTTE  150

Query  616  ALN  624
            ALN
Sbjct  151  ALN  153



>ref|XP_006290584.1| hypothetical protein CARUB_v10016673mg [Capsella rubella]
 gb|EOA23482.1| hypothetical protein CARUB_v10016673mg [Capsella rubella]
Length=892

 Score =   162 bits (410),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 96/123 (78%), Gaps = 1/123 (1%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS-ADSQKPSVPQVPFM  432
            DY PT+KILLNCGG   + D DNR W +DV SKFL  +   S +S A +Q PSVP+VP+M
Sbjct  27   DYSPTEKILLNCGGASDLRDTDNRTWISDVKSKFLSSSSGDSKTSPALTQDPSVPEVPYM  86

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            TAR F+S FTY+FPVASGRKF+RLYFYP SY+GLNATNS+FSV  G YTLLKNFS  QT 
Sbjct  87   TARVFRSPFTYTFPVASGRKFVRLYFYPNSYDGLNATNSLFSVSFGPYTLLKNFSVAQTA  146

Query  613  EAL  621
            +AL
Sbjct  147  DAL  149



>gb|KEH32083.1| feronia receptor-like kinase [Medicago truncatula]
Length=701

 Score =   160 bits (405),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            D+ PTDKILLNCGGP   TD D R+WTTD GSKF     KS+TS A +Q P+VPQ+PFMT
Sbjct  31   DFKPTDKILLNCGGPAVSTDPDGREWTTDNGSKFGSSAVKSTTSQAATQDPAVPQIPFMT  90

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR FQS +TYSFPVASG KFLRLYFY ASY GLNA+++ F V    YT+L+NFS  +T  
Sbjct  91   ARVFQSPYTYSFPVASGWKFLRLYFYSASYGGLNASDARFGVTAQSYTVLRNFSVSETAL  150

Query  616  ALN  624
             LN
Sbjct  151  GLN  153



>ref|XP_010098025.1| Receptor-like protein kinase FERONIA [Morus notabilis]
 gb|EXB74408.1| Receptor-like protein kinase FERONIA [Morus notabilis]
Length=888

 Score =   161 bits (408),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 93/123 (76%), Gaps = 2/123 (2%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            +YVP ++I LNCGGP    + D +KWT+D GS +L    KS+TS A SQ PSV  +PFMT
Sbjct  30   NYVPAEQIFLNCGGP--TEEADGKKWTSDKGSLYLSKAAKSTTSEASSQDPSVSTIPFMT  87

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR FQS+FTYS  VA GRKF+RLYFYP+SY+GLNA+N+VF V    YTLLKNFS  QTTE
Sbjct  88   ARVFQSDFTYSISVAPGRKFIRLYFYPSSYSGLNASNAVFDVTAQSYTLLKNFSVAQTTE  147

Query  616  ALN  624
            ALN
Sbjct  148  ALN  150



>ref|XP_004492579.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cicer arietinum]
Length=896

 Score =   161 bits (407),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            D+ PTDKILLNCGGP   +D D R+WTTD GSKF   TGKS+TS A +Q P+VPQVPFMT
Sbjct  28   DFKPTDKILLNCGGPAVSSDPDGREWTTDNGSKFGSLTGKSTTSQAAAQDPAVPQVPFMT  87

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR FQS++TYSFPVASG KFLRLYFY ASY+GLN +++ F V    Y++L NFS  +TT 
Sbjct  88   ARIFQSQYTYSFPVASGWKFLRLYFYAASYSGLNVSDARFGVTSQSYSVLSNFSVLETTL  147

Query  616  ALN  624
             LN
Sbjct  148  GLN  150



>ref|XP_007140079.1| hypothetical protein PHAVU_008G082400g [Phaseolus vulgaris]
 gb|ESW12073.1| hypothetical protein PHAVU_008G082400g [Phaseolus vulgaris]
Length=898

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 95/124 (77%), Gaps = 1/124 (1%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSST-SSADSQKPSVPQVPFM  432
            D+ PTD ILL+CGGP   TD D R WTTDVGSKF   + KS+T S A +Q P+VPQVP+M
Sbjct  28   DFQPTDNILLDCGGPSSSTDTDGRVWTTDVGSKFDSSSAKSTTVSPAATQDPAVPQVPYM  87

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            TAR F + FTY+FPVASG KFLRL+FYPASY+ LNA+++ F+V    YTLL+NFS  QTT
Sbjct  88   TARVFHAPFTYAFPVASGWKFLRLHFYPASYSNLNASDARFAVTANSYTLLRNFSVAQTT  147

Query  613  EALN  624
             ALN
Sbjct  148  LALN  151



>ref|XP_003609098.1| FERONIA receptor-like kinase [Medicago truncatula]
Length=893

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            D+ PTDKILLNCGGP   TD D R+WTTD GSKF     KS+TS A +Q P+VPQ+PFMT
Sbjct  25   DFKPTDKILLNCGGPAVSTDPDGREWTTDNGSKFGSSAVKSTTSQAATQDPAVPQIPFMT  84

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR FQS +TYSFPVASG KFLRLYFY ASY GLNA+++ F V    YT+L+NFS  +T  
Sbjct  85   ARVFQSPYTYSFPVASGWKFLRLYFYSASYGGLNASDARFGVTAQSYTVLRNFSVSETAL  144

Query  616  ALN  624
             LN
Sbjct  145  GLN  147



>gb|KEH23293.1| feronia receptor-like kinase [Medicago truncatula]
Length=899

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            D+ PTDKILLNCGGP   TD D R+WTTD GSKF     KS+TS A +Q P+VPQ+PFMT
Sbjct  31   DFKPTDKILLNCGGPAVSTDPDGREWTTDNGSKFGSSAVKSTTSQAATQDPAVPQIPFMT  90

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR FQS +TYSFPVASG KFLRLYFY ASY GLNA+++ F V    YT+L+NFS  +T  
Sbjct  91   ARVFQSPYTYSFPVASGWKFLRLYFYSASYGGLNASDARFGVTAQSYTVLRNFSVSETAL  150

Query  616  ALN  624
             LN
Sbjct  151  GLN  153



>gb|ABT18098.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=892

 Score =   159 bits (402),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 94/122 (77%), Gaps = 1/122 (1%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            DY+PTDKILLNCG     +D D R W+ D  +KFL  +G S TS A +Q PSV ++P+MT
Sbjct  32   DYIPTDKILLNCGASSNSSDADKRAWSADNINKFL-SSGDSKTSPAATQDPSVSEIPYMT  90

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR  +S FTYSFPVA+GRKF+RLYFYP +Y+GLNAT+++FSV  G YTLLKNFSA QT E
Sbjct  91   ARVSRSPFTYSFPVATGRKFVRLYFYPNTYDGLNATDALFSVSFGPYTLLKNFSAAQTAE  150

Query  616  AL  621
            AL
Sbjct  151  AL  152



>ref|XP_008463270.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
 ref|XP_008463271.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
 ref|XP_008463272.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
Length=897

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            +Y+P D ILL+CGGP    D D+RKW TD  SKF+   G S+ S A +Q PSVP +PFMT
Sbjct  33   NYIPRDVILLDCGGPSTANDIDSRKWNTDDKSKFVPAAGDSTVSKAATQDPSVPDIPFMT  92

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F S FTYSFPVA  R F+RLYFYP+SY GL+A++++FSV    YTLLKNFSA QT  
Sbjct  93   ARVFSSNFTYSFPVAPSRLFVRLYFYPSSYGGLDASDALFSVSTQSYTLLKNFSASQTAA  152

Query  616  ALN  624
            ALN
Sbjct  153  ALN  155



>ref|XP_002877809.1| hypothetical protein ARALYDRAFT_485507 [Arabidopsis lyrata subsp. 
lyrata]
 gb|ABT18096.1| FERONIA receptor-like kinase [Arabidopsis lyrata]
 gb|EFH54068.1| hypothetical protein ARALYDRAFT_485507 [Arabidopsis lyrata subsp. 
lyrata]
Length=891

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 97/123 (79%), Gaps = 1/123 (1%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS-ADSQKPSVPQVPFM  432
            DY PT+KILLNCGG   + D DNR W +DV SKFL  +   S +S A +Q PSVP+VP+M
Sbjct  26   DYSPTEKILLNCGGASDLVDTDNRTWISDVKSKFLSSSSSDSKTSPALTQDPSVPEVPYM  85

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            TAR F+S FTY+FPVASGRKF+RLYFYP SY+GLNATNS+FSV  G YTLLKNFSA QT 
Sbjct  86   TARVFRSPFTYTFPVASGRKFVRLYFYPNSYDGLNATNSLFSVSFGPYTLLKNFSAAQTA  145

Query  613  EAL  621
            EAL
Sbjct  146  EAL  148



>ref|XP_002308259.1| kinase family protein [Populus trichocarpa]
 gb|EEE91782.1| kinase family protein [Populus trichocarpa]
Length=893

 Score =   153 bits (386),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            +YVPT+KILL+CG     +D D R WT+D GS FL  +  SST++A +Q PSVPQVP++T
Sbjct  26   NYVPTEKILLDCGANSDQSDSDGRDWTSDRGSSFLSSSTNSSTATASTQDPSVPQVPYLT  85

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F+S FTYSFPV SGRKF+RLYFYP+SY+GLNA+N++FSV  G YTLL NFS  QT E
Sbjct  86   ARIFRSSFTYSFPVVSGRKFIRLYFYPSSYSGLNASNALFSVTAGSYTLLSNFSVAQTAE  145

Query  616  ALN  624
            ALN
Sbjct  146  ALN  148



>ref|XP_002323088.2| kinase family protein [Populus trichocarpa]
 gb|EEF04849.2| kinase family protein [Populus trichocarpa]
Length=894

 Score =   152 bits (385),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            +YVPT+K LL+CG    + D D R WT+D GS FL  +GKSST++A +Q P+VPQVP++T
Sbjct  29   NYVPTEKTLLDCGANSDLPDSDGRGWTSDKGSSFLSSSGKSSTATASTQDPAVPQVPYLT  88

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR FQS FTYSFPV SG KF+RLYFYP+SYNGLNA++++FSV  G YTLL NFS  QTT+
Sbjct  89   ARIFQSSFTYSFPVVSGHKFVRLYFYPSSYNGLNASDALFSVTAGSYTLLSNFSVAQTTD  148

Query  616  ALN  624
            ALN
Sbjct  149  ALN  151



>ref|XP_011001679.1| PREDICTED: receptor-like protein kinase FERONIA [Populus euphratica]
Length=894

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            +YVPT+K LL+CG      D D R WT+D GS FL  +GKSST++A +Q P+VPQVP++T
Sbjct  29   NYVPTEKTLLDCGANSDRPDSDGRDWTSDKGSSFLSSSGKSSTATASTQDPAVPQVPYLT  88

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR FQS FTYSFPV SG KF+RLYFYP+SYNGLNA++++FSV  G YTLL NFS  QTT+
Sbjct  89   ARIFQSNFTYSFPVISGHKFVRLYFYPSSYNGLNASDALFSVTAGSYTLLSNFSVAQTTD  148

Query  616  ALN  624
            ALN
Sbjct  149  ALN  151



>gb|EYU42039.1| hypothetical protein MIMGU_mgv1a001343mg [Erythranthe guttata]
Length=837

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            DYV TD+  LNCGGP   TD D RKWT+D+GSKF L T KSSTS A +QKPSVP+VP+MT
Sbjct  27   DYVATDQFFLNCGGPPDSTDPDGRKWTSDIGSKFALSTTKSSTSPAATQKPSVPEVPYMT  86

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNAT  543
            AR FQSEFTYSFPVA GRKF+RLYFYPA+YN LN T
Sbjct  87   ARIFQSEFTYSFPVAPGRKFVRLYFYPATYNVLNVT  122



>ref|XP_011016728.1| PREDICTED: receptor-like protein kinase FERONIA [Populus euphratica]
Length=893

 Score =   151 bits (381),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            +YVPT+KILL+CG      D D R WT+D GS FL  +  SST++A +Q PSVPQVP++T
Sbjct  26   NYVPTEKILLDCGANSDQPDSDGRDWTSDRGSSFLSSSANSSTATASTQDPSVPQVPYLT  85

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F+S FTYSFPV SGRKF+RLYFYP+SY+GLNA+N++FSV  G YTLL NFS  QT E
Sbjct  86   ARIFRSNFTYSFPVVSGRKFIRLYFYPSSYSGLNASNALFSVTSGSYTLLSNFSVAQTAE  145

Query  616  ALN  624
            ALN
Sbjct  146  ALN  148



>ref|XP_007140062.1| hypothetical protein PHAVU_008G081000g [Phaseolus vulgaris]
 gb|ESW12056.1| hypothetical protein PHAVU_008G081000g [Phaseolus vulgaris]
Length=899

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 97/124 (78%), Gaps = 1/124 (1%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS-ADSQKPSVPQVPFM  432
            D+ PTD ILL+CGGP   TD D R+WTTDVGSKF   + KS+T S A +Q P+VPQVP+M
Sbjct  28   DFQPTDNILLDCGGPPSSTDTDGREWTTDVGSKFDSSSSKSTTVSPAATQDPAVPQVPYM  87

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            TAR F + FTY+FPVASG KFLRL+FYPASY+ LNA+N++F+V    YTLL+NFS  QTT
Sbjct  88   TARVFHAPFTYAFPVASGWKFLRLHFYPASYSNLNASNALFAVTANSYTLLRNFSVAQTT  147

Query  613  EALN  624
             ALN
Sbjct  148  LALN  151



>ref|XP_010553161.1| PREDICTED: receptor-like protein kinase FERONIA [Tarenaya hassleriana]
Length=852

 Score =   149 bits (377),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 85/123 (69%), Gaps = 1/123 (1%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            DY P DKI L+CG     TD D R+W  DV SKFL   G S  + A +Q P VPQVPFMT
Sbjct  34   DYSPIDKIFLSCGESSQRTDSDQRQWIPDVNSKFL-SPGSSKPAKAATQDPGVPQVPFMT  92

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F S FTYSFPV  GRKFLRLYFY  SY+ LNAT+++FSV  G Y LL NFS  QT+E
Sbjct  93   ARIFHSAFTYSFPVEPGRKFLRLYFYANSYDALNATDALFSVSSGPYQLLHNFSVSQTSE  152

Query  616  ALN  624
            AL+
Sbjct  153  ALS  155



>gb|ABT18099.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=898

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 89/122 (73%), Gaps = 0/122 (0%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            +Y PTD+ILLNCG     +D D R W+ D  +KFL  +G S TS A +Q  SV ++P+MT
Sbjct  32   NYTPTDQILLNCGASSNSSDADKRAWSADDNNKFLSSSGDSKTSPAATQGSSVSEIPYMT  91

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR  QS FTYSF VA+GRK +RLYFYP++Y+GLNAT+ +FS   G YTLLKNFSA QT E
Sbjct  92   ARISQSPFTYSFSVAAGRKIVRLYFYPSTYDGLNATDGLFSFSFGPYTLLKNFSAAQTVE  151

Query  616  AL  621
            AL
Sbjct  152  AL  153



>ref|XP_010683454.1| PREDICTED: receptor-like protein kinase FERONIA [Beta vulgaris 
subsp. vulgaris]
Length=881

 Score =   147 bits (372),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 87/123 (71%), Gaps = 1/123 (1%)
 Frame = +1

Query  259  YVPTDKILLNCGGPD-GVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            Y P D ILLNCG  D   TD D R W +D GSKF+  T  SS ++A +Q P V +VP+MT
Sbjct  23   YTPHDNILLNCGASDRQSTDVDGRNWNSDDGSKFMSTTRGSSMATAATQAPDVGEVPYMT  82

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            AR F S FTYS  VA GRKFLRLYFYP +Y+G N+TN +FSV  G +TLL NFSA QTTE
Sbjct  83   ARIFDSNFTYSIAVAPGRKFLRLYFYPNTYSGRNSTNGIFSVTAGPFTLLSNFSAAQTTE  142

Query  616  ALN  624
            ALN
Sbjct  143  ALN  145



>ref|XP_004499818.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cicer arietinum]
Length=312

 Score =   131 bits (330),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 82/119 (69%), Gaps = 4/119 (3%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            ++ PT++ILLNCGG     D D R W+TD  S F  GTGKS+ S      P+VPQ+PFMT
Sbjct  23   NFKPTNEILLNCGGAS--LDLDGRSWSTDRASNF--GTGKSTMSEVAINDPAVPQIPFMT  78

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            AR F+S +TYSFPVASG  FLRLYFY ASY GLN +++ F V    YTLL NFS  +TT
Sbjct  79   ARIFESPYTYSFPVASGWIFLRLYFYAASYPGLNISDARFGVTSQSYTLLTNFSVLETT  137



>ref|XP_004499647.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cicer arietinum]
Length=575

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 84/119 (71%), Gaps = 2/119 (2%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            D+ PTD+ILL CGGP    + D R W+TD GS F   +GKS+ S   +  P VPQVPFMT
Sbjct  316  DFKPTDEILLYCGGPFLSLNLDGRSWSTDRGSNF--RSGKSTMSEVATNDPPVPQVPFMT  373

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            A+ F+S +TYSFPV SG  FLRLYFYPASY+GLN +++ F V    YTLL+NFS  +TT
Sbjct  374  AQIFESPYTYSFPVPSGWIFLRLYFYPASYSGLNISDTRFGVTSQSYTLLRNFSVLETT  432


 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +1

Query  346  GSKFLLGTGKSSTSSADSQKPSVPQVPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASY  525
            GS F  G+GKS+ S   +  P++PQVPFMTAR F+S +TYSF V+SG  FLRLYFYPASY
Sbjct  5    GSNF--GSGKSTMSVVATNDPAIPQVPFMTARIFESPYTYSFLVSSGWIFLRLYFYPASY  62

Query  526  NGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            +GLN +++ F V    YTLL+NF+  +TT
Sbjct  63   SGLNISDARFGVTSQSYTLLRNFNVLETT  91



>ref|XP_009118021.1| PREDICTED: receptor-like protein kinase FERONIA isoform X1 [Brassica 
rapa]
Length=808

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 86/119 (72%), Gaps = 1/119 (1%)
 Frame = +1

Query  271  DKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSV-PQVPFMTARTF  447
            +++LL CGG   V    NR W  D   K L  +G+S TS A +Q PSV P VP+M+AR F
Sbjct  22   EEVLLYCGGRVSVIGVGNRTWMPDQLFKCLSTSGESKTSPALTQDPSVVPSVPYMSARVF  81

Query  448  QSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALN  624
            +S FTYSFPVASGRKFLRLYFYP SY+GLNAT S+FS+  G YTLL+NFSA QT + ++
Sbjct  82   KSPFTYSFPVASGRKFLRLYFYPNSYDGLNATLSLFSLSSGPYTLLRNFSASQTVQEMS  140



>ref|XP_010667956.1| PREDICTED: receptor-like protein kinase FERONIA [Beta vulgaris 
subsp. vulgaris]
Length=412

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 84/124 (68%), Gaps = 1/124 (1%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDG-VTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFM  432
            D++  D ILLNCG  D   TD D R WT+D GSKFL  +  S  +SA ++ P V  +P+M
Sbjct  22   DFIAKDNILLNCGSFDAKTTDSDGRNWTSDNGSKFLQSSKGSFRASATTEAPDVGNIPYM  81

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            +AR F S  TYSFPV+ GR FLRLYFYP  Y+  N+ N+VFSV  G YTLL+NF+A QT 
Sbjct  82   SARIFHSNATYSFPVSPGRIFLRLYFYPNVYSRSNSANAVFSVTAGPYTLLRNFNASQTA  141

Query  613  EALN  624
            + L+
Sbjct  142  KKLD  145



>ref|XP_004499646.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cicer arietinum]
Length=1333

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 84/119 (71%), Gaps = 2/119 (2%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            D+ PTD+ILLNCGGP    D D R W+TD GS F  G+GKS+     +  P++PQVPFMT
Sbjct  18   DFKPTDEILLNCGGPILSLDLDGRSWSTDRGSNF--GSGKSNMLEVATNDPALPQVPFMT  75

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
             + F+S +TYSFPVASG  FLRLYFY ASY+GLN +++ F V    YTLL NFS  +TT
Sbjct  76   VQIFESPYTYSFPVASGWIFLRLYFYLASYSGLNISDARFGVTSQSYTLLWNFSVLETT  134


 Score = 89.7 bits (221),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 59/107 (55%), Gaps = 27/107 (25%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGV-------------------------TDQDNRKWTTDVGSKFL  360
            D+ PTD+ILLNCGGP  V                          D D R W+TD GS F 
Sbjct  633  DFKPTDEILLNCGGPILVWILMAVHGPLIVARILVLENPPCQSLDLDGRSWSTDRGSNF-  691

Query  361  LGTGKSSTSSADSQKPSVPQVPFMTARTFQSEFTYSFPVASGRKFLR  501
             G+GKS+ S   S  P+VPQ PFMTAR F+S +TYSFPVAS   FLR
Sbjct  692  -GSGKSTMSEVASNDPAVPQNPFMTARIFESPYTYSFPVASDWIFLR  737


 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 54/81 (67%), Gaps = 2/81 (2%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            D+ PT +ILL+CGGP    D D R  + D GS F  G+GKS+ S   +  P VPQVPFMT
Sbjct  354  DFKPTHEILLHCGGPILSLDLDGRSMSIDRGSNF--GSGKSTMSEVATNDPPVPQVPFMT  411

Query  436  ARTFQSEFTYSFPVASGRKFL  498
            AR F+S +TYSF VASG  FL
Sbjct  412  ARIFESPYTYSFLVASGWIFL  432



>ref|XP_004514615.1| PREDICTED: uncharacterized protein LOC101497599, partial [Cicer 
arietinum]
Length=1088

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 83/119 (70%), Gaps = 2/119 (2%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            D+  TD+ILLNCGGP    D D R W+TD GS F  G+GKS+ S   +   +VPQVPFMT
Sbjct  845  DFKHTDEILLNCGGPILSLDLDGRSWSTDRGSNF--GSGKSTMSEVATNDHAVPQVPFMT  902

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            AR F+S + YSF VA G  FLRLYFYPASY+GLN +++ F V    YTLL+NFS  +TT
Sbjct  903  ARIFESPYIYSFLVACGWIFLRLYFYPASYSGLNISDARFGVTSQSYTLLRNFSVLETT  961


 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 80/119 (67%), Gaps = 2/119 (2%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            D+ PTD+I+LNCG P    + D R W+T  GS F  G+GKS      +  P+VPQ PFMT
Sbjct  135  DFKPTDEIILNCGDPILSLNLDGRSWSTGCGSNF--GSGKSIMLEVATNDPAVPQNPFMT  192

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            AR F++ +TYSFPVASG  FLRLYFY ASY+ LN +++ F V    YTL +NFS  +TT
Sbjct  193  ARIFETPYTYSFPVASGWIFLRLYFYMASYSSLNISDARFGVTSQFYTLFRNFSVLETT  251



>ref|XP_009391670.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
Length=887

 Score =   130 bits (327),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 85/125 (68%), Gaps = 7/125 (6%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSK---FLLGTGKSSTSSADSQKPSVPQVPF  429
            YVP D ILL+CG     TD + R WT D GSK   FL G G     +A  Q  SVPQVP+
Sbjct  34   YVPRDHILLDCGASGQATDANGRSWTADSGSKYAPFLNGGG----FTAPLQDSSVPQVPY  89

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  609
            +TAR F S +TYSFP+ +GRKF+RL+FYP++Y+   A+++ FSV  G YTLL NFSA QT
Sbjct  90   LTARVFTSPYTYSFPLGAGRKFIRLHFYPSNYSNHAASDAFFSVTAGPYTLLHNFSAYQT  149

Query  610  TEALN  624
             +ALN
Sbjct  150  ADALN  154



>ref|XP_010247768.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=876

 Score =   130 bits (326),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 84/125 (67%), Gaps = 3/125 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGP-DGVTDQDNRKWTTDVGSKF--LLGTGKSSTSSADSQKPSVPQVPF  429
            Y P+DKI LNCG P + +T QD R WT D+GSK   L      S+ S  +Q PSVPQ+P+
Sbjct  26   YDPSDKIFLNCGAPPEVITAQDGRNWTGDIGSKLAPLASLINISSISQATQGPSVPQIPY  85

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  609
            +TAR F + FTY FPV++G KF+RL+F+PASY   N T ++F V  G YTLLKNFSA  T
Sbjct  86   LTARIFYAPFTYKFPVSAGPKFIRLHFFPASYAVANRTKALFDVSAGPYTLLKNFSASLT  145

Query  610  TEALN  624
             +  N
Sbjct  146  ADFFN  150



>ref|XP_004984479.1| PREDICTED: receptor-like protein kinase FERONIA-like [Setaria 
italica]
Length=884

 Score =   130 bits (326),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 81/121 (67%), Gaps = 0/121 (0%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  438
            +VP D ILL+CG      D D R W  D GSK+   +  ++ + A  Q PSVPQVP++TA
Sbjct  30   FVPRDDILLDCGAKGQGNDTDGRMWGGDEGSKYAPPSNLAAAAPASGQDPSVPQVPYLTA  89

Query  439  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEA  618
            R   S FTYSFP+  GRKFLRL+FYPA+Y+  +A + VFSV VG+ TLL NFSA QT  A
Sbjct  90   RVSASPFTYSFPLGPGRKFLRLHFYPANYSNRDAADGVFSVSVGKLTLLSNFSAYQTAAA  149

Query  619  L  621
            +
Sbjct  150  I  150



>ref|XP_008660180.1| PREDICTED: receptor-like protein kinase FERONIA [Zea mays]
 gb|AFW88468.1| putative receptor-like protein kinase family protein [Zea mays]
Length=888

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 82/125 (66%), Gaps = 4/125 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  438
            +VP D ILL+CG      D D R WT D GSKF      +S +SA  Q PSVPQVP++TA
Sbjct  27   FVPRDDILLDCGAKGQGNDTDGRVWTGDAGSKFAPPDNLASVASASGQDPSVPQVPYLTA  86

Query  439  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRV----GEYTLLKNFSAGQ  606
            R   S FTYSFP+  GRKFLRL+FYPA+Y+  +A + +FSV V    G+ TLL NFSA Q
Sbjct  87   RVSASPFTYSFPLGPGRKFLRLHFYPANYSNHDAADGLFSVSVAVPGGKLTLLSNFSAYQ  146

Query  607  TTEAL  621
            T  A+
Sbjct  147  TAAAI  151



>ref|XP_010246590.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=836

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 83/124 (67%), Gaps = 4/124 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGP-DGVTDQDNRKWTTDVGSKF--LLGTGKSSTSSADSQKPSVPQVPF  429
            Y P ++ILLNCG P   +  QD R WT DVGS F  +     S+TS+A  Q  SVPQ+P+
Sbjct  38   YTP-EEILLNCGSPLKSIQSQDGRNWTGDVGSNFAPMDRFNLSTTSTASQQDSSVPQIPY  96

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  609
            MTAR F S F Y+F V  G KF+RLYFYPASY+GL+ TN+ F V  G YTLL+NFSA  T
Sbjct  97   MTARVFHSPFVYTFLVQPGPKFIRLYFYPASYSGLDKTNAFFDVYAGSYTLLRNFSAFLT  156

Query  610  TEAL  621
             + L
Sbjct  157  ADTL  160



>gb|EMT17007.1| Receptor-like protein kinase FERONIA [Aegilops tauschii]
Length=890

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 85/124 (69%), Gaps = 4/124 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  438
            +VP D ILL+CG      D D R+W  D GSK+     K +++SA +Q PSVPQVP++TA
Sbjct  38   FVPRDDILLDCGATGKGNDTDGRQWDGDAGSKY--APPKLASASAGAQDPSVPQVPYLTA  95

Query  439  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRV--GEYTLLKNFSAGQTT  612
            R   + FTYSFP+  GRKFLRL+FYPA+Y+  NA ++ FSV V   + TLL NFSA QTT
Sbjct  96   RVSAAPFTYSFPLGPGRKFLRLHFYPANYSNRNAADAFFSVSVPAAKVTLLSNFSAYQTT  155

Query  613  EALN  624
             ALN
Sbjct  156  TALN  159



>emb|CDY26624.1| BnaA09g46530D [Brassica napus]
Length=1432

 Score =   128 bits (322),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 84/120 (70%), Gaps = 1/120 (1%)
 Frame = +1

Query  268  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSV-PQVPFMTART  444
             +++LL C G   V    NR W  D   K L  +G+S TS A +Q  SV P VP+M+AR 
Sbjct  12   CEEVLLYCSGGVSVIGVGNRTWMPDQLFKCLSTSGESKTSPALTQDSSVVPSVPYMSARV  71

Query  445  FQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALN  624
            F+S FTYSFPVASGRKFLRLYFYP SY+GLNAT S+FS+  G YTLL+NFSA QT + ++
Sbjct  72   FKSPFTYSFPVASGRKFLRLYFYPNSYDGLNATLSLFSLSSGPYTLLRNFSASQTVQEMS  131



>ref|XP_002467915.1| hypothetical protein SORBIDRAFT_01g036260 [Sorghum bicolor]
 gb|EER94913.1| hypothetical protein SORBIDRAFT_01g036260 [Sorghum bicolor]
Length=895

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 82/125 (66%), Gaps = 4/125 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  438
            +VP D ILL+CG      D D R WT D GSK+      +S +SA  Q PSVPQVP++TA
Sbjct  34   FVPRDDILLDCGAKGQGNDTDGRVWTGDAGSKYAPPDNLASVASASGQDPSVPQVPYLTA  93

Query  439  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRV----GEYTLLKNFSAGQ  606
            R   S FTYSFP+  GRKFLRL+FYPA+Y+  +A + +FSV V    G+ TLL NFSA Q
Sbjct  94   RVSASPFTYSFPLGPGRKFLRLHFYPANYSNRDAADGLFSVSVAIPGGKLTLLSNFSAYQ  153

Query  607  TTEAL  621
            T  A+
Sbjct  154  TAAAI  158



>ref|XP_008810848.1| PREDICTED: receptor-like protein kinase FERONIA [Phoenix dactylifera]
Length=891

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 84/125 (67%), Gaps = 7/125 (6%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF---LLGTGKSSTSSADSQKPSVPQVPF  429
            YVP D ILLNCG      D D R WT D GSK+   + G G +    A SQ  SVPQVP+
Sbjct  35   YVPRDNILLNCGASGQDKDTDGRIWTADAGSKYAPSINGVGLT----ASSQDSSVPQVPY  90

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  609
            +TAR F S +TY+FP+ +GRKF+RLYFYP++Y+G  A+++ FSV     TLL+NFSA  T
Sbjct  91   LTARFFTSPYTYTFPLGAGRKFIRLYFYPSNYSGHAASDAFFSVTAASSTLLQNFSAYLT  150

Query  610  TEALN  624
             +ALN
Sbjct  151  ADALN  155



>ref|XP_010938035.1| PREDICTED: receptor-like protein kinase FERONIA [Elaeis guineensis]
Length=891

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 85/125 (68%), Gaps = 7/125 (6%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF---LLGTGKSSTSSADSQKPSVPQVPF  429
            YVP D ILLNCG      D D R WT D GSK+   + G G +    A SQ  SVPQVP+
Sbjct  36   YVPRDNILLNCGASGQDKDTDGRIWTGDAGSKYAPSINGVGLT----APSQDSSVPQVPY  91

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  609
            +TAR F S +TY+FP+ +GRKF+RLYFYP++Y+   A+++ FSV  G +TLL+NFSA  T
Sbjct  92   LTARFFTSPYTYTFPLGAGRKFIRLYFYPSNYSDRAASDAFFSVTAGSHTLLQNFSAYLT  151

Query  610  TEALN  624
             +ALN
Sbjct  152  ADALN  156



>ref|XP_010250338.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=790

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 79/125 (63%), Gaps = 4/125 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFL----LGTGKSSTSSADSQKPSVPQVP  426
            Y P ++ILL+CG      D D R WT DVGS F       T   ST+ A  Q  SVP +P
Sbjct  39   YTPNEQILLDCGSSALKADGDGRNWTGDVGSDFATSARFNTSTVSTALALYQGSSVPLIP  98

Query  427  FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQ  606
            ++TAR F S FTY+FPVA+G K +RLYFYP SY+GL+ T + F V  G YTLL NFSA  
Sbjct  99   YVTARIFHSPFTYTFPVAAGPKLIRLYFYPVSYSGLDKTKAFFDVSAGPYTLLHNFSAFF  158

Query  607  TTEAL  621
            T EAL
Sbjct  159  TVEAL  163



>emb|CBI27305.3| unnamed protein product [Vitis vinifera]
Length=762

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 81/122 (66%), Gaps = 0/122 (0%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  438
            Y P + I L+CG     T  D RKWT+D GSKF+     +S+ S  S + SVP VP+MTA
Sbjct  139  YTPVENIALDCGSHGHSTAPDGRKWTSDTGSKFICSQLNASSISMASTQDSVPLVPYMTA  198

Query  439  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEA  618
            R F S+FTY+FP++ G KFLRL+F+PASY+ L+ +++ FSV    YTLL NFSA  T   
Sbjct  199  RIFTSQFTYAFPLSPGPKFLRLHFHPASYSNLDPSHAFFSVTANHYTLLHNFSAWLTAGF  258

Query  619  LN  624
            LN
Sbjct  259  LN  260



>ref|XP_002273707.2| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=924

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 81/122 (66%), Gaps = 0/122 (0%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  438
            Y P + I L+CG     T  D RKWT+D GSKF+     +S+ S  S + SVP VP+MTA
Sbjct  95   YTPVENIALDCGSHGHSTAPDGRKWTSDTGSKFICSQLNASSISMASTQDSVPLVPYMTA  154

Query  439  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEA  618
            R F S+FTY+FP++ G KFLRL+F+PASY+ L+ +++ FSV    YTLL NFSA  T   
Sbjct  155  RIFTSQFTYAFPLSPGPKFLRLHFHPASYSNLDPSHAFFSVTANHYTLLHNFSAWLTAGF  214

Query  619  LN  624
            LN
Sbjct  215  LN  216



>tpg|DAA45217.1| TPA: putative receptor-like protein kinase family protein [Zea 
mays]
Length=886

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 79/125 (63%), Gaps = 4/125 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  438
            +VP D I L+CG      D D R WT D GSK+      +S +SA  Q PSVPQVP++TA
Sbjct  27   FVPRDDIRLDCGAKGQGNDTDGRVWTGDAGSKYAPPDNLASVASASGQDPSVPQVPYLTA  86

Query  439  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRV----GEYTLLKNFSAGQ  606
            R   S FTYSFP+  GRKFLRL+FYPA+Y   +A + +FSV V    G  TLL NFSA Q
Sbjct  87   RVSASPFTYSFPLGPGRKFLRLHFYPANYTDRDAADGLFSVSVAAPGGNLTLLSNFSAYQ  146

Query  607  TTEAL  621
            T  A+
Sbjct  147  TAAAI  151



>gb|KDP27676.1| hypothetical protein JCGZ_20096 [Jatropha curcas]
Length=838

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 80/124 (65%), Gaps = 3/124 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVG--SKFL-LGTGKSSTSSADSQKPSVPQVPF  429
            Y PTD+ILLN G PDG    D R W +D    SK+  + +  S+ S A  Q PSV QVP+
Sbjct  27   YTPTDRILLNSGAPDGEQSMDGRNWESDADQQSKYCPMNSETSAASKASQQDPSVTQVPY  86

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  609
            MTAR  +S++T  FPV+ G KF+RLYFYP SY+GL+ + S FSV    YTLL NFSA  T
Sbjct  87   MTARIIRSKYTCMFPVSMGPKFIRLYFYPNSYSGLDTSTSFFSVTANGYTLLSNFSAHLT  146

Query  610  TEAL  621
              A+
Sbjct  147  VSAM  150



>ref|NP_001050022.1| Os03g0333200 [Oryza sativa Japonica Group]
 gb|ABF95782.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11936.1| Os03g0333200 [Oryza sativa Japonica Group]
 gb|EEE59005.1| hypothetical protein OsJ_10725 [Oryza sativa Japonica Group]
Length=893

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 85/124 (69%), Gaps = 4/124 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  438
            +VP D ILL+CG      D D R WT D GSK+L      + ++A +Q PSVPQVP++TA
Sbjct  41   FVPRDNILLDCGATGQANDTDGRLWTGDTGSKYL--PANLAAAAATAQDPSVPQVPYLTA  98

Query  439  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGE--YTLLKNFSAGQTT  612
            R   + FTYSFPV +GRKFLRL+FYPA+Y+  NA +++FSV + +   TLL NFSA QT 
Sbjct  99   RFSAAPFTYSFPVGAGRKFLRLHFYPANYSNRNAADALFSVSIPDPNITLLSNFSAYQTA  158

Query  613  EALN  624
             ALN
Sbjct  159  LALN  162



>gb|EEC75192.1| hypothetical protein OsI_11431 [Oryza sativa Indica Group]
Length=893

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 85/124 (69%), Gaps = 4/124 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  438
            +VP D ILL+CG      D D R WT D GSK+L      + ++A +Q PSVPQVP++TA
Sbjct  41   FVPRDNILLDCGATGQANDTDGRLWTGDTGSKYL--PANLAAAAATAQDPSVPQVPYLTA  98

Query  439  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGE--YTLLKNFSAGQTT  612
            R   + FTYSFPV +GRKFLRL+FYPA+Y+  NA +++FSV + +   TLL NFSA QT 
Sbjct  99   RFSAAPFTYSFPVGAGRKFLRLHFYPANYSNRNAADALFSVSIPDPNITLLSNFSAYQTA  158

Query  613  EALN  624
             ALN
Sbjct  159  LALN  162



>gb|KDP24658.1| hypothetical protein JCGZ_26517 [Jatropha curcas]
Length=264

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 76/123 (62%), Gaps = 2/123 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSST--SSADSQKPSVPQVPFM  432
            Y PT+  LLNCG     T  D R W +D  SKFL    + S+   +A  Q PSV QVPFM
Sbjct  44   YDPTEIFLLNCGASFDTTSLDGRNWVSDFNSKFLAFNSQISSLEYTASLQDPSVTQVPFM  103

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            TAR  QS+F Y FPV+ G KF+RLYFYP + + L+ + S FSV   +YTLL NFSA  T 
Sbjct  104  TARISQSKFIYVFPVSPGSKFVRLYFYPVASSNLDISKSFFSVEANDYTLLSNFSASLTV  163

Query  613  EAL  621
             A+
Sbjct  164  SAM  166



>gb|KJB10568.1| hypothetical protein B456_001G207900 [Gossypium raimondii]
Length=794

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 72/114 (63%), Gaps = 2/114 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  438
            Y+PTD ILLNCG     T  D R W  D     L     S +S+A  Q PSV QVP+MTA
Sbjct  24   YIPTDYILLNCGASSNTTSYDGRNWVAD--DDHLYANTSSFSSTASYQDPSVTQVPYMTA  81

Query  439  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSA  600
            R F+ EFTY FP++ G KFLRLYFYP  Y GL+ T+S FSV    YTLL NFSA
Sbjct  82   RFFRGEFTYKFPLSPGPKFLRLYFYPNQYPGLDITSSFFSVAANNYTLLSNFSA  135



>emb|CDP15786.1| unnamed protein product [Coffea canephora]
Length=517

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 76/117 (65%), Gaps = 3/117 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLG--TGKSSTSSADSQKPSVPQVPFM  432
            Y PTD IL+NCG     T  D R W  DVGSKFL       S   +A  Q  SV Q+PF+
Sbjct  26   YTPTDYILINCGSSSNATSTDGRHWEGDVGSKFLPNDVANISLADTATEQHSSVTQIPFL  85

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASY-NGLNATNSVFSVRVGEYTLLKNFSA  600
            TAR  +S+F+Y+FPV+ G KFLRLYFYP+SY +GLN + S F+V    YTLL NF+A
Sbjct  86   TARIIRSQFSYTFPVSPGEKFLRLYFYPSSYSSGLNTSESFFTVTANNYTLLSNFNA  142



>ref|XP_003557976.1| PREDICTED: receptor-like protein kinase FERONIA [Brachypodium 
distachyon]
Length=898

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 82/124 (66%), Gaps = 4/124 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  438
            +VP D ILL+CG      D D R+W  D GSK+      S+ + A  Q PSVPQVP++TA
Sbjct  45   FVPRDDILLDCGATGNGNDTDGREWGGDAGSKYAPANLGSAIAGA--QDPSVPQVPYLTA  102

Query  439  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRV--GEYTLLKNFSAGQTT  612
            R   + FTYSFP+  GRKFLRL+FYPA+Y+  NA ++ FSV V   + TLL NFSA QT+
Sbjct  103  RVSAAPFTYSFPLGPGRKFLRLHFYPANYSNRNAADAFFSVTVPAAKVTLLSNFSAYQTS  162

Query  613  EALN  624
             ALN
Sbjct  163  TALN  166



>ref|XP_009414253.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009414254.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
Length=887

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 81/125 (65%), Gaps = 8/125 (6%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF---LLGTGKSSTSSADSQKPSVPQVPF  429
            Y P D ILLNCG    VTD D   WT D GSK+   L G G     SA  Q PSV  VP+
Sbjct  33   YKPRDHILLNCGASGQVTDLDGLNWTGDAGSKYAPSLNGGG-----SAARQDPSVSSVPY  87

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  609
            +TAR F S +TY+FP+ +GR F+RL+FYP +Y+  +A+++ FSV  G YT L+NFSA  T
Sbjct  88   LTARVFTSPYTYTFPLGAGRIFIRLHFYPTTYSNHSASDAFFSVTSGHYTFLQNFSASLT  147

Query  610  TEALN  624
             +ALN
Sbjct  148  ADALN  152



>gb|EAY75971.1| hypothetical protein OsI_03893 [Oryza sativa Indica Group]
Length=859

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 81/124 (65%), Gaps = 4/124 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  438
            +VP D ILL+CG      D D R W+ D GSK+        ++SA  Q PSVPQVP++TA
Sbjct  44   FVPRDDILLDCGATGKGNDTDGRVWSGDAGSKY--APASLGSASAAGQDPSVPQVPYLTA  101

Query  439  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRV--GEYTLLKNFSAGQTT  612
            R   + FTYSFP+ +GRKFLRL+FYPA+Y+  +A ++ FSV V     TLL NFSA QT 
Sbjct  102  RVSAAPFTYSFPLGAGRKFLRLHFYPANYSSRDAADARFSVSVPAANVTLLSNFSAYQTA  161

Query  613  EALN  624
             ALN
Sbjct  162  TALN  165



>ref|NP_001044372.1| Os01g0769700 [Oryza sativa Japonica Group]
 dbj|BAB56062.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAD53342.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAF06286.1| Os01g0769700 [Oryza sativa Japonica Group]
 gb|EEE55446.1| hypothetical protein OsJ_03602 [Oryza sativa Japonica Group]
Length=896

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 81/124 (65%), Gaps = 4/124 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  438
            +VP D ILL+CG      D D R W+ D GSK+        ++SA  Q PSVPQVP++TA
Sbjct  44   FVPRDDILLDCGATGKGNDTDGRVWSGDAGSKY--APASLGSASAAGQDPSVPQVPYLTA  101

Query  439  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRV--GEYTLLKNFSAGQTT  612
            R   + FTYSFP+ +GRKFLRL+FYPA+Y+  +A ++ FSV V     TLL NFSA QT 
Sbjct  102  RVSAAPFTYSFPLGAGRKFLRLHFYPANYSSRDAADARFSVSVPAANVTLLSNFSAYQTA  161

Query  613  EALN  624
             ALN
Sbjct  162  TALN  165



>gb|KDP24662.1| hypothetical protein JCGZ_26521 [Jatropha curcas]
Length=740

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 79/123 (64%), Gaps = 2/123 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS--ADSQKPSVPQVPFM  432
            Y P D ILLNCG     T  D R W +D  SKF   T ++S+ +  A  Q  SV QVP+M
Sbjct  44   YTPPDIILLNCGESSLTTSPDGRNWVSDARSKFGASTSQNSSFAFKASRQDTSVTQVPYM  103

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            TAR F S+FTYSFPV+ G KF+RLYFYP +Y+ L+ + S FSV   +YTLL NFSA  T 
Sbjct  104  TARIFLSKFTYSFPVSLGSKFVRLYFYPVAYSNLDISKSFFSVEANDYTLLSNFSAFLTV  163

Query  613  EAL  621
             A+
Sbjct  164  SAM  166



>ref|XP_004499645.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cicer arietinum]
Length=415

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 70/98 (71%), Gaps = 2/98 (2%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  435
            D+ PTD+ILLNCGGP    D D   W+TD GS F  G+GKS+ S   +  P+VPQVPF+T
Sbjct  295  DFKPTDEILLNCGGPILSLDLDGSSWSTDRGSNF--GSGKSTMSEVATNDPAVPQVPFVT  352

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNS  549
            AR  +S +TYSFPV SG  FL LYFYPASY+ LN +N+
Sbjct  353  ARIIESPYTYSFPVVSGWTFLMLYFYPASYSSLNISNT  390


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 48/78 (62%), Gaps = 4/78 (5%)
 Frame = +1

Query  397  SQKPSVPQVPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSV--FSVRVG  570
            +  P+VPQVPFMTAR F+S +TYSFPVASG  FL  +  P +  G N    V  +S+++ 
Sbjct  25   TNDPAVPQVPFMTARIFESLYTYSFPVASGWIFLMNFSVPKTTLGSNDHYGVKEYSIQID  84

Query  571  EYTLLKNFSAGQTTEALN  624
              TL   F+   +T A+N
Sbjct  85   GGTLKVTFT--PSTAAIN  100



>gb|EMT27425.1| Receptor-like protein kinase FERONIA [Aegilops tauschii]
Length=841

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 82/124 (66%), Gaps = 4/124 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  438
            +VP D ILL+CG      D D R+W  D GSK+       +++ A +Q PSVPQVP++TA
Sbjct  22   FVPRDDILLDCGATGKGNDTDGREWRGDAGSKY--APPNLASADAGAQDPSVPQVPYLTA  79

Query  439  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRV--GEYTLLKNFSAGQTT  612
            R   + FTYSFP+  GRKFLRL+FYPA+Y+  +A ++ FSV V   + TLL NFSA QT 
Sbjct  80   RVSAAAFTYSFPLGPGRKFLRLHFYPANYSNRDAADAFFSVSVPAAKVTLLSNFSAYQTA  139

Query  613  EALN  624
             ALN
Sbjct  140  TALN  143



>ref|XP_006373375.1| hypothetical protein POPTR_0017s13190g, partial [Populus trichocarpa]
 gb|ERP51172.1| hypothetical protein POPTR_0017s13190g, partial [Populus trichocarpa]
Length=855

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 78/121 (64%), Gaps = 2/121 (2%)
 Frame = +1

Query  265  PTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTS--SADSQKPSVPQVPFMTA  438
            PTD ILLNCG    ++  D R W  D  SKF       ++S  +A +Q PSV QVP+MTA
Sbjct  33   PTDLILLNCGASSNLSSPDGRSWDGDSQSKFAASNPPETSSVFAASNQDPSVNQVPYMTA  92

Query  439  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEA  618
            R F S+FTY+FPV  G KF+RLYFYPASY+ L+ + S FS+   +Y LL NFSA  T  A
Sbjct  93   RIFHSKFTYTFPVLPGPKFVRLYFYPASYSNLDISTSYFSLSANDYELLNNFSASLTVSA  152

Query  619  L  621
            +
Sbjct  153  I  153



>ref|XP_006373380.1| hypothetical protein POPTR_0017s13240g [Populus trichocarpa]
 gb|ERP51177.1| hypothetical protein POPTR_0017s13240g [Populus trichocarpa]
Length=879

 Score =   121 bits (303),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 77/120 (64%), Gaps = 2/120 (2%)
 Frame = +1

Query  268  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTS--SADSQKPSVPQVPFMTAR  441
            TD ILLNCG    ++  D R W  D  SKF       ++S  +A +Q PSV QVP+MTAR
Sbjct  33   TDLILLNCGASSNLSSPDGRGWDGDSQSKFAASNPPEASSVFAASNQDPSVNQVPYMTAR  92

Query  442  TFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
             F S+FTY+FPV  G KF+RLYFYPASY+ L+ + S FS+R   Y LL NFSA  T  A+
Sbjct  93   IFHSKFTYTFPVLPGPKFVRLYFYPASYSNLDISTSYFSIRANNYQLLNNFSASLTVSAI  152



>ref|XP_008813242.1| PREDICTED: receptor-like protein kinase FERONIA [Phoenix dactylifera]
Length=894

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 81/125 (65%), Gaps = 7/125 (6%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF---LLGTGKSSTSSADSQKPSVPQVPF  429
            Y   DKI LNCG    VTD D   WT D GSK+   + G G    +SA SQ  SVPQ+P+
Sbjct  38   YNARDKIFLNCGASGQVTDTDGLNWTGDAGSKYAPSINGAG----ASASSQDSSVPQIPY  93

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  609
            MTAR F S +TY+FP+  G KF+RLYFYP++Y+   A+++ FSV  G  TLL+NFSA  T
Sbjct  94   MTARVFTSPYTYTFPLGPGGKFVRLYFYPSNYSSRAASDAFFSVTAGSNTLLQNFSAYLT  153

Query  610  TEALN  624
              ALN
Sbjct  154  ANALN  158



>ref|XP_006373370.1| hypothetical protein POPTR_0017s13150g [Populus trichocarpa]
 gb|ERP51167.1| hypothetical protein POPTR_0017s13150g [Populus trichocarpa]
Length=855

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 76/123 (62%), Gaps = 2/123 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTS--SADSQKPSVPQVPFM  432
            Y PTD ILLNCG    +   D R W  D  SKF       ++S   A +Q PSV QVP+M
Sbjct  29   YSPTDLILLNCGASSNLLSPDGRGWDGDSQSKFAASNPPEASSVFEASNQDPSVNQVPYM  88

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            TAR F S+FTY+FPV  G KF+RLYFYPASY+ L+ + S FS+    Y LL NFSA  T 
Sbjct  89   TARIFHSKFTYTFPVLPGPKFVRLYFYPASYSNLDISTSYFSLSANNYELLNNFSASLTV  148

Query  613  EAL  621
             A+
Sbjct  149  SAI  151



>gb|KDP27678.1| hypothetical protein JCGZ_20098 [Jatropha curcas]
Length=464

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 78/124 (63%), Gaps = 3/124 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVG--SKFL-LGTGKSSTSSADSQKPSVPQVPF  429
            Y PTD ILLN G P G    D RKW  D    SK+  + +  SS S A  Q PSV QVP+
Sbjct  27   YTPTDLILLNSGAPSGDQSMDRRKWEGDADQQSKYCPMNSETSSASKASQQDPSVTQVPY  86

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  609
            MTAR  +S++T  FPV+ G KF+RLYFYP SY+GL+ + S FSV    YTLL NFS+  T
Sbjct  87   MTARIIRSKYTCMFPVSMGPKFIRLYFYPNSYSGLDTSTSFFSVTANGYTLLSNFSSYLT  146

Query  610  TEAL  621
              A+
Sbjct  147  VSAM  150



>ref|XP_011021061.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA, partial [Populus euphratica]
Length=834

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 74/121 (61%), Gaps = 1/121 (1%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  438
            Y PTD ILLNCG    ++  D R W  D  SKF   +     S  DSQ PSV QVP+MTA
Sbjct  44   YSPTDLILLNCGASSNLSSPDGRSWDGDSQSKFA-ASNPPEASXCDSQDPSVNQVPYMTA  102

Query  439  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEA  618
            R F S+FTY+FPV  G KF+RLYFYPAS + L+ + S FS+    Y LL N SA  T  A
Sbjct  103  RIFHSKFTYTFPVLPGPKFVRLYFYPASDSNLDISTSYFSISANNYQLLNNCSASLTVSA  162

Query  619  L  621
            +
Sbjct  163  I  163



>ref|XP_010921184.1| PREDICTED: receptor-like protein kinase FERONIA [Elaeis guineensis]
Length=895

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 80/122 (66%), Gaps = 1/122 (1%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  438
            Y P DKILLNCG      D D R WT D  SK+      ++ + A SQ  SVPQVP+++ 
Sbjct  35   YQPRDKILLNCGFSGTANDTDGRTWTGDAASKYAPSMNGAAVT-ATSQDSSVPQVPYLSG  93

Query  439  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEA  618
            R F S +TY+FP+ +GRKF+RLYFYP++Y+   A+++ F+V    YTLL+NFSA  T  A
Sbjct  94   RVFTSPYTYTFPLGAGRKFIRLYFYPSNYSTHAASDAFFTVTADSYTLLQNFSAYLTAGA  153

Query  619  LN  624
            LN
Sbjct  154  LN  155



>ref|XP_006373383.1| hypothetical protein POPTR_0017s13270g [Populus trichocarpa]
 gb|ERP51180.1| hypothetical protein POPTR_0017s13270g [Populus trichocarpa]
Length=829

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 75/121 (62%), Gaps = 2/121 (2%)
 Frame = +1

Query  265  PTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTS--SADSQKPSVPQVPFMTA  438
            PTD ILLNCG    ++  D R W  D  SKF       ++S   A +  PSV QVP+MTA
Sbjct  41   PTDLILLNCGASSNLSSPDGRSWDGDSQSKFAASKPPEASSVFEASNHDPSVNQVPYMTA  100

Query  439  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEA  618
            R F S+FTY+FPV  G KF+RLYFYPASY+ L+ + S FS+    Y LL NFSA  T  A
Sbjct  101  RIFHSKFTYTFPVLPGPKFVRLYFYPASYSNLDISTSYFSISANNYQLLNNFSASLTVSA  160

Query  619  L  621
            +
Sbjct  161  I  161



>ref|XP_009412649.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412650.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
Length=889

 Score =   118 bits (296),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 82/125 (66%), Gaps = 7/125 (6%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKS---STSSADSQKPSVPQVPF  429
            YVP D ILLNCG      D D+R WT D GSK+    G S   +  +A  Q  SVPQVP+
Sbjct  33   YVPRDNILLNCGASGQAKDTDSRIWTGDTGSKY----GPSLNVAGLTASLQDSSVPQVPY  88

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  609
            MTAR F S +T+SFP+  GRK++RL+FYP +Y+   A++++FSV    +TLL NFSA  T
Sbjct  89   MTARVFTSPYTFSFPLGPGRKYIRLHFYPCNYSTHAASDALFSVTSDSHTLLSNFSAYLT  148

Query  610  TEALN  624
             ++LN
Sbjct  149  ADSLN  153



>gb|KDP24661.1| hypothetical protein JCGZ_26520 [Jatropha curcas]
Length=978

 Score =   119 bits (297),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 78/126 (62%), Gaps = 6/126 (5%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS----ADSQKPSVPQVP  426
            Y PT+ ILL+CG     T  D R W +D  SKF  G   S  SS    A  Q  SV QVP
Sbjct  205  YTPTEIILLSCGASSLTTSPDGRNWVSDARSKF--GASISLNSSFAFKASGQDTSVTQVP  262

Query  427  FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQ  606
            +MTAR F S+FTYSFPV+ G KF+RLYFYP +Y+ L+ + S FSV   +YTLL NFSA  
Sbjct  263  YMTARIFLSKFTYSFPVSPGSKFVRLYFYPVAYSNLDISKSFFSVEANDYTLLSNFSAFL  322

Query  607  TTEALN  624
            T  A+ 
Sbjct  323  TVSAMQ  328



>ref|XP_011009252.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA [Populus euphratica]
Length=744

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 73/120 (61%), Gaps = 1/120 (1%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  438
            Y PTD ILLNCG    ++  D R W  D  SKF   +     SS   Q PSV QVP+MTA
Sbjct  44   YSPTDLILLNCGASSNLSSPDGRSWDGDSQSKFA-ASNPPEASSVTXQDPSVNQVPYMTA  102

Query  439  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEA  618
            R F S+FTY+FPV  G KF+RLYFY ASY+ L+ + S FS+    Y LL NFSA  T  A
Sbjct  103  RIFHSKFTYTFPVLPGPKFVRLYFYRASYSNLDISTSYFSLSANNYKLLDNFSASLTVSA  162



>ref|XP_010660578.1| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=900

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 77/125 (62%), Gaps = 4/125 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF----LLGTGKSSTSSADSQKPSVPQVP  426
            Y PTD ILLNCG     T  D+R W  DVGSKF    LL     S  +  S   S+  VP
Sbjct  46   YYPTDIILLNCGSFGNSTALDDRGWMGDVGSKFTSSRLLNQTSVSAKAPHSHGFSIDPVP  105

Query  427  FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQ  606
            +MT R F+S+FTY+F V  G+KF+RL+FYPAS+ G   + + FSV+ G YTLL NFS   
Sbjct  106  YMTVRFFRSQFTYTFHVKPGQKFIRLHFYPASFPGFERSEAFFSVKAGPYTLLSNFSPSH  165

Query  607  TTEAL  621
            T +AL
Sbjct  166  TADAL  170



>ref|XP_010921463.1| PREDICTED: receptor-like protein kinase ANXUR2 [Elaeis guineensis]
Length=870

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 82/124 (66%), Gaps = 3/124 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMT  435
            Y P+D  L+NCG      D D RKW+ D  SKF + T  S+T++A SQ PS+P  VP+MT
Sbjct  26   YTPSDSFLVNCGSSSDAADADGRKWSADDTSKFGVSTKNSATATAASQDPSLPSAVPYMT  85

Query  436  ARTFQSEFTYSFPV-ASGRKFLRLYFYPASYNGLNATNSVFSVRV-GEYTLLKNFSAGQT  609
            AR F SE TY F V  + R ++RL+FYP++YNGL   NS F+V   G  TLL+NFSA  T
Sbjct  86   ARVFTSESTYKFSVNKTARHWIRLHFYPSTYNGLAPENSYFAVSASGGVTLLRNFSAYIT  145

Query  610  TEAL  621
            T+AL
Sbjct  146  TKAL  149



>ref|XP_009118022.1| PREDICTED: receptor-like protein kinase FERONIA isoform X2 [Brassica 
rapa]
Length=766

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 73/92 (79%), Gaps = 1/92 (1%)
 Frame = +1

Query  352  KFLLGTGKSSTSSADSQKPSV-PQVPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYN  528
            K L  +G+S TS A +Q PSV P VP+M+AR F+S FTYSFPVASGRKFLRLYFYP SY+
Sbjct  7    KCLSTSGESKTSPALTQDPSVVPSVPYMSARVFKSPFTYSFPVASGRKFLRLYFYPNSYD  66

Query  529  GLNATNSVFSVRVGEYTLLKNFSAGQTTEALN  624
            GLNAT S+FS+  G YTLL+NFSA QT + ++
Sbjct  67   GLNATLSLFSLSSGPYTLLRNFSASQTVQEMS  98



>ref|XP_011009253.1| PREDICTED: receptor-like protein kinase FERONIA [Populus euphratica]
Length=833

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 75/122 (61%), Gaps = 2/122 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGT--GKSSTSSADSQKPSVPQVPFM  432
            Y PTD+ILLNCG    +T  D R W  D  SKF        SS  +A +Q PS  QVP+M
Sbjct  45   YSPTDQILLNCGASSNLTSPDGRSWDGDSQSKFAASNPPEASSVFAASTQGPSGDQVPYM  104

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            TAR F S+FTY+FPV  G KF+RLYFY ASY+ L+ + S FS+    Y LL NFSA  T 
Sbjct  105  TARIFHSKFTYTFPVLPGPKFVRLYFYRASYSNLDISTSYFSLSANNYKLLDNFSASLTV  164

Query  613  EA  618
             A
Sbjct  165  SA  166



>emb|CDP05401.1| unnamed protein product [Coffea canephora]
Length=888

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 75/121 (62%), Gaps = 1/121 (1%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  438
            Y PTD IL+NCG     T  D R W  D GSKF      S +S+  +  PSV   PF+TA
Sbjct  26   YSPTDYILINCGTSSNATSADGRNWYGDAGSKFSPNDMASISSAVTATAPSVSGAPFLTA  85

Query  439  RTFQSEFTYSFPVASGRKFLRLYFYPASYNG-LNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            R  +S F+Y+FPV+ G+KF+RLYFYPASY+   NAT S F+V    YTLL NFSA  T  
Sbjct  86   RIIRSNFSYTFPVSPGKKFVRLYFYPASYSSDFNATESFFAVMANNYTLLSNFSAFLTVL  145

Query  616  A  618
            A
Sbjct  146  A  146



>ref|XP_009416326.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416327.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
Length=882

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 82/125 (66%), Gaps = 7/125 (6%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTS---SADSQKPSVPQVPF  429
            YVP D ILLNCG      D D++ WT D GSK+    G S  +   +A  Q  SVP+VP+
Sbjct  28   YVPRDYILLNCGASGKAIDTDSQTWTGDAGSKY----GPSLNAVGFTAPQQDSSVPEVPY  83

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  609
            +TAR F S +TYSFPV  GRK++RL+FYP++Y+   A+++ FSV    +TLL NFSA  T
Sbjct  84   LTARVFTSPYTYSFPVGPGRKYVRLHFYPSNYSNHVASDAFFSVTSDTHTLLSNFSAYLT  143

Query  610  TEALN  624
             ++LN
Sbjct  144  ADSLN  148



>gb|KJB10595.1| hypothetical protein B456_001G210100 [Gossypium raimondii]
Length=868

 Score =   115 bits (289),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 76/123 (62%), Gaps = 4/123 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF---LLGTGKSSTSSADSQKPSVPQVPF  429
            YVPTD I LNCG P  +   D R W  D  S F        KS    AD+Q  S   VP+
Sbjct  26   YVPTDNITLNCGAPTDLLANDGRSWAADKTSNFGPFESSHNKSQAYEADTQDGS-ETVPY  84

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  609
            MTAR  +SEF Y+FPV SG+KF+RLYF+PASY G + + + FSV+ G +TLLKNFSA   
Sbjct  85   MTARVSRSEFKYTFPVTSGQKFVRLYFHPASYEGNDRSKAFFSVKAGSFTLLKNFSASLV  144

Query  610  TEA  618
             ++
Sbjct  145  ADS  147



>ref|XP_007032827.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY03753.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=866

 Score =   115 bits (288),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 77/123 (63%), Gaps = 3/123 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDV-GSKFLLGTGKSST--SSADSQKPSVPQVPF  429
            Y+PTD ILL+CG     T  D R W  D   SKF     ++++  S+A  Q  SV ++P+
Sbjct  27   YIPTDNILLDCGAQSNTTSSDGRSWEADSDHSKFSAPNRENASFVSTASQQDSSVTRIPY  86

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  609
            MTAR F+SEFTY+FPV+ G KFLRLYFY A + GLN T S FSV     TLL NFSA  T
Sbjct  87   MTARIFRSEFTYNFPVSPGPKFLRLYFYSAEFPGLNVTTSFFSVNANNSTLLSNFSAYLT  146

Query  610  TEA  618
              A
Sbjct  147  ASA  149



>ref|XP_010660576.1| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=875

 Score =   115 bits (288),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 75/127 (59%), Gaps = 9/127 (7%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS------ADSQKPSVPQ  420
            Y PTD ILL+CG        D R W  D GSKF   +G S   +      A  Q PSV Q
Sbjct  35   YRPTDNILLDCGSSISKMSPDGRTWQGDQGSKF---SGTSDVQNSSSSSNAFRQDPSVEQ  91

Query  421  VPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSA  600
            VP+MTAR F S FTYSFPV+SG KF+R YFYP +Y+G N +   FSV  G YTLL NFSA
Sbjct  92   VPYMTARIFNSSFTYSFPVSSGPKFVRFYFYPTAYSGHNESEFFFSVTSGVYTLLSNFSA  151

Query  601  GQTTEAL  621
              T   +
Sbjct  152  SLTVAPM  158



>ref|XP_007032832.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY03758.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=807

 Score =   115 bits (288),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 71/116 (61%), Gaps = 2/116 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTS--SADSQKPSVPQVPFM  432
            Y PTD ILLNCG     T  D R W  D   K+     K+S+    A   +PSV +VP+M
Sbjct  26   YTPTDHILLNCGTSSNTTSLDGRNWVGDADYKYSSSISKASSFASKASDLEPSVTEVPYM  85

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSA  600
            TAR F  +FTY FPV+ G KFLRLYFYP  Y GL+ T S FSV    YTLL+NFSA
Sbjct  86   TARIFHGKFTYKFPVSPGPKFLRLYFYPNEYPGLDITTSFFSVTANNYTLLRNFSA  141



>gb|KDO53394.1| hypothetical protein CISIN_1g002533mg [Citrus sinensis]
Length=911

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 80/133 (60%), Gaps = 12/133 (9%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTG--KSSTSSADSQKPSVPQVPFM  432
            Y+PTD IL+ CG     T  D R W  D  SKF       KS TS A  Q+ SVPQVP+M
Sbjct  29   YIPTDYILIICGESSNTTSSDGRNWDGDAHSKFSSSNSATKSFTSRASFQENSVPQVPYM  88

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASY------NGLNATNSV----FSVRVGEYTL  582
            TAR F  EFTY+FPV+ G KFLRL+FYPA Y       GL+  +++    F+V   +YTL
Sbjct  89   TARVFPEEFTYTFPVSPGPKFLRLHFYPAPYLLGQQQGGLDNNDTISTSFFTVSANKYTL  148

Query  583  LKNFSAGQTTEAL  621
            L+NFSA  T  A+
Sbjct  149  LRNFSAHLTVSAI  161



>ref|XP_006427852.1| hypothetical protein CICLE_v10024830mg [Citrus clementina]
 ref|XP_006464563.1| PREDICTED: putative receptor-like protein kinase At5g39000-like 
[Citrus sinensis]
 gb|ESR41092.1| hypothetical protein CICLE_v10024830mg [Citrus clementina]
Length=911

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 80/133 (60%), Gaps = 12/133 (9%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTG--KSSTSSADSQKPSVPQVPFM  432
            Y+PTD IL+ CG     T  D R W  D  SKF       KS TS A  Q+ SVPQVP+M
Sbjct  29   YIPTDYILIICGESSNTTSSDGRNWDGDAHSKFSSSNSATKSFTSRASFQENSVPQVPYM  88

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASY------NGLNATNSV----FSVRVGEYTL  582
            TAR F  EFTY+FPV+ G KFLRL+FYPA Y       GL+  +++    F+V   +YTL
Sbjct  89   TARVFPEEFTYTFPVSPGPKFLRLHFYPAPYLLGQQQGGLDNNDTISTSFFTVSANKYTL  148

Query  583  LKNFSAGQTTEAL  621
            L+NFSA  T  A+
Sbjct  149  LRNFSAHLTVSAI  161



>ref|XP_009419820.1| PREDICTED: receptor-like protein kinase FERONIA isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=531

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 78/125 (62%), Gaps = 7/125 (6%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF---LLGTGKSSTSSADSQKPSVPQVPF  429
            YVP D ILLNCG     +  D R WT D G+++   L G G      A  Q PSV  VP+
Sbjct  31   YVPRDDILLNCGASGQASSFDGRSWTGDTGTRYAPSLNGDGFD----ALRQDPSVSTVPY  86

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  609
             TAR F S FTY FP+++GRKF+RL+FYP+ Y+    +++ FSV  G YTLL NFS+  T
Sbjct  87   STARVFTSPFTYRFPLSAGRKFIRLHFYPSDYSNHAVSDAFFSVTSGPYTLLHNFSSYLT  146

Query  610  TEALN  624
             +ALN
Sbjct  147  ADALN  151



>gb|KDP27270.1| hypothetical protein JCGZ_19969 [Jatropha curcas]
Length=831

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 78/119 (66%), Gaps = 5/119 (4%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF----LLGTGKSSTSSADSQKPSVPQVP  426
            YVPTD IL NCG     T  D RKWT D+ SKF       + KS ++ A  Q  SV  VP
Sbjct  33   YVPTDIILSNCGSSGQTTTGDGRKWTGDLNSKFGPVDHSNSTKSVSAIALRQGSSVASVP  92

Query  427  FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYN-GLNATNSVFSVRVGEYTLLKNFSA  600
            +MTAR  Q++FTY+FPV +G+KF+RL+FYP++Y  G N +   F V+ G +TLLKNFSA
Sbjct  93   YMTARISQTQFTYTFPVTAGQKFIRLFFYPSNYQGGFNKSKDFFDVKTGPFTLLKNFSA  151



>ref|XP_009419819.1| PREDICTED: receptor-like protein kinase FERONIA isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=545

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 78/125 (62%), Gaps = 7/125 (6%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF---LLGTGKSSTSSADSQKPSVPQVPF  429
            YVP D ILLNCG     +  D R WT D G+++   L G G      A  Q PSV  VP+
Sbjct  45   YVPRDDILLNCGASGQASSFDGRSWTGDTGTRYAPSLNGDGFD----ALRQDPSVSTVPY  100

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  609
             TAR F S FTY FP+++GRKF+RL+FYP+ Y+    +++ FSV  G YTLL NFS+  T
Sbjct  101  STARVFTSPFTYRFPLSAGRKFIRLHFYPSDYSNHAVSDAFFSVTSGPYTLLHNFSSYLT  160

Query  610  TEALN  624
             +ALN
Sbjct  161  ADALN  165



>emb|CAN77538.1| hypothetical protein VITISV_025026 [Vitis vinifera]
Length=853

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 75/127 (59%), Gaps = 9/127 (7%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS------ADSQKPSVPQ  420
            Y PTD ILL+CG        D R W  D GSKF   +G S   +      A  Q PSV Q
Sbjct  27   YRPTDNILLDCGSSINTKSPDGRTWQGDQGSKF---SGTSDVQNSSSSSKAFRQDPSVDQ  83

Query  421  VPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSA  600
            VP+MTAR F S FTYSFPV++G KF+R YFYP +Y+G N +   FSV  G YTLL NFSA
Sbjct  84   VPYMTARIFNSSFTYSFPVSAGPKFVRFYFYPTAYSGHNESEFFFSVTSGVYTLLSNFSA  143

Query  601  GQTTEAL  621
              T   +
Sbjct  144  SLTVAPM  150



>ref|XP_002277584.3| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=895

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 75/127 (59%), Gaps = 9/127 (7%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS------ADSQKPSVPQ  420
            Y PTD ILL+CG        D R W  D GSKF   +G S   +      A  Q PSV Q
Sbjct  35   YRPTDNILLDCGSSINTKSPDGRTWQGDQGSKF---SGTSDVQNSSSSSKAFRQDPSVDQ  91

Query  421  VPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSA  600
            VP+MTAR F S FTYSFPV++G KF+R YFYP +Y+G N +   FSV  G YTLL NFSA
Sbjct  92   VPYMTARIFNSSFTYSFPVSAGPKFVRFYFYPTAYSGHNESEFFFSVTSGVYTLLSNFSA  151

Query  601  GQTTEAL  621
              T   +
Sbjct  152  SLTVAPM  158



>emb|CBI21192.3| unnamed protein product [Vitis vinifera]
Length=974

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 75/127 (59%), Gaps = 9/127 (7%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS------ADSQKPSVPQ  420
            Y PTD ILL+CG        D R W  D GSKF   +G S   +      A  Q PSV Q
Sbjct  117  YRPTDNILLDCGSSINTKSPDGRTWQGDQGSKF---SGTSDVQNSSSSSKAFRQDPSVDQ  173

Query  421  VPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSA  600
            VP+MTAR F S FTYSFPV++G KF+R YFYP +Y+G N +   FSV  G YTLL NFSA
Sbjct  174  VPYMTARIFNSSFTYSFPVSAGPKFVRFYFYPTAYSGHNESEFFFSVTSGVYTLLSNFSA  233

Query  601  GQTTEAL  621
              T   +
Sbjct  234  SLTVAPM  240



>gb|KJB42940.1| hypothetical protein B456_007G175600 [Gossypium raimondii]
Length=891

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 75/118 (64%), Gaps = 4/118 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDG--VTDQDNRKWTTDVGSKFLLGTGKSSTSS--ADSQKPSVPQVP  426
            Y PTD ILL+CG P    +  +D RKW TD  SKF     ++++S+  A  Q  SV +VP
Sbjct  23   YTPTDYILLDCGAPSSSSLVSEDGRKWITDERSKFATSNSENASSNFRATRQDHSVTRVP  82

Query  427  FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSA  600
            +MTAR F  +FTYSFPV++G KFLR YFYP   +G +   S FSV    + LLKNFSA
Sbjct  83   YMTARVFHDKFTYSFPVSAGLKFLRFYFYPVQDSGFDGATSFFSVTANNHLLLKNFSA  140



>ref|XP_008809255.1| PREDICTED: receptor-like protein kinase ANXUR1 [Phoenix dactylifera]
Length=865

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 81/124 (65%), Gaps = 4/124 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPS-VPQVPFMT  435
            Y PTD ILLNCG     TD DNRKW  D GSK L  +G S+ + A  Q PS +  VP+MT
Sbjct  29   YTPTDSILLNCGSSADGTDADNRKWAADNGSK-LRPSGNSAAAQAAFQDPSLLSPVPYMT  87

Query  436  ARTFQSEFTYSFPVA-SGRKFLRLYFYPASYNGLNATNSVFSVRV-GEYTLLKNFSAGQT  609
            AR F SE TY F V+   R ++RL+FYP++YN LN  ++ FSV V G  TLL+NFSA  T
Sbjct  88   ARIFTSESTYKFAVSDKDRHWIRLHFYPSTYNNLNPEDAYFSVTVSGGITLLRNFSAHVT  147

Query  610  TEAL  621
             +AL
Sbjct  148  AQAL  151



>gb|KDP24278.1| hypothetical protein JCGZ_25574 [Jatropha curcas]
Length=845

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 78/124 (63%), Gaps = 3/124 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVG--SKFL-LGTGKSSTSSADSQKPSVPQVPF  429
            Y PTD ILLN G P G    D RKW +D    SK+  + +  SS S A  Q PSV  VP+
Sbjct  27   YTPTDLILLNSGAPYGKQSMDGRKWESDADKQSKYCPVNSETSSASKASQQDPSVTPVPY  86

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  609
            MTAR  +S++T  FPV+ G  F+RLYFYP +Y+GL+ + S FSV   +YTLL NFS+  T
Sbjct  87   MTARIIRSKYTCMFPVSVGPNFIRLYFYPTTYSGLDTSTSFFSVTANDYTLLSNFSSYLT  146

Query  610  TEAL  621
              A+
Sbjct  147  ASAM  150



>ref|XP_007032799.1| Malectin/receptor protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY03725.1| Malectin/receptor protein kinase family protein, putative [Theobroma 
cacao]
Length=888

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 78/128 (61%), Gaps = 8/128 (6%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTS------SADSQKPSVPQ  420
            YVPTD I LNCG        D R W  D  SKF  G  +SS +       AD+Q  SV  
Sbjct  30   YVPTDNITLNCGALSDSHGSDGRFWAGDKSSKF--GPVESSRTIPSAPYEADNQGGSVET  87

Query  421  VPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSA  600
            VP+MTAR   SEF YSFPV+ G+KF+RL+FYPASY   + + + FSV+ G +TLLKNFSA
Sbjct  88   VPYMTARVSSSEFKYSFPVSPGQKFVRLHFYPASYKKFDRSKAFFSVKAGSFTLLKNFSA  147

Query  601  GQTTEALN  624
                E+ N
Sbjct  148  FLVAESSN  155



>ref|XP_007032796.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY03722.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
Length=155

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 79/128 (62%), Gaps = 9/128 (7%)
 Frame = +1

Query  259  YVPTDKILLNCG----GPDGVTDQDNRKWTTDVGSKFLL---GTGKSSTSSADSQKPSVP  417
            Y P D I L+CG    G   V     RKWT D  SK  L    + KS  ++A SQ  S+ 
Sbjct  27   YTPPDNIALDCGSSTSGNSAVPG--GRKWTGDKDSKVALIEESSSKSVFATALSQSSSIL  84

Query  418  QVPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFS  597
            +VP++TAR   S+FTY FPV +G+KF+RL+FYPA Y G + + + FSV+VG Y+LL NFS
Sbjct  85   RVPYLTARISISQFTYVFPVTAGQKFIRLHFYPAQYQGFDRSKNFFSVKVGSYSLLNNFS  144

Query  598  AGQTTEAL  621
            A  T + L
Sbjct  145  ASLTAQYL  152



>ref|XP_002870806.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47065.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=478

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 75/123 (61%), Gaps = 4/123 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLG--TGKSSTSSADSQKPSVPQVPFM  432
            +VPTD  L NCG      D + R WT +   K L       S TS A  QK  V ++P+M
Sbjct  23   FVPTDVFLFNCGDTSNNVDNNGRNWTAE-DRKILSSNLVNASYTSEASYQKTGVSRIPYM  81

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASY-NGLNATNSVFSVRVGEYTLLKNFSAGQT  609
             AR F+SEFTYSFPV  G KFLRLYFYP  Y +G +A NS  SV+V  +TLL+NF+A  T
Sbjct  82   KARIFRSEFTYSFPVTPGWKFLRLYFYPTQYKSGFDAVNSFVSVKVSGFTLLRNFNADIT  141

Query  610  TEA  618
             +A
Sbjct  142  VQA  144



>emb|CDP19885.1| unnamed protein product [Coffea canephora]
Length=895

 Score =   113 bits (282),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 76/124 (61%), Gaps = 5/124 (4%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFL---LGTGKSSTSSADSQKPSVPQVPF  429
            Y PTD IL+NCG     T  D R W  D GSKF    + T  SS  +A  Q PSV   P+
Sbjct  26   YSPTDYILINCGTSSNATSADGRNWYGDAGSKFSPNDMAT-ISSAVTAIEQDPSVSGAPY  84

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNG-LNATNSVFSVRVGEYTLLKNFSAGQ  606
            + AR  +S F+Y+FPV+ G+KF+RLYFYPASY+   NAT S F+V    YTLL NFSA  
Sbjct  85   LNARIIRSNFSYTFPVSPGKKFVRLYFYPASYSSDFNATESFFAVMANNYTLLSNFSAFL  144

Query  607  TTEA  618
            T  A
Sbjct  145  TVSA  148



>dbj|BAK00988.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=507

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 72/118 (61%), Gaps = 1/118 (1%)
 Frame = +1

Query  274  KILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQ  450
            ++ L+CG P   TD D R W  D  SKFL  T     + A  Q PS+P  VP++TAR F 
Sbjct  36   QVRLSCGAPASATDSDGRAWDGDSASKFLPSTNAGVAARASYQDPSLPSSVPYVTARVFA  95

Query  451  SEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALN  624
            S  TY+FP+  GR FLRLYFYPA Y   +A  ++F V  G  TLL++F+A QT  AL+
Sbjct  96   SSHTYTFPLRPGRVFLRLYFYPADYGNHSAYGALFGVTAGGVTLLRDFNASQTALALD  153



>ref|NP_198719.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 sp|Q9FID5.1|Y5393_ARATH RecName: Full=Probable receptor-like protein kinase At5g39030; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10827.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AED94389.1| putative receptor-like protein kinase [Arabidopsis thaliana]
Length=806

 Score =   112 bits (281),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 78/123 (63%), Gaps = 3/123 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPS--VPQVPFM  432
            Y P D  L+NCG  D   D   R WT +  +     +  +S SS  S K    +PQVP+M
Sbjct  21   YKPDDVFLINCGETDVPFDNHGRTWTQEEKNILPKNSDNASFSSVVSYKEESGIPQVPYM  80

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASY-NGLNATNSVFSVRVGEYTLLKNFSAGQT  609
            TAR F+S+FTYSFPV+ G KFLRLYFYP SY +G +A NS  SV V ++TLL+NFSA  T
Sbjct  81   TARIFRSDFTYSFPVSPGWKFLRLYFYPTSYKSGFDAVNSFVSVTVNDFTLLQNFSADLT  140

Query  610  TEA  618
             +A
Sbjct  141  VKA  143



>ref|XP_002530995.1| kinase, putative [Ricinus communis]
 gb|EEF31383.1| kinase, putative [Ricinus communis]
Length=888

 Score =   112 bits (281),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 73/121 (60%), Gaps = 2/121 (2%)
 Frame = +1

Query  265  PTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSST--SSADSQKPSVPQVPFMTA  438
            P D ILLNCG     T  D R W  D  SKFL    ++++   SA  + PS  +VP+M A
Sbjct  25   PADLILLNCGTSSSATSLDGRGWDGDAQSKFLASNSETASYGCSASQRDPSATEVPYMDA  84

Query  439  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEA  618
            R  QS+FTY FPV+ G KF+RLYFYP  Y+ L  + S FSV   +YTLL+NFSA     A
Sbjct  85   RVSQSKFTYLFPVSPGSKFVRLYFYPTKYSDLEISKSFFSVTANDYTLLRNFSAYLAVSA  144

Query  619  L  621
            +
Sbjct  145  M  145



>emb|CDY36996.1| BnaC06g12670D [Brassica napus]
Length=872

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 78/122 (64%), Gaps = 3/122 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS-ADSQKPSVPQVPFMT  435
            YVP D  L NCG    V+D+  R WT +        +G +S SS A  Q+  VP VP+ T
Sbjct  26   YVPIDLFLFNCGANSDVSDR-GRNWTAENRKTLPSNSGDASFSSDASFQESGVPLVPYKT  84

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASY-NGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            AR F+S+FTYSFPV+ G KFLRLYFYP  Y +G +A NS FSV V  +TLLKNFSA  T 
Sbjct  85   ARIFRSDFTYSFPVSPGWKFLRLYFYPTRYGSGFDAVNSFFSVNVNGFTLLKNFSADLTV  144

Query  613  EA  618
            +A
Sbjct  145  KA  146



>ref|XP_007045781.1| Malectin/receptor-like protein kinase family protein, putative 
isoform 1 [Theobroma cacao]
 ref|XP_007045782.1| Malectin/receptor-like protein kinase family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY01613.1| Malectin/receptor-like protein kinase family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY01614.1| Malectin/receptor-like protein kinase family protein, putative 
isoform 1 [Theobroma cacao]
Length=832

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 81/124 (65%), Gaps = 2/124 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGG-PDGVTDQDNRKWTTDVGSKF-LLGTGKSSTSSADSQKPSVPQVPFM  432
            YVP+++I L+CG   +     D R W++D+GS F    +  +ST S+ S   +VP+VP+M
Sbjct  43   YVPSEQIFLDCGSSAEKSLLFDGRNWSSDIGSDFTAYNSDSNSTVSSASIGTAVPRVPYM  102

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            TAR F S+F+Y+F V  G KF+RLYFYP SY GLN + S  +V  G YTLL+NFS   T 
Sbjct  103  TARLFYSKFSYTFNVTPGPKFIRLYFYPDSYRGLNVSESFLTVTSGHYTLLRNFSCYLTA  162

Query  613  EALN  624
            + LN
Sbjct  163  KYLN  166



>ref|NP_198718.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 sp|Q9FID6.1|Y5392_ARATH RecName: Full=Probable receptor-like protein kinase At5g39020; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10826.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AED94387.1| putative receptor-like protein kinase [Arabidopsis thaliana]
Length=813

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 76/124 (61%), Gaps = 6/124 (5%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTG---KSSTSSADSQKPSVPQVPF  429
            Y PTD  L NCG      D   R WT  V S+ +L +     S TS A  QK  V ++P+
Sbjct  23   YHPTDVFLFNCGDTSNNVDNSGRNWT--VESRQILSSNLVNASFTSEASYQKAGVSRIPY  80

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASY-NGLNATNSVFSVRVGEYTLLKNFSAGQ  606
            M AR F+SEFTYSFPV  G  FLRLYFYP  Y +G +A NS FSV+V  +TLL+NF+A  
Sbjct  81   MKARIFRSEFTYSFPVTPGSIFLRLYFYPTQYKSGFDAVNSFFSVKVNGFTLLRNFNADS  140

Query  607  TTEA  618
            T +A
Sbjct  141  TVQA  144



>emb|CDP20271.1| unnamed protein product [Coffea canephora]
Length=886

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 74/117 (63%), Gaps = 3/117 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLG--TGKSSTSSADSQKPSVPQVPFM  432
            Y PTD IL+NCG     T  D RKW  DVGSKF        SS  +A     SV  VPF 
Sbjct  27   YTPTDYILINCGSSSNSTSVDGRKWDGDVGSKFSPNDMANISSAVTATELDSSVSGVPFS  86

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYN-GLNATNSVFSVRVGEYTLLKNFSA  600
            +AR  +S+F+Y+FPV+ G+KFLRLYFYP SY+ GLN   S F+V+   +TLL NFSA
Sbjct  87   SARIIRSQFSYTFPVSLGKKFLRLYFYPTSYSGGLNTMESFFNVKANNFTLLSNFSA  143



>ref|XP_009388012.1| PREDICTED: receptor-like protein kinase FERONIA, partial [Musa 
acuminata subsp. malaccensis]
Length=532

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 73/122 (60%), Gaps = 0/122 (0%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  438
            YVP D ILLNCG     +  D R WT D G+++      S    A    PSV  VP+ TA
Sbjct  45   YVPRDDILLNCGASGQASSFDRRSWTGDTGTRYAPSLNGSGGFDALRLDPSVSTVPYSTA  104

Query  439  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEA  618
            R F S FTY FP+++G  F+RL+FYP+ Y+   A+++ FSV  G Y LL NFSA  T +A
Sbjct  105  RVFTSPFTYRFPLSAGPIFIRLHFYPSDYSNHAASDAFFSVTSGPYILLHNFSAYLTADA  164

Query  619  LN  624
            LN
Sbjct  165  LN  166



>ref|XP_009588433.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana tomentosiformis]
Length=882

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 80/124 (65%), Gaps = 3/124 (2%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGT--GKSSTSSADSQKPSVPQVPF  429
            +Y  T   LLNCG   G T +DNR W TD+    LL +     ST++  S++ S+ +VP+
Sbjct  27   EYNATVHFLLNCGASSGATAEDNRLWNTDIHFTNLLPSNFATISTTAIASEQGSLTRVPY  86

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYN-GLNATNSVFSVRVGEYTLLKNFSAGQ  606
            M AR F+S+FTY+FPV+ G KFLRLYF+PA+Y+ G N + S FSV    +TLL NFSA  
Sbjct  87   MNARIFKSQFTYTFPVSPGTKFLRLYFHPANYSGGFNKSESFFSVTANHFTLLSNFSAFL  146

Query  607  TTEA  618
            T  A
Sbjct  147  TLSA  150



>ref|XP_009115877.1| PREDICTED: putative receptor-like protein kinase At5g39000 [Brassica 
rapa]
Length=875

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 75/122 (61%), Gaps = 2/122 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS-ADSQKPSVPQVPFMT  435
            Y PTD  L NCG     TD   RKWT +           +S SS A SQ+  VPQVP++ 
Sbjct  26   YDPTDLFLFNCGATSDNTDNTGRKWTAENRQTLSSNAVNASFSSDASSQESGVPQVPYLK  85

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASY-NGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            AR F+S+FTYSFPV+ G K+LRLYFYP  Y +G +A  S FSV V  +TLLKNFSA  T 
Sbjct  86   ARIFRSDFTYSFPVSPGWKYLRLYFYPTRYESGFDAVASFFSVTVNGFTLLKNFSASLTV  145

Query  613  EA  618
             A
Sbjct  146  TA  147



>emb|CDP17056.1| unnamed protein product [Coffea canephora]
Length=881

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 77/119 (65%), Gaps = 6/119 (5%)
 Frame = +1

Query  277  ILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTG-KSSTSSADSQKPSVP-QVPFMTARTFQ  450
            ++L+CG  DG TD D RKW  D  +K+L+ +  KS  S AD+Q PS+P  VP+MTAR F 
Sbjct  32   LVLDCGSSDGGTDADGRKWEAD--AKYLVNSNDKSIASKADNQDPSLPSDVPYMTARIFT  89

Query  451  SEFTYSFPVASG--RKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
            SE  Y FPVA+   R  LRL+FYPASY   N ++S FSV  G   LL NFSA  T EAL
Sbjct  90   SEAIYQFPVANATDRVLLRLHFYPASYPNFNISDSYFSVSAGGIQLLSNFSAFITAEAL  148



>emb|CDP19887.1| unnamed protein product [Coffea canephora]
Length=825

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 74/118 (63%), Gaps = 5/118 (4%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFL---LGTGKSSTSSADSQKPSVPQVPF  429
            Y PTD IL+NCG     T  D R W  D GSKF    + T  SS  +A  Q  SV   P+
Sbjct  26   YSPTDYILINCGSSSNATSADGRNWYGDAGSKFSPNDMAT-ISSAVTATEQDSSVSGAPY  84

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNG-LNATNSVFSVRVGEYTLLKNFSA  600
            +TAR  +S F+Y+FPV+ G+KF+RLYFYPASY+   NAT S F+V    YTLL NFSA
Sbjct  85   LTARIIRSNFSYTFPVSPGKKFVRLYFYPASYSSDFNATESFFAVMANNYTLLSNFSA  142



>ref|XP_006405671.1| hypothetical protein EUTSA_v10027636mg [Eutrema salsugineum]
 gb|ESQ47124.1| hypothetical protein EUTSA_v10027636mg [Eutrema salsugineum]
Length=876

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 75/123 (61%), Gaps = 4/123 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADS--QKPSVPQVPFM  432
            Y PTD  L NCG      D   R WT +   K L     +++  ++S  Q   VPQVP+ 
Sbjct  27   YTPTDVFLFNCGATSDTVDNTGRNWTAE-NRKILSSNPVNASFPSESSFQDSGVPQVPYT  85

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYN-GLNATNSVFSVRVGEYTLLKNFSAGQT  609
            TAR F+SEFTYSFPV+ G KFLRLY YP SY  G +A NS+FSV V  +TL++NFSA  T
Sbjct  86   TARIFRSEFTYSFPVSPGDKFLRLYIYPTSYKPGFDAVNSLFSVTVNGFTLMENFSADLT  145

Query  610  TEA  618
              A
Sbjct  146  VRA  148



>emb|CDX78036.1| BnaA09g32310D [Brassica napus]
Length=867

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 78/123 (63%), Gaps = 4/123 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADS--QKPSVPQVPFM  432
            Y PTD  L NCG     TD   RKWT +   + L     +++ S+D+  Q+  VPQVP+M
Sbjct  26   YDPTDLFLFNCGATSDNTDNTGRKWTAE-NRQTLSSNAVNASFSSDASFQESGVPQVPYM  84

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASY-NGLNATNSVFSVRVGEYTLLKNFSAGQT  609
             AR F+S+FTYSFPV+ G K+LRLYFYP  Y +G +A  S FSV V  +TLLKNFSA  T
Sbjct  85   KARIFRSDFTYSFPVSPGWKYLRLYFYPTRYESGFDAVASFFSVTVNGFTLLKNFSASLT  144

Query  610  TEA  618
              A
Sbjct  145  VTA  147



>ref|XP_006844774.1| hypothetical protein AMTR_s00016p00259140 [Amborella trichopoda]
 gb|ERN06449.1| hypothetical protein AMTR_s00016p00259140 [Amborella trichopoda]
Length=856

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 81/125 (65%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDV-GSKFLLGTGKSSTSSADSQKPSVPQ-VPF  429
            +Y P+D IL+NCG      D D R W  DV GS++ L +  +  + A++Q PS+P  +P+
Sbjct  35   NYAPSDAILVNCGSSSDGVDADGRSWKGDVHGSRYTLDSENTVPARAETQDPSLPSTIPY  94

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRV-GEYTLLKNFSAGQ  606
            M+AR F S  TY F V  GR ++RL+FYP+SY+GL+  +++FSV   G + LL+NFSA  
Sbjct  95   MSARIFSSRSTYEFSVTPGRHWVRLHFYPSSYSGLSPDDALFSVEASGGFMLLRNFSASI  154

Query  607  TTEAL  621
            T  AL
Sbjct  155  TATAL  159



>ref|XP_006842554.1| hypothetical protein AMTR_s00077p00138840 [Amborella trichopoda]
 gb|ERN04229.1| hypothetical protein AMTR_s00077p00138840 [Amborella trichopoda]
Length=899

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 73/115 (63%), Gaps = 1/115 (1%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVP-QVPFMT  435
            ++P D ILL+CG      D DNR WT D  S+F   +  +    A +Q  S+P + P+MT
Sbjct  38   FIPKDVILLDCGTDSDSNDADNRHWTGDANSRFAPASQNTLPVQASNQDTSLPSKTPYMT  97

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSA  600
            AR F S FTY+FPV  GR ++RLYFYP+ Y   N+T ++FSV  G ++LL NFSA
Sbjct  98   ARIFNSNFTYTFPVTPGRHWVRLYFYPSDYKPHNSTAALFSVTSGPFSLLHNFSA  152



>ref|XP_008464587.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
Length=908

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 78/128 (61%), Gaps = 6/128 (5%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQ--DNRKWTTDVGSKFL----LGTGKSSTSSADSQKPSVPQ  420
            Y P D I L CG    +++   D R W  D+ SKF        G S TS AD+Q  SV  
Sbjct  33   YQPIDNIPLVCGSHGNLSNSYLDGRIWVGDIDSKFFPSDHQQNGASMTSKADAQSTSVTT  92

Query  421  VPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSA  600
            VP+MTAR  +S+FTYSFPV+ G KF+RLYFY A+Y   + + +VFSVR G +TLL++F+ 
Sbjct  93   VPYMTARLSRSQFTYSFPVSPGHKFIRLYFYSANYQQFDRSKAVFSVRAGRFTLLRDFNT  152

Query  601  GQTTEALN  624
                +A N
Sbjct  153  SVNADASN  160



>gb|KJB10597.1| hypothetical protein B456_001G210300 [Gossypium raimondii]
Length=869

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 74/123 (60%), Gaps = 4/123 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF---LLGTGKSSTSSADSQKPSVPQVPF  429
            Y+PTD I LNCG    +   D R W  D  SKF        KS    AD+Q  S   VP+
Sbjct  26   YIPTDDITLNCGATTDLVANDGRSWAEDNNSKFGPFESSHNKSQAYEADTQDGS-ETVPY  84

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  609
            MTAR  +SEF Y+FPV  G+KF+RLYF+PASY   + + + FSV+ G +TLLKNFSA   
Sbjct  85   MTARVSRSEFKYTFPVTPGQKFVRLYFHPASYKEYDRSKAFFSVKAGSFTLLKNFSASLV  144

Query  610  TEA  618
             ++
Sbjct  145  ADS  147



>ref|XP_003520131.2| PREDICTED: receptor-like protein kinase FERONIA-like [Glycine 
max]
Length=847

 Score =   110 bits (274),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 55/126 (44%), Positives = 77/126 (61%), Gaps = 4/126 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGG--PDGVTDQDNRKWTTDVGSKFLLGTGKSS--TSSADSQKPSVPQVP  426
            YVP++ I+LNCG    + V   D R W+ D+ S ++     +    + A +   S+P+VP
Sbjct  34   YVPSENIVLNCGSNVSNVVEYVDGRNWSGDIASPYMPSDADTKFLVARAPNTLQSIPEVP  93

Query  427  FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQ  606
            +MTAR FQS+FTY+F V  G KF+RL+FYPASY  LN +N+  SV    +TLL NFS   
Sbjct  94   YMTARIFQSQFTYTFNVTPGPKFIRLHFYPASYLNLNLSNAFLSVSAANFTLLHNFSVSL  153

Query  607  TTEALN  624
              + LN
Sbjct  154  NADYLN  159



>ref|XP_007153476.1| hypothetical protein PHAVU_003G038800g [Phaseolus vulgaris]
 gb|ESW25470.1| hypothetical protein PHAVU_003G038800g [Phaseolus vulgaris]
Length=840

 Score =   110 bits (274),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 57/125 (46%), Positives = 74/125 (59%), Gaps = 3/125 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQ-DNRKWTTDVGSKFLLGTG--KSSTSSADSQKPSVPQVPF  429
            YVPT+ I+LNCG       Q D R W+ D+ S ++      KS    A +   S+P+ P+
Sbjct  29   YVPTENIVLNCGSSTSEFVQYDGRNWSGDIVSPYVPSNADTKSLVVRAPNTLQSIPEAPY  88

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  609
            MTAR F S+FTY+F V  G KF+RL+FYPASY  LN +N+  SV    +TLL NFSA   
Sbjct  89   MTARIFHSQFTYTFNVTPGPKFIRLHFYPASYMDLNISNAFLSVSAANFTLLHNFSASLN  148

Query  610  TEALN  624
             E  N
Sbjct  149  AEYYN  153



>gb|KJB10602.1| hypothetical protein B456_001G210700 [Gossypium raimondii]
Length=856

 Score =   109 bits (273),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 74/123 (60%), Gaps = 4/123 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF---LLGTGKSSTSSADSQKPSVPQVPF  429
            YVPTD I LNCG P  +   D R W  D  S F        KS    AD+Q  S   VP+
Sbjct  26   YVPTDNITLNCGAPTDLLANDGRYWAADKTSNFGPFESSHNKSQAYEADTQDGS-ETVPY  84

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  609
            MTAR  +SEF Y+FPV SG+KF+RLYF+PASY   + + + FSV+ G  TLLKNF+A   
Sbjct  85   MTARVSRSEFKYTFPVTSGQKFVRLYFHPASYEENDRSKAFFSVKAGSVTLLKNFTASLV  144

Query  610  TEA  618
             ++
Sbjct  145  ADS  147



>ref|XP_006654205.1| PREDICTED: receptor-like protein kinase FERONIA-like [Oryza brachyantha]
Length=868

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 79/125 (63%), Gaps = 3/125 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSST-SSADSQKPSVPQ-VPFM  432
            Y PT+ IL++CG      D D RKW +D  SK+L+  GKSS  ++AD Q PS+P  VP+M
Sbjct  26   YKPTESILVDCGADKEGQDVDGRKWVSDKDSKWLVDGGKSSIMANADFQDPSLPSPVPYM  85

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGE-YTLLKNFSAGQT  609
            +AR F  E  Y+FP+   R ++RL+FYPASY+ L A N  FSV      TLLKNFS   T
Sbjct  86   SARVFTKEAAYNFPIGEDRHWVRLHFYPASYHDLPAENFFFSVSTSTGITLLKNFSVYIT  145

Query  610  TEALN  624
             + L+
Sbjct  146  AKVLS  150



>ref|XP_011099030.1| PREDICTED: receptor-like protein kinase FERONIA [Sesamum indicum]
Length=886

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 72/116 (62%), Gaps = 2/116 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLL--GTGKSSTSSADSQKPSVPQVPFM  432
            Y  TD ILLNCG    + D  +R W +D  S +        S +S A +  PSV QVP+ 
Sbjct  29   YTATDLILLNCGSLSNLNDTSSRSWDSDERSSYAPPNAASISLSSMASTMAPSVFQVPYQ  88

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSA  600
            TAR F+S FTY+FPV +G KFLRLYFYP +Y+G N + S FSV    +TLL NFSA
Sbjct  89   TARVFRSSFTYAFPVLTGAKFLRLYFYPDTYSGFNTSQSFFSVTANGFTLLSNFSA  144



>emb|CDX67422.1| BnaA07g14620D [Brassica napus]
Length=722

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 76/122 (62%), Gaps = 3/122 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADS-QKPSVPQVPFMT  435
            YVP D  L NCG    VTD   R WT +        +G +S SS  S Q+  VP VP+ T
Sbjct  26   YVPVDLFLFNCGANSDVTDS-GRSWTAENRKTLPSNSGDASFSSEASFQESGVPLVPYKT  84

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASY-NGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            AR F+S+FTYSFPV+ G KFLRLYFYP  Y +G +A +S FSV V  +TLL NFSA  T 
Sbjct  85   ARIFRSDFTYSFPVSPGWKFLRLYFYPTRYGSGFDAVSSFFSVNVNGFTLLNNFSADLTV  144

Query  613  EA  618
            +A
Sbjct  145  KA  146



>gb|KJB75372.1| hypothetical protein B456_012G038800 [Gossypium raimondii]
Length=853

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 74/121 (61%), Gaps = 2/121 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGP--DGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFM  432
            Y+P D I L+CG       T  D R+WT D  S F     +S ++S +    S   VP+M
Sbjct  21   YIPADNIALDCGSSTSGNSTAPDGREWTGDNMSWFAESGSQSVSASVEKHNSSFHVVPYM  80

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            TAR  +SEFTY FPV +G+KF+RLYF PA YNG + +   FSV+VG YTLL NF+A  T 
Sbjct  81   TARISKSEFTYMFPVTAGQKFIRLYFNPARYNGFDTSVYFFSVKVGPYTLLNNFTASITA  140

Query  613  E  615
            +
Sbjct  141  D  141



>ref|XP_007032831.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY03757.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=884

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 70/121 (58%), Gaps = 2/121 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSST--SSADSQKPSVPQVPFM  432
            Y P D ILL+CG       +D RKW  D  SKF      +S+  S+A  Q  +V QVP+M
Sbjct  26   YSPIDYILLSCGASLNSISEDGRKWIPDEKSKFSTSNSVNSSFASTASRQDHAVTQVPYM  85

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            TAR F+  FTYSFPV+ G KFLR YFYP  Y+  +     FSV    Y LLKNFSA  T 
Sbjct  86   TARVFRDIFTYSFPVSPGLKFLRFYFYPVKYSDFDGHTFFFSVTANNYVLLKNFSAYLTA  145

Query  613  E  615
            E
Sbjct  146  E  146



>gb|KDP27267.1| hypothetical protein JCGZ_19966 [Jatropha curcas]
Length=858

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 76/119 (64%), Gaps = 5/119 (4%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF----LLGTGKSSTSSADSQKPSVPQVP  426
            Y PTD IL NCG     T  D  KWT D+ SKF       + KS ++ A  Q  SV  VP
Sbjct  31   YTPTDIILSNCGFSGQTTAPDGSKWTGDLNSKFGPVDHSNSTKSVSAIALRQGSSVASVP  90

Query  427  FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYN-GLNATNSVFSVRVGEYTLLKNFSA  600
            +MTAR  Q++FTY+FPV +G+KF+RL+FYP++Y  G N +   F V+ G +TLLKNFSA
Sbjct  91   YMTARISQTQFTYTFPVTAGQKFIRLFFYPSNYQGGFNKSKDFFDVKTGPFTLLKNFSA  149



>ref|XP_007045784.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY01616.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=822

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 73/117 (62%), Gaps = 3/117 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGG-PDGVTDQDNRKWTTDVGSKFLLGTGKSS--TSSADSQKPSVPQVPF  429
            Y P + ILL+CG         D R W++D+ S F+     SS   S A S   SVP+VP+
Sbjct  42   YFPLENILLDCGSLASQAVSYDGRNWSSDIRSHFVASNPDSSFTVSRASSAGTSVPEVPY  101

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSA  600
            MTAR F S+FTYSF V+ G KF+RL+FY  SY  LNA+ +  SV  G +TLL+NFSA
Sbjct  102  MTARLFHSQFTYSFNVSPGPKFIRLHFYDDSYMSLNASKAFLSVTAGHFTLLRNFSA  158



>ref|XP_009125099.1| PREDICTED: putative receptor-like protein kinase At5g39000 [Brassica 
rapa]
Length=873

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 76/122 (62%), Gaps = 3/122 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADS-QKPSVPQVPFMT  435
            YVP D  L NCG    VTD   R WT +        +G +S SS  S Q+  VP VP+ T
Sbjct  26   YVPVDLFLFNCGANSDVTDS-GRSWTAENRKTLPSNSGDASFSSEASFQESGVPLVPYKT  84

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASY-NGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            AR F+S+FTYSFPV+ G KFLRLYFYP  Y +G +A +S FSV V  +TLL NFSA  T 
Sbjct  85   ARIFRSDFTYSFPVSPGWKFLRLYFYPTRYGSGFDAVSSFFSVNVNGFTLLNNFSADLTV  144

Query  613  EA  618
            +A
Sbjct  145  KA  146



>gb|EMT01093.1| hypothetical protein F775_16963 [Aegilops tauschii]
Length=509

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 71/121 (59%), Gaps = 1/121 (1%)
 Frame = +1

Query  265  PTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTAR  441
            P  ++ L+CG     TD D R W  D  S FL  T     + A  Q PS+P  VP+MTAR
Sbjct  35   PAGQVRLSCGSSASATDSDGRAWDGDSASMFLPSTNAGVAARASYQDPSLPSTVPYMTAR  94

Query  442  TFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
             F S  TY+F V  GR FLRLYFYPA Y   +A+ ++F V  G  TLL++F+A QT  AL
Sbjct  95   VFASSHTYTFLVRPGRVFLRLYFYPADYGNRSASGALFGVTAGGVTLLQDFNASQTALAL  154

Query  622  N  624
            +
Sbjct  155  D  155



>ref|XP_004137258.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cucumis 
sativus]
 gb|KGN53792.1| hypothetical protein Csa_4G129580 [Cucumis sativus]
Length=910

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 79/126 (63%), Gaps = 6/126 (5%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTD--QDNRKWTTDVGSKFL----LGTGKSSTSSADSQKPSVPQ  420
            Y P D I L+CG    ++   +++R W  D+ SK+        G S TS AD+Q  SV  
Sbjct  33   YEPIDNITLDCGSDANLSSFYENDRIWVGDIDSKYFPSDHQQNGASMTSKADAQSTSVTT  92

Query  421  VPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSA  600
            VP+MTAR  +S+FTYSFPV  G+KF+RLYFY A+Y   + + +VFSVR G +TLL++F+ 
Sbjct  93   VPYMTARLSRSQFTYSFPVTPGQKFIRLYFYSANYQQFDRSKAVFSVRAGLFTLLRDFNT  152

Query  601  GQTTEA  618
                +A
Sbjct  153  SVNADA  158



>ref|XP_002519226.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF43090.1| ATP binding protein, putative [Ricinus communis]
Length=854

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 79/119 (66%), Gaps = 4/119 (3%)
 Frame = +1

Query  271  DKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTF  447
            D  +L CG  +  TD D RKW  D  +K++  +G S  ++AD+Q PS+P  VP+MT R F
Sbjct  29   DSYVLACGASNAGTDGDGRKWEPD--TKYVKSSGNSIMATADNQDPSLPSTVPYMTGRLF  86

Query  448  QSEFTYSFPV-ASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
             S FTY+FPV A GR ++RL+FYP++Y+ L+  N+ FSV   +  LLKNFSA  T +AL
Sbjct  87   TSAFTYTFPVPAKGRLWVRLHFYPSTYSSLDPNNAYFSVTANKLQLLKNFSASITAKAL  145



>gb|KHN29954.1| Receptor-like protein kinase FERONIA [Glycine soja]
Length=841

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 77/126 (61%), Gaps = 4/126 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGG--PDGVTDQDNRKWTTDVGSKFLLGTG--KSSTSSADSQKPSVPQVP  426
            YVP++ I+LNCG    + V   D R W+ D+ S ++      K   + A +   S+P+VP
Sbjct  29   YVPSENIVLNCGSNVSNVVEYVDGRNWSGDIASPYMPSDADTKFLVARAPNTLQSIPEVP  88

Query  427  FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQ  606
            +MTAR FQS+FTY+F V  G KF+RL+FYPASY  LN +N+  SV    +TLL NFS   
Sbjct  89   YMTARIFQSQFTYTFNVTPGPKFIRLHFYPASYLNLNLSNAFLSVSAANFTLLHNFSVSL  148

Query  607  TTEALN  624
              + LN
Sbjct  149  NADYLN  154



>ref|XP_004154760.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA-like [Cucumis sativus]
Length=910

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 79/126 (63%), Gaps = 6/126 (5%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTD--QDNRKWTTDVGSKFL----LGTGKSSTSSADSQKPSVPQ  420
            Y P D I L+CG    ++   +++R W  D+ SK+        G S TS AD+Q  SV  
Sbjct  33   YEPIDNITLDCGSDANLSSFYENDRIWVGDIDSKYFPSDHQQNGASMTSKADAQSTSVTT  92

Query  421  VPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSA  600
            VP+MTAR  +S+FTYSFPV  G+KF+RLYFY A+Y   + + +VFSVR G +TLL++F+ 
Sbjct  93   VPYMTARLSRSQFTYSFPVTPGQKFIRLYFYSANYQQFDRSKAVFSVRAGLFTLLRDFNT  152

Query  601  GQTTEA  618
                +A
Sbjct  153  SVNADA  158



>gb|EMT04378.1| Receptor-like protein kinase FERONIA [Aegilops tauschii]
Length=833

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 79/125 (63%), Gaps = 4/125 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSST-SSADSQKPSVPQ-VPFM  432
            Y PTD IL++CG      D+D RKWT D  SK+L   GKSS   +AD   PS+P  VP+M
Sbjct  29   YKPTDSILVHCGSDKDGQDEDGRKWTADKDSKWLPDGGKSSVMGTADVPAPSLPSPVPYM  88

Query  433  TARTFQSEFTYSFPVASG-RKFLRLYFYPASYNGLNATNSVFSVRVGE-YTLLKNFSAGQ  606
            TAR F  E  Y+FPVA   R ++RL+FYPA+Y+G+ A +  FSV      TLL+NFS   
Sbjct  89   TARVFPKETAYTFPVADADRHWVRLHFYPAAYHGIPADHFFFSVTTSTGVTLLRNFSVYT  148

Query  607  TTEAL  621
            T +AL
Sbjct  149  TAKAL  153



>ref|XP_007032823.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY03749.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=894

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 73/118 (62%), Gaps = 4/118 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF---LLGTGKSSTSSADSQKPS-VPQVP  426
            Y+P + I ++CG P+  T  D R WT D   KF        +S  S A  Q PS V QVP
Sbjct  42   YIPIENITIDCGSPNDNTALDGRSWTRDNTPKFSPIESQNNQSVYSEAPQQPPSGVGQVP  101

Query  427  FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSA  600
            F+TAR  ++EF Y FP+ SG+KF+RLYFYP SY   +   + FSV  GE+TLLKNFSA
Sbjct  102  FITARVSKAEFIYVFPLTSGQKFVRLYFYPTSYPPFDPLKAFFSVNTGEFTLLKNFSA  159



>ref|XP_007227151.1| hypothetical protein PRUPE_ppa026453mg [Prunus persica]
 gb|EMJ28350.1| hypothetical protein PRUPE_ppa026453mg [Prunus persica]
Length=860

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 79/120 (66%), Gaps = 4/120 (3%)
 Frame = +1

Query  268  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVP-QVPFMTART  444
            TD  +++CG   G TD D RKW +D  S+FL  + KS+T++A  Q PS+P QVP+M+AR 
Sbjct  28   TDSYVISCGSSSGGTDSDGRKWASD--SQFLTSSYKSNTATAQYQDPSLPSQVPYMSARI  85

Query  445  FQSEFTYSFPVASGRKFL-RLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
            F S  +Y F V+  ++ L RL+FYP SYN L+ +NS F V    +TLL NFSA  T +AL
Sbjct  86   FNSASSYKFSVSPKQRLLVRLHFYPTSYNSLDPSNSYFDVVANGFTLLHNFSASITAQAL  145



>ref|XP_003614252.1| Kinase-like protein [Medicago truncatula]
 gb|AES97210.1| feronia receptor-like kinase [Medicago truncatula]
Length=817

 Score =   107 bits (266),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 74/127 (58%), Gaps = 5/127 (4%)
 Frame = +1

Query  259  YVPTDKILLNCG-GPDGVTDQDNRKWTTDVGSKFLLG----TGKSSTSSADSQKPSVPQV  423
            YVP++ I+LNCG     +   D R W  D+ S ++        KS T+ A S   S+P+V
Sbjct  28   YVPSENIVLNCGSNTSELVQYDGRIWNGDIDSPYVPSYEEIINKSLTAKAPSNLQSIPEV  87

Query  424  PFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAG  603
            P+MTAR FQS+FTY F V SG KF+RL+FYP SY   N + +  SV  G +TLL NFS  
Sbjct  88   PYMTARIFQSQFTYRFNVTSGPKFIRLHFYPFSYLNFNISKAFLSVTAGNFTLLHNFSVS  147

Query  604  QTTEALN  624
               +  N
Sbjct  148  LNVDYFN  154



>ref|XP_002272797.2| PREDICTED: receptor-like protein kinase ANXUR1 [Vitis vinifera]
 emb|CBI22880.3| unnamed protein product [Vitis vinifera]
Length=857

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 77/116 (66%), Gaps = 4/116 (3%)
 Frame = +1

Query  280  LLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQSE  456
            +L+CG   G  D D RKW  D  +KFL   GKS +++A  Q PS+P  VP+M+AR F SE
Sbjct  36   ILSCGDSSGGADADGRKWVPD--TKFLASPGKSISATAQLQDPSLPSPVPYMSARIFTSE  93

Query  457  FTYSFPVA-SGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
             TY F V+   R ++RL+FYP+ Y+ LNA++S FSV  G +TLL NFSA  T +AL
Sbjct  94   STYQFSVSPKNRLWVRLHFYPSFYSALNASDSFFSVTAGGFTLLNNFSASTTAQAL  149



>dbj|BAK06468.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=891

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 80/125 (64%), Gaps = 4/125 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSS-TSSADSQKPSVP-QVPFM  432
            Y PTD IL++CG      D+D RKWT+D  SKFL   GKSS T++AD   PS+P  VP+M
Sbjct  29   YKPTDSILVDCGSDKEGQDEDGRKWTSDKDSKFLPDGGKSSITATADINDPSLPSSVPYM  88

Query  433  TARTFQSEFTYSFPVASG-RKFLRLYFYPASYNGLNATNSVFSVRVGE-YTLLKNFSAGQ  606
            TAR F  E  Y+FPV+   R ++RL+FYPASY+ +   +  FSV      TLL+NFS   
Sbjct  89   TARVFPKETAYTFPVSDADRHWVRLHFYPASYHDIPTDHFFFSVTTSTGVTLLRNFSVYV  148

Query  607  TTEAL  621
            T +AL
Sbjct  149  TAKAL  153



>ref|NP_198716.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 sp|Q9FID8.1|Y5900_ARATH RecName: Full=Putative receptor-like protein kinase At5g39000; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10824.1| receptor-like protein kinase [Arabidopsis thaliana]
 gb|AED94385.1| putative receptor-like protein kinase [Arabidopsis thaliana]
Length=873

 Score =   107 bits (266),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 70/123 (57%), Gaps = 4/123 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLG--TGKSSTSSADSQKPSVPQVPFM  432
            Y PTD  L NCG      D   R WT +   K L       S T+ A  Q+  V Q+P+M
Sbjct  26   YEPTDVFLFNCGDTSNNVDVSGRNWTAE-NQKILSSNLVNASFTAQASYQESGVSQIPYM  84

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNG-LNATNSVFSVRVGEYTLLKNFSAGQT  609
            TAR F+SEFTYSFPV  G  FLRLYFYP  Y    NA  S FSV+V  +TLL NFSA  T
Sbjct  85   TARIFRSEFTYSFPVTPGSNFLRLYFYPTRYGSQFNAVKSFFSVKVNGFTLLNNFSADLT  144

Query  610  TEA  618
             +A
Sbjct  145  VKA  147



>ref|NP_001055089.1| Os05g0280700 [Oryza sativa Japonica Group]
 gb|AAS98512.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAF17003.1| Os05g0280700 [Oryza sativa Japonica Group]
 gb|EAY97366.1| hypothetical protein OsI_19288 [Oryza sativa Indica Group]
 gb|EEE63092.1| hypothetical protein OsJ_17900 [Oryza sativa Japonica Group]
Length=869

 Score =   107 bits (266),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 78/125 (62%), Gaps = 3/125 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSST-SSADSQKPSVPQ-VPFM  432
            Y PT+ IL+NCG      D D RKW +D  SK+L+   KSS  ++AD Q PS+P  VP+M
Sbjct  26   YKPTESILVNCGSDKEGQDIDGRKWLSDKDSKWLIDGEKSSIMANADFQDPSLPSPVPYM  85

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGE-YTLLKNFSAGQT  609
            TAR F  E  Y+F V   R ++RL+FYPASY+ L A N  FSV      TLLKNFS   T
Sbjct  86   TARVFTKETMYNFSVGEERHWVRLHFYPASYHDLPAENFFFSVSTSTGITLLKNFSVYIT  145

Query  610  TEALN  624
             +AL+
Sbjct  146  AKALS  150



>ref|XP_008368476.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA [Malus domestica]
Length=892

 Score =   107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 76/125 (61%), Gaps = 4/125 (3%)
 Frame = +1

Query  259  YVPTDKILLNCG-GPDGVTDQDNRKWTTDVGSKF--LLGTGKSSTSSADSQKPSVPQVPF  429
            Y P D I L CG   D V  QD R W+ D+ SKF      G SS   A +   S  QVP+
Sbjct  29   YKPVDDITLQCGFSGDQVNQQDGRTWSGDINSKFSPFQAAGSSSVYKAATPIXSSSQVPY  88

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNG-LNATNSVFSVRVGEYTLLKNFSAGQ  606
             TAR  +SEFTY+FP+ SG+KF+RLYFYP SY    + + S+FSV  G +TLL++F+A  
Sbjct  89   TTARLSRSEFTYTFPLTSGQKFIRLYFYPTSYAAEFDRSKSLFSVEAGGFTLLRDFNASV  148

Query  607  TTEAL  621
            T +A 
Sbjct  149  TADAF  153



>ref|XP_009790514.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana sylvestris]
Length=879

 Score =   107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 76/124 (61%), Gaps = 4/124 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKS--STSSADSQKPSVPQVPFM  432
            Y  T   LLNCG     TD+D+R W TD+    LL +  +  ST +  S++ SV  VP+M
Sbjct  28   YNATVHFLLNCGASSDATDEDDRLWNTDIHFTNLLPSNFTTISTPAIASEQGSVTTVPYM  87

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNG--LNATNSVFSVRVGEYTLLKNFSAGQ  606
             AR F+S+FTY+FPV+ G KFLRLYF+PA Y+G   N + S FSV     TLL NFSA  
Sbjct  88   NARIFKSQFTYTFPVSPGTKFLRLYFHPADYSGGRFNKSESFFSVTANHVTLLSNFSAFL  147

Query  607  TTEA  618
            T  A
Sbjct  148  TVSA  151



>ref|XP_008341792.1| PREDICTED: receptor-like protein kinase FERONIA [Malus domestica]
Length=892

 Score =   107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 77/126 (61%), Gaps = 4/126 (3%)
 Frame = +1

Query  259  YVPTDKILLNCG-GPDGVTDQDNRKWTTDVGSKF--LLGTGKSSTSSADSQKPSVPQVPF  429
            Y P D I L CG   D V  QD R W+ D+ SKF      G SS   A +   S  QVP+
Sbjct  29   YKPVDDITLQCGFSGDQVNQQDGRTWSGDINSKFSPFQAAGSSSVYKAATPIXSSSQVPY  88

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNG-LNATNSVFSVRVGEYTLLKNFSAGQ  606
             TAR  +SEFTY+FP+ SG+KF+RLYFYP SY    + + S+FSV  G +TLL++F+A  
Sbjct  89   TTARLSRSEFTYTFPLTSGQKFIRLYFYPTSYAAEFDRSKSLFSVEAGGFTLLRDFNASV  148

Query  607  TTEALN  624
            T +A +
Sbjct  149  TADAFS  154



>ref|XP_009385155.1| PREDICTED: receptor-like protein kinase ANXUR2 [Musa acuminata 
subsp. malaccensis]
Length=852

 Score =   107 bits (266),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 80/124 (65%), Gaps = 3/124 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMT  435
            Y+P+D ILLNCG     TD D RKW  D  SK  L +  S+ ++A  Q P++P  VP+M+
Sbjct  23   YLPSDSILLNCGFSSEATDADGRKWLADSTSKSSLTSKNSAPATALYQDPALPSTVPYMS  82

Query  436  ARTFQSEFTYSFPV-ASGRKFLRLYFYPASYNGLNATNSVFSVRVGE-YTLLKNFSAGQT  609
            AR F SE TY F V  S R ++RL+FYP++YNGL   NS FSV   +  TLLKNFSA  T
Sbjct  83   ARVFNSESTYKFAVNGSERHWVRLHFYPSAYNGLPPENSFFSVSTSDGITLLKNFSAYIT  142

Query  610  TEAL  621
             +AL
Sbjct  143  AKAL  146



>gb|EMS48200.1| Receptor-like protein kinase HERK 1 [Triticum urartu]
Length=807

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 79/125 (63%), Gaps = 4/125 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSST-SSADSQKPSVPQ-VPFM  432
            Y PTD IL++CG      D+D RKWTTD  SK+L   GKSS   +A    PS+P  VP+M
Sbjct  28   YKPTDSILVHCGSDKDGQDEDGRKWTTDKDSKWLPDGGKSSIMGTAAVADPSLPSPVPYM  87

Query  433  TARTFQSEFTYSFPVASG-RKFLRLYFYPASYNGLNATNSVFSVRVGE-YTLLKNFSAGQ  606
            TAR F  E  Y+FPVA   R ++RL+FYPA+Y+G+ A +  FSV      TLL+NFS   
Sbjct  88   TARVFPKETAYTFPVADADRHWVRLHFYPAAYHGIPADHFFFSVTTSTGVTLLRNFSVYI  147

Query  607  TTEAL  621
            T +AL
Sbjct  148  TAKAL  152



>ref|XP_008223394.1| PREDICTED: receptor-like protein kinase ANXUR1 [Prunus mume]
Length=860

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 78/120 (65%), Gaps = 4/120 (3%)
 Frame = +1

Query  268  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVP-QVPFMTART  444
            +D  +++CG   G TD D RKW +D  S+FL  + KS+T++A  Q PS+P QVP+M+AR 
Sbjct  28   SDSYVISCGSSSGGTDSDGRKWASD--SQFLTSSDKSNTATAQYQDPSLPSQVPYMSARI  85

Query  445  FQSEFTYSFPVASGRKFL-RLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
            F S  +Y F V+  ++ L RL+FYP SYN L  +NS F V    +TLL NFSA  T +AL
Sbjct  86   FNSASSYKFSVSPKQRLLVRLHFYPTSYNSLEPSNSYFDVVANGFTLLHNFSASITAQAL  145



>gb|ACA25088.1| serine/threonine protein kinase A, partial [Populus tremula]
 gb|ACA25091.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 75/120 (63%), Gaps = 4/120 (3%)
 Frame = +1

Query  268  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  444
            +D  +L CG     TD D R W  D  +K +   G S TS+A++Q PS P  +P+MTAR 
Sbjct  34   SDSYILACGASGAGTDSDGRDWQPD--AKHINSPGNSITSTAENQDPSFPSTIPYMTARI  91

Query  445  FQSEFTYSFPVAS-GRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
            F SE TY F V +  R ++RL+FYP++Y+ L+  NS FSV    +TLL NFSA  T++AL
Sbjct  92   FTSESTYKFSVPTKSRLWVRLHFYPSTYSSLDPNNSYFSVTANSFTLLNNFSASITSQAL  151



>gb|KJB11637.1| hypothetical protein B456_001G269100 [Gossypium raimondii]
Length=889

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 75/118 (64%), Gaps = 4/118 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKS--STSSADSQKP--SVPQVP  426
            + PT+ I ++CG P+     D R WT D   K  L   K+  S SS   Q+P  S+ QVP
Sbjct  33   FTPTESITIDCGSPNDNIGLDGRVWTGDSMPKLSLVESKNNKSVSSKAFQQPPSSLGQVP  92

Query  427  FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSA  600
            F TAR   SEFTY  P+ SG+KF+RLYF+P SY   +A+ ++FSV+ G+ TLLKNFSA
Sbjct  93   FATARASNSEFTYVIPLTSGQKFIRLYFFPTSYPSFDASKALFSVKAGDITLLKNFSA  150



>gb|ACA25086.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 74/120 (62%), Gaps = 4/120 (3%)
 Frame = +1

Query  268  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  444
            +D  +L CG     TD D R W  D  +K +   G S TS+A++Q PS P  +P+MTAR 
Sbjct  34   SDSYILACGASGAGTDSDGRDWQPD--AKHINSPGNSITSTAENQDPSFPSTIPYMTARI  91

Query  445  FQSEFTYSFPVAS-GRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
            F SE TY F V +  R ++RL+FYP++Y+ L+  NS FSV    +TLL NFSA  T +AL
Sbjct  92   FTSESTYKFSVPTKSRLWVRLHFYPSTYSSLDPNNSYFSVTANSFTLLNNFSASITAQAL  151



>gb|EYU46822.1| hypothetical protein MIMGU_mgv1a022107mg [Erythranthe guttata]
Length=886

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 78/123 (63%), Gaps = 6/123 (5%)
 Frame = +1

Query  265  PTDKILLNCGGPD-GVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTA  438
            P   ++L CG  D G  D D RKW  D   K+++   K++ + AD Q PS+   +P+MTA
Sbjct  26   PNPPLVLTCGSSDAGGNDPDGRKWDPD--DKYIISGDKTTAAKADYQDPSLSSTIPYMTA  83

Query  439  RTFQSEFTYSFPV--ASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            R FQSE TY FP+  ++ R  LRL+FYP+SY   N +NS FSV  G++TLL+NFSA    
Sbjct  84   RIFQSETTYQFPLQNSTSRTLLRLHFYPSSYPNFNISNSYFSVVAGKFTLLQNFSAFLAA  143

Query  613  EAL  621
            EAL
Sbjct  144  EAL  146



>ref|XP_008341797.1| PREDICTED: receptor-like protein kinase FERONIA [Malus domestica]
Length=892

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 76/125 (61%), Gaps = 4/125 (3%)
 Frame = +1

Query  259  YVPTDKILLNCG-GPDGVTDQDNRKWTTDVGSKF--LLGTGKSSTSSADSQKPSVPQVPF  429
            Y P + I L CG   D V  QD R W+ D+ SKF      G SS   A +   S  QVP+
Sbjct  29   YKPVBBITLQCGFSGDQVNQQDGRTWSGDINSKFSPFQAAGSSSVYKAATPIYSSSQVPY  88

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNG-LNATNSVFSVRVGEYTLLKNFSAGQ  606
             TAR  +SEFTY+FP+ SG+KF+RLYFYP SY    + + S+FSV  G +TLL++F+A  
Sbjct  89   TTARLSRSEFTYTFPLTSGQKFIRLYFYPTSYAAEFDRSKSLFSVEAGGFTLLRDFNASV  148

Query  607  TTEAL  621
            T +A 
Sbjct  149  TADAF  153



>ref|XP_010914574.1| PREDICTED: receptor-like protein kinase ANXUR2 [Elaeis guineensis]
Length=865

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 78/124 (63%), Gaps = 4/124 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPS-VPQVPFMT  435
            Y PTD ILL+CG     TD D+RKW  D  SKF   +G S+T+ A  Q PS +  VP+MT
Sbjct  29   YTPTDSILLDCGSSADGTDADHRKWAADDSSKF-RPSGNSTTAPAAFQDPSLLSPVPYMT  87

Query  436  ARTFQSEFTYSFPVA-SGRKFLRLYFYPASYNGLNATNSVFSVRV-GEYTLLKNFSAGQT  609
            AR F SE TY F V+     ++RL+FYP++YN LN  ++ FSV   G  TLL NFSA  T
Sbjct  88   ARIFTSESTYKFAVSDKDHHWIRLHFYPSTYNSLNPEDAYFSVTASGGITLLHNFSAHVT  147

Query  610  TEAL  621
             +AL
Sbjct  148  AQAL  151



>ref|XP_010243447.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=825

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 76/125 (61%), Gaps = 3/125 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTD-QDNRKWTTDVGSKFL-LGTGKSSTSSADSQKPSVPQVPFM  432
            YV T ++ ++CG    VT+  D R WT D G K+      + ST     Q  SVPQ+P+M
Sbjct  32   YVTTYQVFVDCGSHGEVTESHDGRNWTGDFGGKYKPYANIRGSTFVVSVQGISVPQIPYM  91

Query  433  TARTFQSEFTYSFP-VASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  609
            TAR F+S  TY F  V++G KF+RLYFYPASY+ LN + + F V  G Y LL+NFSA  T
Sbjct  92   TARIFRSHLTYKFSDVSAGPKFIRLYFYPASYSNLNQSYAFFDVSAGPYILLRNFSASLT  151

Query  610  TEALN  624
               L+
Sbjct  152  ANFLD  156



>gb|KDO71938.1| hypothetical protein CISIN_1g041565mg [Citrus sinensis]
Length=862

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 78/116 (67%), Gaps = 4/116 (3%)
 Frame = +1

Query  280  LLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQSE  456
            +L CG     TD ++RKWT+D  SKFL  +G S T++A SQ  S+P  +P+MTAR F+S 
Sbjct  37   VLACGASSDGTDSNDRKWTSD--SKFLTNSGNSITATAQSQDSSLPSTIPYMTARIFKST  94

Query  457  FTYSFPVASGRKF-LRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
             +Y F V+S  +F LRL+FYPASY  L+ +N+ FSV    +TLL NFSA  T +AL
Sbjct  95   SSYKFTVSSKDRFWLRLHFYPASYGNLDPSNAYFSVNANGFTLLNNFSASITAKAL  150



>ref|XP_006488842.1| PREDICTED: receptor-like protein kinase ANXUR1-like [Citrus sinensis]
Length=862

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 78/116 (67%), Gaps = 4/116 (3%)
 Frame = +1

Query  280  LLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQSE  456
            +L CG     TD ++RKWT+D  SKFL  +G S T++A SQ  S+P  +P+MTAR F+S 
Sbjct  37   VLACGASSDGTDSNDRKWTSD--SKFLTNSGNSITATAQSQDSSLPSTIPYMTARIFKST  94

Query  457  FTYSFPVASGRKF-LRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
             +Y F V+S  +F LRL+FYPASY  L+ +N+ FSV    +TLL NFSA  T +AL
Sbjct  95   SSYKFTVSSKDRFWLRLHFYPASYGNLDPSNAYFSVNANGFTLLNNFSASITAKAL  150



>ref|XP_006419383.1| hypothetical protein CICLE_v10004295mg [Citrus clementina]
 gb|ESR32623.1| hypothetical protein CICLE_v10004295mg [Citrus clementina]
Length=862

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 78/116 (67%), Gaps = 4/116 (3%)
 Frame = +1

Query  280  LLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQSE  456
            +L CG     TD ++RKWT+D  SKFL  +G S T++A SQ  S+P  +P+MTAR F+S 
Sbjct  37   VLACGASSDGTDSNDRKWTSD--SKFLTNSGNSITATAQSQDSSLPSTIPYMTARIFKST  94

Query  457  FTYSFPVASGRKF-LRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
             +Y F V+S  +F LRL+FYPASY  L+ +N+ FSV    +TLL NFSA  T +AL
Sbjct  95   SSYKFTVSSKDRFWLRLHFYPASYGNLDPSNAYFSVNANGFTLLNNFSASITAKAL  150



>gb|EYU44219.1| hypothetical protein MIMGU_mgv11b013480mg [Erythranthe guttata]
Length=133

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 67/110 (61%), Gaps = 2/110 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGK--SSTSSADSQKPSVPQVPFM  432
            ++ TD ILLNCG    + D  +R W+ D GS++        SS S A    PSV  VP+ 
Sbjct  24   FIATDFILLNCGASSSLNDSSSRIWSGDAGSRYAPPNADTVSSASKASRMLPSVAPVPYE  83

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTL  582
            TAR  QS FTYSFPV  GRKF+RLYFYP +Y+G + +N  FSV    +TL
Sbjct  84   TARVLQSPFTYSFPVLEGRKFVRLYFYPDTYSGADTSNFFFSVTANSFTL  133



>ref|XP_004962493.1| PREDICTED: receptor-like protein kinase ANXUR1-like [Setaria 
italica]
Length=869

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 78/126 (62%), Gaps = 4/126 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSST-SSADSQKPSVPQ-VPFM  432
            Y P + IL+NCG      D D RKW TD  SK+L+  GKSS  + AD Q PS+P  VP+M
Sbjct  26   YKPPESILVNCGSAKEGLDADGRKWMTDQDSKWLIDGGKSSIMADADVQDPSLPSPVPYM  85

Query  433  TARTFQSEFTYSFPV-ASGRKFLRLYFYPASYNGLNATNSVFSVRVGE-YTLLKNFSAGQ  606
            +AR F  E  Y+F V  + R +LRL+FYPA+Y+GL A    FSV      TLL+NFS   
Sbjct  86   SARVFTKETVYNFSVDETDRHWLRLHFYPAAYHGLPAEQFFFSVSTSTGITLLRNFSVYI  145

Query  607  TTEALN  624
            T +AL+
Sbjct  146  TAKALS  151



>ref|NP_198715.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 sp|Q9FID9.1|Y5389_ARATH RecName: Full=Probable receptor-like protein kinase At5g38990; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10823.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AED94384.1| malectin/receptor-like protein kinase family protein [Arabidopsis 
thaliana]
Length=880

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 71/118 (60%), Gaps = 5/118 (4%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTG---KSSTSSADSQKPSVPQVPF  429
            Y PTD  L+NCG      D   R WTT+   KF+        S TSSA  Q+  +PQVP+
Sbjct  23   YEPTDVFLINCGDTSNNMDYSGRNWTTE-NPKFMSSNAVDDASFTSSASYQESGIPQVPY  81

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASY-NGLNATNSVFSVRVGEYTLLKNFSA  600
            + AR F+ +FTYSFPV+ G KFLRLYFYP  Y +  +A  S FSV V  +TLL NFS 
Sbjct  82   LKARIFRYDFTYSFPVSPGWKFLRLYFYPTRYGSDFDAVKSFFSVNVNRFTLLHNFSV  139



>gb|AAM10331.1| AT5g38990/K15E6_170 [Arabidopsis thaliana]
 gb|AAN18200.1| At5g38990/K15E6_170 [Arabidopsis thaliana]
Length=880

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 71/118 (60%), Gaps = 5/118 (4%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTG---KSSTSSADSQKPSVPQVPF  429
            Y PTD  L+NCG      D   R WTT+   KF+        S TSSA  Q+  +PQVP+
Sbjct  23   YEPTDVFLINCGDTSNNMDYSGRNWTTE-NPKFMSSNAVDDASFTSSASYQESGIPQVPY  81

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASY-NGLNATNSVFSVRVGEYTLLKNFSA  600
            + AR F+ +FTYSFPV+ G KFLRLYFYP  Y +  +A  S FSV V  +TLL NFS 
Sbjct  82   LKARIFRYDFTYSFPVSPGWKFLRLYFYPTRYGSDFDAVKSFFSVNVNRFTLLHNFSV  139



>ref|XP_010660597.1| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
 emb|CAN76104.1| hypothetical protein VITISV_015219 [Vitis vinifera]
Length=511

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 74/122 (61%), Gaps = 2/122 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF-LLGTGKSST-SSADSQKPSVPQVPFM  432
            Y PTD   ++CG    +   DNR W  D  S+F L+   K+S  S A    PSV  VPF 
Sbjct  40   YNPTDIYTVDCGASGNLKAWDNRIWIGDTNSRFSLIEKNKASIISKAAKTSPSVDPVPFA  99

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            TAR  + +F Y FPV +G+KF+RL+FYP+S  G + + + FSV++G YTLL NFSA    
Sbjct  100  TARLSRFQFAYIFPVTTGQKFIRLHFYPSSVAGFDRSKAFFSVKIGGYTLLNNFSAALAA  159

Query  613  EA  618
            +A
Sbjct  160  DA  161



>ref|XP_003580431.1| PREDICTED: receptor-like protein kinase FERONIA [Brachypodium 
distachyon]
Length=514

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 72/119 (61%), Gaps = 2/119 (2%)
 Frame = +1

Query  274  KILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTF-  447
            +I LNCG     TD D R W  D  SKF      ++ +SA  + PS+P  VP+ TAR F 
Sbjct  34   QIRLNCGESGSATDADGRAWAGDAASKFAPSMPDAAAASASYKDPSLPSLVPYTTARVFA  93

Query  448  QSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALN  624
             S +TYSF V  GR FLRLYFYP++Y    A++++F V  G  TLL+ F+A QT  ALN
Sbjct  94   SSSYTYSFLVRPGRAFLRLYFYPSNYGTHAASDALFGVTAGGVTLLRGFNASQTALALN  152



>gb|ACA25095.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 74/120 (62%), Gaps = 4/120 (3%)
 Frame = +1

Query  268  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  444
            +D  +L CG     TD D R W  D  +K +   G S TS+A++Q PS+P  +P+MTAR 
Sbjct  34   SDSYILACGASGAGTDSDGRDWQPD--AKHINSPGNSITSTAENQDPSLPSTIPYMTARI  91

Query  445  FQSEFTYSFPVAS-GRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
            F SE TY F V +  R ++RL+FYP++Y+ L+  NS FSV    +TLL NFS   T +AL
Sbjct  92   FTSESTYKFSVPTKSRLWVRLHFYPSTYSSLDPNNSYFSVTANSFTLLNNFSGSITAQAL  151



>gb|EMT03407.1| Receptor-like protein kinase FERONIA [Aegilops tauschii]
Length=778

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 71/120 (59%), Gaps = 2/120 (2%)
 Frame = +1

Query  268  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVP-QVPFMTART  444
            T  ILLNCG      D   R W  D GSKF     K   ++A  Q PS+P + PFMTAR 
Sbjct  32   TGLILLNCGASSQNIDDSGRTWDGDSGSKFTPSV-KGVATNASYQDPSLPSRTPFMTARI  90

Query  445  FQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALN  624
            F S +TYSFPV+ GR FLRLYFYP +Y     +++VF V      LL +F+A QT +A++
Sbjct  91   FTSSYTYSFPVSPGRTFLRLYFYPIAYGNYTVSDAVFRVTARNLVLLNDFNASQTAQAIS  150



>emb|CDY37883.1| BnaC04g31230D [Brassica napus]
Length=793

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 71/121 (59%), Gaps = 1/121 (1%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  438
            Y PTD  L+NCG      D  ++ WT+D            S SS  S +  VPQVP+ TA
Sbjct  25   YKPTDLFLINCGTSSDTIDSQSQTWTSDQQHLLTSNLDNVSFSSNASYQEEVPQVPYTTA  84

Query  439  RTFQSEFTYSFPVASGRKFLRLYFYPASY-NGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            R F S   YSFPV+ G K+LRLYFYP  Y +G +A +S FSV V  +TLLKNFSA  T +
Sbjct  85   RVFLSNVDYSFPVSPGWKYLRLYFYPTRYESGFDAASSFFSVTVNGFTLLKNFSADLTVK  144

Query  616  A  618
            A
Sbjct  145  A  145



>ref|XP_006338349.1| PREDICTED: receptor-like protein kinase FERONIA-like [Solanum 
tuberosum]
Length=856

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 73/118 (62%), Gaps = 4/118 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGT---GKSSTSSADSQKPSVPQVPF  429
            Y  T  +LLNCG     TD+ +R+W TD      L +     S+T++A  Q PSV +VP+
Sbjct  26   YNATVYVLLNCGAQSATTDETDRRWDTDTHFPNFLPSDFSNISTTATASEQDPSVNRVPY  85

Query  430  MT-ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSA  600
             T AR  +S FTY+F V+ G KFLRLYFYPA+Y+G N   S FSV     TLL+NFSA
Sbjct  86   TTGARIMKSRFTYTFRVSPGAKFLRLYFYPANYSGFNKAESFFSVTANHLTLLRNFSA  143



>gb|ACA25085.1| serine/threonine protein kinase A, partial [Populus tremula]
 gb|ACA25093.1| serine/threonine protein kinase A, partial [Populus tremula]
 gb|ACA25094.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 74/120 (62%), Gaps = 4/120 (3%)
 Frame = +1

Query  268  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  444
            +D  +L CG     TD D R W  D  +K +   G S TS+A++Q PS+P  +P+MTAR 
Sbjct  34   SDSYILACGASGAGTDSDGRDWQPD--AKHINSPGNSITSTAENQDPSLPSTIPYMTARI  91

Query  445  FQSEFTYSFPVAS-GRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
            F +E TY F V +  R ++RL+FYP++YN L+   S FSV    +TLL NFSA  T +AL
Sbjct  92   FTTESTYKFSVPTKSRLWVRLHFYPSTYNSLDPNYSYFSVTANSFTLLNNFSASITAQAL  151



>gb|ACA25082.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 74/120 (62%), Gaps = 4/120 (3%)
 Frame = +1

Query  268  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  444
            +D  +L CG     TD D R W  D  +K +   G S TS+A++Q PS+P  +P+MTAR 
Sbjct  34   SDSYILACGASGAGTDSDGRDWQPD--AKHINSPGNSITSTAENQDPSLPSTIPYMTARI  91

Query  445  FQSEFTYSFPVAS-GRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
            F +E TY F V +  R ++RL+FYP++YN L+   S FSV    +TLL NFSA  T +AL
Sbjct  92   FTTESTYKFSVPTKSRLWVRLHFYPSTYNSLDPNYSYFSVTANSFTLLNNFSASITAQAL  151



>ref|XP_003614249.1| Kinase-like protein [Medicago truncatula]
 gb|AES97207.1| feronia receptor-like kinase [Medicago truncatula]
Length=833

 Score =   104 bits (260),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 56/128 (44%), Positives = 74/128 (58%), Gaps = 6/128 (5%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDG-VTDQDNRKWTTDVGSKFLLG----TGKSSTSSA-DSQKPSVPQ  420
            YVP++ I+LNCG     +   D R W  D+ S ++        KS T+ A  S   S+P+
Sbjct  28   YVPSENIVLNCGSNTSELVQYDGRIWNGDIDSPYVPSYEDIINKSLTAKALSSNLESIPE  87

Query  421  VPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSA  600
            VP+MTAR FQS+FTY F V SG KF+RL+FYP SY   N + +  SV  G +TLL NFS 
Sbjct  88   VPYMTARIFQSQFTYRFNVTSGPKFIRLHFYPFSYLDFNISKAFLSVTAGNFTLLHNFSV  147

Query  601  GQTTEALN  624
                +  N
Sbjct  148  SLNVDYFN  155



>gb|ACA25099.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 74/120 (62%), Gaps = 4/120 (3%)
 Frame = +1

Query  268  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  444
            +D  +L CG     TD D R W  D  +K +   G S TS+A++Q PS+P  +P+MTAR 
Sbjct  34   SDSYILACGASGAGTDSDGRDWQPD--AKHINSPGNSITSTAENQDPSLPSTIPYMTARI  91

Query  445  FQSEFTYSFPVAS-GRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
            F +E TY F V +  R ++RL+FYP++YN L+   S FSV    +TLL NFSA  T +AL
Sbjct  92   FTTESTYKFSVPTKSRLWVRLHFYPSTYNSLDPNYSYFSVTANSFTLLNNFSASITAQAL  151



>gb|ACA25100.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 98.6 bits (244),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 74/120 (62%), Gaps = 4/120 (3%)
 Frame = +1

Query  268  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  444
            +D  +L CG     TD D R W  D  +K +   G S TS+A++Q PS+P  +P+MTAR 
Sbjct  34   SDSYILACGASGAGTDSDGRDWQPD--AKHINSPGNSITSTAENQDPSLPSTIPYMTARI  91

Query  445  FQSEFTYSFPVAS-GRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
            F +E TY F V +  R ++RL+FYP++YN L+   S FSV    +TLL NFSA  T +AL
Sbjct  92   FTTESTYKFSVPTKSRLWVRLHFYPSTYNSLDPNYSYFSVTANSFTLLNNFSASITAQAL  151



>emb|CDY37884.1| BnaC04g31220D [Brassica napus]
Length=867

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 70/123 (57%), Gaps = 3/123 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSS-TSSADSQKPSVPQVPFMT  435
            YVPTD  L NCG      D   R W  +  +        +S  S A  Q   VPQVP+MT
Sbjct  44   YVPTDIFLFNCGETSNQMDISGRNWMAEQPNILPSNAAIASFVSHASFQGSGVPQVPYMT  103

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNG--LNATNSVFSVRVGEYTLLKNFSAGQT  609
            AR F+ +FTYSFPV+ G KFLRLYFYP  Y+     A NS FSV V  +TLLKNF A  T
Sbjct  104  ARIFRHDFTYSFPVSPGWKFLRLYFYPTRYSSDLEAAVNSYFSVTVNGFTLLKNFRADLT  163

Query  610  TEA  618
             +A
Sbjct  164  AKA  166



>gb|EMT13360.1| hypothetical protein F775_08521 [Aegilops tauschii]
Length=499

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 69/118 (58%), Gaps = 1/118 (1%)
 Frame = +1

Query  274  KILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQ  450
            ++ L+CG     TD D R W  D  SKFL        + A  Q PS+P  VP+M AR F 
Sbjct  33   QVRLSCGASASATDSDGRAWDGDSASKFLTSANAGVAARASYQDPSLPSSVPYMMARVFA  92

Query  451  SEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALN  624
            S  TY+F V  GR FLRL+FYP  Y   NA++++F V  G  TLL++F+A Q+  AL+
Sbjct  93   SSHTYTFLVRPGRAFLRLFFYPTDYGNRNASSALFGVTAGGVTLLRDFNASQSALALD  150



>gb|ACA25080.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 98.2 bits (243),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 73/120 (61%), Gaps = 4/120 (3%)
 Frame = +1

Query  268  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  444
            +D  +L CG     TD D R W  D  +K +   G S TS+A+ Q PS+P  +P+MTAR 
Sbjct  34   SDSYILACGASGAGTDSDGRDWQPD--AKHINSPGNSITSTAEKQDPSLPSTIPYMTARI  91

Query  445  FQSEFTYSFPVAS-GRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
            F +E TY F V +  R ++RL+FYP++YN L+   S FSV    +TLL NFSA  T +AL
Sbjct  92   FTTESTYKFSVPTKSRLWVRLHFYPSTYNSLDPNYSYFSVTANSFTLLNNFSASITAQAL  151



>ref|XP_011071382.1| PREDICTED: receptor-like protein kinase ANXUR1 [Sesamum indicum]
Length=871

 Score =   103 bits (258),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 75/119 (63%), Gaps = 4/119 (3%)
 Frame = +1

Query  271  DKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTF  447
            D  +L CG     TD + RKW +D  +KFL+    S +++A SQ PS+P  VP+MTAR F
Sbjct  46   DSFVLACGATADATDSNGRKWASD--AKFLISPNSSLSATAQSQDPSLPSTVPYMTARIF  103

Query  448  QSEFTYSFPVASG-RKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
            +SE TY F V+   R ++RL+FYP+ Y+  +   S FSV  G +TLL NFSA  T EAL
Sbjct  104  KSEATYKFSVSPNFRHWIRLHFYPSFYDNFDTLRSFFSVTAGGFTLLNNFSASITAEAL  162



>ref|XP_009372137.1| PREDICTED: receptor-like protein kinase ANXUR1 [Pyrus x bretschneideri]
Length=879

 Score =   103 bits (258),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 80/120 (67%), Gaps = 4/120 (3%)
 Frame = +1

Query  268  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVP-QVPFMTART  444
            ++  ++ CG   G TD D R+W  D  S+FL  +  S T++A  Q PS+P Q+P+M+AR 
Sbjct  49   SESYIIACGSSSGGTDSDGRRWVPD--SRFLSSSENSKTATAQYQDPSLPSQIPYMSARI  106

Query  445  FQSEFTYSFPVASGRKFL-RLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
            F S  +Y F V+  ++ L RL+FYP+SY+GL+A+NS F V    ++LL+NFSA  TT+AL
Sbjct  107  FNSAASYKFFVSPRQRLLVRLHFYPSSYDGLDASNSYFDVIANGFSLLRNFSAAITTQAL  166



>gb|ACA25089.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 97.8 bits (242),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 75/120 (63%), Gaps = 4/120 (3%)
 Frame = +1

Query  268  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  444
            +D  +L CG     TD D R W  D  +K +   G S TS+A++Q PS+P  +P+MTAR 
Sbjct  34   SDSYILACGASGAGTDSDGRDWQPD--AKHINSPGNSITSTAENQDPSLPSTIPYMTARI  91

Query  445  FQSEFTYSFPVAS-GRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
            F +E TY F V +  R ++RL+FYP++Y+ L+  NS FSV    +TLL +FSA  T +AL
Sbjct  92   FTTESTYKFSVPTKSRLWVRLHFYPSTYSSLDPNNSYFSVTANSFTLLNDFSASITAQAL  151



>ref|XP_004976623.1| PREDICTED: receptor-like protein kinase FERONIA-like [Setaria 
italica]
Length=509

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 68/118 (58%), Gaps = 6/118 (5%)
 Frame = +1

Query  274  KILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQ  450
            +I +NCG      D D R W  D  S      G    + A  + PS+P  VP+MTAR F 
Sbjct  34   QIRVNCGASVSAADSDGRTWDRDAPS-----VGGGVAAGAPYEDPSLPSAVPYMTARVFG  88

Query  451  SEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALN  624
            S  TYSFPV  GR FLRL+FYPA Y G  A +++F V  G  TLL++F+A QT  ALN
Sbjct  89   SAHTYSFPVRPGRVFLRLFFYPADYGGRGAGDALFGVAAGGVTLLRDFNASQTALALN  146



>ref|XP_008390536.1| PREDICTED: receptor-like protein kinase ANXUR1 [Malus domestica]
Length=860

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 79/120 (66%), Gaps = 4/120 (3%)
 Frame = +1

Query  268  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVP-QVPFMTART  444
            ++  ++ CG   G TD D R+W  D  S+FL  +  S T++A  Q PS+P Q+P+M+AR 
Sbjct  30   SESYIIACGSSSGGTDSDGRRWVPD--SRFLKSSENSKTATAQYQDPSLPSQIPYMSARI  87

Query  445  FQSEFTYSFPVASGRKFL-RLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
            F S  +Y F V+  ++ L RL+FYP+SY+GL A+NS F V    ++LL+NFSA  TT+AL
Sbjct  88   FNSAASYKFFVSPRQRLLVRLHFYPSSYDGLEASNSYFDVIANGFSLLRNFSAAITTQAL  147



>emb|CBI21198.3| unnamed protein product [Vitis vinifera]
Length=932

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 74/122 (61%), Gaps = 2/122 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF-LLGTGKSST-SSADSQKPSVPQVPFM  432
            Y PTD   ++CG    +   DNR W  D  S+F L+   K+S  S A    PSV  VPF 
Sbjct  61   YNPTDIYTVDCGASGNLKAWDNRIWIGDTNSRFSLIEKNKASIISKAAKTSPSVDPVPFA  120

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            TAR  + +F Y FPV +G+KF+RL+FYP+S  G + + + FSV++G YTLL NFSA    
Sbjct  121  TARLSRFQFAYIFPVTTGQKFIRLHFYPSSVAGFDRSKAFFSVKIGGYTLLNNFSAALAA  180

Query  613  EA  618
            +A
Sbjct  181  DA  182



>gb|ACA25079.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 74/120 (62%), Gaps = 4/120 (3%)
 Frame = +1

Query  268  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  444
            +D  +L  G     TD D R W TD  +K +   G S TS+A+ Q PS+P  +P+MTAR 
Sbjct  34   SDSYILAYGASGAGTDSDGRDWQTD--AKNINSPGNSITSTAEKQDPSLPSTIPYMTARI  91

Query  445  FQSEFTYSFPVAS-GRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
            F +E TY F V +  R ++RL+FYP++YN L+  NS FSV    +TLL NFSA  T +AL
Sbjct  92   FTTESTYKFSVPTKSRLWVRLHFYPSTYNSLDPNNSYFSVTANSFTLLNNFSASITAQAL  151



>ref|XP_003568703.1| PREDICTED: receptor-like protein kinase ANXUR1 [Brachypodium 
distachyon]
Length=871

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 78/126 (62%), Gaps = 4/126 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSS-TSSADSQKPSVPQ-VPFM  432
            Y PT+ IL++CG      D   RKW  D  SK+L   GKSS  ++AD+Q PS+P  VP+M
Sbjct  28   YEPTETILVDCGSEKDGQDAQGRKWVMDKDSKWLGDGGKSSMMAAADAQDPSLPSPVPYM  87

Query  433  TARTFQSEFTYSFPVASG-RKFLRLYFYPASYNGLNATNSVFSVRVGE-YTLLKNFSAGQ  606
            +AR F  E  Y+FPVA   R ++RL+FYPA+Y+ L A    FSV      TLL+NFS   
Sbjct  88   SARVFTKEAVYTFPVADADRHWVRLHFYPAAYHDLPAEQFFFSVSTASGITLLRNFSVYI  147

Query  607  TTEALN  624
            T +AL+
Sbjct  148  TVKALS  153



>gb|ACA25097.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 74/120 (62%), Gaps = 4/120 (3%)
 Frame = +1

Query  268  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  444
            +D  +L CG     TD D R W  D  +K +   G S TS+A++Q PS+P  +P+MTAR 
Sbjct  34   SDSYILACGASGAGTDSDGRDWQPD--AKHINSPGNSITSTAENQDPSLPSTIPYMTARI  91

Query  445  FQSEFTYSFPVAS-GRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
            F SE TY F V +  R ++RL+FYP++Y+ L+   S FSV    +TLL NFSA  T +AL
Sbjct  92   FTSESTYKFSVPTKSRLWVRLHFYPSTYSSLDPNYSYFSVTANSFTLLNNFSASITAQAL  151



>gb|ACA25084.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 74/120 (62%), Gaps = 4/120 (3%)
 Frame = +1

Query  268  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  444
            +D  +L CG     TD D R W  D  +K +   G S TS+A++Q PS+P  +P+MTAR 
Sbjct  34   SDSYILACGASGAGTDSDGRDWQPD--AKHINSPGNSITSTAENQDPSLPSTIPYMTARI  91

Query  445  FQSEFTYSFPVAS-GRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
            F SE TY F V +  R ++RL+FYP++Y+ L+   S FSV    +TLL NFSA  T +AL
Sbjct  92   FTSESTYKFSVPTKSRLWVRLHFYPSTYSSLDPNYSYFSVTANSFTLLNNFSASITAQAL  151



>gb|KJB80425.1| hypothetical protein B456_013G096400 [Gossypium raimondii]
Length=519

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 70/117 (60%), Gaps = 4/117 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPD-GVTDQDNRKWTTDVGSKFLLGTGKSS--TSSADSQKPSVPQVPF  429
            Y P + ILL+CG         D R WT D  S F     +SS   S A  ++ SV +VP+
Sbjct  24   YFPLETILLDCGSSALRALSYDGRNWTND-SSHFGASNSESSFAMSRASLEETSVAEVPY  82

Query  430  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSA  600
            MTAR F S FTY+F V  G KF+RL+FYP SY  LNA+ S  +V  G YTLL+NFSA
Sbjct  83   MTARLFHSRFTYTFNVTPGSKFIRLHFYPDSYMNLNASKSFLTVTAGNYTLLRNFSA  139



>ref|XP_002439522.1| hypothetical protein SORBIDRAFT_09g009320 [Sorghum bicolor]
 gb|EES17952.1| hypothetical protein SORBIDRAFT_09g009320 [Sorghum bicolor]
Length=870

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 78/126 (62%), Gaps = 4/126 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSST-SSADSQKPSVPQ-VPFM  432
            Y P + IL++CG      D D RKW TD GS +L+  GKSS  + AD Q PS+P  VP+M
Sbjct  27   YKPPESILVDCGSAKEGQDADGRKWVTDQGSNWLIDGGKSSIMADADVQDPSLPSPVPYM  86

Query  433  TARTFQSEFTYSFPVA-SGRKFLRLYFYPASYNGLNATNSVFSVRVGE-YTLLKNFSAGQ  606
            +AR F  E  Y+F +  + R +LRL+FYPA+Y+G+ A    FSV      TLL+NFS   
Sbjct  87   SARVFTKEAVYNFSIGDTDRHWLRLHFYPAAYHGVPAEQFFFSVSTSTGITLLRNFSVYI  146

Query  607  TTEALN  624
            T +AL+
Sbjct  147  TAKALS  152



>ref|XP_010552466.1| PREDICTED: putative receptor-like protein kinase At5g39000 [Tarenaya 
hassleriana]
Length=964

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 78/122 (64%), Gaps = 7/122 (6%)
 Frame = +1

Query  259  YVPTDKILLNCGGP-DGVTDQDNRKWTTDVGSKFLLGT---GKSSTSSADSQKPSVPQVP  426
            Y  TD +L+NCG     + DQ  R W+ +   + LL     G S  ++A  Q+PSV QVP
Sbjct  85   YNATDLLLVNCGATGSNIADQSGRIWSAE--DRRLLSANSNGSSFPATASVQEPSVEQVP  142

Query  427  FMTARTFQSEFTYSFPVASGRKFLRLYFYPASY-NGLNATNSVFSVRVGEYTLLKNFSAG  603
            +MTAR F+S+F YSFPV+ G KF+RLYFYP  Y +  +A NS F+V V  ++L++NFSA 
Sbjct  143  YMTARIFRSDFRYSFPVSPGWKFVRLYFYPTRYGSDFDAVNSYFAVTVNGFSLMRNFSAS  202

Query  604  QT  609
             T
Sbjct  203  LT  204



>ref|XP_009799586.1| PREDICTED: receptor-like protein kinase ANXUR1 [Nicotiana sylvestris]
Length=860

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 74/116 (64%), Gaps = 5/116 (4%)
 Frame = +1

Query  280  LLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPS-VPQVPFMTARTFQSE  456
            +L CG     TD D R W+ D      L +G S TS A  Q PS V  +P+MTAR F+++
Sbjct  36   VLACGATSNATDADGRIWSPDSTH---LPSGNSITSKAKYQDPSLVSDIPYMTARIFKTQ  92

Query  457  FTYSFPVA-SGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
             TYSFPV+   R ++RL+FYP++Y+  N +NS FSV VG +TLL NFSA  T +AL
Sbjct  93   TTYSFPVSPKSRHWIRLHFYPSTYDNFNCSNSFFSVTVGGFTLLNNFSASITAQAL  148



>ref|XP_006358215.1| PREDICTED: receptor-like protein kinase ANXUR1-like [Solanum 
tuberosum]
Length=854

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 75/116 (65%), Gaps = 3/116 (3%)
 Frame = +1

Query  280  LLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPS-VPQVPFMTARTFQSE  456
            +L+CG     TD D R W+ D  + F   +G S TS A  Q PS +  +P+MTAR F+++
Sbjct  33   VLSCGATSNATDADGRIWSPD-STYFPSSSGNSITSKAKYQDPSLISDIPYMTARIFKNQ  91

Query  457  FTYSFPVA-SGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
             TYSFPV+   R ++RL+FYP+SY+  N +NS FSV +  +TLL NFSA  T +AL
Sbjct  92   TTYSFPVSPKSRHWIRLHFYPSSYDNFNCSNSFFSVNIAGFTLLNNFSASITAQAL  147



>ref|XP_003633771.1| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=894

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 77/123 (63%), Gaps = 4/123 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFL-LGTGKSSTSSADSQKPSVPQVPFMT  435
            Y PT+   +NCG  +   D   R WT DVGSKF  L  GK ST+S  + KPS   V + T
Sbjct  36   YTPTENFAINCGSSENWQDL-GRNWTGDVGSKFSPLEKGKLSTTS-QADKPSSSSVLYST  93

Query  436  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRV-GEYTLLKNFSAGQTT  612
            AR  + EFTYSFP+ +G+KF+RL+FYP+SY   + + + FSV+  G YTLL NFSA    
Sbjct  94   ARLSRYEFTYSFPLTAGQKFIRLHFYPSSYGEFDGSKAFFSVKTGGGYTLLSNFSAALAA  153

Query  613  EAL  621
            E L
Sbjct  154  EDL  156



>ref|XP_003568697.1| PREDICTED: receptor-like protein kinase FERONIA [Brachypodium 
distachyon]
Length=878

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 71/118 (60%), Gaps = 2/118 (2%)
 Frame = +1

Query  274  KILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQ  450
             + LNCG      D + R W  D  SKF     K  T+ A  Q PS+P  VPFMTAR F 
Sbjct  32   HVALNCGASGQNNDDNGRTWDGDTSSKFAPLV-KGVTAPASYQHPSLPSTVPFMTARIFT  90

Query  451  SEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALN  624
            S +TYSFPV++GR F+RLYFYP +Y     +++ FSV     +LL +F+A QT +A+N
Sbjct  91   SNYTYSFPVSAGRMFVRLYFYPIAYGNYAVSDAFFSVTTRNLSLLNDFNASQTAQAIN  148



>ref|XP_010684237.1| PREDICTED: receptor-like protein kinase ANXUR1 [Beta vulgaris 
subsp. vulgaris]
Length=865

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 72/121 (60%), Gaps = 4/121 (3%)
 Frame = +1

Query  265  PTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVP-QVPFMTAR  441
            P   I ++CG      D D R+W TD  +K+L   G S +  A  Q PS+P ++P+M+AR
Sbjct  29   PNVAIAIDCGATGQGKDGDGRQWDTD--NKYLPSQGNSQSVKAQFQDPSLPSEIPYMSAR  86

Query  442  TFQSEFTYSFPVAS-GRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEA  618
               SE  Y FP+ S  R FLRL+FYP SYN  + +NS FSV    +TLL NFSA  T EA
Sbjct  87   ISNSEMAYKFPINSTSRYFLRLHFYPTSYNSFSISNSYFSVTAAGFTLLNNFSASVTAEA  146

Query  619  L  621
            L
Sbjct  147  L  147



>gb|ACA25092.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 73/120 (61%), Gaps = 4/120 (3%)
 Frame = +1

Query  268  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  444
            +D  +L CG     TD D R W  D  +K +   G S TS+A++Q PS+P  +P+MTAR 
Sbjct  34   SDSYILACGASGAGTDSDGRDWQPD--AKHINSPGNSITSTAENQDPSLPSTIPYMTARI  91

Query  445  FQSEFTYSFPVAS-GRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
            F +E TY F V +  R ++RL+FYP++YN L+   S FSV    +TLL NFSA  T + L
Sbjct  92   FTTESTYKFSVPTKSRLWVRLHFYPSTYNSLDPNYSYFSVTANSFTLLNNFSASITAQGL  151



>gb|ACA25087.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 74/120 (62%), Gaps = 4/120 (3%)
 Frame = +1

Query  268  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  444
            +D  +L CG     TD D R W  D  +K +   G S TS+A++Q PS+P  +P+MTAR 
Sbjct  34   SDSYILACGASGAGTDSDGRDWQPD--AKHINSPGNSITSTAENQDPSLPSTIPYMTARI  91

Query  445  FQSEFTYSFPVAS-GRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
            F +E TY F V +  R ++RL+FYP++Y+ L+   S FSV    +TLL NFSA  T +AL
Sbjct  92   FTTESTYKFSVPTKSRLWVRLHFYPSTYSSLDPNYSYFSVTANSFTLLNNFSASITAQAL  151



>gb|ACA25090.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 73/120 (61%), Gaps = 4/120 (3%)
 Frame = +1

Query  268  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  444
            +D  +L CG     TD D R W  D  +K +   G S TS+A++Q PS+P  +P+MTAR 
Sbjct  34   SDSYILACGASGAGTDSDGRDWQPD--AKHINSPGNSITSTAENQDPSLPSTIPYMTARI  91

Query  445  FQSEFTYSFPVAS-GRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
            F +E TY F V +  R ++RL+FYP++YN L+   S FSV    +TLL NFS   T +AL
Sbjct  92   FTTESTYKFSVPTKSRLWVRLHFYPSTYNSLDPNYSYFSVTANSFTLLNNFSGSITAQAL  151



>emb|CDX74491.1| BnaA04g08980D [Brassica napus]
Length=832

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 70/121 (58%), Gaps = 1/121 (1%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  438
            Y PTD  L+NCG      D  ++ WT+D            S SS  S +  VPQVP+ TA
Sbjct  27   YKPTDLFLINCGTSSDTIDSQSQTWTSDQQHLLTSKLKNLSFSSDASYQEEVPQVPYTTA  86

Query  439  RTFQSEFTYSFPVASGRKFLRLYFYPASY-NGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            R F S   YSFPV+ G K+LRLYFYP  Y +G +  +S FSV V  +TLLKNFSA  T +
Sbjct  87   RIFLSNVNYSFPVSPGWKYLRLYFYPTRYESGFDTASSFFSVTVNGFTLLKNFSADLTVK  146

Query  616  A  618
            A
Sbjct  147  A  147



>ref|XP_009139818.1| PREDICTED: putative receptor-like protein kinase At5g39000 [Brassica 
rapa]
Length=832

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 70/121 (58%), Gaps = 1/121 (1%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  438
            Y PTD  L+NCG      D  ++ WT+D            S SS  S +  VPQVP+ TA
Sbjct  27   YKPTDLFLINCGTSSDTIDSQSQTWTSDQQHLLTSKLKNLSFSSDASYQEEVPQVPYTTA  86

Query  439  RTFQSEFTYSFPVASGRKFLRLYFYPASY-NGLNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            R F S   YSFPV+ G K+LRLYFYP  Y +G +  +S FSV V  +TLLKNFSA  T +
Sbjct  87   RIFLSNVNYSFPVSPGWKYLRLYFYPTRYESGFDTASSFFSVTVNGFTLLKNFSADLTVK  146

Query  616  A  618
            A
Sbjct  147  A  147



>gb|ACA25096.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 73/120 (61%), Gaps = 4/120 (3%)
 Frame = +1

Query  268  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  444
            +D  +L CG     TD D R W  D  +K +   G S TS+A++Q PS P  +P+MTAR 
Sbjct  34   SDSYILACGASGAGTDSDGRDWQPD--AKHINSPGNSITSTAENQDPSFPSTIPYMTARI  91

Query  445  FQSEFTYSFPVAS-GRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
            F SE TY F V +  R ++RL+FYP++Y+ L+  NS FSV    +TLL NFS   T++ L
Sbjct  92   FTSESTYKFSVPTKSRLWVRLHFYPSTYSSLDPNNSYFSVTANSFTLLNNFSGSITSQGL  151



>gb|EMT28751.1| Receptor-like protein kinase FERONIA [Aegilops tauschii]
Length=737

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 70/124 (56%), Gaps = 2/124 (2%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVP-QVPFM  432
            D + +  ILLNCGG     D   R W  D  SKF     +   +SA  Q PS+P  VP+M
Sbjct  6    DSMDSGLILLNCGGSGQEVDSGGRTWDGDNSSKFTPSV-EGVAASASYQDPSLPSMVPYM  64

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            TAR F S +TYSFPV  GR FLRLYFYP +Y      ++ F V      LL +F+A QT 
Sbjct  65   TARIFTSNYTYSFPVRPGRMFLRLYFYPVAYGNYVTPDAFFGVMAENLVLLNSFNASQTA  124

Query  613  EALN  624
            +A+N
Sbjct  125  QAIN  128



>gb|AFW77551.1| putative receptor-like protein kinase family protein [Zea mays]
Length=870

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 74/126 (59%), Gaps = 4/126 (3%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSST-SSADSQKPSVPQ-VPFM  432
            Y PT+ IL+NCG      D D RKW  D    +L+  GKSS    AD Q PS+P  VP+M
Sbjct  26   YKPTESILVNCGSAKEGKDVDGRKWAADQDKSWLVDAGKSSIMGDADVQDPSLPSPVPYM  85

Query  433  TARTFQSEFTYSFPVASG-RKFLRLYFYPASYNGLNATNSVFSVRVGE-YTLLKNFSAGQ  606
            TAR F  E  Y+F V    R +LRL+FYPA+Y+G+ A    FSV      TLL+NFS   
Sbjct  86   TARVFTKEAMYNFSVGDADRHWLRLHFYPAAYHGVPAEQFFFSVSTSTGITLLRNFSVYI  145

Query  607  TTEALN  624
            T +AL+
Sbjct  146  TAKALS  151



>gb|ACA25098.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 72/120 (60%), Gaps = 4/120 (3%)
 Frame = +1

Query  268  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  444
            +D  +L CG     TD D R W  D  +K +   G S TS+A+ Q PS P  +P+MTAR 
Sbjct  34   SDSYILACGASGAGTDSDGRDWQPD--AKHINSPGNSITSTAEKQDPSFPSTIPYMTARI  91

Query  445  FQSEFTYSFPVAS-GRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
            F SE TY F V +  R ++RL+FYP++Y+ L+  NS FSV    +TLL NFS   T++ L
Sbjct  92   FTSESTYKFSVPTKSRLWVRLHFYPSTYSSLDPNNSYFSVTANSFTLLNNFSGSITSQGL  151



>gb|KDP37883.1| hypothetical protein JCGZ_05765 [Jatropha curcas]
Length=441

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 72/126 (57%), Gaps = 7/126 (6%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQ-DNRKWTTDVGSKFLLGTGKSSTSS---ADSQKPSVPQVP  426
            Y P + I L+CG PD  T   D R WT+D      +   KS+ +    + S +P VPQVP
Sbjct  11   YEPLENIALDCGSPDLRTLPFDGRNWTSDAS---FISQSKSTVAPIMVSSSIEPGVPQVP  67

Query  427  FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQ  606
            + TAR F SEFTY+F +  G KFLRL+FYP SY G +A+    SV  G +TLL NFSA  
Sbjct  68   YKTARLFFSEFTYTFNLTPGPKFLRLHFYPTSYPGFDASKEFLSVMEGNHTLLSNFSASL  127

Query  607  TTEALN  624
                 N
Sbjct  128  AANCKN  133



>ref|XP_002316044.1| Pto-like kinase OGw family protein [Populus trichocarpa]
 gb|EEF02215.1| Pto-like kinase OGw family protein [Populus trichocarpa]
Length=858

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 77/120 (64%), Gaps = 4/120 (3%)
 Frame = +1

Query  268  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  444
            +D  +L CG     TD D+R W  D  +K +  +G S TS+A++Q PS+P  +P+MTAR 
Sbjct  34   SDSYILACGASGAGTDSDSRDWQPD--AKHINSSGNSITSTAENQDPSLPSTIPYMTARI  91

Query  445  FQSEFTYSFPVAS-GRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
            F SE TY F V +  R ++RL+FYP++Y+ L+  NS FSV    +TLL NFSA  T +AL
Sbjct  92   FTSESTYKFSVPTKSRLWVRLHFYPSTYSSLDPNNSYFSVTANSFTLLNNFSASITAQAL  151



>gb|ACA25081.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 95.5 bits (236),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 73/120 (61%), Gaps = 4/120 (3%)
 Frame = +1

Query  268  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  444
            +D  +L CG     TD D R W  D  +K +   G S TS+A++Q PS+P  +P+MTAR 
Sbjct  34   SDSYILACGASGAGTDSDGRDWQPD--AKHINSPGNSITSTAENQDPSLPSTIPYMTARI  91

Query  445  FQSEFTYSFPVAS-GRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
            F +E TY F V +  R ++RL+FYP++Y  L+  NS FSV    +TLL NFSA  T + L
Sbjct  92   FTTESTYKFSVPTKSRLWVRLHFYPSTYYSLDPNNSYFSVTANSFTLLNNFSASITGQGL  151



>ref|XP_011099029.1| PREDICTED: receptor-like protein kinase FERONIA [Sesamum indicum]
Length=885

 Score =   101 bits (251),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 73/116 (63%), Gaps = 2/116 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLL--GTGKSSTSSADSQKPSVPQVPFM  432
            Y  TD ILLNCG P  + D  +R W +D  S++        S +S A S  PSV  VP+ 
Sbjct  29   YTATDLILLNCGSPSNLNDTSSRSWDSDERSRYAPPNAASISLSSMASSMAPSVFHVPYQ  88

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSA  600
            TAR F+S FTY+FPV +G KFLRLYFYP +Y+G N + S FSV    +TLL NFSA
Sbjct  89   TARVFRSSFTYAFPVLTGPKFLRLYFYPDTYSGFNTSQSFFSVTANGFTLLSNFSA  144



>emb|CDP05402.1| unnamed protein product [Coffea canephora]
Length=892

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 71/121 (59%), Gaps = 2/121 (2%)
 Frame = +1

Query  259  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  438
            Y P D IL+NCG     T  D R W  D GSKF      ++ S A +       VP++TA
Sbjct  26   YSPIDYILINCGLSSNATSADGRNWYGDAGSKFT-PIDMANISLAVTATEQGLSVPYLTA  84

Query  439  RTFQSEFTYSFPVASGRKFLRLYFYPASYNG-LNATNSVFSVRVGEYTLLKNFSAGQTTE  615
            R  +S F+Y+FPV+ G+KF+RLYF PASY+   NAT S F+V    YTLL NFSA  T  
Sbjct  85   RIIRSNFSYTFPVSPGKKFVRLYFNPASYSSDFNATESFFAVMANNYTLLSNFSAFLTVS  144

Query  616  A  618
            A
Sbjct  145  A  145



>gb|EMS52253.1| Receptor-like protein kinase FERONIA [Triticum urartu]
Length=827

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 72/124 (58%), Gaps = 2/124 (2%)
 Frame = +1

Query  256  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVP-QVPFM  432
            D + +  +LLNCG      D   R W  D GSKF+  + K   ++A  Q PS+P  VP+M
Sbjct  28   DSMDSGLVLLNCGESKQDNDSSGRMWDGDTGSKFMT-SFKGIAANASYQDPSLPSMVPYM  86

Query  433  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  612
            +AR F S + YSFPV   R FLRLYFYP SY     +++ F V +G   LL +F+A QT 
Sbjct  87   SARIFTSNYKYSFPVNPDRMFLRLYFYPISYGNYTMSDAFFGVTLGNLVLLNSFNASQTA  146

Query  613  EALN  624
            +A N
Sbjct  147  QAAN  150



>ref|XP_002319081.1| kinase family protein [Populus trichocarpa]
 gb|EEE95004.1| kinase family protein [Populus trichocarpa]
Length=861

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 71/115 (62%), Gaps = 6/115 (5%)
 Frame = +1

Query  283  LNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPS-VPQVPFMTARTFQSEF  459
            LNCG  +G TD D RKW +DV  K++   G    + A  Q  S V +VP+M AR F SE 
Sbjct  35   LNCGSENGGTDGDGRKWESDV--KYI--AGNYPHARAQYQDSSIVSEVPYMDARIFTSEV  90

Query  460  TYSFPVA-SGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  621
            TY+ P+    R +LRLYFYP+ Y+GLN  NS FSV  G  TLL NFSA  T +AL
Sbjct  91   TYNLPIMLKTRYWLRLYFYPSEYSGLNIANSYFSVVAGGVTLLNNFSASITAQAL  145



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380