BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS024E02

Length=441
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP15610.1|  unnamed protein product                              81.6    6e-17   Coffea canephora [robusta coffee]
emb|CDP16188.1|  unnamed protein product                              81.6    4e-15   Coffea canephora [robusta coffee]
ref|XP_002324232.2|  hypothetical protein POPTR_0018s00440g           81.6    6e-15   
ref|XP_009607662.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     81.3    7e-15   Nicotiana tomentosiformis
ref|XP_009787108.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2          80.5    1e-14   Nicotiana sylvestris
emb|CDP16191.1|  unnamed protein product                              80.1    2e-14   Coffea canephora [robusta coffee]
emb|CDP16193.1|  unnamed protein product                              79.7    3e-14   Coffea canephora [robusta coffee]
emb|CDP16184.1|  unnamed protein product                              77.8    3e-14   Coffea canephora [robusta coffee]
ref|XP_011090957.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2 isof...  79.0    4e-14   Sesamum indicum [beniseed]
ref|XP_011090875.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2 isof...  79.0    4e-14   Sesamum indicum [beniseed]
ref|XP_011026626.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     78.2    8e-14   Populus euphratica
emb|CDP16194.1|  unnamed protein product                              78.2    9e-14   Coffea canephora [robusta coffee]
ref|XP_010314832.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...  76.3    3e-13   
ref|XP_006450666.1|  hypothetical protein CICLE_v10010188mg           76.3    3e-13   
ref|XP_006342519.1|  PREDICTED: probable peptide transporter At1g...  75.9    5e-13   Solanum tuberosum [potatoes]
emb|CDP16183.1|  unnamed protein product                              75.5    6e-13   Coffea canephora [robusta coffee]
ref|XP_004253108.2|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...  75.9    6e-13   Solanum lycopersicum
gb|KDO79779.1|  hypothetical protein CISIN_1g008264mg                 74.7    8e-13   Citrus sinensis [apfelsine]
gb|KDO79781.1|  hypothetical protein CISIN_1g008264mg                 74.7    9e-13   Citrus sinensis [apfelsine]
ref|XP_006476064.1|  PREDICTED: probable peptide transporter At1g...  75.1    1e-12   Citrus sinensis [apfelsine]
gb|KDO79777.1|  hypothetical protein CISIN_1g008264mg                 75.1    1e-12   Citrus sinensis [apfelsine]
ref|XP_006450663.1|  hypothetical protein CICLE_v10007857mg           74.7    1e-12   Citrus clementina [clementine]
ref|XP_010668254.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     74.7    1e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006476061.1|  PREDICTED: probable peptide transporter At1g...  73.9    3e-12   Citrus sinensis [apfelsine]
gb|KDO79783.1|  hypothetical protein CISIN_1g039943mg                 73.9    3e-12   Citrus sinensis [apfelsine]
ref|XP_006450665.1|  hypothetical protein CICLE_v10010641mg           73.9    3e-12   Citrus clementina [clementine]
ref|XP_008445025.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     72.8    6e-12   
ref|XP_011026625.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     72.8    6e-12   Populus euphratica
ref|XP_011081806.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     72.8    6e-12   Sesamum indicum [beniseed]
ref|XP_002324231.1|  hypothetical protein POPTR_0018s00430g           72.8    6e-12   
emb|CDP21289.1|  unnamed protein product                              72.8    7e-12   Coffea canephora [robusta coffee]
ref|XP_002516546.1|  nitrate transporter, putative                    72.4    7e-12   
ref|XP_002516544.1|  nitrate transporter, putative                    71.6    1e-11   Ricinus communis
ref|XP_010254052.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2          71.6    1e-11   Nelumbo nucifera [Indian lotus]
ref|XP_007012104.1|  Major facilitator superfamily protein            71.6    2e-11   
gb|EYU29274.1|  hypothetical protein MIMGU_mgv1a003369mg              70.9    2e-11   Erythranthe guttata [common monkey flower]
ref|XP_004150292.1|  PREDICTED: probable peptide transporter At1g...  70.5    3e-11   
gb|KGN62823.1|  hypothetical protein Csa_2G374650                     70.5    3e-11   Cucumis sativus [cucumbers]
ref|XP_004164040.1|  PREDICTED: probable peptide transporter At1g...  70.5    3e-11   
ref|XP_008445026.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     70.1    5e-11   
gb|AAL25616.1|  At1g52190/F9I5_4                                      67.4    6e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KGN62824.1|  hypothetical protein Csa_2G374660                     65.5    7e-11   Cucumis sativus [cucumbers]
ref|XP_010668239.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     69.3    7e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010648806.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2          68.6    9e-11   
gb|AAM20441.1|  putative transport protein                            68.9    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004170441.1|  PREDICTED: probable peptide transporter At1g...  68.2    2e-10   
ref|XP_008445024.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     68.2    2e-10   Cucumis melo [Oriental melon]
ref|XP_006306954.1|  hypothetical protein CARUB_v10008522mg           67.8    3e-10   
ref|XP_009145285.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like     65.5    3e-10   Brassica rapa
emb|CBI20867.3|  unnamed protein product                              68.2    3e-10   Vitis vinifera
ref|XP_010691376.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2          67.8    3e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010503915.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like     67.8    3e-10   Camelina sativa [gold-of-pleasure]
ref|XP_008462171.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     66.6    3e-10   Cucumis melo [Oriental melon]
gb|KGN45387.1|  hypothetical protein Csa_7G447020                     67.4    4e-10   Cucumis sativus [cucumbers]
ref|XP_002514272.1|  nitrate transporter, putative                    67.4    4e-10   Ricinus communis
ref|NP_175630.1|  nitrate transporter 1.11                            67.4    4e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891678.1|  proton-dependent oligopeptide transport fami...  67.4    4e-10   Arabidopsis lyrata subsp. lyrata
ref|XP_006486908.1|  PREDICTED: probable peptide transporter At1g...  67.0    4e-10   
ref|XP_010479721.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2 isof...  67.0    5e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010465628.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1 isof...  67.0    5e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010479719.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2 isof...  67.0    5e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010479720.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2 isof...  67.0    5e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010462057.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     67.0    5e-10   Camelina sativa [gold-of-pleasure]
dbj|BAB02684.1|  peptide/amino acid transporter-like protein          67.0    5e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188239.1|  nitrate transporter 1.12                            67.0    6e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AFK43183.1|  unknown                                               63.9    6e-10   Medicago truncatula
ref|XP_002324234.2|  hypothetical protein POPTR_0018s00490g           67.0    6e-10   Populus trichocarpa [western balsam poplar]
ref|XP_010487466.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like     67.0    6e-10   Camelina sativa [gold-of-pleasure]
ref|XP_006486905.1|  PREDICTED: probable peptide transporter At1g...  66.6    6e-10   
ref|XP_010648805.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like     66.6    6e-10   Vitis vinifera
ref|XP_006486906.1|  PREDICTED: probable peptide transporter At1g...  66.6    6e-10   Citrus sinensis [apfelsine]
gb|KFK38969.1|  hypothetical protein AALP_AA3G183300                  66.6    7e-10   Arabis alpina [alpine rockcress]
ref|XP_006486909.1|  PREDICTED: probable peptide transporter At1g...  66.6    7e-10   Citrus sinensis [apfelsine]
ref|XP_006422797.1|  hypothetical protein CICLE_v10029786mg           66.6    7e-10   
ref|XP_006422795.1|  hypothetical protein CICLE_v10029930mg           66.6    7e-10   
ref|XP_009147706.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2          66.6    8e-10   Brassica rapa
ref|XP_009114865.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like     65.5    8e-10   Brassica rapa
ref|XP_010519892.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.3          66.2    9e-10   Tarenaya hassleriana [spider flower]
gb|KGN62822.1|  hypothetical protein Csa_2G374640                     66.2    9e-10   Cucumis sativus [cucumbers]
ref|XP_002885127.1|  proton-dependent oligopeptide transport fami...  66.2    9e-10   Arabidopsis lyrata subsp. lyrata
ref|XP_004150293.1|  PREDICTED: probable peptide transporter At1g...  66.2    9e-10   
ref|XP_004164039.1|  PREDICTED: probable peptide transporter At1g...  66.2    9e-10   
ref|XP_004141840.1|  PREDICTED: probable peptide transporter At1g...  66.2    9e-10   
ref|XP_006422799.1|  hypothetical protein CICLE_v10028344mg           65.9    9e-10   Citrus clementina [clementine]
ref|XP_006297268.1|  hypothetical protein CARUB_v10013282mg           66.2    1e-09   Capsella rubella
ref|XP_009352687.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like     66.2    1e-09   Pyrus x bretschneideri [bai li]
emb|CDY28371.1|  BnaC01g35410D                                        65.5    1e-09   Brassica napus [oilseed rape]
ref|XP_009114884.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like...  65.5    2e-09   
emb|CDY51257.1|  BnaC03g77810D                                        65.5    2e-09   Brassica napus [oilseed rape]
gb|KFK35804.1|  hypothetical protein AALP_AA4G038900                  65.5    2e-09   Arabis alpina [alpine rockcress]
ref|XP_011026620.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...  65.5    2e-09   Populus euphratica
ref|XP_008352327.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like     64.3    2e-09   
emb|CDY70561.1|  BnaCnng68850D                                        65.1    2e-09   Brassica napus [oilseed rape]
ref|XP_009114876.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like...  65.5    2e-09   Brassica rapa
gb|KDP33700.1|  hypothetical protein JCGZ_07271                       65.1    2e-09   Jatropha curcas
ref|XP_011019627.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     65.1    2e-09   Populus euphratica
ref|XP_011026619.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like...  65.1    2e-09   Populus euphratica
ref|XP_007135664.1|  hypothetical protein PHAVU_010G147900g           65.1    2e-09   Phaseolus vulgaris [French bean]
gb|KJB27307.1|  hypothetical protein B456_004G290100                  65.1    3e-09   Gossypium raimondii
gb|KJB27308.1|  hypothetical protein B456_004G290200                  64.7    3e-09   Gossypium raimondii
ref|XP_002516008.1|  nitrate transporter, putative                    65.1    3e-09   Ricinus communis
ref|XP_004301550.2|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like     64.7    3e-09   Fragaria vesca subsp. vesca
ref|XP_004235680.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     64.7    3e-09   Solanum lycopersicum
ref|XP_003569868.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     64.7    3e-09   Brachypodium distachyon [annual false brome]
ref|XP_006833367.1|  hypothetical protein AMTR_s00109p00101980        64.7    3e-09   
gb|KJB54816.1|  hypothetical protein B456_009G050500                  63.2    4e-09   Gossypium raimondii
gb|KJB27309.1|  hypothetical protein B456_004G290200                  64.3    4e-09   Gossypium raimondii
ref|XP_006392949.1|  hypothetical protein EUTSA_v10011325mg           64.3    4e-09   Eutrema salsugineum [saltwater cress]
gb|KHG18966.1|  hypothetical protein F383_07419                       64.3    4e-09   Gossypium arboreum [tree cotton]
ref|XP_010500813.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     64.3    4e-09   Camelina sativa [gold-of-pleasure]
gb|KHG12398.1|  hypothetical protein F383_17450                       64.3    4e-09   Gossypium arboreum [tree cotton]
ref|XP_003567138.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     64.3    4e-09   Brachypodium distachyon [annual false brome]
ref|XP_007150639.1|  hypothetical protein PHAVU_005G169300g           64.3    5e-09   Phaseolus vulgaris [French bean]
ref|XP_003546946.1|  PREDICTED: probable peptide transporter At1g...  63.9    5e-09   Glycine max [soybeans]
gb|EPS73537.1|  proton-dependent oligopeptide transport family pr...  62.8    5e-09   Genlisea aurea
gb|KHM98742.1|  Putative peptide transporter                          63.9    5e-09   Glycine soja [wild soybean]
gb|KEH40281.1|  peptide/nitrate transporter plant                     63.9    5e-09   Medicago truncatula
ref|XP_008367055.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     60.8    6e-09   
gb|KDO66442.1|  hypothetical protein CISIN_1g007910mg                 63.9    6e-09   Citrus sinensis [apfelsine]
ref|XP_006475659.1|  PREDICTED: probable peptide transporter At1g...  63.9    6e-09   Citrus sinensis [apfelsine]
ref|XP_006451203.1|  hypothetical protein CICLE_v10007831mg           63.9    6e-09   Citrus clementina [clementine]
ref|XP_011072387.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2          63.5    8e-09   Sesamum indicum [beniseed]
ref|XP_006475660.1|  PREDICTED: probable peptide/nitrate transpor...  62.4    8e-09   
ref|XP_003597722.1|  hypothetical protein MTR_2g101560                63.5    8e-09   
ref|XP_008340555.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     62.0    9e-09   
ref|XP_007137205.1|  hypothetical protein PHAVU_009G108400g           63.2    9e-09   Phaseolus vulgaris [French bean]
ref|XP_010668942.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     63.2    1e-08   
ref|XP_010042085.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     62.4    2e-08   Eucalyptus grandis [rose gum]
ref|XP_010049663.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     62.4    2e-08   Eucalyptus grandis [rose gum]
ref|XP_007150641.1|  hypothetical protein PHAVU_005G169400g           62.4    2e-08   Phaseolus vulgaris [French bean]
ref|XP_010654644.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2          62.4    2e-08   Vitis vinifera
ref|XP_002308609.1|  hypothetical protein POPTR_0006s25670g           62.4    2e-08   Populus trichocarpa [western balsam poplar]
gb|KHN10207.1|  Putative peptide transporter                          62.4    2e-08   Glycine soja [wild soybean]
ref|XP_003522705.1|  PREDICTED: probable peptide transporter At1g...  62.4    2e-08   Glycine max [soybeans]
ref|XP_009146163.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1          62.0    2e-08   Brassica rapa
ref|XP_006371704.1|  hypothetical protein POPTR_0018s00460g           62.0    2e-08   
emb|CDX97728.1|  BnaA05g23510D                                        62.0    2e-08   
ref|XP_006371705.1|  hypothetical protein POPTR_0018s00470g           62.0    2e-08   
ref|XP_010047267.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...  62.0    2e-08   
gb|KDO66443.1|  hypothetical protein CISIN_1g007637mg                 62.0    2e-08   Citrus sinensis [apfelsine]
ref|XP_011008319.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2          62.0    2e-08   Populus euphratica
emb|CDY30141.1|  BnaC05g37210D                                        62.0    2e-08   Brassica napus [oilseed rape]
ref|XP_007024207.1|  Major facilitator superfamily protein, putative  62.0    2e-08   
gb|KCW79098.1|  hypothetical protein EUGRSUZ_C00542                   62.0    2e-08   Eucalyptus grandis [rose gum]
ref|XP_002299719.2|  hypothetical protein POPTR_0001s18640g           62.0    3e-08   Populus trichocarpa [western balsam poplar]
ref|XP_011013128.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     62.0    3e-08   Populus euphratica
ref|XP_007150640.1|  hypothetical protein PHAVU_005G169300g           61.6    3e-08   Phaseolus vulgaris [French bean]
ref|XP_011026621.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     62.0    3e-08   Populus euphratica
ref|XP_006371706.1|  hypothetical protein POPTR_0018s00470g           62.0    3e-08   
ref|XP_010050380.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     62.0    3e-08   
ref|XP_006451204.1|  hypothetical protein CICLE_v10007800mg           62.0    3e-08   Citrus clementina [clementine]
ref|XP_011026623.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     62.0    3e-08   Populus euphratica
ref|XP_008242634.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     62.0    3e-08   Prunus mume [ume]
ref|XP_007204860.1|  hypothetical protein PRUPE_ppa023390mg           61.6    3e-08   Prunus persica
ref|XP_011026624.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     61.6    3e-08   Populus euphratica
ref|XP_010545694.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     61.6    3e-08   Tarenaya hassleriana [spider flower]
ref|XP_004970044.1|  PREDICTED: probable peptide transporter At1g...  62.0    3e-08   Setaria italica
ref|XP_006465636.1|  PREDICTED: probable peptide transporter At1g...  61.6    3e-08   
ref|XP_004970047.1|  PREDICTED: probable peptide transporter At1g...  61.6    3e-08   
gb|KEH21351.1|  peptide/nitrate transporter plant                     61.6    3e-08   Medicago truncatula
ref|XP_004970046.1|  PREDICTED: probable peptide transporter At1g...  61.6    3e-08   Setaria italica
ref|XP_006465634.1|  PREDICTED: probable peptide transporter At1g...  61.6    3e-08   Citrus sinensis [apfelsine]
ref|XP_008793166.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     61.6    3e-08   Phoenix dactylifera
ref|XP_010098095.1|  putative peptide transporter                     61.6    3e-08   Morus notabilis
ref|XP_008466778.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...  61.6    3e-08   Cucumis melo [Oriental melon]
ref|XP_004970045.1|  PREDICTED: probable peptide transporter At1g...  61.6    3e-08   Setaria italica
ref|XP_007019700.1|  Nitrate transporter, putative                    61.6    3e-08   
ref|XP_008466783.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...  61.6    4e-08   Cucumis melo [Oriental melon]
ref|XP_004486756.1|  PREDICTED: probable peptide transporter At1g...  61.6    4e-08   
ref|XP_004486755.1|  PREDICTED: probable peptide transporter At1g...  61.6    4e-08   Cicer arietinum [garbanzo]
gb|EAY75907.1|  hypothetical protein OsI_03827                        61.2    4e-08   Oryza sativa Indica Group [Indian rice]
gb|KHN04222.1|  Putative peptide transporter                          61.2    4e-08   Glycine soja [wild soybean]
ref|XP_003530142.1|  PREDICTED: probable peptide transporter At1g...  61.2    4e-08   Glycine max [soybeans]
ref|XP_003597726.1|  hypothetical protein MTR_2g101610                61.2    4e-08   Medicago truncatula
ref|XP_007135665.1|  hypothetical protein PHAVU_010G148000g           61.2    4e-08   Phaseolus vulgaris [French bean]
ref|XP_003597725.1|  hypothetical protein MTR_2g101590                61.2    5e-08   Medicago truncatula
ref|XP_003529761.1|  PREDICTED: probable peptide transporter At1g...  61.2    5e-08   Glycine max [soybeans]
ref|XP_006426938.1|  hypothetical protein CICLE_v10025189mg           61.2    5e-08   Citrus clementina [clementine]
gb|KEH40283.1|  peptide/nitrate transporter plant                     61.2    5e-08   Medicago truncatula
ref|XP_008242632.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like     60.8    5e-08   
ref|XP_010105519.1|  Peptide transporter                              60.8    5e-08   Morus notabilis
ref|XP_008793165.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like     60.8    6e-08   
ref|NP_001044323.1|  Os01g0761400                                     60.8    6e-08   
ref|XP_010318543.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...  60.8    6e-08   Solanum lycopersicum
gb|KHN04221.1|  Putative peptide transporter                          60.8    6e-08   Glycine soja [wild soybean]
ref|XP_008389126.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     60.8    7e-08   
ref|XP_010318544.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...  60.8    7e-08   
ref|XP_004235682.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...  60.8    7e-08   
ref|XP_006837800.1|  hypothetical protein AMTR_s00104p00113760        60.5    7e-08   
ref|XP_006371703.1|  hypothetical protein POPTR_0018s00450g           60.5    7e-08   
ref|XP_010924574.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2          60.5    7e-08   
ref|XP_003531667.1|  PREDICTED: probable peptide transporter At1g...  60.5    8e-08   Glycine max [soybeans]
ref|XP_004252349.2|  PREDICTED: protein NRT1/ PTR FAMILY 1.2          60.5    8e-08   Solanum lycopersicum
ref|XP_006343083.1|  PREDICTED: probable peptide transporter At1g...  60.5    8e-08   
emb|CDP20348.1|  unnamed protein product                              58.9    9e-08   Coffea canephora [robusta coffee]
gb|KJB33640.1|  hypothetical protein B456_006G023500                  60.5    9e-08   Gossypium raimondii
emb|CDX69747.1|  BnaA10g20960D                                        60.8    9e-08   
ref|XP_007222295.1|  hypothetical protein PRUPE_ppa003339mg           60.1    1e-07   Prunus persica
ref|XP_006343082.1|  PREDICTED: probable peptide transporter At1g...  60.1    1e-07   
ref|XP_004149470.1|  PREDICTED: peptide transporter PTR2-like         60.1    1e-07   Cucumis sativus [cucumbers]
ref|XP_002324233.2|  hypothetical protein POPTR_0018s00480g           60.1    1e-07   
emb|CDX91207.1|  BnaC02g03900D                                        59.3    1e-07   
ref|XP_007222294.1|  hypothetical protein PRUPE_ppa003339mg           59.7    1e-07   
gb|AAM47310.1|AF377946_12  putative peptide transporter protein       59.3    1e-07   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051098.1|  Os03g0719900                                     60.1    1e-07   
ref|XP_006353565.1|  PREDICTED: probable peptide/nitrate transpor...  59.7    1e-07   
gb|EEE59822.1|  hypothetical protein OsJ_12376                        59.7    1e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009121934.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.3          59.7    1e-07   Brassica rapa
ref|XP_006343081.1|  PREDICTED: probable peptide transporter At1g...  59.7    1e-07   Solanum tuberosum [potatoes]
ref|XP_010243098.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     59.3    1e-07   
ref|XP_001774221.1|  predicted protein                                59.3    2e-07   
ref|XP_009789264.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     59.3    2e-07   Nicotiana sylvestris
ref|XP_009628173.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     59.3    2e-07   Nicotiana tomentosiformis
ref|XP_009788943.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like     59.3    2e-07   Nicotiana sylvestris
ref|XP_002521890.1|  peptide transporter, putative                    59.3    2e-07   Ricinus communis
ref|NP_196718.1|  major facilitator protein                           58.9    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004252058.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like     59.3    2e-07   
ref|XP_010230764.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     59.3    2e-07   
ref|XP_006343084.1|  PREDICTED: probable peptide transporter At1g...  58.9    2e-07   Solanum tuberosum [potatoes]
ref|XP_009628045.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     58.9    2e-07   Nicotiana tomentosiformis
emb|CDP20524.1|  unnamed protein product                              56.6    2e-07   Coffea canephora [robusta coffee]
ref|XP_007203564.1|  hypothetical protein PRUPE_ppa026167mg           58.9    2e-07   
ref|XP_006406868.1|  hypothetical protein EUTSA_v10020365mg           58.9    2e-07   Eutrema salsugineum [saltwater cress]
ref|XP_007024218.1|  Major facilitator superfamily protein            58.9    3e-07   
gb|KHN41645.1|  Putative peptide transporter                          58.9    3e-07   Glycine soja [wild soybean]
ref|XP_009416500.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like     58.9    3e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010109734.1|  Peptide transporter                              56.2    3e-07   
ref|XP_003597728.1|  hypothetical protein MTR_2g101640                58.9    3e-07   Medicago truncatula
ref|XP_004235683.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     58.9    3e-07   Solanum lycopersicum
ref|XP_008220969.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...  58.9    3e-07   
ref|XP_002873521.1|  proton-dependent oligopeptide transport fami...  58.5    3e-07   
ref|XP_007227293.1|  hypothetical protein PRUPE_ppa017140mg           58.5    3e-07   Prunus persica
ref|XP_010051584.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     58.5    3e-07   Eucalyptus grandis [rose gum]
gb|KCW69640.1|  hypothetical protein EUGRSUZ_F03048                   58.5    4e-07   Eucalyptus grandis [rose gum]
ref|XP_003597729.1|  hypothetical protein MTR_2g101650                58.5    4e-07   Medicago truncatula
ref|XP_010939959.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     58.5    4e-07   Elaeis guineensis
gb|KEH16315.1|  peptide/nitrate transporter                           58.2    4e-07   Medicago truncatula
ref|XP_010678590.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like     58.2    4e-07   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS63172.1|  hypothetical protein M569_11615                       58.2    4e-07   Genlisea aurea
ref|XP_003579314.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like    58.2    4e-07   Brachypodium distachyon [annual false brome]
emb|CDY30787.1|  BnaC07g16870D                                        58.2    4e-07   Brassica napus [oilseed rape]
gb|KDP37260.1|  hypothetical protein JCGZ_06316                       58.2    4e-07   Jatropha curcas
ref|XP_009778211.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     58.2    4e-07   Nicotiana sylvestris
ref|XP_009795447.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...  58.2    4e-07   Nicotiana sylvestris
ref|XP_006650508.1|  PREDICTED: peptide transporter PTR2-like         58.2    4e-07   
ref|XP_009795448.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...  58.2    4e-07   Nicotiana sylvestris
ref|XP_009783586.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     58.2    4e-07   Nicotiana sylvestris
ref|XP_006355953.1|  PREDICTED: probable peptide transporter At1g...  58.2    4e-07   Solanum tuberosum [potatoes]
ref|XP_006586332.1|  PREDICTED: probable peptide transporter At1g...  58.2    4e-07   
ref|XP_006355955.1|  PREDICTED: probable peptide transporter At1g...  58.2    5e-07   Solanum tuberosum [potatoes]
ref|XP_009405084.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     58.2    5e-07   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN16613.1|  Putative peptide transporter                          58.2    5e-07   Glycine soja [wild soybean]
emb|CDO98013.1|  unnamed protein product                              57.8    6e-07   Coffea canephora [robusta coffee]
ref|XP_002315835.1|  Peptide transporter PTR2-B family protein        57.8    6e-07   Populus trichocarpa [western balsam poplar]
ref|XP_009351619.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     57.8    6e-07   Pyrus x bretschneideri [bai li]
ref|XP_006662136.1|  PREDICTED: peptide transporter PTR2-like         57.8    6e-07   
emb|CDO98012.1|  unnamed protein product                              57.8    7e-07   Coffea canephora [robusta coffee]
ref|XP_008220970.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     57.8    7e-07   Prunus mume [ume]
ref|XP_004968864.1|  PREDICTED: peptide transporter PTR2-like         57.4    7e-07   Setaria italica
emb|CDX71495.1|  BnaC04g17300D                                        57.4    7e-07   
ref|XP_002463973.1|  hypothetical protein SORBIDRAFT_01g009900        57.4    8e-07   Sorghum bicolor [broomcorn]
ref|XP_008466771.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...  57.4    8e-07   
ref|XP_004983460.1|  PREDICTED: probable peptide/nitrate transpor...  57.0    8e-07   
ref|XP_006448045.1|  hypothetical protein CICLE_v10014643mg           57.0    8e-07   
ref|XP_010656492.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     57.4    8e-07   Vitis vinifera
ref|XP_004238698.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     57.4    9e-07   Solanum lycopersicum
ref|XP_003630771.1|  hypothetical protein MTR_8g103250                57.0    9e-07   
ref|XP_009609880.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     55.5    9e-07   Nicotiana tomentosiformis
ref|XP_002981698.1|  hypothetical protein SELMODRAFT_444972           57.4    9e-07   Selaginella moellendorffii
ref|XP_002967819.1|  hypothetical protein SELMODRAFT_88337            57.0    1e-06   Selaginella moellendorffii
ref|XP_009774738.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like     57.0    1e-06   Nicotiana sylvestris
gb|KEH41920.1|  peptide/nitrate transporter plant                     57.0    1e-06   Medicago truncatula
gb|KEH41919.1|  peptide/nitrate transporter plant                     57.0    1e-06   Medicago truncatula
ref|XP_006492274.1|  PREDICTED: peptide transporter PTR2-like         57.0    1e-06   Citrus sinensis [apfelsine]
ref|XP_006448044.1|  hypothetical protein CICLE_v10014643mg           57.0    1e-06   
ref|XP_003524398.1|  PREDICTED: probable peptide transporter At1g...  56.6    1e-06   Glycine max [soybeans]
ref|XP_002463972.1|  hypothetical protein SORBIDRAFT_01g009890        56.6    1e-06   Sorghum bicolor [broomcorn]
emb|CCN27389.1|  low affinity nitrate transporter                     53.9    1e-06   Triticum aestivum [Canadian hard winter wheat]
gb|EYU29810.1|  hypothetical protein MIMGU_mgv1a020560mg              56.6    1e-06   Erythranthe guttata [common monkey flower]
emb|CDY45207.1|  BnaA07g12830D                                        56.6    1e-06   
ref|XP_008787880.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     56.6    2e-06   
ref|XP_009103552.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2          56.6    2e-06   
ref|XP_010043898.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3          56.6    2e-06   
gb|KJB59595.1|  hypothetical protein B456_009G262700                  56.6    2e-06   
ref|XP_002464816.1|  hypothetical protein SORBIDRAFT_01g027250        56.6    2e-06   
ref|XP_002318679.2|  hypothetical protein POPTR_0012s08940g           56.2    2e-06   
ref|XP_010937011.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     56.2    2e-06   
ref|XP_002458529.1|  hypothetical protein SORBIDRAFT_03g035260        56.2    2e-06   
ref|XP_006346661.1|  PREDICTED: peptide transporter PTR2-like         56.6    2e-06   
ref|XP_007045396.1|  Peptide transporter 2 isoform 2                  56.2    2e-06   
ref|XP_010491892.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.3-like...  56.2    2e-06   
ref|XP_010491891.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.3-like...  56.2    2e-06   
ref|XP_011040515.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like     56.2    2e-06   
ref|XP_010252354.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3 isof...  56.2    2e-06   
ref|XP_011021701.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     56.2    2e-06   
emb|CDY67993.1|  BnaCnng57240D                                        56.2    2e-06   
ref|XP_006286746.1|  hypothetical protein CARUB_v10003056mg           55.8    2e-06   
ref|XP_009774737.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     56.2    2e-06   
ref|XP_007225683.1|  hypothetical protein PRUPE_ppa003292mg           56.2    2e-06   
ref|XP_008222264.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.1          56.2    2e-06   
gb|EAY75908.1|  hypothetical protein OsI_03828                        56.2    2e-06   
dbj|BAG91471.1|  unnamed protein product                              56.2    2e-06   
ref|XP_010105518.1|  Peptide transporter                              56.2    2e-06   
ref|XP_010105517.1|  Peptide transporter                              56.2    2e-06   
ref|XP_003546477.1|  PREDICTED: probable peptide transporter At1g...  56.2    2e-06   
ref|NP_001044324.1|  Os01g0761500                                     56.2    2e-06   
gb|KHM98741.1|  Putative peptide transporter                          56.2    2e-06   
gb|EPS64583.1|  hypothetical protein M569_10198                       55.1    2e-06   
ref|XP_010920688.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like...  55.8    2e-06   
ref|XP_010521163.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.14-like    55.8    2e-06   
ref|XP_007045395.1|  Peptide transporter 2 isoform 1                  55.8    2e-06   
emb|CDP21642.1|  unnamed protein product                              55.8    2e-06   
ref|XP_010252355.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4 isof...  55.8    2e-06   
ref|XP_009591623.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...  55.8    3e-06   
dbj|BAK04396.1|  predicted protein                                    55.8    3e-06   
ref|XP_004151437.1|  PREDICTED: probable peptide transporter At1g...  55.8    3e-06   
ref|XP_010276259.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...  55.8    3e-06   
ref|XP_004171650.1|  PREDICTED: LOW QUALITY PROTEIN: probable pep...  55.8    3e-06   
ref|XP_010920695.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like...  55.8    3e-06   
ref|XP_010680056.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     55.8    3e-06   
gb|AIU49675.1|  major facilitator superfamily protein                 55.8    3e-06   
ref|XP_004239355.2|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...  55.8    3e-06   
ref|XP_010276258.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...  55.8    3e-06   
ref|XP_006346629.1|  PREDICTED: peptide transporter PTR2-like         55.8    3e-06   
gb|KEH28715.1|  peptide/nitrate transporter plant                     55.8    3e-06   
ref|XP_009591624.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...  55.8    3e-06   
ref|XP_008798072.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     55.8    3e-06   
ref|XP_010320606.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...  55.5    3e-06   
gb|AES91176.2|  peptide/nitrate transporter                           55.5    3e-06   
ref|XP_003608979.1|  Nitrate transporter NRT1-2                       55.5    3e-06   
ref|XP_001774033.1|  predicted protein                                55.5    3e-06   
ref|XP_006359461.1|  PREDICTED: probable peptide transporter At1g...  55.5    3e-06   
ref|XP_004983459.1|  PREDICTED: probable peptide/nitrate transpor...  55.5    3e-06   
ref|XP_002880817.1|  nitrate transporter                              55.5    4e-06   
ref|XP_004959949.1|  PREDICTED: probable peptide/nitrate transpor...  55.5    4e-06   
emb|CDM84274.1|  unnamed protein product                              55.5    4e-06   
ref|XP_010314236.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...  55.1    4e-06   
ref|XP_010105516.1|  Peptide transporter                              55.5    4e-06   
ref|XP_009353501.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.1-like     55.5    4e-06   
ref|XP_006408723.1|  hypothetical protein EUTSA_v10001943mg           55.1    4e-06   
ref|XP_010229109.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     55.1    4e-06   
ref|XP_010510873.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2 isof...  55.1    4e-06   
ref|XP_010066525.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     55.1    4e-06   
gb|KHN41359.1|  Putative peptide transporter                          55.1    5e-06   
ref|XP_009416965.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like     55.1    5e-06   
gb|KJB18644.1|  hypothetical protein B456_003G064500                  55.1    5e-06   
ref|XP_009593688.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     55.1    5e-06   
ref|XP_010678591.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like     55.1    5e-06   
gb|KHG27963.1|  Peptide transporter PTR2 -like protein                55.1    5e-06   
ref|XP_010937012.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     55.1    5e-06   
ref|XP_006408724.1|  hypothetical protein EUTSA_v10001943mg           55.1    5e-06   
emb|CDP05420.1|  unnamed protein product                              55.1    5e-06   
ref|XP_002452718.1|  hypothetical protein SORBIDRAFT_04g031320        55.1    5e-06   
gb|KJB15302.1|  hypothetical protein B456_002G169800                  54.7    6e-06   
ref|XP_006356754.1|  PREDICTED: nitrate transporter 1.4-like          54.7    6e-06   
ref|XP_002325970.2|  proton-dependent oligopeptide transport fami...  54.7    6e-06   
gb|EMS47891.1|  Peptide transporter PTR2                              54.7    6e-06   
ref|XP_004985075.1|  PREDICTED: peptide transporter PTR2-like iso...  54.7    6e-06   
ref|XP_009786716.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     54.7    6e-06   
ref|XP_006475799.1|  PREDICTED: nitrate transporter 1.4-like isof...  54.7    6e-06   
emb|CDX87266.1|  BnaC09g05810D                                        54.7    6e-06   
ref|XP_006450986.1|  hypothetical protein CICLE_v10007850mg           54.7    6e-06   
ref|XP_006475798.1|  PREDICTED: nitrate transporter 1.4-like isof...  54.7    6e-06   
ref|XP_009117889.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     54.7    6e-06   
gb|AFW72868.1|  hypothetical protein ZEAMMB73_561824                  54.7    6e-06   
ref|XP_004252286.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...  54.7    6e-06   
ref|XP_006849517.1|  hypothetical protein AMTR_s00024p00147790        54.7    6e-06   
ref|XP_006346628.1|  PREDICTED: peptide transporter PTR2-like         54.7    7e-06   
ref|XP_008646076.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like     54.7    7e-06   
ref|XP_010320607.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2 isof...  54.7    7e-06   
ref|XP_004985076.1|  PREDICTED: peptide transporter PTR2-like iso...  54.7    7e-06   
ref|XP_006475796.1|  PREDICTED: nitrate transporter 1.4-like isof...  54.7    7e-06   
ref|XP_002447891.1|  hypothetical protein SORBIDRAFT_06g017470        54.7    7e-06   
ref|XP_004238699.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2 isof...  54.7    7e-06   
ref|XP_006293915.1|  hypothetical protein CARUB_v10022906mg           54.3    7e-06   
gb|KHG06441.1|  Peptide transporter PTR2 -like protein                54.3    7e-06   
gb|EMT01236.1|  Peptide transporter PTR1                              54.3    8e-06   
ref|XP_004983455.1|  PREDICTED: probable peptide/nitrate transpor...  54.3    8e-06   
ref|XP_010062498.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     54.3    8e-06   
gb|AIU49699.1|  major facilitator superfamily protein                 54.3    8e-06   
gb|EMT26749.1|  Peptide transporter PTR2                              54.3    8e-06   
ref|XP_009403716.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like...  54.3    8e-06   
ref|XP_009403715.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like...  54.3    8e-06   
gb|KCW85919.1|  hypothetical protein EUGRSUZ_B02630                   53.9    8e-06   
ref|XP_002285274.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     54.3    8e-06   
gb|KJB77816.1|  hypothetical protein B456_012G159000                  54.3    8e-06   
gb|ABR32183.1|  peptide transporter                                   54.3    8e-06   
ref|XP_009388204.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     54.3    9e-06   
ref|XP_007158832.1|  hypothetical protein PHAVU_002G185700g           54.3    9e-06   
ref|XP_011029471.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     54.3    9e-06   
ref|XP_010676154.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     54.3    9e-06   
ref|XP_008390220.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.1-like     54.3    9e-06   
ref|XP_010939960.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     54.3    9e-06   
ref|XP_010417814.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     54.3    9e-06   
emb|CBI26754.3|  unnamed protein product                              53.9    9e-06   
gb|KEH29305.1|  proton-dependent oligopeptide transport family pr...  53.9    1e-05   
ref|XP_010937010.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     53.9    1e-05   
gb|EMT19380.1|  Peptide transporter PTR2                              54.3    1e-05   
ref|XP_010668218.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like     53.9    1e-05   
ref|XP_004489982.1|  PREDICTED: nitrate transporter 1.7-like          53.9    1e-05   
ref|XP_010541927.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2          53.9    1e-05   
emb|CDX81655.1|  BnaC08g39460D                                        53.9    1e-05   
ref|XP_009403717.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like...  53.9    1e-05   
ref|XP_010473052.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     53.9    1e-05   
gb|EMS68423.1|  Peptide transporter PTR2                              53.9    1e-05   
emb|CDP21853.1|  unnamed protein product                              53.9    1e-05   
ref|XP_011070505.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     53.9    1e-05   
ref|XP_004143744.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  54.3    1e-05   
gb|KEH40280.1|  peptide/nitrate transporter plant                     53.9    1e-05   
gb|EYU26644.1|  hypothetical protein MIMGU_mgv1a003683mg              53.9    1e-05   
ref|XP_010551494.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13         53.9    1e-05   
ref|XP_002269340.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13         53.9    1e-05   
emb|CDY16763.1|  BnaA09g06190D                                        53.9    1e-05   
ref|XP_006387190.1|  hypothetical protein POPTR_1576s00200g           52.8    1e-05   
ref|XP_004965186.1|  PREDICTED: probable nitrite transporter At1g...  53.9    1e-05   
ref|XP_003524837.1|  PREDICTED: peptide transporter PTR2-like         53.5    1e-05   
ref|XP_004983458.1|  PREDICTED: probable peptide/nitrate transpor...  53.5    1e-05   
gb|KJB56778.1|  hypothetical protein B456_009G135700                  53.5    1e-05   
gb|KHG04534.1|  hypothetical protein F383_29859                       53.5    1e-05   
ref|XP_008798043.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     53.5    1e-05   
ref|XP_003540022.1|  PREDICTED: probable peptide/nitrate transpor...  53.5    1e-05   
gb|KEH29315.1|  oligopeptide transporter, putative                    50.8    1e-05   
gb|ACR38185.1|  unknown                                               53.5    1e-05   
gb|AAM20651.1|  putative nitrate transporter                          53.5    1e-05   
ref|XP_007134767.1|  hypothetical protein PHAVU_010G0742001g          53.5    1e-05   
ref|XP_003568460.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like     53.5    1e-05   
ref|NP_850084.1|  nitrate transporter 1.4                             53.5    1e-05   
gb|EMT14648.1|  Peptide transporter PTR2                              53.5    2e-05   
gb|KDP24485.1|  hypothetical protein JCGZ_25049                       53.5    2e-05   
ref|XP_004981956.1|  PREDICTED: peptide transporter PTR2-like         53.5    2e-05   
gb|AAB95302.1|  putative nitrate transporter                          53.5    2e-05   
ref|XP_004297798.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     53.5    2e-05   
ref|XP_004143743.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  53.5    2e-05   
ref|XP_002870939.1|  proton-dependent oligopeptide transport fami...  53.5    2e-05   
ref|XP_010521166.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.14-like    53.5    2e-05   
gb|KEH16161.1|  proton-dependent oligopeptide transport family pr...  53.5    2e-05   
ref|XP_002463917.1|  hypothetical protein SORBIDRAFT_01g008885        53.5    2e-05   
ref|XP_004978375.1|  PREDICTED: peptide transporter PTR2-like         50.8    2e-05   
ref|XP_010930856.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  53.5    2e-05   
gb|ACG29580.1|  POT family protein                                    53.1    2e-05   
ref|XP_010510874.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2 isof...  53.1    2e-05   
gb|KDP45469.1|  hypothetical protein JCGZ_09718                       53.1    2e-05   
ref|XP_002300021.1|  hypothetical protein POPTR_0001s34640g           53.1    2e-05   
dbj|BAJ34570.1|  unnamed protein product                              53.1    2e-05   
tpg|DAA35554.1|  TPA: hypothetical protein ZEAMMB73_763704            53.1    2e-05   
ref|XP_008462682.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like     53.1    2e-05   
ref|XP_006355956.1|  PREDICTED: probable peptide transporter At1g...  53.1    2e-05   
ref|XP_006376230.1|  hypothetical protein POPTR_0013s11170g           53.1    2e-05   
gb|KDP21241.1|  hypothetical protein JCGZ_21712                       53.1    2e-05   
ref|XP_006404313.1|  hypothetical protein EUTSA_v10010180mg           53.1    2e-05   
gb|EEC66459.1|  hypothetical protein OsI_32531                        53.1    2e-05   
ref|XP_010109735.1|  Peptide transporter                              53.1    2e-05   
ref|XP_008668757.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.12-like    53.1    2e-05   
emb|CDY59420.1|  BnaA09g56930D                                        53.1    2e-05   
ref|XP_004138148.1|  PREDICTED: probable peptide/nitrate transpor...  53.1    2e-05   
ref|XP_006652744.1|  PREDICTED: peptide transporter PTR2-like         53.1    2e-05   
gb|KDO76033.1|  hypothetical protein CISIN_1g007827mg                 52.8    2e-05   
emb|CDX84344.1|  BnaC03g51560D                                        53.1    2e-05   
ref|XP_004983703.1|  PREDICTED: nitrate transporter 1.1-like          53.1    2e-05   
ref|XP_008453172.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like    53.1    2e-05   
ref|XP_008798073.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3          53.1    2e-05   
gb|EMS55593.1|  hypothetical protein TRIUR3_35114                     51.2    2e-05   
ref|XP_006439661.1|  hypothetical protein CICLE_v10019426mg           52.8    2e-05   
ref|XP_006371707.1|  hypothetical protein POPTR_0018s00500g           52.8    2e-05   
gb|KDP38200.1|  hypothetical protein JCGZ_04843                       53.1    2e-05   
ref|XP_006394362.1|  hypothetical protein EUTSA_v10003849mg           53.1    2e-05   
gb|AAM08520.1|AC068654_22  Putative peptide transporter               52.8    2e-05   
ref|XP_010456494.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.3-like     51.6    2e-05   
gb|KHN32469.1|  Putative peptide/nitrate transporter                  52.8    2e-05   
gb|KFK32490.1|  hypothetical protein AALP_AA6G249500                  52.8    2e-05   
ref|XP_004953503.1|  PREDICTED: nitrate transporter 1.5-like isof...  53.1    2e-05   
gb|KEH29306.1|  proton-dependent oligopeptide transport family pr...  52.8    2e-05   
ref|XP_011007525.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like     52.8    2e-05   
ref|XP_002317503.2|  Peptide transporter PTR2-B family protein        52.8    2e-05   
gb|KDO76032.1|  hypothetical protein CISIN_1g007827mg                 52.8    2e-05   
ref|XP_004953502.1|  PREDICTED: nitrate transporter 1.5-like isof...  52.8    2e-05   
gb|EMT01237.1|  Peptide transporter PTR5                              52.8    2e-05   
ref|XP_010242330.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like     52.8    2e-05   
gb|AEN81086.1|  AT1G52190-like protein                                51.2    2e-05   
emb|CDY03659.1|  BnaA02g15780D                                        52.8    2e-05   
dbj|BAJ86984.1|  predicted protein                                    52.8    2e-05   
ref|XP_002464815.1|  hypothetical protein SORBIDRAFT_01g027221        48.9    2e-05   
ref|XP_009127900.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.13-lik...  52.8    2e-05   
gb|ADG37990.1|  AT1G52190-like protein                                51.2    2e-05   
gb|KGN63647.1|  hypothetical protein Csa_1G008530                     52.8    2e-05   
gb|AIU49716.1|  major facilitator superfamily protein                 52.8    2e-05   
ref|XP_006844420.1|  hypothetical protein AMTR_s00016p00024040        52.8    3e-05   
ref|NP_001058518.2|  Os06g0705600                                     52.8    3e-05   
dbj|BAJ98035.1|  predicted protein                                    52.8    3e-05   
ref|XP_009127898.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.13-lik...  52.8    3e-05   
ref|XP_006476663.1|  PREDICTED: probable peptide/nitrate transpor...  52.8    3e-05   
gb|EAZ31849.1|  hypothetical protein OsJ_16012                        52.8    3e-05   
emb|CDY00315.1|  BnaA06g22160D                                        52.8    3e-05   
ref|XP_011086904.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.1          52.8    3e-05   
gb|EMT14752.1|  Peptide transporter PTR2                              52.8    3e-05   
ref|XP_009419340.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     52.8    3e-05   
ref|XP_003531124.1|  PREDICTED: peptide transporter PTR2-like         52.8    3e-05   
ref|XP_009151387.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like    52.8    3e-05   
ref|XP_009406476.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like     52.8    3e-05   
ref|XP_009362432.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like    52.8    3e-05   



>emb|CDP15610.1| unnamed protein product [Coffea canephora]
Length=91

 Score = 81.6 bits (200),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK-DEKPVA  178
            +I++LS   G  SWI ++IN+GHYDY+YWVLAGLS++N + FLICS++YGPSK DEK   
Sbjct  26   AIDKLSKLGGKESWIETNINKGHYDYYYWVLAGLSVLNMIYFLICSKAYGPSKEDEKETT  85

Query  179  MEED  190
              E+
Sbjct  86   FHEE  89



>emb|CDP16188.1| unnamed protein product [Coffea canephora]
Length=463

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK-DEKPVA  178
            +I++LS   G  SWI ++IN+GHYDY+YWVLAGLS++N + FLICS++YGPSK DEK   
Sbjct  398  AIDKLSKLGGKESWIETNINKGHYDYYYWVLAGLSVLNMIYFLICSKAYGPSKEDEKETT  457

Query  179  MEED  190
              E+
Sbjct  458  FHEE  461



>ref|XP_002324232.2| hypothetical protein POPTR_0018s00440g [Populus trichocarpa]
 gb|EEF02797.2| hypothetical protein POPTR_0018s00440g [Populus trichocarpa]
Length=573

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            ++ +L+   G  SW++S+IN+GHYDY+YW+LA LS+VNFL +L+CS+SYGPS +E+
Sbjct  509  AVRDLTTVEGQESWVSSNINKGHYDYYYWLLASLSLVNFLYYLVCSKSYGPSMEEQ  564



>ref|XP_009607662.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Nicotiana tomentosiformis]
Length=576

 Score = 81.3 bits (199),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            +INEL+   G  SW++S+IN+GH+DY+Y VLAGLS+VN L ++ CSR+YGP K E    +
Sbjct  514  TINELTRGGGQESWVSSNINKGHFDYYYLVLAGLSVVNLLCYIACSRAYGPCKGENREVI  573

Query  182  EED  190
            EED
Sbjct  574  EED  576



>ref|XP_009787108.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Nicotiana sylvestris]
Length=576

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            +INEL+   G  SW++S+IN+GH+DY+Y VLAGLS+VN L ++ CSR+YGP K E    +
Sbjct  514  TINELTGGGGQESWVSSNINKGHFDYYYLVLAGLSVVNLLCYIACSRAYGPCKGENREMI  573

Query  182  EED  190
            EED
Sbjct  574  EED  576



>emb|CDP16191.1| unnamed protein product [Coffea canephora]
Length=571

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            +I+ELS   G  SWI+++IN+GHYDY+YWVLAGLS+ N + FLICS++YGP K++K
Sbjct  506  AIDELSKLGGKESWISTNINKGHYDYYYWVLAGLSVPNMIYFLICSKAYGPGKEDK  561



>emb|CDP16193.1| unnamed protein product [Coffea canephora]
Length=572

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            +I++LS   G  SWI++++N+GHYDY+YWVLAGLSM+N + FLIC+++YGP K++K
Sbjct  507  AIDKLSKLGGKESWISTNVNKGHYDYYYWVLAGLSMLNMIYFLICNKAYGPGKEDK  562



>emb|CDP16184.1| unnamed protein product [Coffea canephora]
Length=353

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK-DEK  169
            I++LS   G  SWI+++IN GHYDY+YWVLAGLSM+N + FL C+++YGP K DEK
Sbjct  291  IDKLSKRGGKESWISTNINNGHYDYYYWVLAGLSMLNMIYFLTCTKAYGPGKEDEK  346



>ref|XP_011090957.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 isoform X2 [Sesamum indicum]
Length=543

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            +++ LS   G  SWI+S+IN+GHYDY+Y VLA LSM N + FL+CS  YGP K+E  +A 
Sbjct  479  AVDSLSKAGGQESWISSNINKGHYDYYYLVLAALSMANMMYFLVCSSMYGPLKEEGKIAE  538

Query  182  EED  190
            EED
Sbjct  539  EED  541



>ref|XP_011090875.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 isoform X1 [Sesamum indicum]
Length=572

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            +++ LS   G  SWI+S+IN+GHYDY+Y VLA LSM N + FL+CS  YGP K+E  +A 
Sbjct  508  AVDSLSKAGGQESWISSNINKGHYDYYYLVLAALSMANMMYFLVCSSMYGPLKEEGKIAE  567

Query  182  EED  190
            EED
Sbjct  568  EED  570



>ref|XP_011026626.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Populus euphratica]
 ref|XP_011026627.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Populus euphratica]
 ref|XP_011026628.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Populus euphratica]
Length=573

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            ++ +L+   G  SW++S+IN+GHYDY+YW+LA LS  NFL +L+CS+SYGPS +E+
Sbjct  509  AVRDLTKVEGQESWVSSNINKGHYDYYYWLLASLSFANFLYYLVCSKSYGPSMEEQ  564



>emb|CDP16194.1| unnamed protein product [Coffea canephora]
Length=572

 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            +I+ELS      SWI++++N+GHYDY+YWVLAGLSM+N + FLIC+++YGP K++K
Sbjct  507  AIDELSKLGEKESWISTNVNKGHYDYYYWVLAGLSMLNMIYFLICNKAYGPGKEDK  562



>ref|XP_010314832.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X2 [Solanum 
lycopersicum]
Length=484

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 49/63 (78%), Gaps = 3/63 (5%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            +I++L+   G  SW++S+IN+GHYDY+Y VLAG S+VN L +++CS++YGP K+E    M
Sbjct  423  TIDDLTKRGGEESWVSSNINKGHYDYYYLVLAGFSLVNILCYIVCSKAYGPCKEE---VM  479

Query  182  EED  190
            EE+
Sbjct  480  EEE  482



>ref|XP_006450666.1| hypothetical protein CICLE_v10010188mg [Citrus clementina]
 gb|ESR63906.1| hypothetical protein CICLE_v10010188mg [Citrus clementina]
Length=519

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 49/65 (75%), Gaps = 3/65 (5%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKD--EKPV  175
            ++++++   GNG WI S+IN+GHYDY+YW+LAGL+M NF+ FL C ++YGP K    KP+
Sbjct  450  TVDDITKRGGNGGWIPSNINKGHYDYYYWLLAGLNMANFIYFLECCKAYGPCKGLVSKPL  509

Query  176  AMEED  190
              E+D
Sbjct  510  G-EKD  513



>ref|XP_006342519.1| PREDICTED: probable peptide transporter At1g52190-like [Solanum 
tuberosum]
Length=576

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 49/63 (78%), Gaps = 3/63 (5%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            +I++L+   G  SW++S+IN+GHYDY+Y VLAG S+VN L +++CS++YGP K+E    M
Sbjct  515  TIDDLTKRGGEESWVSSNINKGHYDYYYLVLAGFSLVNILCYIVCSKAYGPCKEE---VM  571

Query  182  EED  190
            EE+
Sbjct  572  EEE  574



>emb|CDP16183.1| unnamed protein product [Coffea canephora]
Length=573

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            SI++L+   G  SWI+++IN+GHYDY++ VLAGLSMVN L FLIC  +YGP + E+  A 
Sbjct  510  SIDDLTKKGGQESWISTNINKGHYDYYFCVLAGLSMVNMLYFLICCWAYGPCRAEEGKAS  569

Query  182  EED  190
            +E 
Sbjct  570  DEQ  572



>ref|XP_004253108.2| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X1 [Solanum 
lycopersicum]
Length=657

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 49/63 (78%), Gaps = 3/63 (5%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            +I++L+   G  SW++S+IN+GHYDY+Y VLAG S+VN L +++CS++YGP K+E    M
Sbjct  596  TIDDLTKRGGEESWVSSNINKGHYDYYYLVLAGFSLVNILCYIVCSKAYGPCKEE---VM  652

Query  182  EED  190
            EE+
Sbjct  653  EEE  655



>gb|KDO79779.1| hypothetical protein CISIN_1g008264mg [Citrus sinensis]
 gb|KDO79780.1| hypothetical protein CISIN_1g008264mg [Citrus sinensis]
Length=451

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            ++++++   GNG WI S+IN+GHYDY+YW+L  LSM NFL +L C ++YGP K     A 
Sbjct  382  AVDDITKRGGNGGWIPSNINKGHYDYYYWLLTALSMANFLYYLACCKAYGPFKGRVGTAF  441

Query  182  EED  190
            ++ 
Sbjct  442  DDK  444



>gb|KDO79781.1| hypothetical protein CISIN_1g008264mg [Citrus sinensis]
 gb|KDO79782.1| hypothetical protein CISIN_1g008264mg [Citrus sinensis]
Length=475

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            ++++++   GNG WI S+IN+GHYDY+YW+L  LSM NFL +L C ++YGP K     A 
Sbjct  406  AVDDITKRGGNGGWIPSNINKGHYDYYYWLLTALSMANFLYYLACCKAYGPFKGRVGTAF  465

Query  182  EED  190
            ++ 
Sbjct  466  DDK  468



>ref|XP_006476064.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X2 [Citrus sinensis]
 gb|KDO79776.1| hypothetical protein CISIN_1g008264mg [Citrus sinensis]
Length=539

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            ++++++   GNG WI S+IN+GHYDY+YW+L  LSM NFL +L C ++YGP K     A 
Sbjct  470  AVDDITKRGGNGGWIPSNINKGHYDYYYWLLTALSMANFLYYLACCKAYGPFKGRVGTAF  529

Query  182  EED  190
            ++ 
Sbjct  530  DDK  532



>gb|KDO79777.1| hypothetical protein CISIN_1g008264mg [Citrus sinensis]
Length=548

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            ++++++   GNG WI S+IN+GHYDY+YW+L  LSM NFL +L C ++YGP K     A 
Sbjct  479  AVDDITKRGGNGGWIPSNINKGHYDYYYWLLTALSMANFLYYLACCKAYGPFKGRVGTAF  538

Query  182  EED  190
            ++ 
Sbjct  539  DDK  541



>ref|XP_006450663.1| hypothetical protein CICLE_v10007857mg [Citrus clementina]
 ref|XP_006476063.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X1 [Citrus sinensis]
 gb|ESR63903.1| hypothetical protein CICLE_v10007857mg [Citrus clementina]
 gb|KDO79778.1| hypothetical protein CISIN_1g008264mg [Citrus sinensis]
Length=572

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            ++++++   GNG WI S+IN+GHYDY+YW+L  LSM NFL +L C ++YGP K     A 
Sbjct  503  AVDDITKRGGNGGWIPSNINKGHYDYYYWLLTALSMANFLYYLACCKAYGPFKGRVGTAF  562

Query  182  EED  190
            ++ 
Sbjct  563  DDK  565



>ref|XP_010668254.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Beta vulgaris subsp. 
vulgaris]
Length=574

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            SI+ ++   G  SW++S+IN+ H+DY+YW LAGLS+VNF  +L+CSR+YGPS  E+
Sbjct  507  SIDSITSRDGKESWVSSNINKAHFDYYYWFLAGLSIVNFFYYLLCSRAYGPSLSEQ  562



>ref|XP_006476061.1| PREDICTED: probable peptide transporter At1g52190-like [Citrus 
sinensis]
Length=581

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            +++E++   G   WI S+IN+G YDY+YW+LAGL+M +F+ FL C ++YGP ++E   A+
Sbjct  512  AVDEITKRGGKEGWIPSNINKGRYDYYYWLLAGLNMASFIYFLACCKAYGPCREEASEAL  571

Query  182  EED  190
            +E 
Sbjct  572  DEK  574



>gb|KDO79783.1| hypothetical protein CISIN_1g039943mg [Citrus sinensis]
Length=581

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            +++E++   G   WI S+IN+G YDY+YW+LAGL+M +F+ FL C ++YGP ++E   A+
Sbjct  512  AVDEITKRGGKEGWIPSNINKGRYDYYYWLLAGLNMASFIYFLACCKAYGPCREEASEAL  571

Query  182  EED  190
            +E 
Sbjct  572  DEK  574



>ref|XP_006450665.1| hypothetical protein CICLE_v10010641mg [Citrus clementina]
 gb|ESR63905.1| hypothetical protein CICLE_v10010641mg [Citrus clementina]
Length=581

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            +++E++   G   WI S+IN+G YDY+YW+LAGL+M +F+ FL C ++YGP ++E   A+
Sbjct  512  AVDEITKRGGKEGWIPSNINKGRYDYYYWLLAGLNMASFIYFLACCKAYGPCREEASEAL  571

Query  182  EED  190
            +E 
Sbjct  572  DEK  574



>ref|XP_008445025.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Cucumis melo]
Length=533

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            +++ LS   G  SW++S+INEGH DY+YW+L GL   NFL FL CS+SYGPSK+E
Sbjct  464  TVDNLSEAVGGRSWVSSNINEGHSDYYYWLLFGLLFANFLYFLACSKSYGPSKEE  518



>ref|XP_011026625.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Populus euphratica]
Length=568

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            ++ + +      SW++S+IN GHYDY+YW+L  LS+VNF+ +L+CS+SYGP + EK
Sbjct  509  TVRDFTKGEARESWVSSNINRGHYDYYYWLLTVLSLVNFIYYLVCSKSYGPCRQEK  564



>ref|XP_011081806.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Sesamum indicum]
Length=535

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAME  184
            ++ +S   G  SWITSDIN+G YD +Y VLAGLSM N + +L+C R+YGP K E+ +   
Sbjct  472  VDSISKARGRQSWITSDINKGRYDCYYLVLAGLSMANTVYYLVCRRAYGPLKAERRLKEH  531

Query  185  ED  190
            ED
Sbjct  532  ED  533



>ref|XP_002324231.1| hypothetical protein POPTR_0018s00430g [Populus trichocarpa]
 gb|EEF02796.1| hypothetical protein POPTR_0018s00430g [Populus trichocarpa]
Length=568

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            ++ + +      SW++S+IN+GHYDY+YW+L  LS+VNF+ +L+CS++YGP + EK
Sbjct  509  AVRDFTKGEAQESWVSSNINKGHYDYYYWILTILSLVNFIYYLVCSKTYGPCRQEK  564



>emb|CDP21289.1| unnamed protein product [Coffea canephora]
Length=623

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            +I++ +   G  SWI+++IN+GHYDY++WVL+GLS+ NF  FLIC  +YGP + E+
Sbjct  557  AIDDFTKRGGGESWISTNINKGHYDYYFWVLSGLSLANFFFFLICCWTYGPCRGEE  612



>ref|XP_002516546.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF45887.1| nitrate transporter, putative [Ricinus communis]
Length=457

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            +++  S   G  SW++S+IN+GHYDY+YW+LA LS++NF+ +L CS+SYGP + E
Sbjct  390  AVDSFSKRGGEESWVSSNINKGHYDYYYWLLASLSLLNFVYYLACSKSYGPCRGE  444



>ref|XP_002516544.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF45885.1| nitrate transporter, putative [Ricinus communis]
Length=578

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            +I+  S   G  SW++S+IN+GHYDY+YW+LA LS++NF+ +L CS+ YGP + ++  A 
Sbjct  513  TIDSFSKRGGEESWVSSNINKGHYDYYYWLLASLSLLNFVYYLACSKGYGPCRAKEGNAP  572

Query  182  EED  190
            ++D
Sbjct  573  DDD  575



>ref|XP_010254052.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Nelumbo nucifera]
Length=588

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            +++E++   G  SW++S++N+GHYDY+YW+LA +  VNFL FL+CS +YG S  E+PV  
Sbjct  506  AVDEVTKRGGKESWVSSNLNKGHYDYYYWLLAVMGSVNFLYFLVCSWAYGSS--EEPVMR  563

Query  182  EED  190
            + +
Sbjct  564  DSN  566



>ref|XP_007012104.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY29723.1| Major facilitator superfamily protein [Theobroma cacao]
Length=585

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  29   GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPV  175
            G  SW++S++N+GHYDY+YW+L GLS++NF+ FL CS++YGP + +  V
Sbjct  521  GGESWVSSNVNKGHYDYYYWLLFGLSILNFMYFLACSKAYGPCRGDDEV  569



>gb|EYU29274.1| hypothetical protein MIMGU_mgv1a003369mg [Erythranthe guttata]
Length=589

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +2

Query  14   LSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAMEE  187
            +S   G  SWI+SDIN+G YDY+Y VLAGLS+ N + FL+CS +YGP K EK +  E+
Sbjct  506  VSKKGGKESWISSDINKGRYDYYYLVLAGLSVANMIYFLVCSSAYGPLKGEKKLEEEQ  563



>ref|XP_004150292.1| PREDICTED: probable peptide transporter At1g52190-like [Cucumis 
sativus]
Length=535

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            +++ LS + G  SW++S+INEGH DY+YW+L+GL   NFL +L CS+SYGPS +E
Sbjct  466  TVDNLSKSVGVKSWVSSNINEGHSDYYYWLLSGLLFANFLYYLACSKSYGPSNEE  520



>gb|KGN62823.1| hypothetical protein Csa_2G374650 [Cucumis sativus]
Length=581

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            +++ LS + G  SW++S+INEGH DY+YW+L+GL   NFL +L CS+SYGPS +E
Sbjct  512  TVDNLSKSVGVKSWVSSNINEGHSDYYYWLLSGLLFANFLYYLACSKSYGPSNEE  566



>ref|XP_004164040.1| PREDICTED: probable peptide transporter At1g52190-like [Cucumis 
sativus]
Length=581

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            +++ LS + G  SW++S+INEGH DY+YW+L+GL   NFL +L CS+SYGPS +E
Sbjct  512  TVDNLSKSVGVKSWVSSNINEGHSDYYYWLLSGLLFANFLYYLACSKSYGPSNEE  566



>ref|XP_008445026.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Cucumis melo]
Length=581

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            +++  S   G  SW++S+IN+GH DY+YW+L GL   NFL FL CS+SYGPSK+E
Sbjct  512  TVDNFSKAVGGKSWVSSNINDGHSDYYYWLLFGLLFANFLYFLACSKSYGPSKEE  566



>gb|AAL25616.1| At1g52190/F9I5_4 [Arabidopsis thaliana]
 gb|AAM19991.1| At1g52190/F9I5_4 [Arabidopsis thaliana]
Length=265

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            ++NEL+  +G  SW++ +IN+GHY+Y+YWVLA +S +N + ++ICS SYGP  D+
Sbjct  176  AVNELTSRNGKESWVSDNINKGHYNYYYWVLAIMSFINVIYYVICSWSYGPLVDQ  230



>gb|KGN62824.1| hypothetical protein Csa_2G374660 [Cucumis sativus]
Length=95

 Score = 65.5 bits (158),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            +++  S   G  SW++S+INEGH DY+YW+L GL + NF  +L C+ SYGPSK+E
Sbjct  26   TVDNFSKTIGVKSWVSSNINEGHNDYYYWLLFGLLVANFFYYLACNNSYGPSKEE  80



>ref|XP_010668239.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Beta vulgaris subsp. 
vulgaris]
Length=565

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAME  184
            IN ++   G  SW++S+IN+ H+DY+YWV+  LS++NF  +LIC+++YG S DE+     
Sbjct  500  INYITSKDGQESWVSSNINKAHFDYYYWVITALSLLNFFYYLICNKAYGTSSDEQDDNFN  559

Query  185  ED  190
            ED
Sbjct  560  ED  561



>ref|XP_010648806.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Vitis vinifera]
Length=365

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            +N ++   G  SW++S++N+GH DY+Y ++A L M+NF+ FL+C R YGP +DEK
Sbjct  291  VNSVTTKGGKESWLSSNLNKGHLDYYYGLIAVLGMINFIYFLVCCRLYGPCEDEK  345



>gb|AAM20441.1| putative transport protein [Arabidopsis thaliana]
Length=579

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            S   GN SWI  +IN+GHYDY+YWVLA LS VN + +++CS SYGP+ D+
Sbjct  522  SSKQGNVSWIEDNINKGHYDYYYWVLAILSFVNVIYYVVCSWSYGPTVDQ  571



>ref|XP_004170441.1| PREDICTED: probable peptide transporter At1g52190-like [Cucumis 
sativus]
Length=500

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 24/62 (39%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            +++ ++   G  SW++ +IN+GH++ +YW+LA LS++N L +++CS +YGPS D++  AM
Sbjct  407  TVDNVTSKGGKESWVSKNINKGHFEKYYWLLAILSVINVLYYVVCSWAYGPSVDQRRTAM  466

Query  182  EE  187
            ++
Sbjct  467  DD  468



>ref|XP_008445024.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Cucumis melo]
Length=581

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            +++  S   G  SW++S+IN+GH DY+YW+L GL   N L FL CS+SYGPSK+E
Sbjct  512  TVDNFSKAVGGKSWVSSNINDGHSDYYYWLLFGLLFANLLYFLACSKSYGPSKEE  566



>ref|XP_006306954.1| hypothetical protein CARUB_v10008522mg, partial [Capsella rubella]
 gb|EOA39852.1| hypothetical protein CARUB_v10008522mg, partial [Capsella rubella]
Length=664

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            ++NEL+  +G  SW++ +IN+GHY+Y+YWVLA +S VN + ++ICS SYGP  D+
Sbjct  575  AVNELTSRNGKESWVSDNINKGHYNYYYWVLAIMSFVNVIYYVICSWSYGPLVDQ  629



>ref|XP_009145285.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Brassica rapa]
Length=248

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            S   G  SWI  +IN+GHYDY+YWVLA LS VN + +++CS SYGP+ D+
Sbjct  178  SSKKGGESWIEDNINKGHYDYYYWVLAILSFVNVIYYIVCSWSYGPTMDQ  227



>emb|CBI20867.3| unnamed protein product [Vitis vinifera]
Length=1181

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +2

Query  5     INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
             +N ++   G  SW++S++N+GH DY+Y ++A L M+NF+ FL+C R YGP +DEK
Sbjct  1107  VNSVTTKGGKESWLSSNLNKGHLDYYYGLIAVLGMINFIYFLVCCRLYGPCEDEK  1161


 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKP  172
            +N ++   G  SW++S++N+GH DY+YW++  L ++N + FL+C  SYGP +DEKP
Sbjct  516  VNSVTSKGGKESWLSSNLNKGHLDYYYWLITILCLINIIYFLVCCWSYGPFEDEKP  571



>ref|XP_010691376.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Beta vulgaris subsp. 
vulgaris]
Length=605

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAME  184
            ++ ++   G  SW++S+IN+GHYDY+YWVLA +S +N L ++ CS SYGP ++ K   ++
Sbjct  518  VDGITKKGGKDSWVSSNINKGHYDYYYWVLATISFLNILYYVFCSWSYGPVEERKNKVID  577

Query  185  ED  190
            E+
Sbjct  578  EE  579



>ref|XP_010503915.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Camelina sativa]
Length=595

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            S   GN SWI  +IN+GHYDY+YWVLA LS VN + +++CS SYGP+ D+
Sbjct  526  SSKKGNVSWIEDNINKGHYDYYYWVLATLSFVNVIYYVVCSWSYGPTVDQ  575



>ref|XP_008462171.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Cucumis melo]
Length=329

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            +++ ++   G  SW++ +IN+GH++ +YW+LA LS++N L +++CS +YGPS D++  AM
Sbjct  236  TVDNVTSKGGKESWVSKNINKGHFEKYYWLLAILSVINVLYYVVCSWAYGPSVDQRRTAM  295

Query  182  EE  187
            ++
Sbjct  296  DD  297



>gb|KGN45387.1| hypothetical protein Csa_7G447020 [Cucumis sativus]
Length=623

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 24/62 (39%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            +++ ++   G  SW++ +IN+GH++ +YW+LA LS++N L +++CS +YGPS D++  AM
Sbjct  530  TVDNVTSKGGKESWVSKNINKGHFEKYYWLLAILSVINVLYYVVCSWAYGPSVDQRRTAM  589

Query  182  EE  187
            ++
Sbjct  590  DD  591



>ref|XP_002514272.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF48226.1| nitrate transporter, putative [Ricinus communis]
Length=595

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = +2

Query  17   SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            S N    SW+++++N+GHYDY+YW+L+GLS+VN   +LICSR+YG S+D +
Sbjct  516  SNNDEKVSWVSNNLNKGHYDYYYWLLSGLSVVNLFYYLICSRAYG-SEDRR  565



>ref|NP_175630.1| nitrate transporter 1.11 [Arabidopsis thaliana]
 sp|Q9M817.1|PTR6_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 1.2; Short=AtNPF1.2; AltName: 
Full=Nitrate transporter 1.11 [Arabidopsis thaliana]
 gb|AAF29404.1|AC022354_3 peptide transporter, putative [Arabidopsis thaliana]
 gb|AEE32766.1| putative peptide transporter [Arabidopsis thaliana]
Length=607

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            ++NEL+  +G  SW++ +IN+GHY+Y+YWVLA +S +N + ++ICS SYGP  D+
Sbjct  518  AVNELTSRNGKESWVSDNINKGHYNYYYWVLAIMSFINVIYYVICSWSYGPLVDQ  572



>ref|XP_002891678.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH67937.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=607

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            ++NEL+  +G  SW++ +IN+GHY+Y+YWVLA +S +N + ++ICS SYGP  D+
Sbjct  518  AVNELTSRNGKESWVSDNINKGHYNYYYWVLAIMSFINVIYYVICSWSYGPLVDQ  572



>ref|XP_006486908.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X4 [Citrus sinensis]
Length=479

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            ++++++ + G   WI S+IN+GHYD+++W+L+ L+M NF+ FL C ++YGP + E   A+
Sbjct  410  AVDDVTRSGGKQGWIPSNINKGHYDHYFWLLSALNMANFVYFLACCKAYGPCRVEVHKAL  469

Query  182  EE  187
            ++
Sbjct  470  DD  471



>ref|XP_010479721.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 isoform X3 [Camelina 
sativa]
Length=607

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            ++NEL+  +G  SW++ +IN+GHY+Y+YWVLA +S +N + ++ICS SYGP  D+
Sbjct  518  AVNELTSRNGKESWVSDNINKGHYNYYYWVLAIMSFINVIYYVICSWSYGPLVDQ  572



>ref|XP_010465628.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1 isoform X1 [Camelina 
sativa]
 ref|XP_010465629.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1 isoform X2 [Camelina 
sativa]
Length=483

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            S   GN SWI  +IN+GHYDY+YWVLA LS VN + +++CS SYGP+ D+
Sbjct  414  SSKKGNVSWIEDNINKGHYDYYYWVLAILSFVNVIYYVVCSWSYGPTVDQ  463



>ref|XP_010479719.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 isoform X1 [Camelina 
sativa]
Length=608

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            ++NEL+  +G  SW++ +IN+GHY+Y+YWVLA +S +N + ++ICS SYGP  D+
Sbjct  519  AVNELTSRNGKESWVSDNINKGHYNYYYWVLAIMSFINVIYYVICSWSYGPLVDQ  573



>ref|XP_010479720.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 isoform X2 [Camelina 
sativa]
Length=607

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            ++NEL+  +G  SW++ +IN+GHY+Y+YWVLA +S +N + ++ICS SYGP  D+
Sbjct  518  AVNELTSRNGKESWVSDNINKGHYNYYYWVLAIMSFINVIYYVICSWSYGPLVDQ  572



>ref|XP_010462057.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Camelina sativa]
Length=607

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            ++NEL+  +G  SW++ +IN+GHY+Y+YWVLA +S +N + ++ICS SYGP  D+
Sbjct  518  AVNELTSRNGKESWVSDNINKGHYNYYYWVLAIMSFINVIYYVICSWSYGPLVDQ  572



>dbj|BAB02684.1| peptide/amino acid transporter-like protein [Arabidopsis thaliana]
Length=541

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            S   GN SWI  +IN+GHYDY+YWVLA LS VN + +++CS SYGP+ D+
Sbjct  472  SSKQGNVSWIEDNINKGHYDYYYWVLAILSFVNVIYYVVCSWSYGPTVDQ  521



>ref|NP_188239.1| nitrate transporter 1.12 [Arabidopsis thaliana]
 sp|Q8LPL2.2|PTR32_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 1.1; Short=AtNPF1.1; AltName: 
Full=Nitrate transporter 1.12 [Arabidopsis thaliana]
 gb|AEE75781.1| probable peptide/nitrate transporter [Arabidopsis thaliana]
Length=591

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            S   GN SWI  +IN+GHYDY+YWVLA LS VN + +++CS SYGP+ D+
Sbjct  522  SSKQGNVSWIEDNINKGHYDYYYWVLAILSFVNVIYYVVCSWSYGPTVDQ  571



>gb|AFK43183.1| unknown [Medicago truncatula]
Length=145

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            +I   + + GN  WI+ +IN+GH+D + WV+AG++++N L +L+CS +YGP+ D+     
Sbjct  26   TIENTTSSGGNEGWISDNINKGHFDKYLWVIAGINVLNLLYYLVCSWAYGPTADQVSKVS  85

Query  182  EED  190
            EE+
Sbjct  86   EEE  88



>ref|XP_002324234.2| hypothetical protein POPTR_0018s00490g [Populus trichocarpa]
 gb|EEF02799.2| hypothetical protein POPTR_0018s00490g [Populus trichocarpa]
Length=581

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  38   SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            SW++S+IN+GHYDY+YW+LAGLS+ NF+ +  CS++YGP K ++
Sbjct  524  SWLSSNINKGHYDYYYWLLAGLSLANFIYYRACSKAYGPCKGQE  567



>ref|XP_010487466.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Camelina sativa]
Length=595

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            S   GN SWI  +IN+GHYDY+YWVLA LS VN + +++CS SYGP+ D+
Sbjct  525  SSKKGNVSWIEDNINKGHYDYYYWVLAILSFVNVIYYVVCSWSYGPTVDQ  574



>ref|XP_006486905.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X1 [Citrus sinensis]
Length=585

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            ++++++ + G   WI S+IN+GHYD+++W+L+ L+M NF+ FL C ++YGP + E   A+
Sbjct  516  AVDDVTRSGGKQGWIPSNINKGHYDHYFWLLSALNMANFVYFLACCKAYGPCRVEVHKAL  575

Query  182  EE  187
            ++
Sbjct  576  DD  577



>ref|XP_010648805.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Vitis vinifera]
Length=589

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKP  172
            +N ++   G  SW++S++N+GH DY+YW++  L ++N + FL+C  SYGP +DEKP
Sbjct  516  VNSVTSKGGKESWLSSNLNKGHLDYYYWLITILCLINIIYFLVCCWSYGPFEDEKP  571



>ref|XP_006486906.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X2 [Citrus sinensis]
 ref|XP_006486907.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X3 [Citrus sinensis]
Length=585

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            ++++++ + G   WI S+IN+GHYD+++W+L+ L+M NF+ FL C ++YGP + E   A+
Sbjct  516  AVDDVTRSGGKQGWIPSNINKGHYDHYFWLLSALNMANFVYFLACCKAYGPCRVEVHKAL  575

Query  182  EE  187
            ++
Sbjct  576  DD  577



>gb|KFK38969.1| hypothetical protein AALP_AA3G183300 [Arabis alpina]
Length=589

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            S   GN SWI  +IN GHYDY+YW+LA LS VN + +++CS SYGP+ D+
Sbjct  521  SSKKGNDSWIEDNINRGHYDYYYWILAILSFVNVIYYVVCSWSYGPTMDQ  570



>ref|XP_006486909.1| PREDICTED: probable peptide transporter At1g52190-like [Citrus 
sinensis]
Length=585

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            S++ ++ + G   WI S+IN+GHYD+++W+L+ L+M NF+ FL C ++YGP + E   A+
Sbjct  516  SVDGITRSRGKQGWIPSNINKGHYDHYFWLLSALNMANFVYFLACCKAYGPCRVEVHKAL  575

Query  182  EE  187
            ++
Sbjct  576  DD  577



>ref|XP_006422797.1| hypothetical protein CICLE_v10029786mg, partial [Citrus clementina]
 gb|ESR36037.1| hypothetical protein CICLE_v10029786mg, partial [Citrus clementina]
Length=584

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            S++ ++ + G   WI S+IN+GHYD+++W+L+ L+M NF+ FL C ++YGP + E   A+
Sbjct  516  SVDGITRSRGKQGWIPSNINKGHYDHYFWLLSALNMANFVYFLACCKAYGPCRVEVHKAL  575

Query  182  EE  187
            ++
Sbjct  576  DD  577



>ref|XP_006422795.1| hypothetical protein CICLE_v10029930mg, partial [Citrus clementina]
 gb|ESR36035.1| hypothetical protein CICLE_v10029930mg, partial [Citrus clementina]
Length=584

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            S++ ++ + G   WI S+IN+GHYD+++W+L+ L+M NF+ FL C ++YGP + E   A+
Sbjct  516  SVDGITRSRGKQGWIPSNINKGHYDHYFWLLSALNMANFVYFLACCKAYGPCRVEVHKAL  575

Query  182  EE  187
            ++
Sbjct  576  DD  577



>ref|XP_009147706.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Brassica rapa]
Length=606

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            ++NEL+  +G  SW++ +IN+GHY+Y+YW+LA +S +N + ++ICS SYGP  D+
Sbjct  517  AVNELTSRNGEDSWVSDNINKGHYNYYYWLLAIMSFINVIYYMICSWSYGPLVDQ  571



>ref|XP_009114865.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Brassica rapa]
Length=330

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            S   G  SWI  +IN+GHYDY+YWVLA LS VN + +++CS SYGP+ D+
Sbjct  260  SSKKGGESWIEDNINKGHYDYYYWVLAILSFVNVIYYIVCSWSYGPTMDQ  309



>ref|XP_010519892.1| PREDICTED: protein NRT1/ PTR FAMILY 1.3 [Tarenaya hassleriana]
Length=581

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  160
            +++ L+ +   GSW++ DIN GH DY+YWV++GL ++N L F+ CSR+YG  K
Sbjct  517  AVDSLTGDGRGGSWVSGDINSGHLDYYYWVISGLCVINVLYFVHCSRAYGKCK  569



>gb|KGN62822.1| hypothetical protein Csa_2G374640 [Cucumis sativus]
Length=581

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            +++  S   G  SW++S+INEGH DY+YW+L GL + NF  +L C+ SYGPSK+E
Sbjct  512  TVDNFSKTIGVKSWVSSNINEGHNDYYYWLLFGLLVANFFYYLACNNSYGPSKEE  566



>ref|XP_002885127.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH61386.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=593

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            S   GN SWI  +IN+GHYDY+YWVLA LS VN + +++CS SYGP+ D+
Sbjct  523  SSKKGNVSWIEDNINKGHYDYYYWVLAILSFVNVIYYVLCSWSYGPTVDQ  572



>ref|XP_004150293.1| PREDICTED: probable peptide transporter At1g52190-like [Cucumis 
sativus]
Length=589

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            +++  S   G  SW++S+INEGH DY+YW+L GL + NF  +L C+ SYGPSK+E
Sbjct  520  TVDNFSKTIGVKSWVSSNINEGHNDYYYWLLFGLLVANFFYYLACNNSYGPSKEE  574



>ref|XP_004164039.1| PREDICTED: probable peptide transporter At1g52190-like [Cucumis 
sativus]
Length=589

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            +++  S   G  SW++S+INEGH DY+YW+L GL + NF  +L C+ SYGPSK+E
Sbjct  520  TVDNFSKTIGVKSWVSSNINEGHNDYYYWLLFGLLVANFFYYLACNNSYGPSKEE  574



>ref|XP_004141840.1| PREDICTED: probable peptide transporter At1g52190-like [Cucumis 
sativus]
Length=608

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            +++ ++   G  SW++ +IN+GH++ +YW+LA LS++N L +++CS +YGPS D++  AM
Sbjct  515  TVDNVTSKGGKESWVSKNINKGHFEKYYWLLAILSVINVLYYVVCSWAYGPSVDQRRTAM  574

Query  182  EE  187
            ++
Sbjct  575  DD  576



>ref|XP_006422799.1| hypothetical protein CICLE_v10028344mg [Citrus clementina]
 gb|ESR36039.1| hypothetical protein CICLE_v10028344mg [Citrus clementina]
Length=479

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            S++ ++ + G   WI S+IN+GHYD+++W+L+ L+M NF+ FL C ++YGP + E   A+
Sbjct  410  SVDGITRSRGKQGWIPSNINKGHYDHYFWLLSALNMANFVYFLACCKAYGPCRVEVHKAL  469

Query  182  E  184
            +
Sbjct  470  D  470



>ref|XP_006297268.1| hypothetical protein CARUB_v10013282mg [Capsella rubella]
 gb|EOA30166.1| hypothetical protein CARUB_v10013282mg [Capsella rubella]
Length=597

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            S   GN SWI  +IN+GHYDY+YW+LA LS VN + +++CS SYGP+ D+
Sbjct  527  SSKKGNVSWIEDNINKGHYDYYYWILAILSFVNVIYYVVCSWSYGPTVDQ  576



>ref|XP_009352687.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Pyrus x bretschneideri]
Length=592

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            G  SW++S++N+ HYDY+YW++AGLS+VN   FL+CS +YG  +D+K
Sbjct  521  GGVSWVSSNLNKAHYDYYYWIVAGLSVVNVFYFLLCSWAYGHCEDKK  567



>emb|CDY28371.1| BnaC01g35410D [Brassica napus]
Length=486

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            S   G  SWI  +IN+GHYDY+YWVLA LS VN + +++CS SYGP+ D+
Sbjct  416  SSKKGGESWIEDNINKGHYDYYYWVLAILSFVNVIYYIVCSWSYGPTMDQ  465



>ref|XP_009114884.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like isoform X2 [Brassica 
rapa]
Length=486

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            S   G  SWI  +IN+GHYDY+YWVLA LS VN + +++CS SYGP+ D+
Sbjct  416  SSKKGGESWIEDNINKGHYDYYYWVLAILSFVNVIYYIVCSWSYGPTMDQ  465



>emb|CDY51257.1| BnaC03g77810D [Brassica napus]
Length=486

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            S   G  SWI  +IN+GHYDY+YWVLA LS VN + +++CS SYGP+ D+
Sbjct  416  SSKKGGESWIEDNINKGHYDYYYWVLAILSFVNVIYYIVCSWSYGPAMDQ  465



>gb|KFK35804.1| hypothetical protein AALP_AA4G038900 [Arabis alpina]
Length=608

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            ++NEL+  +G  SW+  +IN+GHY+Y+YW+LA +S +N + ++ICS SYGP  D+
Sbjct  518  AVNELTSRNGKVSWVADNINKGHYNYYYWLLAIMSFINVIYYVICSWSYGPLVDQ  572



>ref|XP_011026620.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X2 [Populus 
euphratica]
Length=571

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  38   SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            SW++S+IN+GHYDY+YW+LAGLS+ NF+ +  C ++YGP K ++
Sbjct  514  SWLSSNINKGHYDYYYWLLAGLSLANFIYYRACCKAYGPCKGQE  557



>ref|XP_008352327.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Malus domestica]
Length=328

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +2

Query  17   SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            +   G  SW++S++N+ HYDY+YW++AGLS+VN   FL+CS +YG  +D+K
Sbjct  253  ATRKGGVSWVSSNLNKAHYDYYYWIVAGLSVVNVFYFLLCSWAYGHCEDKK  303



>emb|CDY70561.1| BnaCnng68850D, partial [Brassica napus]
Length=544

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            S   G  SWI  +IN+GHYDY+YWVLA LS VN + +++CS SYGP+ D+
Sbjct  490  SSKKGGESWIEDNINKGHYDYYYWVLAILSFVNVIYYIVCSWSYGPTMDQ  539



>ref|XP_009114876.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like isoform X1 [Brassica 
rapa]
Length=593

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            S   G  SWI  +IN+GHYDY+YWVLA LS VN + +++CS SYGP+ D+
Sbjct  523  SSKKGGESWIEDNINKGHYDYYYWVLAILSFVNVIYYIVCSWSYGPTMDQ  572



>gb|KDP33700.1| hypothetical protein JCGZ_07271 [Jatropha curcas]
Length=596

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  26   SGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYG  151
            +G  SW++ ++N GHYDY+YW+LA LS++NF  +L+CSR+YG
Sbjct  523  NGKVSWVSDNLNRGHYDYYYWLLAFLSVINFFYYLLCSRAYG  564



>ref|XP_011019627.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Populus euphratica]
Length=571

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            ++ ++   G  SW++S++N+G  D +YW++  LS++NF+ FL+C R+YGP+KD+K
Sbjct  511  VDRVTSRGGQESWLSSNLNKGRLDDYYWLITVLSIINFVYFLVCCRTYGPTKDQK  565



>ref|XP_011026619.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like isoform X1 [Populus 
euphratica]
Length=581

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  38   SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            SW++S+IN+GHYDY+YW+LAGLS+ NF+ +  C ++YGP K ++
Sbjct  524  SWLSSNINKGHYDYYYWLLAGLSLANFIYYRACCKAYGPCKGQE  567



>ref|XP_007135664.1| hypothetical protein PHAVU_010G147900g [Phaseolus vulgaris]
 gb|ESW07658.1| hypothetical protein PHAVU_010G147900g [Phaseolus vulgaris]
Length=616

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            ++ + S   G   WI+ +IN+GH+D +YWVL  LS VN L +L+CS +YGP+ D++    
Sbjct  514  AVEKFSSRGGKHGWISDNINKGHFDKYYWVLVTLSAVNLLYYLLCSWAYGPTADQESKVT  573

Query  182  EED  190
            +E+
Sbjct  574  QEN  576



>gb|KJB27307.1| hypothetical protein B456_004G290100 [Gossypium raimondii]
Length=583

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = +2

Query  23   NSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK-DEK  169
              G  SWI+S++N+GHYDY+Y +LAGLSM+NF+ FL C ++YGP   D+K
Sbjct  517  KRGGESWISSNMNKGHYDYYYCLLAGLSMLNFIYFLACCKAYGPCHGDDK  566



>gb|KJB27308.1| hypothetical protein B456_004G290200 [Gossypium raimondii]
Length=463

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  23   NSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGP  154
              G  SW++S++N+GHYDY+Y +LAGLSM+NF+ FL+C +++GP
Sbjct  397  KKGGESWVSSNMNKGHYDYYYCLLAGLSMLNFVYFLVCCKAHGP  440



>ref|XP_002516008.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF46428.1| nitrate transporter, putative [Ricinus communis]
Length=612

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            +N ++   G   W+ S+IN+GHYD +YW+LA +S VN L FLICS  YGP K++
Sbjct  520  VNNITSKGGKVGWVPSNINQGHYDNYYWLLAIMSAVNLLYFLICSWGYGPCKEQ  573



>ref|XP_004301550.2| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Fragaria vesca 
subsp. vesca]
Length=593

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            G  SW++S++N+GHYDYFY V+   SMVNFL +L+C R+YG  +D+K
Sbjct  518  GGVSWVSSNLNQGHYDYFYLVVTIFSMVNFLYYLLCCRAYGCCEDKK  564



>ref|XP_004235680.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Solanum lycopersicum]
Length=597

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKD  163
            ++++ +   G  SW++S+IN+GHY+Y+YW+LA L+  N L F+ C R YGPS D
Sbjct  526  AVDKYTKGEGTESWVSSNINKGHYEYYYWLLAVLTAFNLLYFVACCRQYGPSAD  579



>ref|XP_003569868.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Brachypodium distachyon]
Length=586

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  29   GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAMEED  190
            G  SW++S++N GHYDY+Y VLAGLS+ NF+ F+ C  +YG     + +A E++
Sbjct  526  GRDSWVSSNLNRGHYDYYYMVLAGLSVANFVYFVWCGWTYGEEGQNRVMATEDE  579



>ref|XP_006833367.1| hypothetical protein AMTR_s00109p00101980 [Amborella trichopoda]
 gb|ERM98645.1| hypothetical protein AMTR_s00109p00101980 [Amborella trichopoda]
Length=578

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKD  163
            ++ +S N    SW+  DIN+GHYDY+YWVLA +S+VNF  FL+CS  Y   KD
Sbjct  499  VDGVSRNLSGVSWVPRDINKGHYDYYYWVLAIMSLVNFFYFLLCSWLYRYRKD  551



>gb|KJB54816.1| hypothetical protein B456_009G050500, partial [Gossypium raimondii]
Length=301

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  38   SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            SWI+S+IN+GHY+Y+YWVL G S++NF+  L CS++YGP +D 
Sbjct  252  SWISSNINKGHYEYYYWVLDGSSILNFIYSLACSKAYGPCQDH  294



>gb|KJB27309.1| hypothetical protein B456_004G290200 [Gossypium raimondii]
Length=577

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  23   NSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGP  154
              G  SW++S++N+GHYDY+Y +LAGLSM+NF+ FL+C +++GP
Sbjct  511  KKGGESWVSSNMNKGHYDYYYCLLAGLSMLNFVYFLVCCKAHGP  554



>ref|XP_006392949.1| hypothetical protein EUTSA_v10011325mg [Eutrema salsugineum]
 gb|ESQ30235.1| hypothetical protein EUTSA_v10011325mg [Eutrema salsugineum]
Length=609

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            ++NEL+  +G  SW++ +IN+GHY+Y+YW+LA +S +N + + ICS SYGP  D+
Sbjct  518  AVNELTSRNGKESWVSDNINKGHYNYYYWLLAIMSFINVIYYAICSWSYGPLFDQ  572



>gb|KHG18966.1| hypothetical protein F383_07419 [Gossypium arboreum]
Length=577

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  23   NSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGP  154
              G  SW++S++N+GHYDY+Y +LAGLSM+NF+ FL+C +++GP
Sbjct  511  KKGGESWVSSNMNKGHYDYYYCLLAGLSMLNFVYFLVCCKAHGP  554



>ref|XP_010500813.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Camelina sativa]
Length=608

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            ++NEL+  +   SW++ +IN+GHY+Y+YWVLA +S +N + ++ICS SYGP  D+
Sbjct  519  AVNELTSRNDKESWVSDNINKGHYNYYYWVLAIMSFINVIYYVICSWSYGPLVDQ  573



>gb|KHG12398.1| hypothetical protein F383_17450 [Gossypium arboreum]
Length=583

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  23   NSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGP  154
              G  SWI+S++N+GHYDY+Y +LAGLSM+NF+ FL C ++YGP
Sbjct  517  KRGGESWISSNMNKGHYDYYYCLLAGLSMLNFIYFLSCCKAYGP  560



>ref|XP_003567138.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Brachypodium distachyon]
Length=576

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYG  151
            ++E S + G  SW++SD+N GHYDY+YW+LA L  +NF+ FL C  +YG
Sbjct  509  VHEASRHGGRTSWLSSDLNLGHYDYYYWLLACLGALNFVYFLCCGWAYG  557



>ref|XP_007150639.1| hypothetical protein PHAVU_005G169300g [Phaseolus vulgaris]
 gb|ESW22633.1| hypothetical protein PHAVU_005G169300g [Phaseolus vulgaris]
Length=580

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 24/53 (45%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKD  163
            ++ ++   G  SW++ +IN+GHYD +YW+LA +S VNFL +L+C  +YGPS +
Sbjct  508  VDNITSKGGKQSWVSDNINKGHYDNYYWLLAIMSAVNFLYYLVCCWAYGPSAE  560



>ref|XP_003546946.1| PREDICTED: probable peptide transporter At1g52190-like [Glycine 
max]
Length=584

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 46/62 (74%), Gaps = 2/62 (3%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAME  184
            +++++   G  SW++ +IN+GHYD +YW+LA +S+VN L +L+CS +YGPS +  P + +
Sbjct  512  VDDITSRGGKESWVSDNINKGHYDKYYWLLAIMSVVNILYYLVCSWAYGPSAE--PASKK  569

Query  185  ED  190
            E+
Sbjct  570  EE  571



>gb|EPS73537.1| proton-dependent oligopeptide transport family protein [Genlisea 
aurea]
Length=305

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +2

Query  35   GSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            GSW++S+IN+GHYD +Y VL G+SM NF+ FL CS +YGP ++E+
Sbjct  253  GSWVSSNINKGHYDDYYLVLGGISMGNFIYFLACSYAYGPMQEEE  297



>gb|KHM98742.1| Putative peptide transporter [Glycine soja]
Length=566

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 46/62 (74%), Gaps = 2/62 (3%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAME  184
            +++++   G  SW++ +IN+GHYD +YW+LA +S+VN L +L+CS +YGPS +  P + +
Sbjct  494  VDDITSRGGKESWVSDNINKGHYDKYYWLLAIMSVVNILYYLVCSWAYGPSAE--PASKK  551

Query  185  ED  190
            E+
Sbjct  552  EE  553



>gb|KEH40281.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=569

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            ++ ++   G  SW++S+IN+GHYDY+YW+L  L + NFL FL  S++YGP K E+
Sbjct  507  VDNVTKGEGKESWVSSNINKGHYDYYYWLLFELMLANFLAFLCFSKAYGPCKGEE  561



>ref|XP_008367055.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Malus domestica]
Length=154

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  160
            +   S   G   WI  ++NEGH DYF+W+LAGLS++N L++++C++ Y   K
Sbjct  101  VTYFSTKDGKAGWIPDNLNEGHLDYFFWLLAGLSLLNMLVYVVCAKRYKKKK  152



>gb|KDO66442.1| hypothetical protein CISIN_1g007910mg [Citrus sinensis]
Length=585

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            +N ++ + G  SW+++++N  HYDY+YW+L  LS+VNF  F+ CS +YG  +D K
Sbjct  505  LNRVTGSGGKVSWVSTNVNRAHYDYYYWILCILSVVNFFYFIACSWAYGSCEDIK  559



>ref|XP_006475659.1| PREDICTED: probable peptide transporter At1g52190-like [Citrus 
sinensis]
Length=585

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            +N ++ + G  SW+++++N  HYDY+YW+L  LS+VNF  F+ CS +YG  +D K
Sbjct  505  LNRVTGSGGKVSWVSTNVNRAHYDYYYWILCILSVVNFFYFIACSWAYGSCEDIK  559



>ref|XP_006451203.1| hypothetical protein CICLE_v10007831mg [Citrus clementina]
 gb|ESR64443.1| hypothetical protein CICLE_v10007831mg [Citrus clementina]
Length=585

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            +N ++ + G  SW+++++N  HYDY+YW+L  LS+VNF  F+ CS +YG  +D K
Sbjct  505  LNRVTGSGGKVSWVSTNVNRAHYDYYYWILCILSVVNFFYFIACSWAYGSCEDIK  559



>ref|XP_011072387.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Sesamum indicum]
Length=592

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            +++  + N GN SW++S+IN+GHYD++YW+LA ++ +N + FL CS  YGP  + 
Sbjct  515  TVDSATKNGGNESWVSSNINKGHYDFYYWLLAAMTFINLIYFLCCSWIYGPCVER  569



>ref|XP_006475660.1| PREDICTED: probable peptide/nitrate transporter At3g16180-like 
isoform X1 [Citrus sinensis]
Length=311

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKD  163
            ++ ++   G  SW++S++N+GH DYFYW+L  + +VNF  FL+C  +YGPS D
Sbjct  234  VDRVTRKHGKESWLSSNLNKGHLDYFYWLLMAMCLVNFGYFLVCCWAYGPSVD  286



>ref|XP_003597722.1| hypothetical protein MTR_2g101560 [Medicago truncatula]
 gb|ABD32300.1| TGF-beta receptor, type I/II extracellular region [Medicago truncatula]
 gb|AES67973.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=637

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            +I   + + GN  WI+ +IN+GH+D + WV+AG++++N L +L+CS +YGP+ D+     
Sbjct  518  TIENTTSSGGNEGWISDNINKGHFDKYLWVIAGINVLNLLYYLVCSWAYGPTADQVSKVS  577

Query  182  EED  190
            EE+
Sbjct  578  EEE  580



>ref|XP_008340555.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Malus domestica]
Length=300

 Score = 62.0 bits (149),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  160
            +  L+   GN  WIT ++N GH DYF+W+LAGLS++N L++++C++ Y   K
Sbjct  247  VTYLTTKDGNSGWITDNLNGGHLDYFFWLLAGLSLLNMLVYVVCAKRYKKKK  298



>ref|XP_007137205.1| hypothetical protein PHAVU_009G108400g [Phaseolus vulgaris]
 gb|ESW09199.1| hypothetical protein PHAVU_009G108400g [Phaseolus vulgaris]
Length=568

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            G+ SW++S+IN+GHYDY+Y ++  L  +N++ FL CS+SYGP KD +
Sbjct  521  GHESWVSSNINKGHYDYYYSLICALCFLNYIYFLYCSKSYGPCKDRR  567



>ref|XP_010668942.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Beta vulgaris subsp. 
vulgaris]
Length=559

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  38   SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  160
            SW++SDIN+GHYDY+YW+LAGLS++N++ F+ CS+ Y   K
Sbjct  507  SWVSSDINKGHYDYYYWILAGLSLLNYVYFVFCSKGYDQGK  547



>ref|XP_010042085.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like, partial [Eucalyptus 
grandis]
Length=514

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            ++ LS  S +G+W+++++N+GHYDY+YW+L GLS++NF  +L C+ +Y   ++ K
Sbjct  437  LDRLSKGSRDGTWLSTNVNKGHYDYYYWILGGLSVINFFYYLACAWAYEGGEERK  491



>ref|XP_010049663.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Eucalyptus grandis]
 gb|KCW82404.1| hypothetical protein EUGRSUZ_C03809 [Eucalyptus grandis]
Length=586

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            ++ LS  S +G+W+++++N+GHYDY+YW+L GLS++NF  +L C+ +Y   ++ K
Sbjct  509  LDRLSKGSRDGTWLSTNVNKGHYDYYYWILGGLSVINFFYYLACAWAYEGGEERK  563



>ref|XP_007150641.1| hypothetical protein PHAVU_005G169400g [Phaseolus vulgaris]
 gb|ESW22635.1| hypothetical protein PHAVU_005G169400g [Phaseolus vulgaris]
Length=605

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAME  184
            I  ++ + G   WI+ +IN+G YD +YWV++GLS +N L +L+CS  YGP+ DE     E
Sbjct  516  IQNVTSSGGKQGWISDNINKGRYDKYYWVISGLSALNILYYLLCSWVYGPTVDEVSKVGE  575

Query  185  ED*RR  199
            E+  R
Sbjct  576  ENGSR  580



>ref|XP_010654644.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Vitis vinifera]
 ref|XP_010654645.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Vitis vinifera]
 ref|XP_010654646.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Vitis vinifera]
 emb|CBI36110.3| unnamed protein product [Vitis vinifera]
Length=622

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            ++N L+   G  SW++++IN+GHYD +YW+LA +S +N L +L+CS  YGP  ++
Sbjct  507  AVNHLTSRGGKESWVSNNINKGHYDNYYWLLAIMSAINLLYYLVCSYFYGPCVEQ  561



>ref|XP_002308609.1| hypothetical protein POPTR_0006s25670g [Populus trichocarpa]
 gb|EEE92132.1| hypothetical protein POPTR_0006s25670g [Populus trichocarpa]
Length=572

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            ++ ++   G  SW++S++N+G  D +YW++  LS++NF+ FL+C R+YG +KDEK
Sbjct  512  VDRVTSRGGQESWLSSNLNKGRLDDYYWLITVLSIINFVYFLVCCRTYGRTKDEK  566



>gb|KHN10207.1| Putative peptide transporter [Glycine soja]
Length=562

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +2

Query  29   GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            G+ SW++S+IN+GHYDY+Y ++  L  VNF+ FL CS+SYGP K+ 
Sbjct  515  GHESWLSSNINKGHYDYYYTLICALCFVNFVYFLYCSKSYGPCKNR  560



>ref|XP_003522705.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X1 [Glycine max]
 ref|XP_006578223.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X2 [Glycine max]
Length=568

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +2

Query  29   GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            G+ SW++S+IN+GHYDY+Y ++  L  VNF+ FL CS+SYGP K+ 
Sbjct  521  GHESWLSSNINKGHYDYYYTLICALCFVNFVYFLYCSKSYGPCKNR  566



>ref|XP_009146163.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1 [Brassica rapa]
Length=593

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            S   G  SWI  +IN+GHYDY+YWVLA +S VN + ++ CS SYGP+ D+
Sbjct  523  SSKKGGVSWIEDNINKGHYDYYYWVLAIMSFVNVIYYVACSWSYGPTVDQ  572



>ref|XP_006371704.1| hypothetical protein POPTR_0018s00460g [Populus trichocarpa]
 gb|ERP49501.1| hypothetical protein POPTR_0018s00460g [Populus trichocarpa]
Length=583

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  38   SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  160
            SW++S+IN+GHYDY+YW+L+ L   NF+ +L CS++YGP K
Sbjct  514  SWVSSNINKGHYDYYYWLLSSLGFANFIYYLACSKAYGPCK  554



>emb|CDX97728.1| BnaA05g23510D [Brassica napus]
Length=593

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            S   G  SWI  +IN+GHYDY+YWVLA +S VN + ++ CS SYGP+ D+
Sbjct  523  SSKKGGVSWIEDNINKGHYDYYYWVLAIMSFVNVIYYVACSWSYGPTVDQ  572



>ref|XP_006371705.1| hypothetical protein POPTR_0018s00470g [Populus trichocarpa]
 gb|ERP49502.1| hypothetical protein POPTR_0018s00470g [Populus trichocarpa]
Length=517

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  38   SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  160
            SW++S+IN+GHYDY+YW+L+ L   NF+ +L CS++YGP K
Sbjct  447  SWVSSNINKGHYDYYYWLLSSLGFANFIYYLACSKAYGPCK  487



>ref|XP_010047267.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 1.2 
[Eucalyptus grandis]
Length=591

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +2

Query  2    SINELSINSGNGS-WITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            SI +L    G    W+ SDIN+GHYDY++WV+   S +NF+ FL C ++YGP K E
Sbjct  518  SIVQLVTERGEMEGWVGSDINKGHYDYYFWVITCFSTLNFVYFLACGKAYGPCKGE  573



>gb|KDO66443.1| hypothetical protein CISIN_1g007637mg [Citrus sinensis]
Length=595

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKD  163
            ++ ++   G  SW++S++N+GH DYFYW+L  + +VNF  FL+C  +YGPS D
Sbjct  518  VDRVTRKHGKESWLSSNLNKGHLDYFYWLLMAMCLVNFGYFLVCCWAYGPSVD  570



>ref|XP_011008319.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Populus euphratica]
Length=597

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGP  154
            ++++L+   G  SW++++IN+GHYD +YW+LA +S VN L FL+CS +YGP
Sbjct  516  AVDKLTSRGGKESWVSNNINKGHYDNYYWLLAIMSSVNLLYFLVCSWAYGP  566



>emb|CDY30141.1| BnaC05g37210D [Brassica napus]
Length=593

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            S   G  SWI  +IN+GHYDY+YWVLA +S VN + ++ CS SYGP+ D+
Sbjct  523  SSKKGGVSWIEDNINKGHYDYYYWVLAIMSFVNVIYYVACSWSYGPTVDQ  572



>ref|XP_007024207.1| Major facilitator superfamily protein, putative [Theobroma cacao]
 gb|EOY26829.1| Major facilitator superfamily protein, putative [Theobroma cacao]
Length=568

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKD  163
            +N+ +   G  SW+  ++NE  +D +YW+LAGLS+VN L ++ICSRSYG + +
Sbjct  505  VNKTTSRGGKPSWVADNLNEARFDNYYWLLAGLSLVNLLYYIICSRSYGSTAE  557



>gb|KCW79098.1| hypothetical protein EUGRSUZ_C00542 [Eucalyptus grandis]
Length=537

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +2

Query  41   WITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            W+ SDIN+GHYDY++WV+   S +NF+ FL C ++YGP K E
Sbjct  478  WVGSDINKGHYDYYFWVITCFSTLNFVYFLACGKAYGPCKGE  519



>ref|XP_002299719.2| hypothetical protein POPTR_0001s18640g [Populus trichocarpa]
 gb|EEE84524.2| hypothetical protein POPTR_0001s18640g [Populus trichocarpa]
Length=597

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGP  154
            ++++L+   G  SW++++IN+GHYD +YW+LA +S VN L FL+CS +YGP
Sbjct  516  AVDKLTSRGGKESWVSNNINKGHYDNYYWLLAIMSSVNLLYFLVCSWAYGP  566



>ref|XP_011013128.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Populus euphratica]
Length=584

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  38   SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  160
            SW++S+IN+GHYDY+YW+L+ L   NF+ +L CS++YGP K
Sbjct  519  SWVSSNINKGHYDYYYWLLSSLGFANFIYYLACSKAYGPCK  559



>ref|XP_007150640.1| hypothetical protein PHAVU_005G169300g [Phaseolus vulgaris]
 gb|ESW22634.1| hypothetical protein PHAVU_005G169300g [Phaseolus vulgaris]
Length=478

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKD  163
            ++ ++   G  SW++ +IN+GHYD +YW+LA +S VNFL +L+C  +YGPS +
Sbjct  406  VDNITSKGGKQSWVSDNINKGHYDNYYWLLAIMSAVNFLYYLVCCWAYGPSAE  458



>ref|XP_011026621.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Populus euphratica]
Length=579

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  38   SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  160
            SW++S+IN+GHYDY+YW+L+ L   NF+ +L CS++YGP K
Sbjct  514  SWVSSNINKGHYDYYYWLLSSLGFANFIYYLACSKAYGPCK  554



>ref|XP_006371706.1| hypothetical protein POPTR_0018s00470g [Populus trichocarpa]
 gb|ERP49503.1| hypothetical protein POPTR_0018s00470g [Populus trichocarpa]
Length=541

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  38   SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  160
            SW++S+IN+GHYDY+YW+L+ L   NF+ +L CS++YGP K
Sbjct  471  SWVSSNINKGHYDYYYWLLSSLGFANFIYYLACSKAYGPCK  511



>ref|XP_010050380.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Eucalyptus grandis]
Length=582

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +2

Query  41   WITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            W+ SDIN+GHYDY++WV+   S +NF+ FL C ++YGP K E
Sbjct  523  WVGSDINKGHYDYYFWVITCFSTLNFVYFLACGKAYGPCKGE  564



>ref|XP_006451204.1| hypothetical protein CICLE_v10007800mg [Citrus clementina]
 gb|ESR64444.1| hypothetical protein CICLE_v10007800mg [Citrus clementina]
Length=598

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKD  163
            ++ ++   G  SW+ S++N+GH DYFYW+L  + +VNF  FL+C  +YGPS D
Sbjct  521  VDRITRKHGKESWLPSNLNKGHLDYFYWLLMAMCLVNFGYFLVCCWAYGPSVD  573



>ref|XP_011026623.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Populus euphratica]
Length=579

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  38   SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  160
            SW++S+IN+GHYDY+YW+L+ L   NF+ +L CS++YGP K
Sbjct  514  SWVSSNINKGHYDYYYWLLSSLGFANFIYYLACSKAYGPCK  554



>ref|XP_008242634.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Prunus mume]
Length=588

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  38   SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            SWI+SD+N  HYDY+YW+L  +S+VNF  FL+CS  YG  +D+K
Sbjct  519  SWISSDLNRAHYDYYYWLLTAMSVVNFFYFLLCSWLYGHCEDKK  562



>ref|XP_007204860.1| hypothetical protein PRUPE_ppa023390mg [Prunus persica]
 gb|EMJ06059.1| hypothetical protein PRUPE_ppa023390mg [Prunus persica]
Length=588

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  38   SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            SWI+SD+N  HYDY+YW+L  +S+VNF  FL+CS  YG  +D+K
Sbjct  519  SWISSDLNRAHYDYYYWLLTAMSVVNFFYFLLCSWLYGHCEDKK  562



>ref|XP_011026624.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Populus euphratica]
Length=576

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  38   SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  160
            SW++S+IN+GHYDY+YW+L+ L   NF+ +L CS++YGP K
Sbjct  514  SWVSSNINKGHYDYYYWLLSSLGFANFIYYLACSKAYGPCK  554



>ref|XP_010545694.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Tarenaya hassleriana]
Length=600

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            ++N+++  +G  SW++ + N+GHYDY+ W+LA LS VN + ++ICS +YGP+ D+
Sbjct  515  AVNDVTSRNGGESWVSDNFNKGHYDYYCWLLAILSFVNVIYYIICSWAYGPAVDQ  569



>ref|XP_004970044.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X1 [Setaria italica]
Length=657

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = +2

Query  17   SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAMEED  190
            S   GN SW+  D+N GHYDY+YW+L G  +VNF+ F  C   YG  ++ K V  EED
Sbjct  594  SRRGGNTSWLVDDLNAGHYDYYYWLLTGYGVVNFVYFAWCCWVYG--EEGKNVEWEED  649



>ref|XP_006465636.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X3 [Citrus sinensis]
Length=558

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            ++++++   G  SW++S+IN+G YD +YW+LA +S+VN + FL+CS +YGP  D 
Sbjct  464  AVDDITSKGGKESWVSSNINKGRYDNYYWLLAIMSLVNLVYFLVCSWAYGPCVDR  518



>ref|XP_004970047.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X4 [Setaria italica]
Length=565

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = +2

Query  17   SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAMEED  190
            S   GN SW+  D+N GHYDY+YW+L G  +VNF+ F  C   YG  ++ K V  EED
Sbjct  502  SRRGGNTSWLVDDLNAGHYDYYYWLLTGYGVVNFVYFAWCCWVYG--EEGKNVEWEED  557



>gb|KEH21351.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=580

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            G  SW++++IN+GHYDY+YW+L  LS+VN   FL+CS +YG ++D K
Sbjct  514  GQVSWLSANINQGHYDYYYWLLTILSLVNMFYFLLCSWAYGSTEDIK  560



>ref|XP_004970046.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X3 [Setaria italica]
Length=567

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = +2

Query  17   SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAMEED  190
            S   GN SW+  D+N GHYDY+YW+L G  +VNF+ F  C   YG  ++ K V  EED
Sbjct  504  SRRGGNTSWLVDDLNAGHYDYYYWLLTGYGVVNFVYFAWCCWVYG--EEGKNVEWEED  559



>ref|XP_006465634.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X1 [Citrus sinensis]
 ref|XP_006465635.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X2 [Citrus sinensis]
 gb|KDO56946.1| hypothetical protein CISIN_1g007262mg [Citrus sinensis]
 gb|KDO56947.1| hypothetical protein CISIN_1g007262mg [Citrus sinensis]
Length=611

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            ++++++   G  SW++S+IN+G YD +YW+LA +S+VN + FL+CS +YGP  D 
Sbjct  517  AVDDITSKGGKESWVSSNINKGRYDNYYWLLAIMSLVNLVYFLVCSWAYGPCVDR  571



>ref|XP_008793166.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Phoenix dactylifera]
Length=582

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = +2

Query  20   INSGNG--SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYG  151
            I++GNG   W+ S++NEGHYDY+YW+L  LS+VN   F +CS +YG
Sbjct  509  ISAGNGRVGWLDSNLNEGHYDYYYWILTLLSVVNVFYFFVCSWAYG  554



>ref|XP_010098095.1| putative peptide transporter [Morus notabilis]
 gb|EXB74532.1| putative peptide transporter [Morus notabilis]
Length=608

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            +++  +   G  SW++ +IN GHYDY+YW+LA +S VN   +L CS +YGP  ++     
Sbjct  517  AVDNATSRKGKESWVSDNINRGHYDYYYWLLAIMSFVNLFYYLFCSWAYGPCAEQMKKVT  576

Query  182  EE  187
            +E
Sbjct  577  DE  578



>ref|XP_008466778.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3 isoform X1 [Cucumis melo]
Length=587

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            +  L+  +G   WI  ++NEGH D+F+W+LAGLS +N L++ +C++ Y P K  +
Sbjct  532  VTYLTTRNGQSGWIPDNLNEGHLDFFFWLLAGLSFLNLLVYTVCAKRYRPKKASQ  586



>ref|XP_004970045.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X2 [Setaria italica]
Length=594

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = +2

Query  17   SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAMEED  190
            S   GN SW+  D+N GHYDY+YW+L G  +VNF+ F  C   YG  ++ K V  EED
Sbjct  531  SRRGGNTSWLVDDLNAGHYDYYYWLLTGYGVVNFVYFAWCCWVYG--EEGKNVEWEED  586



>ref|XP_007019700.1| Nitrate transporter, putative [Theobroma cacao]
 gb|EOY16925.1| Nitrate transporter, putative [Theobroma cacao]
Length=603

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            +N ++   G  SW+++++N+GHYDY+YW+L  LS++N L +L+CS +YG  +++
Sbjct  521  LNSVTQKKGEVSWVSTNLNKGHYDYYYWLLTILSVINVLYYLVCSWAYGSCENK  574



>ref|XP_008466783.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3 isoform X2 [Cucumis melo]
Length=586

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            +  L+  +G   WI  ++NEGH D+F+W+LAGLS +N L++ +C++ Y P K  +
Sbjct  531  VTYLTTRNGQSGWIPDNLNEGHLDFFFWLLAGLSFLNLLVYTVCAKRYRPKKASQ  585



>ref|XP_004486756.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X2 [Cicer arietinum]
Length=593

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            +I  ++   G   WI+ +IN+G +D +YWV+AG+S +N L +L+CS +YGP+ D+     
Sbjct  471  TIENVTSREGKEGWISDNINKGRFDKYYWVIAGVSALNILYYLVCSWAYGPTVDQISKVS  530

Query  182  EED  190
            EE+
Sbjct  531  EEN  533



>ref|XP_004486755.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X1 [Cicer arietinum]
Length=638

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAM  181
            +I  ++   G   WI+ +IN+G +D +YWV+AG+S +N L +L+CS +YGP+ D+     
Sbjct  516  TIENVTSREGKEGWISDNINKGRFDKYYWVIAGVSALNILYYLVCSWAYGPTVDQISKVS  575

Query  182  EED  190
            EE+
Sbjct  576  EEN  578



>gb|EAY75907.1| hypothetical protein OsI_03827 [Oryza sativa Indica Group]
Length=574

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYG  151
            ++E+S   G  SW+  D+N G YDY+YW+LAGL  VNF+ FL C  +YG
Sbjct  507  VHEVSRRGGRTSWLAEDLNAGRYDYYYWLLAGLGAVNFVCFLWCGWAYG  555



>gb|KHN04222.1| Putative peptide transporter [Glycine soja]
Length=579

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAME  184
            + +++   G   W++ +IN+G +D +YW+LA +S VN L +L+CS +YGP+ D++    E
Sbjct  484  VEKVTSRGGKDGWVSDNINKGRFDKYYWLLATMSAVNVLYYLVCSWAYGPTADQESKVTE  543

Query  185  ED  190
            E+
Sbjct  544  EN  545



>ref|XP_003530142.1| PREDICTED: probable peptide transporter At1g52190-like [Glycine 
max]
Length=611

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAME  184
            + +++   G   W++ +IN+G +D +YW+LA +S VN L +L+CS +YGP+ D++    E
Sbjct  516  VEKVTSRGGKDGWVSDNINKGRFDKYYWLLATMSAVNVLYYLVCSWAYGPTSDQESKVTE  575

Query  185  ED  190
            E+
Sbjct  576  EN  577



>ref|XP_003597726.1| hypothetical protein MTR_2g101610 [Medicago truncatula]
 gb|ABD32296.1| TGF-beta receptor, type I/II extracellular region [Medicago truncatula]
 gb|AES67977.1| nitrate transporter 1 [Medicago truncatula]
Length=638

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            I   + + GN  W++ +IN+GH+D +YWV+ G++ +N L +L+CS +YGP+ DE
Sbjct  519  IESTTPSGGNEGWVSDNINKGHFDKYYWVIVGINALNLLYYLVCSWAYGPTVDE  572



>ref|XP_007135665.1| hypothetical protein PHAVU_010G148000g [Phaseolus vulgaris]
 gb|ESW07659.1| hypothetical protein PHAVU_010G148000g [Phaseolus vulgaris]
Length=582

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            ++  ++   G   WI  +IN+G YD +YWVLA L+ VN L +L+CS +YGP+ D+
Sbjct  514  TVEHVTSRGGKEGWILDNINKGRYDKYYWVLALLNAVNILYYLVCSWAYGPTHDQ  568



>ref|XP_003597725.1| hypothetical protein MTR_2g101590 [Medicago truncatula]
 gb|ABD32298.1| TGF-beta receptor, type I/II extracellular region [Medicago truncatula]
 gb|AES67976.1| nitrate transporter 1 [Medicago truncatula]
Length=637

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            I   + + GN  W++ +IN+GH+D +YWV+ G++ +N L +L+CS +YGP+ DE
Sbjct  518  IESTTPSGGNEGWVSDNINKGHFDKYYWVIVGINALNLLYYLVCSWAYGPTVDE  571



>ref|XP_003529761.1| PREDICTED: probable peptide transporter At1g52190-like [Glycine 
max]
Length=606

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  29   GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            GN  W+  +IN+G YD +YWVLA LS VN L +L+CS +YGP+ D+
Sbjct  523  GNEGWVLDNINKGRYDRYYWVLASLSAVNILYYLVCSWAYGPTVDQ  568



>ref|XP_006426938.1| hypothetical protein CICLE_v10025189mg [Citrus clementina]
 gb|ESR40178.1| hypothetical protein CICLE_v10025189mg [Citrus clementina]
Length=611

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            +++ ++   G  SW++S+IN+G YD +YW+LA +S+VN + FL+CS +YGP  D 
Sbjct  517  AVDHITSKGGKESWVSSNINKGRYDNYYWLLAIMSLVNLVYFLVCSWAYGPCVDR  571



>gb|KEH40283.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=565

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            ++ ++   G  SW++S+IN+GHYDY+YW+L  L + NFL FL  S++YGP K E+
Sbjct  503  VDNVTKGEGKESWVSSNINKGHYDYYYWLLFVLMLANFLGFLWFSKAYGPCKGEE  557



>ref|XP_008242632.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Prunus mume]
Length=596

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 21/43 (49%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  38   SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            SW++ ++N+GHYDY+YW+L  L++VNF  F++C   YGP +D+
Sbjct  521  SWVSKNLNKGHYDYYYWLLTVLNVVNFFYFILCGWLYGPCEDK  563



>ref|XP_010105519.1| Peptide transporter [Morus notabilis]
 gb|EXC05014.1| Peptide transporter [Morus notabilis]
Length=584

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  23   NSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  160
            N+G   WIT ++NEGH DY++W+LAGLS +N L+++ C+  + P K
Sbjct  537  NAGKSGWITDNLNEGHLDYYFWLLAGLSFLNLLVYIFCANKFKPKK  582



>ref|XP_008793165.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Phoenix dactylifera]
Length=610

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +2

Query  26   SGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYG  151
            +G G W+ +++N GHYDY+YWVL  +  ++FL FL+CS +YG
Sbjct  547  NGRGMWLATNLNRGHYDYYYWVLTLMGAIDFLYFLVCSWAYG  588



>ref|NP_001044323.1| Os01g0761400 [Oryza sativa Japonica Group]
 dbj|BAB61218.1| putative peptide transporter [Oryza sativa Japonica Group]
 dbj|BAB92363.1| putative nitrite transporter [Oryza sativa Japonica Group]
 dbj|BAF06237.1| Os01g0761400 [Oryza sativa Japonica Group]
 gb|EAZ13621.1| hypothetical protein OsJ_03537 [Oryza sativa Japonica Group]
 dbj|BAG97289.1| unnamed protein product [Oryza sativa Japonica Group]
Length=574

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYG  151
            ++E+S   G  SW+  D+N G YDY+YW+LAGL  VNF+ FL C  +YG
Sbjct  507  VHEVSGRRGRTSWLAEDLNAGRYDYYYWLLAGLGAVNFVYFLWCGWAYG  555



>ref|XP_010318543.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X1 [Solanum 
lycopersicum]
Length=615

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKD  163
            ++++ +   G  SWI+S+IN+GHY+Y+YW+LA L+  N L F+ C   YGPS D
Sbjct  526  AVDKYTKGKGKESWISSNINKGHYEYYYWLLALLTAFNLLYFMACCWQYGPSVD  579



>gb|KHN04221.1| Putative peptide transporter [Glycine soja]
Length=575

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  29   GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            GN  W+  +IN+G YD +YWVLA LS VN L +L+CS +YGP+ D+
Sbjct  492  GNEGWVLDNINKGRYDRYYWVLASLSAVNILYYLVCSWAYGPTVDK  537



>ref|XP_008389126.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like, partial [Malus 
domestica]
Length=611

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  160
            +   S   G   WI  ++NEGH DYF+W+LAGLS++N L++++C++ Y   K
Sbjct  558  VTYFSTKDGKAGWIPDNLNEGHLDYFFWLLAGLSLLNMLVYVVCAKRYKKKK  609



>ref|XP_010318544.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X2 [Solanum 
lycopersicum]
Length=623

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKD  163
            ++++ +   G  SWI+S+IN+GHY+Y+YW+LA L+  N L F+ C   YGPS D
Sbjct  534  AVDKYTKGKGKESWISSNINKGHYEYYYWLLALLTAFNLLYFMACCWQYGPSVD  587



>ref|XP_004235682.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X3 [Solanum 
lycopersicum]
Length=616

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKD  163
            ++++ +   G  SWI+S+IN+GHY+Y+YW+LA L+  N L F+ C   YGPS D
Sbjct  527  AVDKYTKGKGKESWISSNINKGHYEYYYWLLALLTAFNLLYFMACCWQYGPSVD  580



>ref|XP_006837800.1| hypothetical protein AMTR_s00104p00113760 [Amborella trichopoda]
 gb|ERN00369.1| hypothetical protein AMTR_s00104p00113760 [Amborella trichopoda]
Length=576

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAME  184
            ++ ++  SG G W+  DIN+G  D FYW+L+GLS+VNF ++L C+  + P    + + ME
Sbjct  505  VDRITGGSGKGGWLADDINKGRLDCFYWLLSGLSLVNFAVYLWCAAWFKPRPPPQDMEME  564



>ref|XP_006371703.1| hypothetical protein POPTR_0018s00450g [Populus trichocarpa]
 gb|ERP49500.1| hypothetical protein POPTR_0018s00450g [Populus trichocarpa]
Length=584

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  38   SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  160
            SW++S+IN+GHYDY+YW+L  L   NF+ +L CS++YGP K
Sbjct  514  SWVSSNINKGHYDYYYWLLYSLGFANFIYYLACSKAYGPCK  554



>ref|XP_010924574.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Elaeis guineensis]
Length=581

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 22/49 (45%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYG  151
            +++ S  +G  SW+ +++N GH+DY+YW+L  LS+ NF  FL+CS +YG
Sbjct  504  VDKRSGRNGRVSWVAANLNRGHFDYYYWILTLLSVCNFFYFLVCSWAYG  552



>ref|XP_003531667.1| PREDICTED: probable peptide transporter At1g52190-like [Glycine 
max]
 gb|KHN47834.1| Putative peptide transporter [Glycine soja]
Length=587

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAME  184
            + +++   G   W++ +IN+G +D +YW+LA LS VN L +L+CS  YGP+ D++    E
Sbjct  516  VEKVTSRGGKDGWVSDNINKGRFDKYYWLLATLSAVNVLYYLVCSWIYGPTADQESKVTE  575

Query  185  ED  190
            E+
Sbjct  576  EN  577



>ref|XP_004252349.2| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Solanum lycopersicum]
Length=629

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAME  184
            ++ ++   G  SW++S+IN GHY+ +YW+LA ++ +N + F++CS +YGP  + +   M+
Sbjct  558  VDSITKREGKESWVSSNINRGHYENYYWLLAIMTCLNLVYFMVCSWAYGPCVESRSKKMD  617

Query  185  ED  190
            E 
Sbjct  618  EK  619



>ref|XP_006343083.1| PREDICTED: probable peptide transporter At1g52190-like [Solanum 
tuberosum]
Length=594

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKD  163
            ++++ +   G  SW++S+IN+GHY+Y+YW+LA L+  N L F+ C   YGPS D
Sbjct  523  AVDKYTKGEGTESWVSSNINKGHYEYYYWLLALLTACNLLYFVACCWQYGPSAD  576



>emb|CDP20348.1| unnamed protein product [Coffea canephora]
Length=281

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVA  178
            + ++S   GN SW   D+NE H +Y+YWVLAGLS  NFL FL+ +  + P  D +PV+
Sbjct  200  VGKISKKGGNKSWFQHDLNESHLNYYYWVLAGLSATNFLWFLLTAICF-PFPDTEPVS  256



>gb|KJB33640.1| hypothetical protein B456_006G023500 [Gossypium raimondii]
Length=598

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPV  175
            ++++L+   G  SW+++++N GHYDY+YW+L  LS++N   +LIC   +G S ++  +
Sbjct  515  TVDKLTSKGGKQSWVSNNLNMGHYDYYYWILTILSVINVFYYLICCWDFGSSDNKNKI  572



>emb|CDX69747.1| BnaA10g20960D [Brassica napus]
Length=1546

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +2

Query  38   SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAMEED*RRT  202
            SWIT DINEGH DY+YW++   S++N + F+ CS++Y     + P ++    ++T
Sbjct  507  SWITEDINEGHLDYYYWLMTAFSLLNVVYFVWCSKAYAKLMTKAPFSLTRSVKKT  561



>ref|XP_007222295.1| hypothetical protein PRUPE_ppa003339mg [Prunus persica]
 gb|EMJ23494.1| hypothetical protein PRUPE_ppa003339mg [Prunus persica]
Length=584

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  160
            +   +   G   WI  ++NEGH DYF+W+LAGLS++N L++++C++ Y   K
Sbjct  531  VTYFTTQGGKAGWIPDNLNEGHLDYFFWLLAGLSLLNMLVYIVCAKRYKKKK  582



>ref|XP_006343082.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X1 [Solanum tuberosum]
Length=552

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKD  163
            ++++ +   G  SW++S+IN+GHY+Y+YW+LA L+  N + F+ C   YGPS D
Sbjct  484  AVDKYTKGEGTESWVSSNINKGHYEYYYWLLAVLTAFNLIYFVACCSQYGPSVD  537



>ref|XP_004149470.1| PREDICTED: peptide transporter PTR2-like [Cucumis sativus]
 ref|XP_004170470.1| PREDICTED: peptide transporter PTR2-like [Cucumis sativus]
 gb|KGN49752.1| hypothetical protein Csa_5G106020 [Cucumis sativus]
Length=586

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            +  L+  +G   WI  ++NEGH D F+W+LAGLS +N L++ +C++ Y P K  +
Sbjct  531  VTYLTTRNGQSGWIPDNLNEGHLDLFFWLLAGLSFLNLLVYTVCAKRYRPKKATQ  585



>ref|XP_002324233.2| hypothetical protein POPTR_0018s00480g, partial [Populus trichocarpa]
 gb|EEF02798.2| hypothetical protein POPTR_0018s00480g, partial [Populus trichocarpa]
Length=552

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  23   NSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGP  154
             +   SW++S+IN+GHYDY+YW+L+ L   NF+ +L CS++YGP
Sbjct  509  EANQESWVSSNINKGHYDYYYWLLSSLGFANFIYYLACSKAYGP  552



>emb|CDX91207.1| BnaC02g03900D [Brassica napus]
Length=348

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  38   SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            SWIT DI+EGH DY+YW++A LS++N L F+ CS+ YG  K +
Sbjct  303  SWITEDIDEGHLDYYYWLVAALSLLNVLYFVWCSKGYGKCKSD  345



>ref|XP_007222294.1| hypothetical protein PRUPE_ppa003339mg [Prunus persica]
 gb|EMJ23493.1| hypothetical protein PRUPE_ppa003339mg [Prunus persica]
Length=458

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  160
            +   +   G   WI  ++NEGH DYF+W+LAGLS++N L++++C++ Y   K
Sbjct  405  VTYFTTQGGKAGWIPDNLNEGHLDYFFWLLAGLSLLNMLVYIVCAKRYKKKK  456



>gb|AAM47310.1|AF377946_12 putative peptide transporter protein [Oryza sativa Japonica Group]
Length=377

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  17   SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  160
            +   GN  WI  ++N+GH DYF+W+LAGLS +NF++++IC+  Y   K
Sbjct  328  TTRGGNPGWIPDNLNQGHLDYFFWLLAGLSFLNFVIYVICANKYKSKK  375



>ref|NP_001051098.1| Os03g0719900 [Oryza sativa Japonica Group]
 dbj|BAB62326.1| peptide transporter [Oryza sativa Japonica Group]
 dbj|BAB62327.1| peptide transporter [Oryza sativa Japonica Group]
 gb|AAT77837.1| putative peptide transporter 1 [Oryza sativa Japonica Group]
 gb|ABF98582.1| Peptide transporter PTR2, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13012.1| Os03g0719900 [Oryza sativa Japonica Group]
 dbj|BAG93866.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76085.1| hypothetical protein OsI_13317 [Oryza sativa Indica Group]
Length=593

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 22/49 (45%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  14   LSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  160
             +   GN  WI  ++N+GH DYF+W+LAGLS +NF++++IC+  Y   K
Sbjct  543  FTTRGGNPGWIPDNLNQGHLDYFFWLLAGLSFLNFVIYVICANKYKSKK  591



>ref|XP_006353565.1| PREDICTED: probable peptide/nitrate transporter At3g16180-like 
[Solanum tuberosum]
Length=590

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            ++ +S   G  SW+++++N GHYDY+YWVL  LS+ NF  F++C+ +YG  +D++
Sbjct  520  VDHVSSRGGKVSWVSNNLNLGHYDYYYWVLCLLSVGNFFYFIVCAWAYGSDEDKR  574



>gb|EEE59822.1| hypothetical protein OsJ_12376 [Oryza sativa Japonica Group]
Length=593

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 22/49 (45%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  14   LSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  160
             +   GN  WI  ++N+GH DYF+W+LAGLS +NF++++IC+  Y   K
Sbjct  543  FTTRGGNPGWIPDNLNQGHLDYFFWLLAGLSFLNFVIYVICANKYKSKK  591



>ref|XP_009121934.1| PREDICTED: protein NRT1/ PTR FAMILY 1.3 [Brassica rapa]
Length=555

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +2

Query  38   SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            SWIT DINEGH DY+YW++   S++N + F+ CS++YG  K +
Sbjct  507  SWITEDINEGHLDYYYWLMTAFSLLNVVYFVWCSKAYGKCKSD  549



>ref|XP_006343081.1| PREDICTED: probable peptide transporter At1g52190-like [Solanum 
tuberosum]
Length=617

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKD  163
            ++++ +   G  SWI+S+IN GHY+Y+YW+LA ++  N L F++C   YGPS D
Sbjct  526  AVDKYTKGEGKESWISSNINRGHYEYYYWLLALMTGFNLLYFVVCCWQYGPSVD  579



>ref|XP_010243098.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like, partial [Nelumbo 
nucifera]
Length=456

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 39/62 (63%), Gaps = 4/62 (6%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAME  184
            +  ++   G   WI +++NEGH DYF+WVLAGL+ +NF+  LI +R Y P    K +  E
Sbjct  395  VTSVTTQGGRAGWIPANLNEGHLDYFFWVLAGLNTLNFVSHLIWARRYKP----KNIVFE  450

Query  185  ED  190
            E+
Sbjct  451  EN  452



>ref|XP_001774221.1| predicted protein [Physcomitrella patens]
 gb|EDQ60997.1| predicted protein [Physcomitrella patens]
Length=593

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKP  172
            +  ++  +G   W+  +IN GH DYF+W+LAG+S +N +LF++CSR Y   +  +P
Sbjct  533  VTRITTRNGAPGWVADNINRGHIDYFFWLLAGMSAMNLVLFVLCSRWYKTIRTWRP  588



>ref|XP_009789264.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Nicotiana sylvestris]
Length=473

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGP  154
            ++++ +   G  SW++S IN+GHY+Y+YW+LA ++  N L F+ICS +YGP
Sbjct  393  AVDKYTKGDGKESWVSSSINKGHYEYYYWLLAIMTSFNLLYFMICSWAYGP  443



>ref|XP_009628173.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Nicotiana tomentosiformis]
 ref|XP_009628174.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Nicotiana tomentosiformis]
Length=580

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +2

Query  14   LSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            L+   G  SW++S+IN GH DY++W+LA LS++NFL FL+  R Y P  D 
Sbjct  509  LTSTRGKTSWLSSNINRGHLDYYFWLLAFLSLLNFLYFLVVCRYYEPGNDR  559



>ref|XP_009788943.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Nicotiana sylvestris]
 ref|XP_009788944.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Nicotiana sylvestris]
Length=581

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +2

Query  17   SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPV  175
            S   G  SW+ +++N GHYDY+YW+L  LS VNF  F++C+ +YG +++++ +
Sbjct  514  STRGGKQSWVLNNLNLGHYDYYYWLLCFLSRVNFFYFIVCAWAYGSTEEQQKI  566



>ref|XP_002521890.1| peptide transporter, putative [Ricinus communis]
 gb|EEF40526.1| peptide transporter, putative [Ricinus communis]
Length=585

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  29   GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY  148
            G   WI  ++NEGH DYF+W+LAGLS+VN LL+++C++ Y
Sbjct  540  GKPGWIPDNLNEGHLDYFFWLLAGLSVVNMLLYIVCAKKY  579



>ref|NP_196718.1| major facilitator protein [Arabidopsis thaliana]
 sp|Q9LYD5.1|PTR48_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 1.3; Short=AtNPF1.3 [Arabidopsis 
thaliana]
 emb|CAB87717.1| putative oligopeptide transporter protein [Arabidopsis thaliana]
 gb|AED91696.1| major facilitator protein [Arabidopsis thaliana]
Length=481

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  35   GSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYG  151
            GSWIT +I+EGH DY+YW+L GLS++N L F+ C +SYG
Sbjct  439  GSWITENIDEGHLDYYYWLLVGLSLLNVLYFVWCKKSYG  477



>ref|XP_004252058.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Solanum lycopersicum]
Length=586

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 43/62 (69%), Gaps = 2/62 (3%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAME  184
            ++ ++   G  SW+++++N GHYDY+YWVL  LS+ NF  F++C+ +YG  +D++    E
Sbjct  516  VDHVTSRGGKVSWVSNNLNLGHYDYYYWVLCLLSVGNFFYFIVCAWAYGSDEDKR--IWE  573

Query  185  ED  190
            ED
Sbjct  574  ED  575



>ref|XP_010230764.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Brachypodium distachyon]
 ref|XP_003560544.2| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Brachypodium distachyon]
Length=947

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +2

Query  14   LSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICS  139
             +   GN  WI  ++NEGH DYF+W+LAGLS +NFL++++C+
Sbjct  539  FTTRGGNPGWIPDNLNEGHLDYFFWLLAGLSFLNFLVYVLCA  580



>ref|XP_006343084.1| PREDICTED: probable peptide transporter At1g52190-like [Solanum 
tuberosum]
Length=594

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKD  163
            ++++ +   G  SW++S+IN+GHY+Y+YW+LA L+  N L F+ C   YGPS D
Sbjct  523  AVDKYTKGEGTESWVSSNINKGHYEYYYWLLALLTGFNLLYFVACCWQYGPSAD  576



>ref|XP_009628045.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Nicotiana tomentosiformis]
Length=613

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKD  163
            ++++ +   G  SW++S IN+GHY+Y+YW+LA ++  N L F++C  +YGP  D
Sbjct  528  AVDKHTKGEGKESWVSSSINKGHYEYYYWLLAIMTAFNMLYFMVCKWAYGPCVD  581



>emb|CDP20524.1| unnamed protein product [Coffea canephora]
Length=188

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVA  178
            + ++S   G  SW   D+NE H +Y+YWVLAGLS  NFL FL+ +  + P  D +PV+
Sbjct  107  VGKISEKGGKKSWFQHDLNESHLNYYYWVLAGLSATNFLWFLLTAICF-PFPDTEPVS  163



>ref|XP_007203564.1| hypothetical protein PRUPE_ppa026167mg [Prunus persica]
 gb|EMJ04763.1| hypothetical protein PRUPE_ppa026167mg [Prunus persica]
Length=596

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 21/43 (49%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  38   SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            SW++ ++N+GHYDY+YW+L  L++VN   FL+C   YGP +D+
Sbjct  521  SWVSKNLNKGHYDYYYWLLTVLNVVNVFYFLLCGWLYGPCEDK  563



>ref|XP_006406868.1| hypothetical protein EUTSA_v10020365mg [Eutrema salsugineum]
 gb|ESQ48321.1| hypothetical protein EUTSA_v10020365mg [Eutrema salsugineum]
Length=588

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            S   G  SWI  +IN+GHYDY+YWVL  LS VN + +++CS SYG + D+
Sbjct  519  SSKKGKESWIEDNINKGHYDYYYWVLVILSFVNVVYYVVCSWSYGLTMDQ  568



>ref|XP_007024218.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY26840.1| Major facilitator superfamily protein [Theobroma cacao]
Length=605

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            I++++   G  SW++S+IN+G  D +YWVLA LS +N L + +C+ +YGP  ++
Sbjct  515  IDDITSRGGKESWVSSNINKGRIDNYYWVLAVLSFINLLYYFVCAWAYGPCGEQ  568



>gb|KHN41645.1| Putative peptide transporter [Glycine soja]
Length=573

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +2

Query  29   GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAMEED*R  196
            G  SW+ S+IN GHYDY+Y +L  L++VN L F I SR YG ++D K    E D R
Sbjct  509  GEASWLASNINRGHYDYYYALLFILNLVNLLCFFIWSRIYGSTRDIKNWEEEVDTR  564



>ref|XP_009416500.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Musa acuminata 
subsp. malaccensis]
Length=609

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/55 (42%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            +N++S   G  SW+  +IN+GH DY+YW+L  L +VN   F+ CS  YG    +K
Sbjct  533  VNKISGADGGASWLDRNINKGHLDYYYWILTLLGIVNIFYFMACSLVYGEEGQDK  587



>ref|XP_010109734.1| Peptide transporter [Morus notabilis]
 gb|EXC24397.1| Peptide transporter [Morus notabilis]
Length=154

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  160
            +   +   G   WI  ++NEGH DYF+W+LAGLS +N L++L+ +R Y   K
Sbjct  101  VTYFTTEGGKAGWIPDNLNEGHLDYFFWLLAGLSYLNMLVYLVFARKYKEKK  152



>ref|XP_003597728.1| hypothetical protein MTR_2g101640 [Medicago truncatula]
 gb|ABD32293.2| TGF-beta receptor, type I/II extracellular region [Medicago truncatula]
 gb|AES67979.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=632

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            +I  ++   G   WI+ +IN+G YD +Y V+AG+S +N L FL+CS +YGP+ D+
Sbjct  514  TIENVTSRGGKEGWISDNINKGRYDKYYMVIAGVSALNLLYFLVCSWAYGPTVDQ  568



>ref|XP_004235683.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Solanum lycopersicum]
Length=603

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKD  163
            ++++ +   G  SW++S+IN+GHY+Y+YW+LA L+  N + F+ C   YGPS D
Sbjct  514  AVDKYTEGEGKESWVSSNINKGHYEYYYWLLALLTAFNLIYFMACCWQYGPSVD  567



>ref|XP_008220969.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 8.3-like 
[Prunus mume]
Length=563

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  160
            +   +   G   WI  ++NEGH DYF+W+L+GLS++N L++++C++ Y   K
Sbjct  510  VTYFTTQGGKAGWIPDNLNEGHLDYFFWLLSGLSLLNMLVYIVCAKRYKKKK  561



>ref|XP_002873521.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH49780.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=481

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  35   GSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYG  151
            GSWIT +I+EGH DY+YW+L GLS++N L F+ C +SYG
Sbjct  439  GSWITENIDEGHLDYYYWLLVGLSVLNVLYFVWCKKSYG  477



>ref|XP_007227293.1| hypothetical protein PRUPE_ppa017140mg [Prunus persica]
 gb|EMJ28492.1| hypothetical protein PRUPE_ppa017140mg [Prunus persica]
Length=637

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAME  184
            I  ++ +S   SW++ +IN G +DYFYW+L  LS++NF +FL C+R Y   + E+ V ME
Sbjct  565  IKSVTGSSEKPSWLSQNINTGRFDYFYWLLTVLSVINFCVFLYCARRY-KYRTEQGVKME  623

Query  185  E  187
            +
Sbjct  624  K  624



>ref|XP_010051584.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Eucalyptus grandis]
 gb|KCW82406.1| hypothetical protein EUGRSUZ_C03811 [Eucalyptus grandis]
Length=574

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            ++ LS +  +G+WI++++N+GHYDY+YW+LA L+++NF  +L+C+ +Y   ++ +
Sbjct  509  LDRLSRSGRDGTWISTNVNKGHYDYYYWILAVLNVINFFYYLVCAWAYEGGEERQ  563



>gb|KCW69640.1| hypothetical protein EUGRSUZ_F03048 [Eucalyptus grandis]
Length=533

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGP  154
            +++ L+  +   SW++S+INEG YD +YW+LA +S++N + FL CS  YGP
Sbjct  437  AVDSLTSGTTRISWVSSNINEGRYDNYYWLLAIMSLLNVVYFLFCSWMYGP  487



>ref|XP_003597729.1| hypothetical protein MTR_2g101650 [Medicago truncatula]
 gb|ABD32292.2| TGF-beta receptor, type I/II extracellular region [Medicago truncatula]
 gb|AES67980.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=592

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAME  184
            +++++   G  SW++ ++N+G YD +YW+L  +S++N + +LICS +YGPS  E     E
Sbjct  516  VDDITSRGGKESWVSDNVNKGRYDKYYWLLTIMSILNIMYYLICSWTYGPSDVEATSEKE  575

Query  185  E  187
            E
Sbjct  576  E  576



>ref|XP_010939959.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Elaeis guineensis]
Length=584

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY  148
            +  ++   G   WI  ++NEGH DYF+W++AGLS +N L+F+ C+R Y
Sbjct  529  VTSITTQGGRSGWIPDNLNEGHLDYFFWLIAGLSFLNLLVFVYCARRY  576



>gb|KEH16315.1| peptide/nitrate transporter [Medicago truncatula]
Length=503

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +2

Query  29   GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            G   WI+ DIN+GH+D + W++AG+S +N L +L+CS +YGP+ +E
Sbjct  454  GKDGWISDDINKGHFDKYSWLIAGISALNILYYLVCSWAYGPAVEE  499



>ref|XP_010678590.1| PREDICTED: protein NRT1/ PTR FAMILY 2.9-like [Beta vulgaris subsp. 
vulgaris]
Length=576

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY  148
            ++++S  S NGSW+  D+N+G  DYFY+++AGL +VN   FL+C++ Y
Sbjct  505  VDKMSRGSKNGSWLKEDLNKGRLDYFYYLIAGLELVNLFYFLMCAKWY  552



>gb|EPS63172.1| hypothetical protein M569_11615 [Genlisea aurea]
Length=459

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY  148
            ++ L+ NS  G W+  D+N+G  DYFY+ LAGL  +NFL F +C +SY
Sbjct  392  VHRLTKNSSGGEWLPEDLNKGRLDYFYYFLAGLCSMNFLYFYLCEKSY  439



>ref|XP_003579314.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Brachypodium distachyon]
Length=542

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY  148
            I+ ++ + G  SW   D+N GH DYFYW+LAGLS    +++L  +RSY
Sbjct  486  IDRVTSSGGGDSWFADDLNRGHLDYFYWLLAGLSAAELVMYLCLARSY  533



>emb|CDY30787.1| BnaC07g16870D [Brassica napus]
Length=601

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAME  184
            + +++  S NG W+  +IN G  D FYW+LA LS +NF++++IC+  + P+K +    ME
Sbjct  532  VKKVTATSVNGGWLADNINHGRLDLFYWLLAILSGINFVVYVICALWFKPTKGKDSEEME  591

Query  185  E  187
            +
Sbjct  592  K  592



>gb|KDP37260.1| hypothetical protein JCGZ_06316 [Jatropha curcas]
Length=611

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            ++N ++   G   W+ S+IN+GH D +YW+LA +S VN + F++CS +YGP K+ 
Sbjct  514  AVNNVTSKGGRDGWVPSNINKGHIDNYYWLLAIMSSVNLVYFVLCSWAYGPCKER  568



>ref|XP_009778211.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Nicotiana sylvestris]
Length=587

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 37/58 (64%), Gaps = 3/58 (5%)
 Frame = +2

Query  20   INSGNGS---WITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAME  184
            +  GNG+   W+  +IN G  D FYW+LA L ++NF+++LIC+  Y P K +  + ME
Sbjct  518  VTGGNGTDEGWLADNINNGRLDLFYWLLAVLGVINFVIYLICATWYKPRKAKSAIQME  575



>ref|XP_009795447.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X1 [Nicotiana 
sylvestris]
Length=597

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            ++ L+   G  SW++S+IN GH DY++W+LA LS++NF  FL+  R Y P  D 
Sbjct  523  VDRLTSIGGKTSWLSSNINRGHLDYYFWLLAFLSLLNFFYFLVVCRYYEPGNDR  576



>ref|XP_006650508.1| PREDICTED: peptide transporter PTR2-like [Oryza brachyantha]
Length=595

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  14   LSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  160
             +   GN  WI  ++NEGH DYF+W+LAGLS +NF++++ C+  Y   K
Sbjct  545  FTTRGGNPGWIPDNLNEGHLDYFFWLLAGLSFLNFVIYIFCANKYKSKK  593



>ref|XP_009795448.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X2 [Nicotiana 
sylvestris]
Length=581

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +2

Query  5    INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  166
            ++ L+   G  SW++S+IN GH DY++W+LA LS++NF  FL+  R Y P  D 
Sbjct  507  VDRLTSIGGKTSWLSSNINRGHLDYYFWLLAFLSLLNFFYFLVVCRYYEPGNDR  560



>ref|XP_009783586.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Nicotiana sylvestris]
Length=613

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKD  163
            ++++ +   G  SW++S IN+GHY+Y+YW+LA ++  N + F++C  +YGP  D
Sbjct  528  AVDKHTKGEGKESWVSSSINKGHYEYYYWLLAIMTAFNLIYFMVCKWAYGPCVD  581



>ref|XP_006355953.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X1 [Solanum tuberosum]
Length=580

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = +2

Query  14   LSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKP-VAMEED  190
            L+   G  SW+ S+IN+GH DY +W+LA +S +N L FL+  R Y    DE P VA EE+
Sbjct  512  LTSRGGKTSWLASNINKGHLDYHFWILAFMSFLNLLYFLVICRFYDTGNDELPHVANEEE  571



>ref|XP_006586332.1| PREDICTED: probable peptide transporter At1g52190-like [Glycine 
max]
Length=647

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  169
            G  SW+ S+IN GHYDY+Y +L  L++VN + FL+ SR+YG ++D K
Sbjct  582  GRASWLASNINRGHYDYYYGLLFILNLVNLVCFLVWSRAYGSTQDIK  628



>ref|XP_006355955.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X3 [Solanum tuberosum]
Length=577

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = +2

Query  14   LSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKP-VAMEED  190
            L+   G  SW+ S+IN+GH DY +W+LA +S +N L FL+  R Y    DE P VA EE+
Sbjct  509  LTSRGGKTSWLASNINKGHLDYHFWILAFMSFLNLLYFLVICRFYDTGNDELPHVANEEE  568



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 560109397860