BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS021B03

Length=619
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009612011.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    275   1e-83   Nicotiana tomentosiformis
dbj|BAQ02862.1|  alpha-L-Arabinofuranosidase/beta-D-Xylopyrianosi...    259   9e-82   Nicotiana tabacum [American tobacco]
ref|XP_006351808.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    266   2e-80   Solanum tuberosum [potatoes]
ref|XP_009762535.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    266   3e-80   Nicotiana sylvestris
ref|XP_009628814.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    264   2e-79   Nicotiana tomentosiformis
ref|XP_009801214.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    264   2e-79   Nicotiana sylvestris
ref|XP_004230547.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    263   3e-79   
gb|KDO56532.1|  hypothetical protein CISIN_1g0476211mg                  249   4e-79   Citrus sinensis [apfelsine]
ref|XP_011092407.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    254   4e-76   Sesamum indicum [beniseed]
ref|NP_001233910.1|  beta-D-xylosidase 1 precursor                      253   1e-75   Solanum lycopersicum
ref|XP_002298197.2|  beta-glucosidase family protein                    253   2e-75   
ref|XP_010546362.1|  PREDICTED: beta-D-xylosidase 4                     253   3e-75   Tarenaya hassleriana [spider flower]
ref|XP_006341844.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    253   3e-75   Solanum tuberosum [potatoes]
ref|XP_002303181.1|  beta-glucosidase family protein                    252   5e-75   
ref|XP_011004967.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    251   1e-74   Populus euphratica
ref|XP_006493288.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    251   1e-74   Citrus sinensis [apfelsine]
ref|XP_006432467.1|  hypothetical protein CICLE_v10000355mg             251   1e-74   Citrus clementina [clementine]
ref|XP_011015574.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    251   2e-74   Populus euphratica
ref|XP_011046123.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    250   2e-74   Populus euphratica
ref|XP_010243340.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    250   3e-74   Nelumbo nucifera [Indian lotus]
ref|XP_008339210.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    250   3e-74   
sp|A5JTQ3.1|XYL2_MEDSV  RecName: Full=Beta-xylosidase/alpha-L-ara...    250   3e-74   Medicago sativa subsp. x varia
ref|XP_009354080.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    249   4e-74   Pyrus x bretschneideri [bai li]
ref|XP_008344154.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    249   4e-74   
ref|XP_009347830.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    249   5e-74   
gb|KEH31243.1|  beta-xylosidase/alpha-L-arabinofuranosidase-like ...    249   6e-74   Medicago truncatula
ref|XP_002513707.1|  Beta-glucosidase, putative                         249   7e-74   Ricinus communis
ref|XP_010065531.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    249   1e-73   Eucalyptus grandis [rose gum]
gb|KDP30704.1|  hypothetical protein JCGZ_16402                         248   1e-73   Jatropha curcas
emb|CAJ65922.1|  xylan 1,4-beta-xylosidase                              248   1e-73   Populus tremula x Populus alba [gray poplar]
ref|XP_004504774.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    248   1e-73   Cicer arietinum [garbanzo]
ref|XP_009379698.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    248   1e-73   
ref|XP_007043027.1|  Beta-D-xylosidase 4                                247   3e-73   
ref|XP_010065527.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    247   3e-73   Eucalyptus grandis [rose gum]
emb|CDY18705.1|  BnaA09g06900D                                          247   3e-73   Brassica napus [oilseed rape]
ref|XP_009112141.1|  PREDICTED: beta-D-xylosidase 4-like                247   4e-73   Brassica rapa
gb|EPS65933.1|  hypothetical protein M569_08842                         246   4e-73   Genlisea aurea
emb|CAJ65921.1|  xylan 1,4-beta-xylosidase                              245   6e-73   Populus tremula x Populus alba [gray poplar]
ref|XP_002268626.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    246   6e-73   Vitis vinifera
ref|XP_007148433.1|  hypothetical protein PHAVU_006G208200g             246   8e-73   Phaseolus vulgaris [French bean]
emb|CBI40687.3|  unnamed protein product                                245   9e-73   Vitis vinifera
ref|XP_002264183.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    246   1e-72   Vitis vinifera
gb|KFK28148.1|  hypothetical protein AALP_AA8G478800                    245   2e-72   Arabis alpina [alpine rockcress]
emb|CDY46812.1|  BnaC02g43200D                                          244   3e-72   Brassica napus [oilseed rape]
gb|KJB31995.1|  hypothetical protein B456_005G218000                    244   4e-72   Gossypium raimondii
gb|KHG10349.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           244   4e-72   Gossypium arboreum [tree cotton]
ref|XP_010261102.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    244   4e-72   Nelumbo nucifera [Indian lotus]
emb|CDX81229.1|  BnaC09g06400D                                          244   4e-72   
ref|XP_006394136.1|  hypothetical protein EUTSA_v10003678mg             244   4e-72   Eutrema salsugineum [saltwater cress]
ref|XP_006280038.1|  hypothetical protein CARUB_v10025915mg             244   6e-72   Capsella rubella
ref|XP_003547598.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    243   7e-72   Glycine max [soybeans]
ref|XP_009401393.1|  PREDICTED: beta-D-xylosidase 4-like                243   7e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010520456.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    243   7e-72   
ref|XP_007225245.1|  hypothetical protein PRUPE_ppa001692mg             243   9e-72   Prunus persica
ref|XP_003531557.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    243   1e-71   Glycine max [soybeans]
ref|XP_008784548.1|  PREDICTED: LOW QUALITY PROTEIN: beta-xylosid...    242   2e-71   
ref|XP_010444394.1|  PREDICTED: beta-D-xylosidase 4-like                242   2e-71   Camelina sativa [gold-of-pleasure]
gb|EYU35409.1|  hypothetical protein MIMGU_mgv1a001738mg                242   3e-71   Erythranthe guttata [common monkey flower]
ref|XP_009130462.1|  PREDICTED: beta-D-xylosidase 4-like                242   3e-71   Brassica rapa
ref|NP_201262.1|  beta-D-xylosidase 4                                   241   4e-71   Arabidopsis thaliana [mouse-ear cress]
emb|CDY31313.1|  BnaA02g34280D                                          241   4e-71   Brassica napus [oilseed rape]
ref|XP_010461983.1|  PREDICTED: beta-D-xylosidase 4-like                241   4e-71   Camelina sativa [gold-of-pleasure]
ref|XP_002866623.1|  beta-xylosidase 4                                  241   4e-71   Arabidopsis lyrata subsp. lyrata
ref|XP_010484241.1|  PREDICTED: beta-D-xylosidase 4                     241   6e-71   Camelina sativa [gold-of-pleasure]
ref|XP_008218886.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    240   1e-70   Prunus mume [ume]
ref|XP_004300692.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    240   1e-70   Fragaria vesca subsp. vesca
ref|XP_010065529.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    240   2e-70   Eucalyptus grandis [rose gum]
ref|XP_010103839.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2      239   2e-70   Morus notabilis
ref|XP_011465594.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    239   3e-70   Fragaria vesca subsp. vesca
emb|CDY52884.1|  BnaC06g27770D                                          228   4e-70   Brassica napus [oilseed rape]
ref|XP_007159080.1|  hypothetical protein PHAVU_002G206800g             239   4e-70   Phaseolus vulgaris [French bean]
ref|XP_010937054.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    238   6e-70   Elaeis guineensis
ref|XP_010065530.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    238   7e-70   Eucalyptus grandis [rose gum]
ref|XP_004136861.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    238   9e-70   
ref|XP_011087838.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    238   1e-69   Sesamum indicum [beniseed]
ref|XP_008455235.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    237   2e-69   Cucumis melo [Oriental melon]
ref|XP_004155509.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    237   3e-69   
emb|CDY56487.1|  BnaCnng30450D                                          236   4e-69   Brassica napus [oilseed rape]
emb|CDY51290.1|  BnaA06g23560D                                          236   4e-69   Brassica napus [oilseed rape]
ref|XP_009150540.1|  PREDICTED: beta-D-xylosidase 4                     236   5e-69   Brassica rapa
dbj|BAE44362.1|  alpha-L-arabinofuranosidase                            236   6e-69   Raphanus sativus
ref|XP_009403180.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    235   7e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006399455.1|  hypothetical protein EUTSA_v10012739mg             234   2e-68   Eutrema salsugineum [saltwater cress]
ref|XP_011087839.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    234   3e-68   Sesamum indicum [beniseed]
ref|XP_004485551.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    234   3e-68   Cicer arietinum [garbanzo]
ref|NP_196535.1|  beta-xylosidase 3                                     233   4e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010452969.1|  PREDICTED: beta-D-xylosidase 3-like                233   4e-68   Camelina sativa [gold-of-pleasure]
ref|XP_003593145.1|  Beta-xylosidase/alpha-L-arabinofuranosidase        232   9e-68   Medicago truncatula
gb|KFK25272.1|  hypothetical protein AALP_AA8G090500                    232   1e-67   Arabis alpina [alpine rockcress]
dbj|BAJ89945.1|  predicted protein                                      227   2e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN06823.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           220   2e-67   Glycine soja [wild soybean]
ref|XP_006827121.1|  hypothetical protein AMTR_s00010p00246460          231   3e-67   Amborella trichopoda
ref|XP_010687471.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    231   4e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004301992.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    230   4e-67   Fragaria vesca subsp. vesca
gb|KJB77499.1|  hypothetical protein B456_012G140300                    230   5e-67   Gossypium raimondii
sp|A5JTQ2.1|XYL1_MEDSV  RecName: Full=Beta-xylosidase/alpha-L-ara...    230   5e-67   Medicago sativa subsp. x varia
ref|XP_002873418.1|  beta-xylosidase 3                                  230   6e-67   Arabidopsis lyrata subsp. lyrata
ref|XP_010422951.1|  PREDICTED: beta-D-xylosidase 3 isoform X2          229   8e-67   Camelina sativa [gold-of-pleasure]
gb|KHG02719.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           229   1e-66   Gossypium arboreum [tree cotton]
ref|XP_010422950.1|  PREDICTED: beta-D-xylosidase 3 isoform X1          229   1e-66   Camelina sativa [gold-of-pleasure]
gb|EYU18508.1|  hypothetical protein MIMGU_mgv1a001685mg                229   1e-66   Erythranthe guttata [common monkey flower]
gb|EYU18507.1|  hypothetical protein MIMGU_mgv1a001685mg                229   1e-66   Erythranthe guttata [common monkey flower]
ref|XP_010068200.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    228   2e-66   Eucalyptus grandis [rose gum]
ref|XP_010491610.1|  PREDICTED: beta-D-xylosidase 3-like isoform X1     228   3e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010491609.1|  PREDICTED: beta-D-xylosidase 4-like                228   3e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010491611.1|  PREDICTED: beta-D-xylosidase 3-like isoform X2     228   3e-66   Camelina sativa [gold-of-pleasure]
emb|CDY01780.1|  BnaC06g28200D                                          228   4e-66   
emb|CDY21595.1|  BnaC09g46970D                                          228   7e-66   Brassica napus [oilseed rape]
ref|XP_003524073.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    224   2e-65   
ref|XP_003531047.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    226   2e-65   Glycine max [soybeans]
emb|CDX97115.1|  BnaC09g45100D                                          225   2e-65   
ref|XP_009105246.1|  PREDICTED: beta-D-xylosidase 3-like                226   2e-65   Brassica rapa
emb|CDX96113.1|  BnaA07g26180D                                          227   3e-65   
dbj|BAJ90420.1|  predicted protein                                      225   3e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90315.1|  predicted protein                                      225   3e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY35825.1|  BnaC09g37570D                                          225   4e-65   Brassica napus [oilseed rape]
emb|CDX69892.1|  BnaA10g22410D                                          225   5e-65   
ref|XP_010424711.1|  PREDICTED: beta-D-xylosidase 4-like                224   9e-65   
ref|XP_009122535.1|  PREDICTED: beta-D-xylosidase 3-like                223   2e-64   Brassica rapa
gb|AAK38481.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase iso...    223   2e-64   Hordeum vulgare [barley]
gb|AFW59619.1|  putative O-Glycosyl hydrolase superfamily protein       217   2e-64   
ref|XP_002448619.1|  hypothetical protein SORBIDRAFT_06g030270          221   8e-64   Sorghum bicolor [broomcorn]
gb|EYU44008.1|  hypothetical protein MIMGU_mgv1a0207571mg               207   1e-63   Erythranthe guttata [common monkey flower]
ref|NP_001054038.1|  Os04g0640700                                       220   2e-63   
ref|XP_004976989.1|  PREDICTED: beta-D-xylosidase 4-like isoform X2     220   3e-63   Setaria italica
gb|KHG24361.1|  Beta-D-xylosidase 1 -like protein                       206   1e-62   Gossypium arboreum [tree cotton]
gb|EYU18509.1|  hypothetical protein MIMGU_mgv1a001665mg                218   2e-62   Erythranthe guttata [common monkey flower]
ref|XP_004976988.1|  PREDICTED: beta-D-xylosidase 4-like isoform X1     218   2e-62   
ref|XP_008661822.1|  PREDICTED: uncharacterized protein LOC100279...    217   3e-62   
ref|XP_006855294.1|  hypothetical protein AMTR_s00057p00049120          216   6e-62   Amborella trichopoda
ref|XP_010657638.1|  PREDICTED: beta-D-xylosidase 4-like                204   8e-62   
ref|XP_002974833.1|  hypothetical protein SELMODRAFT_101733             216   1e-61   Selaginella moellendorffii
ref|XP_006653810.1|  PREDICTED: beta-D-xylosidase 4-like                216   1e-61   
ref|XP_002963750.1|  hypothetical protein SELMODRAFT_80102              215   2e-61   Selaginella moellendorffii
emb|CDP18762.1|  unnamed protein product                                210   3e-61   Coffea canephora [robusta coffee]
ref|XP_002515300.1|  Beta-glucosidase, putative                         213   1e-60   Ricinus communis
ref|XP_003580652.1|  PREDICTED: beta-D-xylosidase 4-like                213   1e-60   Brachypodium distachyon [annual false brome]
ref|XP_004170761.1|  PREDICTED: beta-D-xylosidase 1-like                200   2e-60   
ref|XP_003625957.1|  Beta-xylosidase                                    211   3e-60   Medicago truncatula
gb|KJB38536.1|  hypothetical protein B456_006G259500                    209   3e-60   Gossypium raimondii
gb|KDO87027.1|  hypothetical protein CISIN_1g0041902mg                  199   5e-60   Citrus sinensis [apfelsine]
ref|XP_010113184.1|  putative beta-D-xylosidase 5                       201   7e-60   Morus notabilis
gb|KDP44489.1|  hypothetical protein JCGZ_16322                         211   8e-60   Jatropha curcas
gb|KHN30647.1|  Putative beta-D-xylosidase 2                            207   2e-59   Glycine soja [wild soybean]
gb|KDP28242.1|  hypothetical protein JCGZ_14013                         209   2e-59   Jatropha curcas
ref|XP_002885319.1|  beta-1,4-xylosidase                                210   2e-59   
gb|KJB77632.1|  hypothetical protein B456_012G147500                    209   3e-59   Gossypium raimondii
ref|XP_007035744.1|  Periplasmic beta-glucosidase, putative             209   3e-59   
gb|KHG14371.1|  Beta-D-xylosidase 1 -like protein                       209   4e-59   Gossypium arboreum [tree cotton]
ref|XP_002980053.1|  hypothetical protein SELMODRAFT_112087             208   4e-59   Selaginella moellendorffii
gb|KJB38535.1|  hypothetical protein B456_006G259500                    208   4e-59   Gossypium raimondii
ref|XP_002987446.1|  hypothetical protein SELMODRAFT_426206             208   5e-59   Selaginella moellendorffii
ref|XP_011015623.1|  PREDICTED: probable beta-D-xylosidase 2            207   8e-59   Populus euphratica
gb|ACD93208.1|  beta xylosidase                                         207   8e-59   Camellia sinensis [black tea]
ref|XP_011041424.1|  PREDICTED: probable beta-D-xylosidase 2            207   8e-59   Populus euphratica
ref|XP_008445351.1|  PREDICTED: probable beta-D-xylosidase 7            207   9e-59   Cucumis melo [Oriental melon]
gb|KJB72795.1|  hypothetical protein B456_011G198200                    207   1e-58   Gossypium raimondii
ref|XP_002519194.1|  Periplasmic beta-glucosidase precursor, puta...    207   1e-58   Ricinus communis
ref|XP_003519750.1|  PREDICTED: probable beta-D-xylosidase 2-like       207   1e-58   Glycine max [soybeans]
ref|XP_010259348.1|  PREDICTED: putative beta-D-xylosidase              207   1e-58   Nelumbo nucifera [Indian lotus]
ref|XP_007163167.1|  hypothetical protein PHAVU_001G212100g             207   1e-58   Phaseolus vulgaris [French bean]
emb|CDP17081.1|  unnamed protein product                                205   2e-58   Coffea canephora [robusta coffee]
emb|CDY67410.1|  BnaCnng54810D                                          203   2e-58   Brassica napus [oilseed rape]
ref|XP_011100796.1|  PREDICTED: beta-D-xylosidase 1                     206   2e-58   Sesamum indicum [beniseed]
ref|NP_188596.1|  putative beta-D-xylosidase 5                          206   2e-58   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB02547.1|  beta-1,4-xylosidase                                    207   3e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003535953.1|  PREDICTED: probable beta-D-xylosidase 2            206   3e-58   Glycine max [soybeans]
gb|KHN08645.1|  Putative beta-D-xylosidase 2                            206   3e-58   Glycine soja [wild soybean]
ref|XP_009804071.1|  PREDICTED: beta-D-xylosidase 1 isoform X2          205   3e-58   Nicotiana sylvestris
gb|KHG05051.1|  putative beta-D-xylosidase 2 -like protein              206   3e-58   Gossypium arboreum [tree cotton]
gb|KJB09457.1|  hypothetical protein B456_001G143600                    206   3e-58   Gossypium raimondii
ref|XP_002320310.2|  hypothetical protein POPTR_0014s11730g             206   3e-58   
ref|XP_003615012.1|  Auxin-induced beta-glucosidase                     193   4e-58   
ref|XP_007042636.1|  Glycosyl hydrolase family protein                  206   5e-58   
emb|CDY15255.1|  BnaC05g01340D                                          205   5e-58   Brassica napus [oilseed rape]
dbj|BAF00595.1|  xylosidase                                             196   6e-58   Arabidopsis thaliana [mouse-ear cress]
gb|KHN19223.1|  Putative beta-D-xylosidase 2                            204   6e-58   Glycine soja [wild soybean]
gb|KDP27887.1|  hypothetical protein JCGZ_18967                         205   6e-58   Jatropha curcas
ref|XP_007145157.1|  hypothetical protein PHAVU_007G215100g             205   7e-58   Phaseolus vulgaris [French bean]
ref|XP_003592512.1|  Xylosidase                                         205   7e-58   Medicago truncatula
ref|XP_004494414.1|  PREDICTED: probable beta-D-xylosidase 2-like       205   7e-58   Cicer arietinum [garbanzo]
dbj|BAG28345.1|  arabinofuranosidase                                    205   8e-58   Citrus unshiu [satsuma mandarin]
ref|XP_008454299.1|  PREDICTED: probable beta-D-xylosidase 2 isof...    204   8e-58   Cucumis melo [Oriental melon]
ref|XP_010457247.1|  PREDICTED: probable beta-D-xylosidase 2            205   9e-58   Camelina sativa [gold-of-pleasure]
emb|CDX89954.1|  BnaA10g01280D                                          204   9e-58   
ref|XP_009804070.1|  PREDICTED: beta-D-xylosidase 1 isoform X1          205   9e-58   Nicotiana sylvestris
ref|XP_009119616.1|  PREDICTED: probable beta-D-xylosidase 2            204   9e-58   Brassica rapa
ref|XP_006419427.1|  hypothetical protein CICLE_v10004369mg             204   1e-57   
ref|XP_002527511.1|  Beta-glucosidase, putative                         204   1e-57   Ricinus communis
ref|XP_008223305.1|  PREDICTED: putative beta-D-xylosidase              204   1e-57   Prunus mume [ume]
ref|XP_006406478.1|  hypothetical protein EUTSA_v10022061mg             204   1e-57   
gb|AAS17751.2|  beta xylosidase                                         204   1e-57   Fragaria x ananassa
ref|XP_003520749.2|  PREDICTED: probable beta-D-xylosidase 2-like       204   1e-57   Glycine max [soybeans]
emb|CDY00033.1|  BnaC09g02680D                                          204   1e-57   
ref|XP_007225668.1|  hypothetical protein PRUPE_ppa001718mg             204   1e-57   Prunus persica
ref|XP_008454298.1|  PREDICTED: probable beta-D-xylosidase 2 isof...    204   1e-57   Cucumis melo [Oriental melon]
ref|XP_010094323.1|  Beta-D-xylosidase 1                                204   1e-57   Morus notabilis
emb|CDY58860.1|  BnaCnng33860D                                          204   1e-57   Brassica napus [oilseed rape]
ref|XP_008384517.1|  PREDICTED: probable beta-D-xylosidase 5            204   1e-57   
ref|XP_003591420.1|  Beta xylosidase                                    204   1e-57   Medicago truncatula
ref|XP_006830079.1|  hypothetical protein AMTR_s00125p00113140          204   2e-57   
ref|XP_006488872.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    204   2e-57   
ref|XP_010466113.1|  PREDICTED: probable beta-D-xylosidase 5            204   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_002302758.2|  hypothetical protein POPTR_0002s19830g             204   2e-57   
ref|XP_009111875.1|  PREDICTED: beta-D-xylosidase 1-like                204   2e-57   Brassica rapa
ref|XP_006298950.1|  hypothetical protein CARUB_v10015075mg             204   2e-57   
ref|XP_003554544.1|  PREDICTED: probable beta-D-xylosidase 2-like       204   2e-57   Glycine max [soybeans]
ref|XP_004295104.1|  PREDICTED: putative beta-D-xylosidase              204   2e-57   Fragaria vesca subsp. vesca
ref|XP_008386729.1|  PREDICTED: probable beta-D-xylosidase 2            204   2e-57   
ref|XP_010087253.1|  putative beta-D-xylosidase 2                       204   2e-57   Morus notabilis
ref|XP_009145766.1|  PREDICTED: probable beta-D-xylosidase 5            204   2e-57   Brassica rapa
ref|XP_011042236.1|  PREDICTED: probable beta-D-xylosidase 2            203   3e-57   Populus euphratica
ref|XP_004487789.1|  PREDICTED: beta-D-xylosidase 1-like                203   3e-57   Cicer arietinum [garbanzo]
ref|XP_009339788.1|  PREDICTED: probable beta-D-xylosidase 2            203   3e-57   Pyrus x bretschneideri [bai li]
ref|XP_007051080.1|  Beta-xylosidase 2                                  203   3e-57   
ref|XP_002270249.1|  PREDICTED: probable beta-D-xylosidase 2 isof...    203   4e-57   Vitis vinifera
ref|XP_009757165.1|  PREDICTED: probable beta-D-xylosidase 2            203   4e-57   Nicotiana sylvestris
ref|XP_002264114.2|  PREDICTED: probable beta-D-xylosidase 5            203   4e-57   Vitis vinifera
ref|XP_010481135.1|  PREDICTED: probable beta-D-xylosidase 2            202   5e-57   Camelina sativa [gold-of-pleasure]
ref|XP_004156823.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    202   5e-57   
ref|XP_008808663.1|  PREDICTED: beta-D-xylosidase 1-like                202   5e-57   Phoenix dactylifera
ref|XP_002311398.2|  beta-D-xylosidase family protein                   202   6e-57   
ref|XP_010687347.1|  PREDICTED: probable beta-D-xylosidase 5            202   6e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009603126.1|  PREDICTED: probable beta-D-xylosidase 5            202   7e-57   
ref|XP_003594795.1|  Beta xylosidase                                    202   7e-57   Medicago truncatula
ref|XP_008234021.1|  PREDICTED: probable beta-D-xylosidase 7            202   7e-57   Prunus mume [ume]
emb|CBI22460.3|  unnamed protein product                                202   7e-57   Vitis vinifera
gb|AFU54452.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase           202   8e-57   Prunus salicina [Japanese plum]
ref|XP_009593976.1|  PREDICTED: probable beta-D-xylosidase 2            202   9e-57   Nicotiana tomentosiformis
emb|CAN82161.1|  hypothetical protein VITISV_035506                     202   9e-57   Vitis vinifera
ref|XP_010679361.1|  PREDICTED: probable beta-D-xylosidase 2            202   9e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004300463.1|  PREDICTED: probable beta-D-xylosidase 2            202   1e-56   Fragaria vesca subsp. vesca
ref|XP_004152230.1|  PREDICTED: probable beta-D-xylosidase 2-like       202   1e-56   Cucumis sativus [cucumbers]
ref|XP_002889410.1|  hypothetical protein ARALYDRAFT_470222             202   1e-56   
ref|XP_004150696.1|  PREDICTED: probable beta-D-xylosidase 7-like       202   1e-56   Cucumis sativus [cucumbers]
ref|XP_004163321.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    202   1e-56   
ref|XP_006306829.1|  hypothetical protein CARUB_v10008371mg             202   1e-56   Capsella rubella
ref|NP_001266104.1|  SlArf/Xyl1 protein precursor                       202   1e-56   
ref|XP_009369955.1|  PREDICTED: putative beta-D-xylosidase              202   1e-56   
ref|XP_002316021.1|  beta-D-xylosidase family protein                   201   1e-56   Populus trichocarpa [western balsam poplar]
emb|CDY49607.1|  BnaA09g03310D                                          201   1e-56   Brassica napus [oilseed rape]
ref|XP_010507856.1|  PREDICTED: probable beta-D-xylosidase 5            201   1e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010111676.1|  putative beta-D-xylosidase 5                       201   1e-56   
gb|KFK42620.1|  hypothetical protein AALP_AA1G019000                    201   1e-56   Arabis alpina [alpine rockcress]
ref|XP_008341125.1|  PREDICTED: putative beta-D-xylosidase              201   1e-56   
ref|XP_008390557.1|  PREDICTED: putative beta-D-xylosidase              201   2e-56   
ref|XP_008362602.1|  PREDICTED: probable beta-D-xylosidase 7            195   2e-56   
dbj|BAO45878.1|  beta-D-xylosidase                                      201   2e-56   Acacia mangium
ref|XP_009378701.1|  PREDICTED: probable beta-D-xylosidase 2            201   2e-56   Pyrus x bretschneideri [bai li]
emb|CDY33913.1|  BnaA02g30740D                                          201   2e-56   Brassica napus [oilseed rape]
gb|AAP83934.1|  auxin-induced beta-glucosidase                          201   2e-56   Oxybasis rubra [pigweed]
ref|XP_009779847.1|  PREDICTED: probable beta-D-xylosidase 5            201   2e-56   Nicotiana sylvestris
ref|XP_010914548.1|  PREDICTED: probable beta-D-xylosidase 2            201   2e-56   Elaeis guineensis
emb|CDY05634.1|  BnaC02g39030D                                          201   2e-56   
ref|XP_003546334.1|  PREDICTED: beta-D-xylosidase 1-like                201   2e-56   Glycine max [soybeans]
ref|XP_006418321.1|  hypothetical protein EUTSA_v10006876mg             201   2e-56   Eutrema salsugineum [saltwater cress]
ref|XP_002276351.1|  PREDICTED: putative beta-D-xylosidase              201   2e-56   Vitis vinifera
ref|XP_004151112.1|  PREDICTED: beta-D-xylosidase 1-like                201   3e-56   Cucumis sativus [cucumbers]
ref|XP_007200259.1|  hypothetical protein PRUPE_ppa015037mg             201   3e-56   Prunus persica
emb|CBI22910.3|  unnamed protein product                                200   3e-56   Vitis vinifera
ref|XP_011020382.1|  PREDICTED: putative beta-D-xylosidase              201   3e-56   Populus euphratica
gb|KFK26586.1|  hypothetical protein AALP_AA8G267600                    201   3e-56   Arabis alpina [alpine rockcress]
ref|XP_009348894.1|  PREDICTED: putative beta-D-xylosidase              201   3e-56   
dbj|BAQ19511.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase          201   3e-56   Persea americana
gb|AAG10624.1|AC022521_2  Similar to xylosidase                         200   4e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008236322.1|  PREDICTED: probable beta-D-xylosidase 5            201   4e-56   Prunus mume [ume]
ref|XP_006444470.1|  hypothetical protein CICLE_v10018959mg             200   4e-56   Citrus clementina [clementine]
ref|NP_563659.1|  probable beta-D-xylosidase 2                          200   4e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007225247.1|  hypothetical protein PRUPE_ppa001675mg             200   4e-56   Prunus persica
ref|XP_010546993.1|  PREDICTED: beta-D-xylosidase 1-like isoform X1     200   4e-56   Tarenaya hassleriana [spider flower]
ref|XP_003533205.2|  PREDICTED: beta-D-xylosidase 1-like                200   4e-56   
ref|XP_009129779.1|  PREDICTED: beta-D-xylosidase 1-like                200   5e-56   Brassica rapa
ref|XP_011009934.1|  PREDICTED: putative beta-D-xylosidase              200   5e-56   Populus euphratica
ref|XP_010268028.1|  PREDICTED: probable beta-D-xylosidase 2            199   7e-56   Nelumbo nucifera [Indian lotus]
gb|AFU54451.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase           199   8e-56   Prunus salicina [Japanese plum]
ref|XP_006280043.1|  hypothetical protein CARUB_v10025920mg             199   8e-56   Capsella rubella
ref|XP_010482214.1|  PREDICTED: beta-D-xylosidase 1-like                199   8e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010440503.1|  PREDICTED: beta-D-xylosidase 1                     199   8e-56   Camelina sativa [gold-of-pleasure]
ref|XP_006301942.1|  hypothetical protein CARUB_v10022420mg             199   9e-56   Capsella rubella
ref|XP_004162442.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    199   9e-56   
ref|XP_002285805.1|  PREDICTED: probable beta-D-xylosidase 7            199   9e-56   
gb|KJB49844.1|  hypothetical protein B456_008G140600                    199   1e-55   
ref|XP_004136155.1|  PREDICTED: probable beta-D-xylosidase 2-like       199   1e-55   
ref|XP_006395069.1|  hypothetical protein EUTSA_v10003681mg             199   1e-55   
gb|KHN12900.1|  Beta-D-xylosidase 1                                     199   1e-55   
ref|XP_009151303.1|  PREDICTED: beta-D-xylosidase 1                     199   1e-55   
emb|CDX85405.1|  BnaC07g27160D                                          198   1e-55   
ref|XP_008235191.1|  PREDICTED: probable beta-D-xylosidase 2            198   2e-55   
gb|KCW68842.1|  hypothetical protein EUGRSUZ_F02442                     198   2e-55   
ref|XP_011079568.1|  PREDICTED: probable beta-D-xylosidase 2            198   2e-55   
ref|NP_001266114.1|  SlArf/Xyl4 protein precursor                       198   2e-55   
ref|XP_010064766.1|  PREDICTED: probable beta-D-xylosidase 7            198   2e-55   
ref|XP_007138975.1|  hypothetical protein PHAVU_009G254300g             198   2e-55   
ref|NP_001266107.1|  SlArf/Xyl2 protein precursor                       198   2e-55   
ref|XP_008458374.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    198   2e-55   
gb|EYU23074.1|  hypothetical protein MIMGU_mgv1a019840mg                197   2e-55   
ref|XP_011011483.1|  PREDICTED: probable beta-D-xylosidase 7            198   3e-55   
gb|KCW61272.1|  hypothetical protein EUGRSUZ_H04033                     197   3e-55   
ref|XP_006354009.1|  PREDICTED: probable beta-D-xylosidase 7-like       197   3e-55   
ref|XP_011030348.1|  PREDICTED: probable beta-D-xylosidase 5            197   4e-55   
ref|XP_009404942.1|  PREDICTED: probable beta-D-xylosidase 6            198   4e-55   
ref|XP_010024778.1|  PREDICTED: putative beta-D-xylosidase              197   4e-55   
ref|XP_011012436.1|  PREDICTED: probable beta-D-xylosidase 5            197   4e-55   
ref|XP_010671663.1|  PREDICTED: beta-D-xylosidase 1                     197   4e-55   
ref|NP_199747.1|  bifunctional {beta}-D-xylosidase/{alpha}-L-arab...    197   5e-55   
dbj|BAF79669.1|  beta-D-xylosidase                                      197   5e-55   
ref|XP_006352077.1|  PREDICTED: beta-D-xylosidase 1-like                197   5e-55   
gb|KFK25328.1|  hypothetical protein AALP_AA8G098500                    197   5e-55   
ref|XP_007200621.1|  hypothetical protein PRUPE_ppa001656mg             197   5e-55   
dbj|BAD98523.1|  alpha-L-arabinofuranosidase / beta-D-xylosidase        197   5e-55   
ref|XP_006287090.1|  hypothetical protein CARUB_v10000252mg             197   5e-55   
emb|CDO97479.1|  unnamed protein product                                196   5e-55   
gb|AGR44452.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase 2         197   6e-55   
ref|NP_001280797.1|  putative beta-D-xylosidase precursor               197   6e-55   
ref|XP_008353169.1|  PREDICTED: putative beta-D-xylosidase              197   7e-55   
gb|EMT32951.1|  Beta-D-xylosidase 4                                     198   7e-55   
ref|XP_008375790.1|  PREDICTED: probable beta-D-xylosidase 7            196   7e-55   
ref|XP_006826952.1|  hypothetical protein AMTR_s00010p00188970          196   8e-55   
gb|KJB59941.1|  hypothetical protein B456_009G282000                    194   8e-55   
ref|XP_008451490.1|  PREDICTED: probable beta-D-xylosidase 2            196   8e-55   
ref|XP_002865732.1|  beta-xylosidase 1                                  196   9e-55   
gb|KJB16241.1|  hypothetical protein B456_002G219100                    196   9e-55   
emb|CBI19138.3|  unnamed protein product                                199   1e-54   
ref|XP_002306583.2|  hypothetical protein POPTR_0005s16660g             196   1e-54   
ref|XP_009383731.1|  PREDICTED: probable beta-D-xylosidase 2            196   1e-54   
ref|XP_010676938.1|  PREDICTED: probable beta-D-xylosidase 7            196   1e-54   
ref|XP_006349198.1|  PREDICTED: probable beta-D-xylosidase 2-like       196   1e-54   
gb|KDO49896.1|  hypothetical protein CISIN_1g003980mg                   196   2e-54   
ref|XP_009369659.1|  PREDICTED: probable beta-D-xylosidase 7            195   2e-54   
ref|XP_002873465.1|  glycosyl hydrolase family 3 protein                195   2e-54   
gb|EPS60429.1|  hypothetical protein M569_14372                         195   2e-54   
ref|XP_006487370.1|  PREDICTED: probable beta-D-xylosidase 5-like       195   2e-54   
ref|XP_006605998.1|  PREDICTED: probable beta-D-xylosidase 5-like       195   2e-54   
ref|XP_006423474.1|  hypothetical protein CICLE_v10027856mg             195   2e-54   
emb|CDO98788.1|  unnamed protein product                                195   2e-54   
ref|XP_010522822.1|  PREDICTED: probable beta-D-xylosidase 2            195   3e-54   
ref|NP_001145980.1|  putative O-Glycosyl hydrolase superfamily pr...    195   3e-54   
ref|NP_196618.1|  putative beta-D-xylosidase 6                          195   3e-54   
ref|XP_010269208.1|  PREDICTED: probable beta-D-xylosidase 7            195   3e-54   
ref|XP_002302285.1|  glycosyl hydrolase family 3 family protein         194   4e-54   
gb|KJB59940.1|  hypothetical protein B456_009G282000                    194   4e-54   
gb|KHG13360.1|  putative beta-D-xylosidase 7 -like protein              194   5e-54   
gb|KFK42187.1|  hypothetical protein AALP_AA2G222800                    194   5e-54   
gb|KCW68841.1|  hypothetical protein EUGRSUZ_F02441                     193   5e-54   
ref|XP_006399554.1|  hypothetical protein EUTSA_v10012725mg             194   6e-54   
ref|XP_007136230.1|  hypothetical protein PHAVU_009G029300g             194   6e-54   
ref|XP_003615003.1|  Xylan 1 4-beta-xylosidase                          194   7e-54   
gb|KDO80914.1|  hypothetical protein CISIN_1g004054mg                   192   7e-54   
ref|XP_008385726.1|  PREDICTED: probable beta-D-xylosidase 6            194   7e-54   
ref|XP_004301317.1|  PREDICTED: probable beta-D-xylosidase 7            193   9e-54   
ref|XP_011074159.1|  PREDICTED: probable beta-D-xylosidase 7            193   1e-53   
ref|XP_010453089.1|  PREDICTED: probable beta-D-xylosidase 6            193   1e-53   
gb|AES97966.2|  glycoside hydrolase family 3 protein                    193   1e-53   
ref|XP_003615008.1|  Xylan 1 4-beta-xylosidase                          193   1e-53   
ref|XP_009400278.1|  PREDICTED: probable beta-D-xylosidase 6            193   2e-53   
ref|XP_006858943.1|  hypothetical protein AMTR_s00068p00088730          193   2e-53   
emb|CDX97026.1|  BnaC09g45990D                                          192   2e-53   
emb|CAN72807.1|  hypothetical protein VITISV_033721                     182   2e-53   
ref|XP_006390030.1|  hypothetical protein EUTSA_v10018160mg             192   2e-53   
ref|XP_010061816.1|  PREDICTED: probable beta-D-xylosidase 7            192   2e-53   
ref|XP_007018823.1|  Glycosyl hydrolase family protein isoform 1        196   2e-53   
ref|XP_007018825.1|  Glycosyl hydrolase family protein isoform 3        196   2e-53   
ref|XP_007018824.1|  Glycosyl hydrolase family protein isoform 2        196   2e-53   
ref|XP_011016184.1|  PREDICTED: probable beta-D-xylosidase 7            192   2e-53   
ref|XP_004513829.1|  PREDICTED: probable beta-D-xylosidase 7-like       192   2e-53   
gb|EYU33328.1|  hypothetical protein MIMGU_mgv1a001688mg                192   2e-53   
gb|AAF17692.1|AC009243_19  F28K19.27                                    192   3e-53   
ref|XP_002513892.1|  Periplasmic beta-glucosidase precursor, puta...    192   3e-53   
ref|XP_006426203.1|  hypothetical protein CICLE_v10024911mg             192   3e-53   
gb|EYU23224.1|  hypothetical protein MIMGU_mgv1a001695mg                192   3e-53   
ref|XP_006434020.1|  hypothetical protein CICLE_v10000352mg             192   3e-53   
ref|XP_006300771.1|  hypothetical protein CARUB_v10019845mg             192   3e-53   
gb|KDO80913.1|  hypothetical protein CISIN_1g004054mg                   192   3e-53   
ref|XP_006466365.1|  PREDICTED: probable beta-D-xylosidase 6-like       192   3e-53   
ref|XP_006472631.1|  PREDICTED: probable beta-D-xylosidase 7-like       192   4e-53   
gb|KDO78723.1|  hypothetical protein CISIN_1g003606mg                   192   4e-53   
gb|KDO78722.1|  hypothetical protein CISIN_1g003606mg                   192   4e-53   
ref|NP_177929.1|  putative beta-D-xylosidase 7                          192   4e-53   
gb|EYU23223.1|  hypothetical protein MIMGU_mgv1a001417mg                192   4e-53   
gb|KEH28065.1|  glycoside hydrolase family 3 amino-terminal domai...    190   4e-53   
ref|XP_009592501.1|  PREDICTED: probable beta-D-xylosidase 7            191   4e-53   
ref|XP_002451244.1|  hypothetical protein SORBIDRAFT_05g026400          191   5e-53   
ref|XP_002513887.1|  hypothetical protein RCOM_1034150                  182   5e-53   
ref|XP_010472005.1|  PREDICTED: probable beta-D-xylosidase 7            191   5e-53   
gb|KJB44020.1|  hypothetical protein B456_007G230000                    191   5e-53   
ref|XP_010069867.1|  PREDICTED: probable beta-D-xylosidase 2            191   5e-53   
ref|XP_010416771.1|  PREDICTED: probable beta-D-xylosidase 7            191   6e-53   
ref|XP_010491733.1|  PREDICTED: probable beta-D-xylosidase 6            191   6e-53   
ref|XP_009782574.1|  PREDICTED: probable beta-D-xylosidase 7            191   6e-53   
gb|EYU33325.1|  hypothetical protein MIMGU_mgv1a001753mg                191   6e-53   
ref|XP_008236665.1|  PREDICTED: probable beta-D-xylosidase 6 isof...    191   7e-53   
ref|XP_010428909.1|  PREDICTED: probable beta-D-xylosidase 7 isof...    191   7e-53   
ref|XP_008236660.1|  PREDICTED: probable beta-D-xylosidase 6 isof...    191   7e-53   
ref|XP_002527212.1|  beta-glucosidase, putative                         184   8e-53   
ref|XP_004979939.1|  PREDICTED: probable beta-D-xylosidase 2-like       191   1e-52   
ref|XP_003567059.2|  PREDICTED: beta-D-xylosidase 1-like                190   1e-52   
ref|XP_002987447.1|  hypothetical protein SELMODRAFT_426207             190   1e-52   
gb|AES97964.2|  glycoside hydrolase family 3 amino-terminal domai...    190   2e-52   
ref|XP_002980054.1|  hypothetical protein SELMODRAFT_419541             190   2e-52   
ref|XP_006448620.1|  hypothetical protein CICLE_v10018262mg             190   2e-52   
ref|XP_009612183.1|  PREDICTED: probable beta-D-xylosidase 6            190   2e-52   
gb|EYU23228.1|  hypothetical protein MIMGU_mgv1a018779mg                188   2e-52   
ref|XP_011457868.1|  PREDICTED: probable beta-D-xylosidase 5            190   2e-52   
ref|XP_010556264.1|  PREDICTED: beta-D-xylosidase 1-like                189   2e-52   
ref|XP_007206430.1|  hypothetical protein PRUPE_ppa001583mg             189   3e-52   
ref|XP_011466576.1|  PREDICTED: probable beta-D-xylosidase 6 isof...    189   3e-52   
ref|XP_011098370.1|  PREDICTED: probable beta-D-xylosidase 7            189   3e-52   
emb|CDX69822.1|  BnaA10g21710D                                          189   3e-52   
dbj|BAK01582.1|  predicted protein                                      189   3e-52   
emb|CDX87482.1|  BnaA07g33910D                                          189   4e-52   
ref|XP_003638778.1|  Xylan 1 4-beta-xylosidase                          189   4e-52   
ref|XP_001775759.1|  predicted protein                                  189   4e-52   
ref|XP_009106451.1|  PREDICTED: probable beta-D-xylosidase 7            189   4e-52   
emb|CBI25718.3|  unnamed protein product                                188   5e-52   
ref|XP_004288313.2|  PREDICTED: probable beta-D-xylosidase 6 isof...    189   6e-52   
gb|KDP20227.1|  hypothetical protein JCGZ_09859                         188   7e-52   
gb|EYU23226.1|  hypothetical protein MIMGU_mgv1a025071mg                188   7e-52   
ref|XP_010030625.1|  PREDICTED: probable beta-D-xylosidase 5            188   8e-52   
emb|CAJ41429.1|  beta (1,4)-xylosidase                                  188   8e-52   
emb|CDX88410.1|  BnaC06g38540D                                          188   8e-52   
ref|XP_006840294.1|  hypothetical protein AMTR_s00045p00064060          188   8e-52   
ref|XP_002264031.2|  PREDICTED: probable beta-D-xylosidase 6            188   8e-52   
ref|XP_010918501.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    188   9e-52   
emb|CDP01027.1|  unnamed protein product                                191   9e-52   
ref|XP_011099456.1|  PREDICTED: probable beta-D-xylosidase 6            188   9e-52   
ref|XP_008796726.1|  PREDICTED: probable beta-D-xylosidase 6            188   9e-52   
gb|KJB29304.1|  hypothetical protein B456_005G093200                    188   1e-51   
gb|KJB29303.1|  hypothetical protein B456_005G093200                    188   1e-51   
ref|XP_009122041.1|  PREDICTED: probable beta-D-xylosidase 6            188   1e-51   
ref|XP_004231972.1|  PREDICTED: probable beta-D-xylosidase 6            187   1e-51   
ref|XP_009536966.1|  xylosidase                                         187   1e-51   
ref|XP_007047697.1|  Glycosyl hydrolase family protein                  187   1e-51   
gb|KDP20226.1|  hypothetical protein JCGZ_09858                         187   1e-51   
ref|XP_008808189.1|  PREDICTED: probable beta-D-xylosidase 7            187   1e-51   
emb|CDP01028.1|  unnamed protein product                                187   1e-51   
ref|XP_010254644.1|  PREDICTED: probable beta-D-xylosidase 6            187   1e-51   
ref|XP_002889174.1|  glycosyl hydrolase family 3 protein                187   2e-51   
ref|XP_010250379.1|  PREDICTED: probable beta-D-xylosidase 5            187   2e-51   
ref|XP_006354074.1|  PREDICTED: probable beta-D-xylosidase 7-like       187   2e-51   
ref|XP_011016128.1|  PREDICTED: probable beta-D-xylosidase 7            187   2e-51   
ref|XP_006357757.1|  PREDICTED: probable beta-D-xylosidase 6-like       187   3e-51   
ref|XP_006468650.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    186   3e-51   
ref|XP_002302284.2|  glycosyl hydrolase family 3 family protein         186   3e-51   
ref|XP_010664313.1|  PREDICTED: probable beta-D-xylosidase 7            186   3e-51   
emb|CDP02677.1|  unnamed protein product                                186   3e-51   
ref|XP_008364222.1|  PREDICTED: probable beta-D-xylosidase 5            180   4e-51   
gb|EPS70883.1|  hypothetical protein M569_03875                         186   4e-51   
ref|XP_009795794.1|  PREDICTED: probable beta-D-xylosidase 6            186   4e-51   
ref|XP_006354008.1|  PREDICTED: probable beta-D-xylosidase 7-like       186   4e-51   
ref|XP_003544783.1|  PREDICTED: probable beta-D-xylosidase 7-like       186   5e-51   
ref|XP_010105119.1|  putative beta-D-xylosidase 6                       186   5e-51   
gb|KJB59094.1|  hypothetical protein B456_009G239100                    186   5e-51   
ref|XP_006448621.1|  hypothetical protein CICLE_v10014325mg             186   5e-51   
ref|XP_010937520.1|  PREDICTED: uncharacterized protein LOC105056876    189   6e-51   
ref|XP_010683056.1|  PREDICTED: probable beta-D-xylosidase 6            186   6e-51   
ref|XP_004953945.1|  PREDICTED: probable beta-D-xylosidase 7-like       186   7e-51   
ref|XP_004160150.1|  PREDICTED: probable beta-D-xylosidase 6-like       185   7e-51   
ref|XP_004143540.1|  PREDICTED: probable beta-D-xylosidase 6-like       185   7e-51   
gb|EYU23220.1|  hypothetical protein MIMGU_mgv1a001636mg                185   7e-51   
gb|KHG02565.1|  putative beta-D-xylosidase 7                            185   8e-51   
ref|XP_010693351.1|  PREDICTED: probable beta-D-xylosidase 7            185   9e-51   
gb|KJB29307.1|  hypothetical protein B456_005G093300                    185   1e-50   
ref|NP_001266109.1|  SlArf/Xyl3 protein precursor                       185   1e-50   
ref|XP_006581546.1|  PREDICTED: probable beta-D-xylosidase 7-like...    183   1e-50   
ref|XP_009599906.1|  PREDICTED: probable beta-D-xylosidase 7            184   1e-50   
gb|EYU23824.1|  hypothetical protein MIMGU_mgv1a020334mg                184   2e-50   
gb|ETO70591.1|  hypothetical protein F444_12960                         184   2e-50   
ref|XP_008909231.1|  hypothetical protein PPTG_14386                    184   2e-50   
gb|ETI41971.1|  hypothetical protein F443_12854                         184   2e-50   
gb|ETL88623.1|  hypothetical protein L917_12312                         184   2e-50   
ref|XP_009782575.1|  PREDICTED: probable beta-D-xylosidase 7            184   2e-50   
gb|EEC74020.1|  hypothetical protein OsI_08964                          184   2e-50   
gb|ETM41887.1|  hypothetical protein L914_12392                         184   2e-50   
gb|ETK81998.1|  hypothetical protein L915_12566                         184   2e-50   
gb|ETP11715.1|  hypothetical protein F441_12812                         184   2e-50   
ref|NP_001048140.1|  Os02g0752200                                       184   2e-50   
gb|KJB16242.1|  hypothetical protein B456_002G219200                    184   2e-50   
ref|XP_003526589.1|  PREDICTED: probable beta-D-xylosidase 7-like...    184   3e-50   
ref|XP_008383565.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    184   3e-50   
ref|XP_007214466.1|  hypothetical protein PRUPE_ppa023763mg             183   3e-50   
gb|AAK38482.1|  beta-D-xylosidase                                       183   3e-50   
gb|KJB16243.1|  hypothetical protein B456_002G219200                    183   4e-50   
ref|XP_004500608.1|  PREDICTED: probable beta-D-xylosidase 7-like       185   4e-50   
ref|XP_011460171.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    183   4e-50   
ref|XP_006468195.1|  PREDICTED: probable beta-D-xylosidase 5-like       183   4e-50   
ref|XP_006449653.1|  hypothetical protein CICLE_v10017977mg             183   4e-50   
ref|XP_003612944.1|  Beta-D-xylosidase                                  183   5e-50   
ref|XP_008440505.1|  PREDICTED: probable beta-D-xylosidase 6            183   5e-50   
gb|KDP32160.1|  hypothetical protein JCGZ_12621                         183   6e-50   
gb|ABY48135.1|  beta-D-xylosidase                                       182   7e-50   
ref|XP_009360864.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    182   7e-50   
emb|CBI25987.3|  unnamed protein product                                182   8e-50   
ref|XP_009390583.1|  PREDICTED: probable beta-D-xylosidase 7            182   8e-50   
ref|XP_002274591.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    182   8e-50   
ref|XP_002977427.1|  hypothetical protein SELMODRAFT_106899             182   9e-50   
ref|XP_002975008.1|  hypothetical protein SELMODRAFT_103038             182   9e-50   
ref|XP_003542472.1|  PREDICTED: probable beta-D-xylosidase 7-like       182   9e-50   
gb|EYU46800.1|  hypothetical protein MIMGU_mgv1a018473mg                182   9e-50   
ref|NP_001130324.1|  putative O-Glycosyl hydrolase superfamily pr...    182   9e-50   
gb|AFI25186.1|  putative beta-D-xylosidase                              182   1e-49   



>ref|XP_009612011.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 {ECO:0000303|PubMed:17615411, 
ECO:0000312|EMBL:ABQ45228.1}-like 
[Nicotiana tomentosiformis]
Length=778

 Score =   275 bits (703),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  110  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  289
            PV +QT+PV+ACD   NPG+K+  FC+  LDV +RV DLVKRLTL EKIT LVNTAG+VS
Sbjct  31   PVLAQTSPVFACDVANNPGVKNFAFCDVSLDVSSRVNDLVKRLTLEEKITMLVNTAGSVS  90

Query  290  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  469
            RLGIPTYEWWSEALHG+SYTGPGV F GVVP ATSFPQP+LT+ASFNETLF TIGK +ST
Sbjct  91   RLGIPTYEWWSEALHGISYTGPGVKFNGVVPGATSFPQPILTSASFNETLFETIGKAVST  150

Query  470  EARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            EARAM+N GLA LTYWSPN+NI+RDPRWGRGQE PGEDPTL
Sbjct  151  EARAMYNVGLAGLTYWSPNVNIYRDPRWGRGQETPGEDPTL  191



>dbj|BAQ02862.1| alpha-L-Arabinofuranosidase/beta-D-Xylopyrianosidase, partial 
[Nicotiana tabacum]
Length=368

 Score =   259 bits (663),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 136/162 (84%), Gaps = 1/162 (1%)
 Frame = +2

Query  110  PVQSQT-APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  286
            PV +QT +P +ACD   NPG+K+  FC+  LDV  RV DLVKRLTL EKIT LVNTAG+V
Sbjct  31   PVLAQTTSPAFACDVANNPGVKNFGFCDVSLDVSARVNDLVKRLTLEEKITMLVNTAGSV  90

Query  287  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  466
            SRLGIP YEWWSEALHG+SYTGPGV F GVVP ATSFP  +LT+ASFNETLF TIGK +S
Sbjct  91   SRLGIPKYEWWSEALHGISYTGPGVKFNGVVPGATSFPPTILTSASFNETLFETIGKAVS  150

Query  467  TEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            TEARAM+N GLA LTYWSPN+NI+RDPRWGRGQE PGEDPTL
Sbjct  151  TEARAMYNVGLAGLTYWSPNVNIYRDPRWGRGQETPGEDPTL  192



>ref|XP_006351808.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Solanum tuberosum]
Length=778

 Score =   266 bits (681),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +2

Query  110  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  289
            PV +QT+ V+ACDT  NP LKS PFC+  L V  RV DLVKRLTL EKIT LVNTAGNVS
Sbjct  34   PVSAQTSAVFACDTATNPSLKSFPFCDVSLGVSARVKDLVKRLTLQEKITMLVNTAGNVS  93

Query  290  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  469
            RLGIP YEWWSEALHG+SYTGPGV F  +VP ATSFPQP+LT+ASFNETLF TIGKV+ST
Sbjct  94   RLGIPKYEWWSEALHGISYTGPGVKFNNIVPHATSFPQPILTSASFNETLFETIGKVVST  153

Query  470  EARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            E RAM+N G A LTYWSPN+NI+RDPRWGRGQE  GEDPTL+
Sbjct  154  EGRAMYNVGQAGLTYWSPNVNIYRDPRWGRGQETAGEDPTLS  195



>ref|XP_009762535.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nicotiana sylvestris]
Length=779

 Score =   266 bits (679),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 138/162 (85%), Gaps = 1/162 (1%)
 Frame = +2

Query  110  PVQSQT-APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  286
            PV +QT +P +ACD   NPG+K+  FC+  LDV  RV DLVKRLTL EKIT LVNTAG+V
Sbjct  31   PVLAQTTSPAFACDVANNPGVKNFGFCDVSLDVSARVNDLVKRLTLEEKITMLVNTAGSV  90

Query  287  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  466
            SRLGIP YEWWSEALHG+SYTGPGV F GVVP ATSFPQP+LT+ASFNETLF TIGK +S
Sbjct  91   SRLGIPKYEWWSEALHGISYTGPGVKFNGVVPGATSFPQPILTSASFNETLFETIGKAVS  150

Query  467  TEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            TEARAM+N GLA LTYWSPN+NI+RDPRWGRGQE PGEDPTL
Sbjct  151  TEARAMYNVGLAGLTYWSPNVNIYRDPRWGRGQETPGEDPTL  192



>ref|XP_009628814.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 {ECO:0000303|PubMed:17615411, 
ECO:0000312|EMBL:ABQ45228.1}-like 
[Nicotiana tomentosiformis]
Length=781

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = +2

Query  110  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  289
            PV +Q +PV+ACD   NPGL +L FC+  L V+TRV DLV+RLTL EKI FLV+ AG VS
Sbjct  37   PVLAQNSPVFACDITSNPGLANLTFCDASLTVETRVNDLVQRLTLSEKIGFLVSGAGGVS  96

Query  290  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  469
            RLGIP YEWWSEALHG+SYTGPGV+F+G++PAATSFPQ +LTAASFN TLF TIGKV+ST
Sbjct  97   RLGIPRYEWWSEALHGVSYTGPGVHFSGLIPAATSFPQVILTAASFNVTLFETIGKVVST  156

Query  470  EARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            EARAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDPTLT
Sbjct  157  EARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPTLT  198



>ref|XP_009801214.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nicotiana sylvestris]
Length=784

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = +2

Query  110  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  289
            PV +Q +PV+ACD   NPGL +L FC+  L V+TRV+DLV+RLTL EKI FLV+ AG VS
Sbjct  40   PVLAQNSPVFACDITSNPGLANLTFCDASLTVETRVSDLVQRLTLSEKIGFLVSGAGGVS  99

Query  290  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  469
            RLGIP YEWWSEALHG+SYTGPGV+F+G+VP ATSFPQ +LTAASFN TLF TIGKV+ST
Sbjct  100  RLGIPRYEWWSEALHGVSYTGPGVHFSGLVPGATSFPQVILTAASFNVTLFETIGKVVST  159

Query  470  EARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            EARAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDPTLT
Sbjct  160  EARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPTLT  201



>ref|XP_004230547.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Solanum 
lycopersicum]
Length=778

 Score =   263 bits (673),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +2

Query  110  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  289
            PV +QT+ V+ACDT  NP LKS PFC+  L V  RV DLVKRLTL EKI+ LVNTAG+VS
Sbjct  34   PVSAQTSAVFACDTANNPSLKSFPFCDVSLGVSDRVNDLVKRLTLQEKISMLVNTAGSVS  93

Query  290  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  469
            RLGIP YEWWSEALHG+SYTGPGV F  +VP ATSFPQP+LT+ASFNETLF TIGKV+ST
Sbjct  94   RLGIPKYEWWSEALHGISYTGPGVKFNNIVPHATSFPQPILTSASFNETLFQTIGKVVST  153

Query  470  EARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            E RAM+N G A LTYWSPN+NI+RDPRWGRGQE  GEDPTL+
Sbjct  154  EGRAMYNVGQAGLTYWSPNVNIYRDPRWGRGQETAGEDPTLS  195



>gb|KDO56532.1| hypothetical protein CISIN_1g0476211mg, partial [Citrus sinensis]
Length=250

 Score =   249 bits (635),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  131  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  310
            PV+ACD V NP L SL FCN  L +  RV DLVKRLTL EKITFLV++AG+VSRLGIP Y
Sbjct  36   PVFACDVVSNPSLASLGFCNTSLGIDLRVGDLVKRLTLQEKITFLVDSAGSVSRLGIPKY  95

Query  311  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  490
            EWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STEARAM+N
Sbjct  96   EWWSEALHGVSYVGPGTHFSNVVPGATSFPQVILTAASFNASLFQAIGKVVSTEARAMYN  155

Query  491  YGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
             GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  156  VGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLL  189



>ref|XP_011092407.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   254 bits (650),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  110  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  289
            PV +QT P +ACD   NPGLK+  FC+Q LDVK+RVADLV RLTL EKI +LVNTA  VS
Sbjct  24   PVFAQTKPAFACDVSNNPGLKNFSFCDQSLDVKSRVADLVGRLTLQEKIGWLVNTAKGVS  83

Query  290  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  469
            RLGIP Y+WWSEALHG+SY GPG  F+G+VP ATSFPQ +LTAA+FNE+LF  IGKV+ST
Sbjct  84   RLGIPDYQWWSEALHGVSYVGPGTKFSGLVPGATSFPQVILTAATFNESLFEIIGKVVST  143

Query  470  EARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            EARAM+N GLA LT+WSPN+NIFRDPRWGRGQE  GEDP L+
Sbjct  144  EARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETAGEDPLLS  185



>ref|NP_001233910.1| beta-D-xylosidase 1 precursor [Solanum lycopersicum]
 dbj|BAC98298.1| LEXYL1 [Solanum lycopersicum]
Length=770

 Score =   253 bits (647),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = +2

Query  101  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  280
            ++  V +Q +PV+ACD   NP L +L FC+  L V+ RV DLV RLTL EKI FLV+ AG
Sbjct  23   LLKQVLAQNSPVFACDVTSNPALGNLTFCDASLAVENRVNDLVNRLTLGEKIGFLVSGAG  82

Query  281  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  460
             VSRLGIP YEWWSEALHG++YTGPGV+FT +VP ATSFPQ +LTAASFN TLF TIGKV
Sbjct  83   GVSRLGIPKYEWWSEALHGVAYTGPGVHFTSLVPGATSFPQVILTAASFNVTLFQTIGKV  142

Query  461  ISTEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            +STEARAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDPTLT
Sbjct  143  VSTEARAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLT  187



>ref|XP_002298197.2| beta-glucosidase family protein [Populus trichocarpa]
 gb|EEE83002.2| beta-glucosidase family protein [Populus trichocarpa]
Length=778

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V +Q++PV+ACD V NP L S  FCN  L V  RV DLVKRLTL EKI FLVN+AG+VSR
Sbjct  33   VLAQSSPVFACDVVSNPSLASFGFCNTSLGVSDRVVDLVKRLTLQEKILFLVNSAGSVSR  92

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP YEWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  93   LGIPKYEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFVAIGKVVSTE  152

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            ARAM+N GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  153  ARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLS  193



>ref|XP_010546362.1| PREDICTED: beta-D-xylosidase 4 [Tarenaya hassleriana]
Length=781

 Score =   253 bits (645),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = +2

Query  110  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  289
            P ++Q++PV+ACD   NP L    FC++ L+V  RVADLV RLTL EKI FLVN A  VS
Sbjct  23   PSEAQSSPVFACDVSGNPSLAGFGFCDKSLEVNDRVADLVGRLTLQEKIGFLVNRANGVS  82

Query  290  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  469
            RLGIPTYEWWSEALHG+SY GPG  F+G VP ATSFPQ +LTAASFN TLF TIGKV+ST
Sbjct  83   RLGIPTYEWWSEALHGVSYVGPGTRFSGQVPGATSFPQVILTAASFNVTLFQTIGKVVST  142

Query  470  EARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            EARAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  143  EARAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLS  184



>ref|XP_006341844.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Solanum tuberosum]
Length=806

 Score =   253 bits (646),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 137/166 (83%), Gaps = 0/166 (0%)
 Frame = +2

Query  104  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  283
            + PV +Q +PV+ACD   NP L +L FC+  L V+ RV DLVKRLTL EKI FLV+ A  
Sbjct  60   LKPVLAQNSPVFACDITSNPALGNLTFCDASLTVENRVNDLVKRLTLGEKIGFLVSGASG  119

Query  284  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  463
            VSRLGIP YEWWSEALHG++YTGPGV+F+ +VP ATSFPQ +LTAASFN +LF TIGKV+
Sbjct  120  VSRLGIPKYEWWSEALHGVAYTGPGVHFSSLVPGATSFPQVILTAASFNVSLFQTIGKVV  179

Query  464  STEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGS  601
            STEARAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDPTLT +
Sbjct  180  STEARAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLTST  225



>ref|XP_002303181.1| beta-glucosidase family protein [Populus trichocarpa]
 gb|EEE78160.1| beta-glucosidase family protein [Populus trichocarpa]
Length=773

 Score =   252 bits (643),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 132/161 (82%), Gaps = 0/161 (0%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V +Q++PV+ACD V NP L SL FCN  + +  RV DLVKRLTL EKI FLVN+AGNVSR
Sbjct  30   VSAQSSPVFACDVVSNPSLASLGFCNTSIGINDRVVDLVKRLTLQEKIVFLVNSAGNVSR  89

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP YEWWSEALHG+SY GPG +F+  V  ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTHFSDDVAGATSFPQVILTAASFNTSLFEAIGKVVSTE  149

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            ARAM+N GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  150  ARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLS  190



>ref|XP_011004967.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Populus euphratica]
Length=775

 Score =   251 bits (641),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 132/161 (82%), Gaps = 0/161 (0%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V +Q++PV+ACD V+NP L SL FCN    +  RV DLVKRLTL EKI FLVN+AGNVSR
Sbjct  32   VSAQSSPVFACDVVRNPSLASLGFCNTSSGINDRVVDLVKRLTLQEKILFLVNSAGNVSR  91

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP YEWWSEALHG+SY GPG +F+  V  ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  92   LGIPKYEWWSEALHGVSYVGPGTHFSNDVAGATSFPQVILTAASFNTSLFEAIGKVVSTE  151

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            ARAM+N GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  152  ARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLS  192



>ref|XP_006493288.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Citrus sinensis]
Length=773

 Score =   251 bits (641),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  131  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  310
            PV+ACD V NP L SL FCN  L +  RV DLVKRLTL EKITFLV++AG+VSRLGIP Y
Sbjct  36   PVFACDVVSNPSLASLGFCNTSLGIDLRVGDLVKRLTLQEKITFLVDSAGSVSRLGIPKY  95

Query  311  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  490
            EWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STEARAM+N
Sbjct  96   EWWSEALHGVSYVGPGTHFSNVVPGATSFPQVILTAASFNASLFQAIGKVVSTEARAMYN  155

Query  491  YGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
             GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  156  VGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLL  189



>ref|XP_006432467.1| hypothetical protein CICLE_v10000355mg [Citrus clementina]
 gb|ESR45707.1| hypothetical protein CICLE_v10000355mg [Citrus clementina]
Length=773

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  131  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  310
            PV+ACD V NP L SL FCN  L +  RV DLVKRLTL EKITFLV++AG+VSRLGIP Y
Sbjct  36   PVFACDVVSNPSLASLGFCNTSLGIDLRVGDLVKRLTLQEKITFLVDSAGSVSRLGIPKY  95

Query  311  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  490
            EWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STEARAM+N
Sbjct  96   EWWSEALHGVSYVGPGTHFSNVVPGATSFPQVILTAASFNASLFQAIGKVVSTEARAMYN  155

Query  491  YGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
             GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  156  VGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLL  189



>ref|XP_011015574.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Populus euphratica]
Length=776

 Score =   251 bits (640),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 132/161 (82%), Gaps = 0/161 (0%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V +Q++PV+ACD V NP L S  FCN  L V  RV DLV RLTL EKI FLVN+AG+VSR
Sbjct  33   VLAQSSPVFACDVVSNPSLASFGFCNTSLGVSDRVVDLVGRLTLQEKILFLVNSAGSVSR  92

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP YEWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  93   LGIPRYEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFVAIGKVVSTE  152

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            ARAM+N GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  153  ARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLS  193



>ref|XP_011046123.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Populus euphratica]
Length=776

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 132/161 (82%), Gaps = 0/161 (0%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V +Q++PV+ACD V NP L S  FCN  L V  RV DLV RLTL EKI FLVN+AG+VSR
Sbjct  33   VLAQSSPVFACDVVSNPSLASFGFCNTSLGVSDRVVDLVGRLTLQEKILFLVNSAGSVSR  92

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP YEWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  93   LGIPRYEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFVAIGKVVSTE  152

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            ARAM+N GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  153  ARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLS  193



>ref|XP_010243340.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nelumbo nucifera]
Length=771

 Score =   250 bits (638),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 131/159 (82%), Gaps = 0/159 (0%)
 Frame = +2

Query  119  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  298
            S  +PV+ACD  KNPGL +  FCN  LD+  RV DLV+RLTL EKITFLV+ AG V+RLG
Sbjct  30   SGQSPVFACDVGKNPGLAAFGFCNTSLDIAARVNDLVERLTLQEKITFLVSKAGAVNRLG  89

Query  299  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  478
            IP+YEWWSEALHG+SY GPG +F+  VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  90   IPSYEWWSEALHGVSYVGPGTHFSSAVPGATSFPQVILTAASFNTSLFEDIGKVVSTEAR  149

Query  479  AMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            AM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  150  AMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLS  188



>ref|XP_008339210.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Malus domestica]
Length=773

 Score =   250 bits (638),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V  Q++PV+AC+   N  L S  FC+  L V  RVADLVKRLTLPEKI FLVN+AG+VSR
Sbjct  30   VLGQSSPVFACNVASNATLSSFAFCDTSLGVDARVADLVKRLTLPEKIGFLVNSAGSVSR  89

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN +LF  IG+V+STE
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFEAIGRVVSTE  149

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            ARAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  150  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLS  190



>sp|A5JTQ3.1|XYL2_MEDSV RecName: Full=Beta-xylosidase/alpha-L-arabinofuranosidase 2; 
AltName: Full=Xylan 1,4-beta-xylosidase/Alpha-L-arabinofuranosidase 
2; Short=MsXyl2; Includes: RecName: Full=Beta-xylosidase; 
AltName: Full=1,4-beta-D-xylan xylohydrolase; AltName: 
Full=Xylan 1,4-beta-xylosidase; Includes: RecName: Full=Alpha-L-arabinofuranosidase; 
Short=Arabinosidase; Flags: Precursor 
[Medicago sativa subsp. x varia]
 gb|ABQ45228.1| beta-xylosidase/alpha-L-arabinosidase [Medicago sativa subsp. 
x varia]
Length=774

 Score =   250 bits (638),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = +2

Query  107  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  286
            G V SQT+ V+ACD  KNP L +  FCN++L V  RV DLV+RLTL EK+  LVN+A +V
Sbjct  29   GRVSSQTSAVFACDVAKNPALANYGFCNKKLSVDARVKDLVRRLTLQEKVGNLVNSAVDV  88

Query  287  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  466
            SRLGIP YEWWSEALHG+S  GPG +F+ V+P ATSFP P+L AASFN +LF TIGKV+S
Sbjct  89   SRLGIPKYEWWSEALHGVSNIGPGTHFSNVIPGATSFPMPILIAASFNASLFQTIGKVVS  148

Query  467  TEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            TEARAMHN GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  149  TEARAMHNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLL  190



>ref|XP_009354080.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Pyrus x bretschneideri]
Length=773

 Score =   249 bits (637),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V  Q++PV+AC+   N  L S  FC+  L V  RVADLVKRLTLPEKI FLVN+AG+VSR
Sbjct  30   VLGQSSPVFACNVASNATLSSFAFCDTTLGVDARVADLVKRLTLPEKIGFLVNSAGSVSR  89

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN +LF  IG+V+STE
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFQAIGRVVSTE  149

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            ARAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  150  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLS  190



>ref|XP_008344154.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Malus domestica]
Length=773

 Score =   249 bits (637),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V  Q++PV+ACD   N  L S  FC+  L V  RVADLVKRLTLPEKI FLVN+AG+VSR
Sbjct  30   VLGQSSPVFACDVASNATLSSFAFCDTSLGVDARVADLVKRLTLPEKIGFLVNSAGSVSR  89

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN +LF  IG+V+STE
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTXFSSLVPGATSFPQVILTAASFNTSLFEAIGRVVSTE  149

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            ARAM+N GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  150  ARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLS  190



>ref|XP_009347830.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Pyrus x bretschneideri]
Length=773

 Score =   249 bits (636),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V  Q++PV+AC+   N  L S  FC+  L V  RVADLVKRLTLPEKI FLVN+AG+VSR
Sbjct  30   VLGQSSPVFACNVASNATLSSFAFCDTTLGVDARVADLVKRLTLPEKIGFLVNSAGSVSR  89

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN +LF  IG+V+STE
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFEAIGRVVSTE  149

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            ARAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  150  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLS  190



>gb|KEH31243.1| beta-xylosidase/alpha-L-arabinofuranosidase-like protein [Medicago 
truncatula]
Length=774

 Score =   249 bits (635),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = +2

Query  107  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  286
            G V SQT+ V+ACD  KNP L +  FCN++L V  RV DLV+RLTL EK+  LVN+A +V
Sbjct  29   GRVSSQTSAVFACDVAKNPALANYGFCNKKLSVDARVKDLVRRLTLQEKVGNLVNSAVDV  88

Query  287  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  466
            SRLGIP YEWWSEALHG+S  GPG +F+ V+P +TSFP P+L AASFN +LF TIGKV+S
Sbjct  89   SRLGIPKYEWWSEALHGVSNIGPGTHFSNVIPGSTSFPMPILIAASFNASLFQTIGKVVS  148

Query  467  TEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            TEARAMHN GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  149  TEARAMHNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLL  190



>ref|XP_002513707.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF48654.1| Beta-glucosidase, putative [Ricinus communis]
Length=777

 Score =   249 bits (635),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V +Q++PV+ACD   NP L S  FCN  L +  RV DLV RLTL EKI FLVN+AG+VSR
Sbjct  33   VLAQSSPVFACDVKSNPSLASFGFCNVSLGISDRVTDLVNRLTLQEKIGFLVNSAGSVSR  92

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP YEWWSEALHG+SY GPG +F+ +VP ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  93   LGIPKYEWWSEALHGVSYVGPGTHFSNIVPGATSFPQVILTAASFNASLFEAIGKVVSTE  152

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            ARAM+N GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  153  ARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLS  193



>ref|XP_010065531.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63059.1| hypothetical protein EUGRSUZ_G00651 [Eucalyptus grandis]
Length=789

 Score =   249 bits (635),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 130/162 (80%), Gaps = 1/162 (1%)
 Frame = +2

Query  113  VQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  289
            V  QT+ PV+ACD   +P L    FCN  L V+ RVADLV+RLTL EK+ FLVN AGNV 
Sbjct  32   VAGQTSKPVFACDVDSDPSLAGFGFCNASLGVEVRVADLVQRLTLQEKVGFLVNNAGNVD  91

Query  290  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  469
            RLGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN TLF TIGKV+ST
Sbjct  92   RLGIPKYEWWSEALHGVSYLGPGTKFSSLVPGATSFPQVILTAASFNATLFETIGKVVST  151

Query  470  EARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            EARAMHN GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  152  EARAMHNVGLAELTFWSPNVNIFRDPRWGRGQETPGEDPLLS  193



>gb|KDP30704.1| hypothetical protein JCGZ_16402 [Jatropha curcas]
Length=770

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V +Q +PV+ACD  KNP + S  FCN  L +  RV DLV+RLTL EKI+FLVN+AG+VSR
Sbjct  27   VVAQPSPVFACDVSKNPSVASFGFCNVSLGINERVVDLVERLTLQEKISFLVNSAGSVSR  86

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP YEWWSEALHG+SY GPG +F+ +VP ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  87   LGIPKYEWWSEALHGVSYVGPGTHFSSLVPGATSFPQVILTAASFNTSLFEAIGKVVSTE  146

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            ARAM+N GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  147  ARAMYNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLS  187



>emb|CAJ65922.1| xylan 1,4-beta-xylosidase [Populus tremula x Populus alba]
Length=757

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 133/165 (81%), Gaps = 4/165 (2%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V +Q++PV+ACD V NP L S  FCN  L V  RV DLVKRLTL EKI FLVN+AG+VSR
Sbjct  33   VLAQSSPVFACDVVSNPSLASFGFCNTSLGVSDRVVDLVKRLTLQEKILFLVNSAGSVSR  92

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI---  463
            LGIP YEWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKVI   
Sbjct  93   LGIPKYEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFVAIGKVISQV  152

Query  464  -STEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
             STEARAM+N GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  153  VSTEARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLS  197



>ref|XP_004504774.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cicer arietinum]
Length=774

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 130/162 (80%), Gaps = 0/162 (0%)
 Frame = +2

Query  107  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  286
            G V SQT+PV+ACD  KNP L +  FCN+ L V  RV+DLV RLTL EKI  LVN+A +V
Sbjct  29   GRVWSQTSPVFACDVGKNPALSNYRFCNKSLGVNARVSDLVSRLTLQEKIGNLVNSAVDV  88

Query  287  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  466
            SRLGIP YEWWSEALHG+S  GPG  F+ VVP +TSFP P+L AASFN +LF TIGKV+S
Sbjct  89   SRLGIPRYEWWSEALHGVSNVGPGTRFSNVVPGSTSFPMPILIAASFNASLFQTIGKVVS  148

Query  467  TEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            TEARAMHN GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  149  TEARAMHNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLL  190



>ref|XP_009379698.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Pyrus x bretschneideri]
Length=773

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 129/161 (80%), Gaps = 0/161 (0%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V  Q++PV+ACD   N  L S  FC+  L V  RV DLVKRLTLPEKI FLVN AG+VSR
Sbjct  30   VLGQSSPVFACDVASNATLSSFAFCDTSLGVDARVVDLVKRLTLPEKIGFLVNNAGSVSR  89

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN +LF  IG+V+STE
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFEAIGRVVSTE  149

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            ARAM+N GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  150  ARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPVLS  190



>ref|XP_007043027.1| Beta-D-xylosidase 4 [Theobroma cacao]
 gb|EOX98858.1| Beta-D-xylosidase 4 [Theobroma cacao]
Length=787

 Score =   247 bits (631),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 132/161 (82%), Gaps = 0/161 (0%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V  QT+PV+ACD  KNP + S  FCN  L +++RVADLV+RLTL EKI F+V+ AG+VSR
Sbjct  44   VFGQTSPVFACDATKNPEVTSYDFCNASLGIESRVADLVQRLTLQEKILFIVSGAGSVSR  103

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP YEWWSEALHG+S  GPG  F+ +VP ATSFPQ +LTAASFN TLF  IG+V+STE
Sbjct  104  LGIPKYEWWSEALHGVSNVGPGTKFSSLVPGATSFPQVILTAASFNTTLFEAIGRVVSTE  163

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            ARAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP LT
Sbjct  164  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLT  204



>ref|XP_010065527.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63057.1| hypothetical protein EUGRSUZ_G00649 [Eucalyptus grandis]
Length=790

 Score =   247 bits (631),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +2

Query  131  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  310
            PV+ACD   NP L +  FCN  L V+ RVADLV+RLTL EK+ FLV+ AGNV RLGIP Y
Sbjct  40   PVFACDVDGNPSLAAFGFCNTSLGVEARVADLVQRLTLQEKVGFLVSGAGNVDRLGIPKY  99

Query  311  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  490
            EWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN TLF TIGKV+STEARAMHN
Sbjct  100  EWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNATLFETIGKVVSTEARAMHN  159

Query  491  YGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
             GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  160  VGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLS  194



>emb|CDY18705.1| BnaA09g06900D [Brassica napus]
Length=776

 Score =   247 bits (630),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 130/160 (81%), Gaps = 0/160 (0%)
 Frame = +2

Query  116  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  295
             +QT PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RL
Sbjct  33   NAQTKPVFACDVDTNPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVNKANGVTRL  92

Query  296  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  475
            GIPTYEWWSEALHG+SY GPG +F+G+VP ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  93   GIPTYEWWSEALHGVSYVGPGTHFSGLVPGATSFPQVILTAASFNVSLFQAIGKVVSTEA  152

Query  476  RAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            RAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  153  RAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLS  192



>ref|XP_009112141.1| PREDICTED: beta-D-xylosidase 4-like [Brassica rapa]
Length=776

 Score =   247 bits (630),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 130/160 (81%), Gaps = 0/160 (0%)
 Frame = +2

Query  116  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  295
             +QT PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RL
Sbjct  33   NAQTKPVFACDVDTNPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVNKANGVTRL  92

Query  296  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  475
            GIPTYEWWSEALHG+SY GPG +F+G+VP ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  93   GIPTYEWWSEALHGVSYVGPGTHFSGLVPGATSFPQVILTAASFNVSLFQAIGKVVSTEA  152

Query  476  RAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            RAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  153  RAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLS  192



>gb|EPS65933.1| hypothetical protein M569_08842, partial [Genlisea aurea]
Length=763

 Score =   246 bits (629),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = +2

Query  131  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  310
            P++ACD   +P LK+L FC+  LDVKTRV DLV RLTLPEK+ +L N+A  VSRLGIP Y
Sbjct  20   PIFACDVSADPALKTLAFCDSSLDVKTRVDDLVNRLTLPEKLGWLANSAKGVSRLGIPDY  79

Query  311  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  490
            EWWSE LHG+SYTGPGV FT +VP ATSFPQ +LT+ASFNE+LF  IGKV+STEARAM+N
Sbjct  80   EWWSEVLHGVSYTGPGVRFTSLVPGATSFPQVILTSASFNESLFRAIGKVVSTEARAMYN  139

Query  491  YGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
             G A LT+WSPN+NIFRDPRWGRGQE PGEDP LT
Sbjct  140  VGSAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLT  174



>emb|CAJ65921.1| xylan 1,4-beta-xylosidase [Populus tremula x Populus alba]
Length=704

 Score =   245 bits (626),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 132/166 (80%), Gaps = 5/166 (3%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V +Q++PV+ACD V NP L SL FCN  + +  RV DLVKRLTL EKI FLVN+AGNVSR
Sbjct  31   VSAQSSPVFACDVVSNPSLASLGFCNTSIGINDRVVDLVKRLTLQEKIVFLVNSAGNVSR  90

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK-----  457
            LGIP YEWWSEALHG+SY GPG +F+  V  ATSFPQ +LTAASFN +LF  IGK     
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFSDDVAGATSFPQVILTAASFNTSLFEAIGKVYYTQ  150

Query  458  VISTEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            V+STEARAM+N GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  151  VVSTEARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLS  196



>ref|XP_002268626.2| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Vitis 
vinifera]
 emb|CBI39114.3| unnamed protein product [Vitis vinifera]
Length=774

 Score =   246 bits (629),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 129/161 (80%), Gaps = 0/161 (0%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V  Q++PV+ACD   NP L    FCN  L+   RVADLVKRLTL EKI FLVN+A +VSR
Sbjct  31   VLGQSSPVFACDVENNPTLGQFGFCNTSLETAARVADLVKRLTLEEKIGFLVNSAASVSR  90

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP YEWWSEALHG+SY GPG +F  +VP ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFNSIVPGATSFPQVILTAASFNASLFEAIGKVVSTE  150

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            ARAM+N GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  151  ARAMYNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLS  191



>ref|XP_007148433.1| hypothetical protein PHAVU_006G208200g [Phaseolus vulgaris]
 gb|ESW20427.1| hypothetical protein PHAVU_006G208200g [Phaseolus vulgaris]
Length=775

 Score =   246 bits (628),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 130/161 (81%), Gaps = 0/161 (0%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V  QT+ V+ACD  KNP L    FC++ L V+ RVADLVKRLTL EKI  LVN+A NVSR
Sbjct  32   VSGQTSAVFACDVAKNPALAGYGFCDKSLSVEDRVADLVKRLTLQEKIGNLVNSAVNVSR  91

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP YEWWSEALHG+S  GPG +F+ VVP ATSFP P+LTAASFN +LF  IG+V+STE
Sbjct  92   LGIPKYEWWSEALHGVSNIGPGTHFSSVVPGATSFPMPILTAASFNSSLFEAIGRVVSTE  151

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            ARAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  152  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLS  192



>emb|CBI40687.3| unnamed protein product [Vitis vinifera]
Length=751

 Score =   245 bits (626),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 129/161 (80%), Gaps = 0/161 (0%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V +Q++PV+ACD   NP L    FCN  L+   RVADLVKRLTL EKI FLVN+A +VSR
Sbjct  31   VLAQSSPVFACDVENNPTLGQFGFCNTSLETAARVADLVKRLTLEEKIGFLVNSAASVSR  90

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP YEWWSEALHG+SY GPG +F  VVP ATSFPQ +LTAASFN +LF  IGK +STE
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFNSVVPGATSFPQVILTAASFNASLFEAIGKAVSTE  150

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            ARAM+N GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  151  ARAMYNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLS  191



>ref|XP_002264183.2| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Vitis vinifera]
Length=774

 Score =   246 bits (627),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 129/161 (80%), Gaps = 0/161 (0%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V +Q++PV+ACD   NP L    FCN  L+   RVADLVKRLTL EKI FLVN+A +VSR
Sbjct  31   VLAQSSPVFACDVENNPTLGQFGFCNTSLETAARVADLVKRLTLEEKIGFLVNSAASVSR  90

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP YEWWSEALHG+SY GPG +F  VVP ATSFPQ +LTAASFN +LF  IGK +STE
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFNSVVPGATSFPQVILTAASFNASLFEAIGKAVSTE  150

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            ARAM+N GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  151  ARAMYNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLS  191



>gb|KFK28148.1| hypothetical protein AALP_AA8G478800 [Arabis alpina]
Length=779

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 130/159 (82%), Gaps = 0/159 (0%)
 Frame = +2

Query  119  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  298
            +QT+PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RLG
Sbjct  33   AQTSPVFACDVTGNPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLG  92

Query  299  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  478
            IPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  93   IPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  152

Query  479  AMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            AM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  153  AMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLS  191



>emb|CDY46812.1| BnaC02g43200D [Brassica napus]
Length=778

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = +2

Query  119  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  298
            +Q+ PV+ACD   N  L S  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RLG
Sbjct  33   AQSTPVFACDVAGNSSLSSYGFCNAALKIEARVADLVGRLTLQEKIGFLVNKASGVTRLG  92

Query  299  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  478
            IPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  93   IPTYEWWSEALHGVSYIGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  152

Query  479  AMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            AM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  153  AMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLS  191



>gb|KJB31995.1| hypothetical protein B456_005G218000 [Gossypium raimondii]
Length=779

 Score =   244 bits (623),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 130/160 (81%), Gaps = 0/160 (0%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V +QT+PV+ACD  K+P + S  FC+ +L    RVADLV RLTL EKI F+VN+AG+VSR
Sbjct  36   VLAQTSPVFACDATKDPQVASYGFCDTKLGTDARVADLVHRLTLQEKILFIVNSAGSVSR  95

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP YEWWSEALHG+S  GPG  FT +VP ATSFPQ +LTAASFN +L+  IGKV+STE
Sbjct  96   LGIPKYEWWSEALHGVSNVGPGTKFTSLVPGATSFPQVILTAASFNTSLYEAIGKVVSTE  155

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            ARAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  156  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLL  195



>gb|KHG10349.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Gossypium arboreum]
Length=779

 Score =   244 bits (623),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 130/160 (81%), Gaps = 0/160 (0%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V +QT+PV+ACD  K+P + S  FC+ +L    RVADLV RLTL EKI F+VN+AG+VSR
Sbjct  36   VLAQTSPVFACDATKDPKVASYGFCDTKLGTDARVADLVHRLTLQEKILFIVNSAGSVSR  95

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP YEWWSEALHG+S  GPG  FT +VP ATSFPQ +LTAASFN +L+  IGKV+STE
Sbjct  96   LGIPKYEWWSEALHGVSNVGPGTKFTSLVPGATSFPQVILTAASFNTSLYEAIGKVVSTE  155

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            ARAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  156  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLL  195



>ref|XP_010261102.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nelumbo nucifera]
Length=773

 Score =   244 bits (623),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = +2

Query  128  APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPT  307
            +PV+ACD  KN GL +  FCN    +  RV DLVKRLTL EKI FLVN AG V+RLGIP+
Sbjct  35   SPVFACDVGKNSGLAAFGFCNSSWGIAARVDDLVKRLTLQEKIIFLVNKAGAVTRLGIPS  94

Query  308  YEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMH  487
            YEWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STEARAM+
Sbjct  95   YEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFQAIGKVVSTEARAMY  154

Query  488  NYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  155  NVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPIL  189



>emb|CDX81229.1| BnaC09g06400D [Brassica napus]
Length=776

 Score =   244 bits (623),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 129/160 (81%), Gaps = 0/160 (0%)
 Frame = +2

Query  116  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  295
             +Q+ P +ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RL
Sbjct  33   NAQSKPAFACDVDTNPSLAAYGFCNTDLKMEYRVADLVARLTLQEKIGFLVNKANGVTRL  92

Query  296  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  475
            GIPTYEWWSEALHG+SY GPG +F+G+VP ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  93   GIPTYEWWSEALHGVSYVGPGTHFSGLVPGATSFPQVILTAASFNVSLFQAIGKVVSTEA  152

Query  476  RAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            RAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  153  RAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLS  192



>ref|XP_006394136.1| hypothetical protein EUTSA_v10003678mg [Eutrema salsugineum]
 gb|ESQ31422.1| hypothetical protein EUTSA_v10003678mg [Eutrema salsugineum]
Length=780

 Score =   244 bits (623),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 129/160 (81%), Gaps = 0/160 (0%)
 Frame = +2

Query  116  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  295
             +Q++PV+ACD   NP L +  FCN  L  + RVADLV RLTL EKI FLV+ A  VSRL
Sbjct  33   NAQSSPVFACDVAGNPSLAAYGFCNTALKSEYRVADLVARLTLQEKIGFLVSKANGVSRL  92

Query  296  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  475
            GIPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  93   GIPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEA  152

Query  476  RAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            RAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  153  RAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLS  192



>ref|XP_006280038.1| hypothetical protein CARUB_v10025915mg [Capsella rubella]
 gb|EOA12936.1| hypothetical protein CARUB_v10025915mg [Capsella rubella]
Length=784

 Score =   244 bits (622),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = +2

Query  116  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  295
             +Q++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RL
Sbjct  37   NAQSSPVFACDVAANPSLAAFGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRL  96

Query  296  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  475
            GIPTYEWWSEALHG+SY GPG  F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  97   GIPTYEWWSEALHGVSYIGPGTRFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEA  156

Query  476  RAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            RAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  157  RAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLL  195



>ref|XP_003547598.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Glycine max]
Length=776

 Score =   243 bits (621),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 130/161 (81%), Gaps = 0/161 (0%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V  QT+ V+ACD  KNP L    FC++ L V+ RVADLVKRLTL EKI  LVN+A +VSR
Sbjct  33   VSGQTSAVFACDVAKNPALAGYGFCDKSLSVEDRVADLVKRLTLQEKIGSLVNSATSVSR  92

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP YEWWSEALHG+S  GPG +F+ +VP ATSFP P+LTAASFN +LF  IG+V+STE
Sbjct  93   LGIPKYEWWSEALHGVSNVGPGTHFSSLVPGATSFPMPILTAASFNASLFEAIGRVVSTE  152

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            ARAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  153  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLS  193



>ref|XP_009401393.1| PREDICTED: beta-D-xylosidase 4-like [Musa acuminata subsp. malaccensis]
Length=770

 Score =   243 bits (621),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 127/160 (79%), Gaps = 1/160 (1%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V  QT PV+ACD   NP L S  FCN     + RVADLVKRLTL EK+ FLVN A  VSR
Sbjct  28   VAGQT-PVFACDVASNPSLGSYGFCNTSYGTEQRVADLVKRLTLQEKVGFLVNKATAVSR  86

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP+YEWWSEALHG+SY GPG +F+ +VP ATSFPQ +LTAASFN TLF  IGKV+STE
Sbjct  87   LGIPSYEWWSEALHGVSYVGPGTHFSTLVPGATSFPQVILTAASFNTTLFQAIGKVVSTE  146

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            ARAMHN GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  147  ARAMHNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLL  186



>ref|XP_010520456.1| PREDICTED: LOW QUALITY PROTEIN: beta-D-xylosidase 4 [Tarenaya 
hassleriana]
Length=750

 Score =   243 bits (620),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 129/165 (78%), Gaps = 0/165 (0%)
 Frame = +2

Query  101  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  280
            ++ P  +Q+ PV+ACD   NP L    FCN  L ++ RVADLV RLTLPEKI FLV+ A 
Sbjct  20   VLPPSNAQSTPVFACDVAGNPSLAGFGFCNTSLGIEARVADLVGRLTLPEKIGFLVSGAK  79

Query  281  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  460
             VSRLGIP YEWWSEALHG+SY GPG  F+G VP ATSFPQ +LTAASFN +LF  IGK 
Sbjct  80   AVSRLGIPAYEWWSEALHGVSYVGPGTRFSGQVPGATSFPQVILTAASFNVSLFQAIGKA  139

Query  461  ISTEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            +STEARAM+N GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  140  VSTEARAMYNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLS  184



>ref|XP_007225245.1| hypothetical protein PRUPE_ppa001692mg [Prunus persica]
 gb|EMJ26444.1| hypothetical protein PRUPE_ppa001692mg [Prunus persica]
Length=779

 Score =   243 bits (621),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 129/159 (81%), Gaps = 0/159 (0%)
 Frame = +2

Query  119  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  298
            +Q++PV+ACD   N  + S  FC+  L +  RVADLVKRLTL EKI FLVN+AG+VSRLG
Sbjct  38   AQSSPVFACDVGSNASVSSFGFCDTSLAIDLRVADLVKRLTLQEKIGFLVNSAGSVSRLG  97

Query  299  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  478
            IP YEWWSEALHG+S  GPG  FT VVP ATSFPQ +LTAASFN +LF  IG+V+STEAR
Sbjct  98   IPKYEWWSEALHGVSNVGPGTKFTNVVPGATSFPQVILTAASFNASLFEAIGRVVSTEAR  157

Query  479  AMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            AM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  158  AMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLS  196



>ref|XP_003531557.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Glycine max]
Length=776

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 130/161 (81%), Gaps = 0/161 (0%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V  QT+ V+ACD  KNP L    FC++ L ++ RVADLVKRLTL EKI  LVN+A +VSR
Sbjct  33   VSGQTSSVFACDVAKNPALAGYGFCDKSLSLEDRVADLVKRLTLQEKIGSLVNSATSVSR  92

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP YEWWSEALHG+S  GPG +F+ +VP ATSFP P+LTAASFN +LF  IG+V+STE
Sbjct  93   LGIPKYEWWSEALHGVSNVGPGTHFSSLVPGATSFPMPILTAASFNASLFEAIGRVVSTE  152

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            ARAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  153  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLS  193



>ref|XP_008784548.1| PREDICTED: LOW QUALITY PROTEIN: beta-xylosidase/alpha-L-arabinofuranosidase 
2-like [Phoenix dactylifera]
Length=773

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 129/160 (81%), Gaps = 1/160 (1%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V +QT P++ACDT  N  L S  FCN    ++ RV DLVKRLTL EK+ FLVN A  VSR
Sbjct  31   VLAQT-PIFACDTASNASLASFGFCNTSWGIEARVGDLVKRLTLEEKVGFLVNKAAAVSR  89

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP+YEWWSEALHG+S+ GPG +F+ +VP ATSFPQ +LTAASFN TLF TIGKV+STE
Sbjct  90   LGIPSYEWWSEALHGVSFVGPGTHFSSLVPGATSFPQVILTAASFNTTLFETIGKVVSTE  149

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            ARAMHN GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  150  ARAMHNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPVL  189



>ref|XP_010444394.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=776

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 127/156 (81%), Gaps = 0/156 (0%)
 Frame = +2

Query  125  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  304
            ++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RLGIP
Sbjct  32   SSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLGIP  91

Query  305  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAM  484
            TYEWWSEALHG+SY GPG +FTG VP ATSFPQ +LTAASFN +LF  IGKV+STEARAM
Sbjct  92   TYEWWSEALHGVSYIGPGTHFTGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAM  151

Query  485  HNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            +N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  152  YNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLL  187



>gb|EYU35409.1| hypothetical protein MIMGU_mgv1a001738mg [Erythranthe guttata]
Length=767

 Score =   242 bits (617),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 129/164 (79%), Gaps = 0/164 (0%)
 Frame = +2

Query  104  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  283
             GPV SQ  PV+ACD   NPGLK+  FC+  LDVK RV DLV RLTL EKI +LV+ A  
Sbjct  20   FGPVCSQAQPVFACDVSSNPGLKNFSFCDPSLDVKARVDDLVARLTLQEKIGWLVHAAKG  79

Query  284  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  463
            VSRLGIP+Y WWSEALHG+S  G G  FTG VPAATSFPQ +LT A+FNE+LF  IGKV+
Sbjct  80   VSRLGIPSYGWWSEALHGVSDVGGGSRFTGPVPAATSFPQVILTGATFNESLFQAIGKVV  139

Query  464  STEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            STEARAM+N G A LT+WSPN+NIFRDPRWGRGQE PGEDP LT
Sbjct  140  STEARAMYNVGSAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLT  183



>ref|XP_009130462.1| PREDICTED: beta-D-xylosidase 4-like [Brassica rapa]
Length=778

 Score =   242 bits (617),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 127/160 (79%), Gaps = 0/160 (0%)
 Frame = +2

Query  116  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  295
             +Q+ P +ACD   N  L +  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RL
Sbjct  32   NAQSTPAFACDVAGNSSLSAYGFCNAALKIEARVADLVGRLTLQEKIGFLVNKANGVTRL  91

Query  296  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  475
            GIPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  92   GIPTYEWWSEALHGVSYIGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEA  151

Query  476  RAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            RAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  152  RAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLS  191



>ref|NP_201262.1| beta-D-xylosidase 4 [Arabidopsis thaliana]
 sp|Q9FLG1.1|BXL4_ARATH RecName: Full=Beta-D-xylosidase 4; Short=AtBXL4; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB11424.1| beta-xylosidase [Arabidopsis thaliana]
 gb|AED97922.1| beta-D-xylosidase 4 [Arabidopsis thaliana]
Length=784

 Score =   241 bits (616),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = +2

Query  116  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  295
             +Q++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RL
Sbjct  37   NAQSSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRL  96

Query  296  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  475
            GIPTYEWWSEALHG+SY GPG +F+  VP ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  97   GIPTYEWWSEALHGVSYIGPGTHFSSQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEA  156

Query  476  RAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            RAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  157  RAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLL  195



>emb|CDY31313.1| BnaA02g34280D [Brassica napus]
Length=778

 Score =   241 bits (616),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 127/160 (79%), Gaps = 0/160 (0%)
 Frame = +2

Query  116  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  295
             +Q+ P +ACD   N  L +  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RL
Sbjct  32   NAQSTPAFACDVAGNSSLSAYGFCNAALKIEARVADLVGRLTLQEKIGFLVNKANGVTRL  91

Query  296  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  475
            GIPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  92   GIPTYEWWSEALHGVSYIGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEA  151

Query  476  RAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            RAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  152  RAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLS  191



>ref|XP_010461983.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=776

 Score =   241 bits (616),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 127/156 (81%), Gaps = 0/156 (0%)
 Frame = +2

Query  125  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  304
            ++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RLGIP
Sbjct  32   SSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLGIP  91

Query  305  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAM  484
            TYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEARAM
Sbjct  92   TYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAM  151

Query  485  HNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            +N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  152  YNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLL  187



>ref|XP_002866623.1| beta-xylosidase 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42882.1| beta-xylosidase 4 [Arabidopsis lyrata subsp. lyrata]
Length=784

 Score =   241 bits (616),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = +2

Query  116  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  295
             +Q++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RL
Sbjct  37   NAQSSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRL  96

Query  296  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  475
            GIPTYEWWSEALHG+SY GPG +F+  VP ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  97   GIPTYEWWSEALHGVSYIGPGTHFSSQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEA  156

Query  476  RAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            RAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  157  RAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLL  195



>ref|XP_010484241.1| PREDICTED: beta-D-xylosidase 4 [Camelina sativa]
Length=785

 Score =   241 bits (615),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 127/156 (81%), Gaps = 0/156 (0%)
 Frame = +2

Query  125  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  304
            ++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RLGIP
Sbjct  41   SSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLGIP  100

Query  305  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAM  484
            TYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEARAM
Sbjct  101  TYEWWSEALHGVSYIGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAM  160

Query  485  HNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            +N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  161  YNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLL  196



>ref|XP_008218886.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Prunus 
mume]
Length=779

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 129/161 (80%), Gaps = 0/161 (0%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V +Q++PV+AC+   N    S  FC+  L +  RVADLV+RLTL EKI FLVN+AG+VSR
Sbjct  36   VFAQSSPVFACNVASNASASSFGFCDTSLAIDLRVADLVQRLTLQEKIGFLVNSAGSVSR  95

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP YEWWSEALHG+S  GPG  FT VVP ATSFPQ +LTAASFN +LF  IG+V+STE
Sbjct  96   LGIPKYEWWSEALHGVSNVGPGTKFTNVVPGATSFPQVILTAASFNASLFEAIGRVVSTE  155

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            ARAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  156  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLS  196



>ref|XP_004300692.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=799

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 128/161 (80%), Gaps = 2/161 (1%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V S +   +AC    N    S PFC++ L    RVADLV+RLTL EKITFLVN+AG+VSR
Sbjct  58   VSSVSGQSFACGESGNA--SSFPFCDKSLAADARVADLVQRLTLQEKITFLVNSAGSVSR  115

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP YEWWSEALHG+SY GPG  F+ VVP ATSFPQP+LTAASFN +LF  IG+V+STE
Sbjct  116  LGIPKYEWWSEALHGVSYVGPGTRFSSVVPGATSFPQPILTAASFNNSLFEAIGRVVSTE  175

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            ARAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP LT
Sbjct  176  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLT  216



>ref|XP_010065529.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63058.1| hypothetical protein EUGRSUZ_G00650 [Eucalyptus grandis]
Length=789

 Score =   240 bits (612),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = +2

Query  131  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  310
            PV+ACD   +P L    FCN  L V+ RVADLV+RLTL EK+ FLVN AGNV RLGIP Y
Sbjct  39   PVFACDVGSDPSLAGFGFCNTSLGVEARVADLVQRLTLQEKVGFLVNNAGNVDRLGIPNY  98

Query  311  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  490
            +WWSEALHG+SY G G +F+ +VP ATSFPQ +LTAASFN TLF TIGKV+STEARAMHN
Sbjct  99   KWWSEALHGVSYVGGGTSFSSLVPGATSFPQVILTAASFNATLFETIGKVVSTEARAMHN  158

Query  491  YGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
             GLA LT+WSPN+NIFRDPRWGRGQE  GEDP L+
Sbjct  159  VGLAGLTFWSPNVNIFRDPRWGRGQETRGEDPLLS  193



>ref|XP_010103839.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Morus notabilis]
 gb|EXB97280.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Morus notabilis]
Length=778

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 129/164 (79%), Gaps = 1/164 (1%)
 Frame = +2

Query  107  GPVQSQ-TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  283
            G V+ Q T+P +ACD   NP L    FCN  L +++RV DLVKRLTL EKI FLVN+AG 
Sbjct  30   GGVRGQSTSPPFACDVGANPSLAGFGFCNASLGIESRVGDLVKRLTLQEKIGFLVNSAGA  89

Query  284  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  463
            VSRLGIP YEWWSEALHG+SY GPG  F+ VVP ATSFPQ +LTAASFN +LF  IGKV+
Sbjct  90   VSRLGIPKYEWWSEALHGVSYVGPGTRFSSVVPGATSFPQVILTAASFNASLFEVIGKVV  149

Query  464  STEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            STEARAM+N GLA LTYWSPN+NI RDPRWGR QE PGEDP L+
Sbjct  150  STEARAMYNVGLAGLTYWSPNVNIVRDPRWGRTQETPGEDPLLS  193



>ref|XP_011465594.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=799

 Score =   239 bits (610),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 128/161 (80%), Gaps = 2/161 (1%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V S +   +AC    N    S PFC++ L    RVADLV+RLTL EKITFLVN+AG+VSR
Sbjct  58   VSSVSGQSFACGESGNA--SSFPFCDKSLAADARVADLVQRLTLQEKITFLVNSAGSVSR  115

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP YEWWSEALHG+SY GPG  F+ VVP ATSFPQP+LTAASFN +LF  IG+V+STE
Sbjct  116  LGIPKYEWWSEALHGVSYVGPGTRFSSVVPGATSFPQPILTAASFNNSLFEAIGRVVSTE  175

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            ARAM+N GLA LTYW+PN+NIFRDPRWGRGQE PGEDP LT
Sbjct  176  ARAMYNVGLAGLTYWAPNINIFRDPRWGRGQETPGEDPLLT  216



>emb|CDY52884.1| BnaC06g27770D, partial [Brassica napus]
Length=318

 Score =   228 bits (581),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 126/165 (76%), Gaps = 1/165 (1%)
 Frame = +2

Query  101  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  277
            I  P  +Q++ PV+ACD + NP L    FCN  L  + RV DLV RLTL EKI FLV+ A
Sbjct  27   ISKPSNAQSSSPVFACDVITNPSLAGYGFCNTGLKAEARVTDLVGRLTLVEKIGFLVSKA  86

Query  278  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  457
              VSRLGIP Y WWSEALHG+S  G G +FTG+VP ATSFPQ +LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGGGSSFTGLVPGATSFPQVILTAASFNVSLFQAIGK  146

Query  458  VISTEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            V+STEARAM+N G A LT+WSPN+NIFRDPRWGRGQE PGEDPTL
Sbjct  147  VVSTEARAMYNVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTL  191



>ref|XP_007159080.1| hypothetical protein PHAVU_002G206800g [Phaseolus vulgaris]
 gb|ESW31074.1| hypothetical protein PHAVU_002G206800g [Phaseolus vulgaris]
Length=773

 Score =   239 bits (609),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 126/162 (78%), Gaps = 0/162 (0%)
 Frame = +2

Query  107  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  286
            G V  QT+ ++ACD  KNP L    FC++ L V+ RVADLV RLTL EKI  LVN A +V
Sbjct  28   GGVWGQTSAIFACDVEKNPALGGYAFCDKSLGVEERVADLVGRLTLQEKIGNLVNAAVDV  87

Query  287  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  466
            SRLGIP YEWWSEALHG+S  GPG  F+ VVP ATSFP P+LTAASFN +LF TIG+ +S
Sbjct  88   SRLGIPKYEWWSEALHGVSNVGPGTRFSNVVPGATSFPMPILTAASFNTSLFETIGRAVS  147

Query  467  TEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            TEARAMHN GLA LTYWSPN+NIFRDPRWGRG E PGEDP L
Sbjct  148  TEARAMHNVGLAGLTYWSPNINIFRDPRWGRGLETPGEDPVL  189



>ref|XP_010937054.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Elaeis guineensis]
Length=772

 Score =   238 bits (607),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 127/160 (79%), Gaps = 1/160 (1%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V +QT P++ACD   NP L +  FCN       RV DLV+RLTL EK+ FLVN A  VSR
Sbjct  30   VLAQT-PIFACDIASNPSLANFGFCNTSWGTAARVDDLVERLTLDEKVGFLVNKATAVSR  88

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP+YEWWSEALHG+SY GPG +F+ +VP ATSFPQ +LTAASFN TLF TIGKV+STE
Sbjct  89   LGIPSYEWWSEALHGVSYVGPGTHFSSLVPGATSFPQVILTAASFNTTLFETIGKVVSTE  148

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            ARAMHN GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  149  ARAMHNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLL  188



>ref|XP_010065530.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
Length=789

 Score =   238 bits (608),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = +2

Query  131  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  310
            PV+ACD   +P L    FCN  L V+ RV DLV+RLTL EK+ FLVN A NV RLGIP Y
Sbjct  39   PVFACDVDSDPSLAGFGFCNTSLGVEARVVDLVQRLTLQEKVGFLVNNASNVDRLGIPKY  98

Query  311  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  490
             WWSEALHG+S  GPG  F  +VP ATSFPQ +LTAASFN TLF TIGKVISTEARAMHN
Sbjct  99   SWWSEALHGVSDVGPGTTFASLVPGATSFPQVILTAASFNATLFETIGKVISTEARAMHN  158

Query  491  YGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
             GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  159  VGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLS  193



>ref|XP_004136861.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cucumis sativus]
 gb|KGN43688.1| hypothetical protein Csa_7G058620 [Cucumis sativus]
Length=782

 Score =   238 bits (607),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = +2

Query  119  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  298
            +Q+   +ACD   NP +    FC+  L  + RV DLVKRLTL EKI FL+N A NV+RLG
Sbjct  41   AQSPTAFACDAETNPSVSGFAFCDSSLGFEARVEDLVKRLTLQEKIGFLINNARNVTRLG  100

Query  299  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  478
            IP YEWWSEALHG+SY GPG  F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  101  IPKYEWWSEALHGVSYVGPGTKFSNVVPGATSFPQVILTAASFNASLFEAIGKVVSTEAR  160

Query  479  AMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            AM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  161  AMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLS  199



>ref|XP_011087838.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 128/162 (79%), Gaps = 0/162 (0%)
 Frame = +2

Query  110  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  289
            PV ++  PV+ACD   NPGL +  FC+  LD+KTR+ DLV RLTL EK  +LV+ A  VS
Sbjct  24   PVFAERKPVFACDVTSNPGLMNFSFCDPSLDLKTRMDDLVSRLTLQEKFGWLVSGARGVS  83

Query  290  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  469
            RLGIP YEWWSEALHG+SYTGPG  F   VP ATSFPQ +LTA +FNE+LF  IGKV+ST
Sbjct  84   RLGIPNYEWWSEALHGVSYTGPGTKFASPVPGATSFPQVILTAGTFNESLFELIGKVVST  143

Query  470  EARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            EARAM+N GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  144  EARAMYNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLS  185



>ref|XP_008455235.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Cucumis melo]
Length=791

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = +2

Query  119  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  298
            +Q+   +ACD   NP +    FC+  L  + RV DLVKRLTL EKI FL+N A NV+RLG
Sbjct  50   AQSPTAFACDAGTNPSVSGFAFCDSSLGFEARVEDLVKRLTLQEKIGFLINNARNVTRLG  109

Query  299  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  478
            IP YEWWSEALHG+SY GPG  F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  110  IPKYEWWSEALHGVSYVGPGTKFSNVVPGATSFPQVILTAASFNASLFEAIGKVVSTEAR  169

Query  479  AMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            AM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  170  AMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLS  208



>ref|XP_004155509.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cucumis sativus]
Length=809

 Score =   237 bits (604),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = +2

Query  119  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  298
            +Q+   +ACD   NP +    FC+  L  + RV DLVKRLTL EKI FL+N A NV+RLG
Sbjct  68   AQSPTAFACDAETNPSVSGFAFCDSSLGFEARVEDLVKRLTLQEKIGFLINNARNVTRLG  127

Query  299  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  478
            IP YEWWSEALHG+SY GPG  F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  128  IPKYEWWSEALHGVSYVGPGTKFSNVVPGATSFPQVILTAASFNASLFEAIGKVVSTEAR  187

Query  479  AMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            AM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  188  AMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLS  226



>emb|CDY56487.1| BnaCnng30450D [Brassica napus]
Length=791

 Score =   236 bits (603),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 126/160 (79%), Gaps = 0/160 (0%)
 Frame = +2

Query  116  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  295
             +Q+ PV+ACD   NP L +  FCN  + ++ RVADLV RLTL EKI  L +    V+RL
Sbjct  43   NAQSTPVFACDVAGNPSLAAYGFCNTAIKIEYRVADLVARLTLQEKIGVLTSKLHGVTRL  102

Query  296  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  475
            GIPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  103  GIPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEA  162

Query  476  RAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            RAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  163  RAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLS  202



>emb|CDY51290.1| BnaA06g23560D [Brassica napus]
Length=780

 Score =   236 bits (602),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 126/160 (79%), Gaps = 0/160 (0%)
 Frame = +2

Query  116  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  295
             +Q+ PV+ACD   NP L +  FCN  + ++ RVADLV RLTL EKI  L +    V+RL
Sbjct  32   NAQSTPVFACDVAGNPSLAAYGFCNTAIKIEYRVADLVARLTLQEKIGVLTSKLHGVTRL  91

Query  296  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  475
            GIPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  92   GIPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEA  151

Query  476  RAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            RAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  152  RAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLS  191



>ref|XP_009150540.1| PREDICTED: beta-D-xylosidase 4 [Brassica rapa]
Length=791

 Score =   236 bits (602),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 126/160 (79%), Gaps = 0/160 (0%)
 Frame = +2

Query  116  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  295
             +Q+ PV+ACD   NP L +  FCN  + ++ RVADLV RLTL EKI  L +    V+RL
Sbjct  43   NAQSTPVFACDVAGNPSLAAYGFCNTAIKIEYRVADLVARLTLQEKIGVLTSKLHGVTRL  102

Query  296  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  475
            GIPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  103  GIPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEA  162

Query  476  RAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            RAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  163  RAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLS  202



>dbj|BAE44362.1| alpha-L-arabinofuranosidase [Raphanus sativus]
Length=780

 Score =   236 bits (601),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 125/160 (78%), Gaps = 0/160 (0%)
 Frame = +2

Query  116  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  295
             +Q+ PV+ACD   NP L +  FCN  + ++ RVADLV RLTL EKI  L +    V+RL
Sbjct  32   NAQSTPVFACDVAGNPSLAAYGFCNTAIKIEYRVADLVARLTLQEKIGVLTSKLHGVARL  91

Query  296  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  475
            GIPTYEWWSEALHG+SY GPG  F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  92   GIPTYEWWSEALHGVSYVGPGTRFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEA  151

Query  476  RAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            RAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  152  RAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLS  191



>ref|XP_009403180.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Musa acuminata subsp. malaccensis]
Length=769

 Score =   235 bits (600),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 120/158 (76%), Gaps = 0/158 (0%)
 Frame = +2

Query  119  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  298
            S   P++ACD   N  L    FCN     K RV DLVKRLTL EK+ FLVN A  V RLG
Sbjct  28   SGQGPIFACDVASNRSLAGFGFCNVSWGTKQRVKDLVKRLTLQEKVGFLVNKATAVPRLG  87

Query  299  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  478
            IP+YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN TLF  IGKV+STEAR
Sbjct  88   IPSYEWWSEALHGVSYVGPGTRFSTLVPGATSFPQVILTAASFNATLFKAIGKVVSTEAR  147

Query  479  AMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            AMHN GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  148  AMHNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPVL  185



>ref|XP_006399455.1| hypothetical protein EUTSA_v10012739mg [Eutrema salsugineum]
 gb|ESQ40908.1| hypothetical protein EUTSA_v10012739mg [Eutrema salsugineum]
Length=779

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 125/165 (76%), Gaps = 0/165 (0%)
 Frame = +2

Query  101  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  280
            I  P  +Q++PV+ACD   NP L    FCN  L  + RV DLV RLTL EKI FL + A 
Sbjct  27   ISEPSNAQSSPVFACDITGNPSLAGFGFCNTELKAEDRVTDLVGRLTLEEKIGFLGSRAN  86

Query  281  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  460
             VSRLGIP Y WWSEALHG+S  G G NF+G VP ATSFPQ +LTAASFN +LF  IGKV
Sbjct  87   GVSRLGIPPYNWWSEALHGVSDVGHGTNFSGQVPGATSFPQVILTAASFNVSLFEAIGKV  146

Query  461  ISTEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            +STEARAM+N GLA LT+WSPN+NIFRDPRWGRGQE PGEDPTLT
Sbjct  147  VSTEARAMYNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLT  191



>ref|XP_011087839.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 131/163 (80%), Gaps = 0/163 (0%)
 Frame = +2

Query  107  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  286
            GPV +Q  PV+ACD   NPGLK+  FC+  L +KTRV DLV RLTL EKI +LV+ +  V
Sbjct  23   GPVFAQQKPVFACDVTDNPGLKNFRFCDLSLGLKTRVDDLVSRLTLQEKIGWLVSGSEGV  82

Query  287  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  466
            SRLGIP Y+WWSEALHG+SY GPG  F+  +PAAT FPQ +LTA++FN++LF TI KV+S
Sbjct  83   SRLGIPDYQWWSEALHGVSYGGPGTKFSSPIPAATIFPQVILTASTFNDSLFETIAKVVS  142

Query  467  TEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            TEARAM+N GLA LT++SPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  143  TEARAMYNAGLAGLTFFSPNINIFRDPRWGRGQETPGEDPLLS  185



>ref|XP_004485551.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Cicer arietinum]
Length=775

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 125/161 (78%), Gaps = 0/161 (0%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V  QT+ V+ACD  KN  L    FC++ L VK RV DLVKRLTL EKI  L N+A  VSR
Sbjct  32   VYGQTSTVFACDVAKNSSLAGYGFCDKSLSVKERVLDLVKRLTLKEKIGNLGNSAVEVSR  91

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP YEWWSEALHG+S  GPG +F+ +VP ATSFP P+LTAASFN +LF  IG V+STE
Sbjct  92   LGIPKYEWWSEALHGISNIGPGTHFSTLVPGATSFPMPILTAASFNTSLFQAIGSVVSTE  151

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            ARAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  152  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLS  192



>ref|NP_196535.1| beta-xylosidase 3 [Arabidopsis thaliana]
 sp|Q9LXD6.1|BXL3_ARATH RecName: Full=Beta-D-xylosidase 3; Short=AtBXL3; AltName: Full=Alpha-L-arabinofuranosidase; 
Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB89357.1| beta-xylosidase-like protein [Arabidopsis thaliana]
 dbj|BAB09531.1| beta-xylosidase [Arabidopsis thaliana]
 gb|AAK96639.1| AT5g09730/F17I14_80 [Arabidopsis thaliana]
 gb|AED91439.1| beta-xylosidase 3 [Arabidopsis thaliana]
Length=773

 Score =   233 bits (595),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 125/160 (78%), Gaps = 0/160 (0%)
 Frame = +2

Query  116  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  295
             +Q++PV+ACD   NP L  L FCN  L +K RV DLV RLTL EKI FL + A  VSRL
Sbjct  27   NNQSSPVFACDVTGNPSLAGLRFCNAGLSIKARVTDLVGRLTLEEKIGFLTSKAIGVSRL  86

Query  296  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  475
            GIP+Y+WWSEALHG+S  G G  FTG VP ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  87   GIPSYKWWSEALHGVSNVGGGSRFTGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEA  146

Query  476  RAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            RAM+N G A LT+WSPN+NIFRDPRWGRGQE PGEDPTL+
Sbjct  147  RAMYNVGSAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLS  186



>ref|XP_010452969.1| PREDICTED: beta-D-xylosidase 3-like [Camelina sativa]
Length=779

 Score =   233 bits (595),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 126/160 (79%), Gaps = 0/160 (0%)
 Frame = +2

Query  116  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  295
             +Q++PV+ACD  +NP L +L FCN  L +K RV DLV RLTL EKI FL + A  VSRL
Sbjct  32   NAQSSPVFACDVTRNPSLAALGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSKAVGVSRL  91

Query  296  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  475
            GIP Y WWSEALHG+S  G G NF+G +  ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  92   GIPDYNWWSEALHGVSNVGSGTNFSGQIRGATSFPQVILTAASFNVSLFQAIGKVVSTEA  151

Query  476  RAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            RAM+N GLA LT+WSPN+NIFRDPRWGRGQE PGEDPTL+
Sbjct  152  RAMYNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLS  191



>ref|XP_003593145.1| Beta-xylosidase/alpha-L-arabinofuranosidase [Medicago truncatula]
 gb|AES63396.1| beta-xylosidase/alpha-L-arabinofuranosidase-like protein [Medicago 
truncatula]
Length=775

 Score =   232 bits (592),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 126/161 (78%), Gaps = 0/161 (0%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V  QT+ V+ACD  KN  + S  FC++ L V+ RV+DLVKRLTL EKI  L N+A  VSR
Sbjct  32   VYGQTSTVFACDVAKNTNVSSYGFCDKSLSVEDRVSDLVKRLTLQEKIGNLGNSAVEVSR  91

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP YEWWSEALHG+S  GPG +F+ +VP ATSFP P+LTAASFN +LF  IG V+S E
Sbjct  92   LGIPKYEWWSEALHGVSNIGPGTHFSSLVPGATSFPMPILTAASFNTSLFQAIGSVVSNE  151

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            ARAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  152  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLS  192



>gb|KFK25272.1| hypothetical protein AALP_AA8G090500 [Arabis alpina]
Length=772

 Score =   232 bits (591),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 126/162 (78%), Gaps = 0/162 (0%)
 Frame = +2

Query  110  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  289
            P+ ++++PV+ACD  K+       FCN  LDV++RV+DLV RLTL EKI FLV+ A  VS
Sbjct  27   PLNAKSSPVFACDVDKDISFSGFRFCNTELDVQSRVSDLVGRLTLEEKIGFLVSRAKGVS  86

Query  290  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  469
            RLGIP Y WWSEALHG+S  GPG  F+G VP ATSFPQ +LTAASFN +LF  IGK +ST
Sbjct  87   RLGIPDYNWWSEALHGVSNVGPGSYFSGQVPGATSFPQVILTAASFNVSLFQAIGKAVST  146

Query  470  EARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            EARAM+N G A LT+WSPN+NIFRDPRWGRGQE PGEDP LT
Sbjct  147  EARAMYNVGQAGLTFWSPNVNIFRDPRWGRGQETPGEDPMLT  188



>dbj|BAJ89945.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=525

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 124/163 (76%), Gaps = 2/163 (1%)
 Frame = +2

Query  107  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  286
            G  ++Q APV+ACD   N  L +  FCN++     R  DLV RLTL EK+ FLVN    +
Sbjct  28   GTAEAQ-APVFACD-ASNATLAAYGFCNRKATASARARDLVSRLTLAEKVGFLVNKQPAL  85

Query  287  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  466
             RLGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+S
Sbjct  86   GRLGIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVS  145

Query  467  TEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            TEARAMHN GLA LT+WSPN+NIFRDPRWGRGQE PGEDP LT
Sbjct  146  TEARAMHNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLT  188



>gb|KHN06823.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Glycine soja]
Length=301

 Score =   220 bits (561),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD  K+P +    FC++ L V+ RV DLV RLTL EKI  LVN+AG+VSRLGIP YEW
Sbjct  12   FACDVGKSPAVAGYGFCDKSLGVEARVKDLVGRLTLQEKIGNLVNSAGDVSRLGIPRYEW  71

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  G G  F+ VVP ATSFP P+LTAASFN +LF  IG+V+STEA AM+N G
Sbjct  72   WSEALHGVSNVGLGTRFSNVVPGATSFPMPILTAASFNTSLFEVIGRVVSTEAGAMYNVG  131

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            LA  TYWSPN+NIFRDPRWGRG E PGEDP LT
Sbjct  132  LAGFTYWSPNINIFRDPRWGRGLETPGEDPVLT  164



>ref|XP_006827121.1| hypothetical protein AMTR_s00010p00246460 [Amborella trichopoda]
 gb|ERM94358.1| hypothetical protein AMTR_s00010p00246460 [Amborella trichopoda]
Length=769

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 124/156 (79%), Gaps = 0/156 (0%)
 Frame = +2

Query  128  APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPT  307
            +PV+ACDT K+P + S  FCN  L +  RV DLV+RLTL EKI FLVN    VSRLGIP 
Sbjct  29   SPVFACDTSKDPSVGSYGFCNGSLGLSERVQDLVQRLTLSEKIGFLVNKGVGVSRLGIPA  88

Query  308  YEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMH  487
            YEWWSEALHG+SY GPG +F+G+VP ATSFPQ + + ASFN +L+  IGKV+STEARAM+
Sbjct  89   YEWWSEALHGVSYVGPGTHFSGLVPGATSFPQVIHSVASFNSSLWEAIGKVVSTEARAMY  148

Query  488  NYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            N GLA LT+WSPN+NIFRDPRWGRGQE  GEDP LT
Sbjct  149  NVGLAGLTFWSPNINIFRDPRWGRGQETAGEDPLLT  184



>ref|XP_010687471.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Beta vulgaris subsp. vulgaris]
Length=777

 Score =   231 bits (588),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 122/156 (78%), Gaps = 0/156 (0%)
 Frame = +2

Query  128  APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPT  307
            +P +ACDT  N  L SL FC+    V+ RVADL+ RLTL EKI +L++ A +V+RLGIP 
Sbjct  39   SPAFACDTTSNASLSSLGFCDTSKSVEARVADLIGRLTLTEKIGYLISGAASVNRLGIPK  98

Query  308  YEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMH  487
            YEWWSEALHG+S  GPG  FT VVP ATSFPQ + TAASFN TLF  IGKV+S EARAM+
Sbjct  99   YEWWSEALHGVSNVGPGTRFTSVVPGATSFPQVITTAASFNTTLFQAIGKVVSNEARAMY  158

Query  488  NYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  159  NTGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLS  194



>ref|XP_004301992.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X3 [Fragaria vesca subsp. vesca]
Length=774

 Score =   230 bits (587),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 128/162 (79%), Gaps = 3/162 (2%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V S +   YAC    N   +S PFC++ L V  RVADLV+RLTL EKITFLV+ AGNVSR
Sbjct  32   VSSVSGQSYACGDGFNA--RSFPFCDKSLAVDARVADLVQRLTLQEKITFLVDAAGNVSR  89

Query  293  LGIPTYEWWSEALHGLSYTGPG-VNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  469
            LGIPTY+WWSEALHG+S  G G   FT +VP ATSFPQP+LTAASFN +LF  IG+V+ST
Sbjct  90   LGIPTYQWWSEALHGVSKVGRGGTKFTELVPGATSFPQPILTAASFNNSLFEAIGRVVST  149

Query  470  EARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            EARAM+N GLA LTYW+PN+NIFRDPRWGRGQE PGEDP LT
Sbjct  150  EARAMYNVGLAGLTYWAPNINIFRDPRWGRGQETPGEDPLLT  191



>gb|KJB77499.1| hypothetical protein B456_012G140300 [Gossypium raimondii]
Length=776

 Score =   230 bits (587),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  113  VQSQTAP-VYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  289
            V  Q +P V+ACD  K+  +    FCN  L    RVADLV+RLTL EKI  +VN AGN+S
Sbjct  29   VVGQVSPAVFACDATKDRKVVHYGFCNASLGRDARVADLVRRLTLQEKILNIVNGAGNIS  88

Query  290  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  469
            RLGIP YEWWSEALHG+S  GPG NF+ +VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  89   RLGIPKYEWWSEALHGVSNVGPGTNFSSLVPGATSFPQVILTAASFNTSLFEAIGKVVST  148

Query  470  EARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            EARAM+N GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  149  EARAMYNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLS  190



>sp|A5JTQ2.1|XYL1_MEDSV RecName: Full=Beta-xylosidase/alpha-L-arabinofuranosidase 1; 
AltName: Full=Xylan 1,4-beta-xylosidase/Alpha-L-arabinofuranosidase 
1; Short=MsXyl1; Includes: RecName: Full=Beta-xylosidase; 
AltName: Full=1,4-beta-D-xylan xylohydrolase; AltName: 
Full=Xylan 1,4-beta-xylosidase; Includes: RecName: Full=Alpha-L-arabinofuranosidase; 
Short=Arabinosidase; Flags: Precursor, 
partial [Medicago sativa subsp. x varia]
 gb|ABQ45227.1| beta-xylosidase/alpha-L-arabinosidase [Medicago sativa subsp. 
x varia]
Length=774

 Score =   230 bits (587),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 125/161 (78%), Gaps = 0/161 (0%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V  QT+ V+ACD  KN  + S  FC+  L V+ RV+DLVKRLTL EKI  L N+A  VSR
Sbjct  31   VYGQTSTVFACDVAKNTNVSSYGFCDNSLSVEDRVSDLVKRLTLQEKIGNLGNSAVEVSR  90

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP YEWWSEALHG+S  GPG +F+ +VP AT+FP P+LTAASFN +LF  IG V+S E
Sbjct  91   LGIPKYEWWSEALHGVSNIGPGTHFSSLVPGATNFPMPILTAASFNTSLFQAIGSVVSNE  150

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            ARAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  151  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLS  191



>ref|XP_002873418.1| beta-xylosidase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49677.1| beta-xylosidase 3 [Arabidopsis lyrata subsp. lyrata]
Length=780

 Score =   230 bits (586),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 126/160 (79%), Gaps = 0/160 (0%)
 Frame = +2

Query  116  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  295
             +Q++PV+ACD   NP L  L FCN  L++K+RV DLV RLTL EKI FL + A  VSRL
Sbjct  32   NAQSSPVFACDVTGNPSLAGLRFCNTGLNIKSRVTDLVGRLTLEEKIGFLGSNAIGVSRL  91

Query  296  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  475
            GIP Y+WWSEALHG+S  G G +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  92   GIPAYKWWSEALHGVSNVGGGSSFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEA  151

Query  476  RAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            RAM+N G A LT+WSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  152  RAMYNVGSAGLTFWSPNVNIFRDPRWGRGQETPGEDPELS  191



>ref|XP_010422951.1| PREDICTED: beta-D-xylosidase 3 isoform X2 [Camelina sativa]
Length=752

 Score =   229 bits (585),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = +2

Query  119  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  298
            +Q++PV+ACD   NP L +L FCN  L +K RV DLV RLTL EKI FL + A  VSRLG
Sbjct  48   AQSSPVFACDVTGNPSLAALGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSKAVGVSRLG  107

Query  299  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  478
            IP Y WWSEALHG+SY G G  F+G V  ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  108  IPAYNWWSEALHGVSYIGGGSGFSGQVHGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  167

Query  479  AMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            AM+N G A LT+WSPN+NIFRDPRWGRGQE PGEDPTL+
Sbjct  168  AMYNVGSAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLS  206



>gb|KHG02719.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Gossypium arboreum]
Length=776

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 127/165 (77%), Gaps = 3/165 (2%)
 Frame = +2

Query  101  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  280
            ++G V   +  V+ACD  K+  +    FCN  L    RVADLV+RLTL EKI  +VN AG
Sbjct  29   VVGQV---SQAVFACDATKDRKVVHYGFCNASLGRDARVADLVRRLTLQEKILNIVNGAG  85

Query  281  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  460
            N+SRLGIP YEWWSEALHG+S  GPG NF+ +VP ATSFPQ +LTAASFN +LF  IGKV
Sbjct  86   NISRLGIPKYEWWSEALHGVSNIGPGTNFSSLVPGATSFPQVILTAASFNTSLFEAIGKV  145

Query  461  ISTEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            +STEARAM+N GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  146  VSTEARAMYNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLS  190



>ref|XP_010422950.1| PREDICTED: beta-D-xylosidase 3 isoform X1 [Camelina sativa]
Length=794

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 124/160 (78%), Gaps = 0/160 (0%)
 Frame = +2

Query  116  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  295
             +Q++PV+ACD   NP L +L FCN  L +K RV DLV RLTL EKI FL + A  VSRL
Sbjct  47   NAQSSPVFACDVTGNPSLAALGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSKAVGVSRL  106

Query  296  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  475
            GIP Y WWSEALHG+SY G G  F+G V  ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  107  GIPAYNWWSEALHGVSYIGGGSGFSGQVHGATSFPQVILTAASFNVSLFQAIGKVVSTEA  166

Query  476  RAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            RAM+N G A LT+WSPN+NIFRDPRWGRGQE PGEDPTL+
Sbjct  167  RAMYNVGSAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLS  206



>gb|EYU18508.1| hypothetical protein MIMGU_mgv1a001685mg [Erythranthe guttata]
Length=770

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 124/157 (79%), Gaps = 1/157 (1%)
 Frame = +2

Query  131  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  310
            P +ACD  KNP LKS  FCN  LD+ TRVADLV +LTL EKI ++V+ +  V+RLGIP Y
Sbjct  33   PPFACDVSKNPDLKSFTFCNPSLDIDTRVADLVNKLTLKEKIGWVVSGSEGVTRLGIPGY  92

Query  311  EWWSEALHGLSYTGPGVNFT-GVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMH  487
            EWWSEALHG+   GPGV F    VPAATSFPQ +LTAASFN +LFH IGK +STEARAMH
Sbjct  93   EWWSEALHGIGSNGPGVVFDQNNVPAATSFPQVILTAASFNVSLFHLIGKAVSTEARAMH  152

Query  488  NYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            N G A LT+WSPN+NIFRDPRWGRGQE PGEDP L+G
Sbjct  153  NVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSG  189



>gb|EYU18507.1| hypothetical protein MIMGU_mgv1a001685mg [Erythranthe guttata]
Length=773

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 124/157 (79%), Gaps = 1/157 (1%)
 Frame = +2

Query  131  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  310
            P +ACD  KNP LKS  FCN  LD+ TRVADLV +LTL EKI ++V+ +  V+RLGIP Y
Sbjct  33   PPFACDVSKNPDLKSFTFCNPSLDIDTRVADLVNKLTLKEKIGWVVSGSEGVTRLGIPGY  92

Query  311  EWWSEALHGLSYTGPGVNFT-GVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMH  487
            EWWSEALHG+   GPGV F    VPAATSFPQ +LTAASFN +LFH IGK +STEARAMH
Sbjct  93   EWWSEALHGIGSNGPGVVFDQNNVPAATSFPQVILTAASFNVSLFHLIGKAVSTEARAMH  152

Query  488  NYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            N G A LT+WSPN+NIFRDPRWGRGQE PGEDP L+G
Sbjct  153  NVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSG  189



>ref|XP_010068200.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
Length=777

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 123/154 (80%), Gaps = 2/154 (1%)
 Frame = +2

Query  134  VYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYE  313
            V+ CD   +P L +  FCN    V+ RVADLVKRLTL EK+ FL N AG+V RLGIP Y+
Sbjct  43   VFPCD--GDPSLSTFGFCNMSWGVEARVADLVKRLTLQEKVGFLGNHAGSVDRLGIPEYQ  100

Query  314  WWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNY  493
            WWSEALHG+SY G G +F+ +VP ATSFPQ +LTAASFN TLF TIGKV+STEARAMHN 
Sbjct  101  WWSEALHGVSYIGGGTSFSSLVPGATSFPQVILTAASFNATLFETIGKVVSTEARAMHNV  160

Query  494  GLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  161  GLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLS  194



>ref|XP_010491610.1| PREDICTED: beta-D-xylosidase 3-like isoform X1 [Camelina sativa]
Length=779

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = +2

Query  116  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  295
             +Q++PV+ACD   NP L  L FCN  L +K RV DLV RLTL EKI FL + A  VSRL
Sbjct  32   NAQSSPVFACDVTGNPSLAVLGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSRAVGVSRL  91

Query  296  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  475
            GIP Y WWSEALHG+SY G G  F+G V  ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  92   GIPDYNWWSEALHGVSYIGGGSGFSGQVRGATSFPQVILTAASFNVSLFQAIGKVVSTEA  151

Query  476  RAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            RAM+N G A LT+WSPN+NIFRDPRWGRGQE PGEDPTL+
Sbjct  152  RAMYNVGSAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLS  191



>ref|XP_010491609.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=780

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 125/162 (77%), Gaps = 0/162 (0%)
 Frame = +2

Query  110  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  289
            P  +Q+ P +AC+   N  L    FCN ++ +++RVADLV RLTL EKI FL ++    S
Sbjct  28   PSNAQSLPAFACNVAGNNSLAGFGFCNTKIKIESRVADLVGRLTLQEKIKFLGSSGNGAS  87

Query  290  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  469
            RLGIPTYEWW+EALHG+S+ GP   F+ +VP+AT FPQ +LTAASFN +LF  IGK +ST
Sbjct  88   RLGIPTYEWWAEALHGVSFIGPATRFSKLVPSATCFPQVILTAASFNVSLFKAIGKAVST  147

Query  470  EARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            EARAM+N GLA LTYWSPN+NIFRDPRWGRGQE PGEDPTL+
Sbjct  148  EARAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLS  189



>ref|XP_010491611.1| PREDICTED: beta-D-xylosidase 3-like isoform X2 [Camelina sativa]
Length=765

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = +2

Query  116  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  295
             +Q++PV+ACD   NP L  L FCN  L +K RV DLV RLTL EKI FL + A  VSRL
Sbjct  32   NAQSSPVFACDVTGNPSLAVLGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSRAVGVSRL  91

Query  296  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  475
            GIP Y WWSEALHG+SY G G  F+G V  ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  92   GIPDYNWWSEALHGVSYIGGGSGFSGQVRGATSFPQVILTAASFNVSLFQAIGKVVSTEA  151

Query  476  RAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            RAM+N G A LT+WSPN+NIFRDPRWGRGQE PGEDPTL+
Sbjct  152  RAMYNVGSAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLS  191



>emb|CDY01780.1| BnaC06g28200D [Brassica napus]
Length=776

 Score =   228 bits (581),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 121/157 (77%), Gaps = 0/157 (0%)
 Frame = +2

Query  125  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  304
            ++P +ACD  +NP L    FCN  L  + RV DLV RLTL EKI FLV+ A  VSRLGIP
Sbjct  36   SSPEFACDITRNPSLAGYGFCNTGLKAEARVTDLVGRLTLEEKIGFLVSKATGVSRLGIP  95

Query  305  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAM  484
             Y WWSEALHG+S  G G NFTG VP ATSFPQ +LTAASFN +LF  IGKV+STEARAM
Sbjct  96   DYNWWSEALHGVSDVGGGSNFTGPVPGATSFPQVILTAASFNLSLFQAIGKVVSTEARAM  155

Query  485  HNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            +N G A LT+WSPN+NIFRDPRWGRGQE PGEDPTLT
Sbjct  156  YNVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLT  192



>emb|CDY21595.1| BnaC09g46970D [Brassica napus]
Length=942

 Score =   228 bits (582),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 125/165 (76%), Gaps = 1/165 (1%)
 Frame = +2

Query  101  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  277
            I  P  +Q++ P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI FLV+ A
Sbjct  27   ISKPSNAQSSSPKFACDVTKNPSLTGYGFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKA  86

Query  278  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  457
              VSRLGIP Y WWSEALHG+S  G G NFTG VP ATSFPQ +LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGGGSNFTGPVPGATSFPQVILTAASFNVSLFQAIGK  146

Query  458  VISTEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            V+STEARAM+N G A LT+WSPN+NIFRDPRWGRGQE PGEDPTL
Sbjct  147  VVSTEARAMYNVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTL  191



>ref|XP_003524073.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Glycine max]
Length=613

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 124/161 (77%), Gaps = 3/161 (2%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V+ QT   +ACD  K+P +    FC++ L V+ RV DLV RLTL EKI  LVN+AG+VSR
Sbjct  25   VRGQT---FACDVGKSPAVAGYGFCDKSLGVEARVKDLVGRLTLQEKIGNLVNSAGDVSR  81

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGIP YEWWSEALHG+S  G G  F+ VVP ATSFP P+LTAASFN +LF  IG+V+STE
Sbjct  82   LGIPRYEWWSEALHGVSNVGLGTRFSNVVPGATSFPMPILTAASFNTSLFEVIGRVVSTE  141

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            A AM+N GLA LTYWSPN+NIFRDPRWGRG E PGEDP LT
Sbjct  142  AGAMYNVGLAGLTYWSPNINIFRDPRWGRGLETPGEDPVLT  182



>ref|XP_003531047.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Glycine max]
Length=765

 Score =   226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 121/153 (79%), Gaps = 0/153 (0%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD  K+P +    FC++ L V+ RV DLV RLTL EKI  LVN+A +VSRLGIP YEW
Sbjct  30   FACDVGKSPAVAGYGFCDKSLGVEARVKDLVGRLTLQEKIGNLVNSAVDVSRLGIPKYEW  89

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG  F+ V+P ATSFP P+LTAASFN +LF  IG+V+STEARAM+N G
Sbjct  90   WSEALHGVSNVGPGTRFSNVIPGATSFPMPILTAASFNTSLFEVIGRVVSTEARAMYNVG  149

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            LA LTYWSPN+NIFRDPRWGRG E PGEDP LT
Sbjct  150  LAGLTYWSPNINIFRDPRWGRGLETPGEDPVLT  182



>emb|CDX97115.1| BnaC09g45100D [Brassica napus]
Length=695

 Score =   225 bits (573),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 124/165 (75%), Gaps = 1/165 (1%)
 Frame = +2

Query  101  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  277
            I  P  +Q++ P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI FLV+ A
Sbjct  27   ITKPSNAQSSSPKFACDVTKNPSLAGYGFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKA  86

Query  278  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  457
              VSRLGIP Y WWSEALHG+S  G G +F G VP ATSFPQ +LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGDGSSFKGPVPGATSFPQVILTAASFNVSLFQAIGK  146

Query  458  VISTEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            V+STEARAM+N G A LT+WSPN+NIFRDPRWGRGQE PGEDPTL
Sbjct  147  VVSTEARAMYNVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTL  191



>ref|XP_009105246.1| PREDICTED: beta-D-xylosidase 3-like [Brassica rapa]
Length=774

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 125/165 (76%), Gaps = 1/165 (1%)
 Frame = +2

Query  101  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  277
            I  P  +Q++ PV+ACD + NP L    FCN  L  + RV DLV RLTL EKI FLV+ +
Sbjct  27   ISKPSNAQSSSPVFACDVITNPSLAGYGFCNTGLKAEARVTDLVGRLTLVEKIGFLVSKS  86

Query  278  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  457
              VSRLGIP Y WWSEALHG+S  G G +FTG+VP ATSFPQ  LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGGGSSFTGLVPGATSFPQVKLTAASFNASLFQAIGK  146

Query  458  VISTEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            V+STEARAM+N G A LT+WSPN+NIFRDPRWGRGQE PGEDPTL
Sbjct  147  VVSTEARAMYNVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTL  191



>emb|CDX96113.1| BnaA07g26180D [Brassica napus]
Length=1013

 Score =   227 bits (579),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 126/165 (76%), Gaps = 1/165 (1%)
 Frame = +2

Query  101  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  277
            I  P  +Q++ PV+ACD + NP L    FCN  L  + RV DLV RLTL EKI FLV+ +
Sbjct  27   ISKPSNAQSSSPVFACDVITNPSLAGYGFCNTGLKAEARVTDLVGRLTLVEKIGFLVSKS  86

Query  278  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  457
              VSRLGIP Y WWSEALHG+S  G G +FTG+VP ATSFPQ +LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGGGSSFTGLVPGATSFPQVILTAASFNVSLFQAIGK  146

Query  458  VISTEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            V+STEARAM+N G A LT+WSPN+NIFRDPRWGRGQE PGEDPTL
Sbjct  147  VVSTEARAMYNVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTL  191



>dbj|BAJ90420.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96778.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08165.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=775

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 123/162 (76%), Gaps = 2/162 (1%)
 Frame = +2

Query  107  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  286
            G  ++Q APV+ACD   N  L +  FCN++     R  DLV RLTL EK+ FLVN    +
Sbjct  28   GTAEAQ-APVFACD-ASNATLAAYGFCNRKATASARARDLVSRLTLAEKVGFLVNKQPAL  85

Query  287  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  466
             RLGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+S
Sbjct  86   GRLGIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVS  145

Query  467  TEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            TEARAMHN GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  146  TEARAMHNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLL  187



>dbj|BAJ90315.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=775

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 123/162 (76%), Gaps = 2/162 (1%)
 Frame = +2

Query  107  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  286
            G  ++Q APV+ACD   N  L +  FCN++     R  DLV RLTL EK+ FLVN    +
Sbjct  28   GTAEAQ-APVFACD-ASNATLAAYGFCNRKATASARARDLVSRLTLAEKVGFLVNKQPAL  85

Query  287  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  466
             RLGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+S
Sbjct  86   GRLGIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVS  145

Query  467  TEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            TEARAMHN GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  146  TEARAMHNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLL  187



>emb|CDY35825.1| BnaC09g37570D [Brassica napus]
Length=774

 Score =   225 bits (574),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 124/165 (75%), Gaps = 1/165 (1%)
 Frame = +2

Query  101  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  277
            I  P  +Q++ P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI FLV+ A
Sbjct  27   ISKPSNAQSSSPKFACDVTKNPSLAGYGFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKA  86

Query  278  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  457
              VSRLGIP Y WWSEALHG+S  G G +F G VP ATSFPQ +LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGDGSSFKGPVPGATSFPQVILTAASFNVSLFQAIGK  146

Query  458  VISTEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            V+STEARAM+N G A LT+WSPN+NIFRDPRWGRGQE PGEDPTL
Sbjct  147  VVSTEARAMYNVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTL  191



>emb|CDX69892.1| BnaA10g22410D [Brassica napus]
Length=774

 Score =   225 bits (573),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 124/165 (75%), Gaps = 1/165 (1%)
 Frame = +2

Query  101  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  277
            I  P  +Q++ P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI FLV+ A
Sbjct  27   ISKPSNAQSSSPKFACDVTKNPSLAGYGFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKA  86

Query  278  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  457
              VSRLGIP Y WWSEALHG+S  G G +F G VP ATSFPQ +LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGDGSSFKGPVPGATSFPQVILTAASFNVSLFQAIGK  146

Query  458  VISTEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            V+STEARAM+N G A LT+WSPN+NIFRDPRWGRGQE PGEDPTL
Sbjct  147  VVSTEARAMYNVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTL  191



>ref|XP_010424711.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=780

 Score =   224 bits (571),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = +2

Query  131  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  310
            P +AC+   N  L    FCN +L ++ RVADLV RLTL EK+ FL ++    SRLGIPTY
Sbjct  35   PAFACNVAGNNSLARFGFCNTKLKIERRVADLVGRLTLQEKVRFLGSSGNGASRLGIPTY  94

Query  311  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  490
            EWW+EALHG+S+ GP   FT +VP+AT FPQ +LTAASFN +LF  IGK +STEARAM+N
Sbjct  95   EWWAEALHGVSFIGPATRFTKLVPSATCFPQVILTAASFNVSLFKAIGKAVSTEARAMYN  154

Query  491  YGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
             GLA LTYWSPN+NIFRDPRWGRGQE PGEDPTL+
Sbjct  155  VGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLS  189



>ref|XP_009122535.1| PREDICTED: beta-D-xylosidase 3-like [Brassica rapa]
Length=774

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 120/156 (77%), Gaps = 0/156 (0%)
 Frame = +2

Query  125  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  304
            ++P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI FLV+ A  VSRLGIP
Sbjct  36   SSPKFACDDTKNPSLAGYRFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKATGVSRLGIP  95

Query  305  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAM  484
             Y WWSEALHG+S  G G +F G VP ATSFPQ +LTAASFN +LF  IGKV+STEARAM
Sbjct  96   DYNWWSEALHGVSDVGDGSSFKGPVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAM  155

Query  485  HNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            +N G A LT+W+PN+NIFRDPRWGRGQE PGEDPTL
Sbjct  156  YNVGAAGLTFWAPNVNIFRDPRWGRGQETPGEDPTL  191



>gb|AAK38481.1| alpha-L-arabinofuranosidase/beta-D-xylosidase isoenzyme ARA-I 
[Hordeum vulgare]
Length=777

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 118/154 (77%), Gaps = 1/154 (1%)
 Frame = +2

Query  131  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  310
            PV+ACD   N  L +  FCN++     R  DLV RLTL EK+ FLVN    + RLGIP Y
Sbjct  37   PVFACD-ASNATLAAYGFCNRKATASARARDLVSRLTLAEKVGFLVNKQPALGRLGIPAY  95

Query  311  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  490
            EWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+STEARAMHN
Sbjct  96   EWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVSTEARAMHN  155

Query  491  YGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
             GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  156  VGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLL  189



>gb|AFW59619.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=451

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 121/160 (76%), Gaps = 2/160 (1%)
 Frame = +2

Query  116  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  295
            ++QT P +ACD   N  L S  FCN+      R ADLV RLTL EK+ FLV+    + RL
Sbjct  34   RAQT-PAFACD-ASNATLASYGFCNRSAAAAARAADLVSRLTLAEKVGFLVDKQAALPRL  91

Query  296  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  475
            G+P YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN TLF  IG+V+S EA
Sbjct  92   GVPLYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNATLFRAIGEVVSNEA  151

Query  476  RAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            RAMHN GLA LT+WSPN+NIFRDPRWGRGQE PGEDP LT
Sbjct  152  RAMHNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLT  191



>ref|XP_002448619.1| hypothetical protein SORBIDRAFT_06g030270 [Sorghum bicolor]
 gb|EES12947.1| hypothetical protein SORBIDRAFT_06g030270 [Sorghum bicolor]
Length=767

 Score =   221 bits (564),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 123/160 (77%), Gaps = 2/160 (1%)
 Frame = +2

Query  116  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  295
            ++QT PV+ACD   N  L S  FCN+      R ADLV RLTL EK+ FLV+    + RL
Sbjct  28   RAQT-PVFACDA-SNATLASYGFCNRSASASARAADLVSRLTLAEKVGFLVDKQAALPRL  85

Query  296  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  475
            GIP YEWWSEALHG+SY GPG  F+ +VPAATSFPQP+LTAASFN TLF  IG+V+S EA
Sbjct  86   GIPLYEWWSEALHGVSYVGPGTRFSSLVPAATSFPQPILTAASFNATLFRAIGEVVSNEA  145

Query  476  RAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            RAMHN GLA LT+WSPN+NIFRDPRWGRGQE PGEDP LT
Sbjct  146  RAMHNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLT  185



>gb|EYU44008.1| hypothetical protein MIMGU_mgv1a0207571mg, partial [Erythranthe 
guttata]
Length=203

 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 115/152 (76%), Gaps = 1/152 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD   N   K++PFC   L ++ RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  33   FACDP-SNSVSKNMPFCRVSLHIRDRVGDLIGRLTLQEKIRSLVNNAAPVDRLGIKGYEW  91

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S TGPGV F G  P ATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  92   WSEALHGVSNTGPGVKFGGEFPGATSFPQVITTAASFNSSLWEAIGQVVSDEARAMYNGG  151

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            +A LTYWSPN+NIFRDPRWGRGQE PGEDPTL
Sbjct  152  VAGLTYWSPNVNIFRDPRWGRGQETPGEDPTL  183



>ref|NP_001054038.1| Os04g0640700 [Oryza sativa Japonica Group]
 emb|CAE02971.2| OSJNBb0079B02.3 [Oryza sativa Japonica Group]
 dbj|BAF15952.1| Os04g0640700 [Oryza sativa Japonica Group]
 emb|CAH67823.1| OSIGBa0138H21-OSIGBa0138E01.14 [Oryza sativa Indica Group]
 gb|EEC78109.1| hypothetical protein OsI_17615 [Oryza sativa Indica Group]
Length=765

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 121/159 (76%), Gaps = 2/159 (1%)
 Frame = +2

Query  116  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  295
            ++QT PV+ACD   N  +    FC++      R ADL+ RLTL EK+ FLVN    + RL
Sbjct  25   RAQT-PVFACDA-SNATVSGYGFCDRTKSSAARAADLLGRLTLAEKVGFLVNKQAALPRL  82

Query  296  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  475
            GIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+STEA
Sbjct  83   GIPAYEWWSEALHGVSYVGPGTRFSTLVPGATSFPQPILTAASFNASLFRAIGEVVSTEA  142

Query  476  RAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            RAMHN GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  143  RAMHNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLL  181



>ref|XP_004976989.1| PREDICTED: beta-D-xylosidase 4-like isoform X2 [Setaria italica]
Length=770

 Score =   220 bits (561),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 117/155 (75%), Gaps = 1/155 (1%)
 Frame = +2

Query  131  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  310
            PV+ACD   N  L +  FCN+      R ADLV RL L EK+ FLV+    + RLGIP Y
Sbjct  33   PVFACDA-SNATLAAYGFCNRSATPAARAADLVSRLKLAEKVGFLVDKQAALPRLGIPAY  91

Query  311  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  490
            EWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN TLF  IG+V+S EARAMHN
Sbjct  92   EWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNVTLFRAIGEVVSNEARAMHN  151

Query  491  YGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
             GLA LT+WSPN+NIFRDPRWGRGQE PGEDP LT
Sbjct  152  VGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLT  186



>gb|KHG24361.1| Beta-D-xylosidase 1 -like protein [Gossypium arboreum]
Length=244

 Score =   206 bits (525),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 116/157 (74%), Gaps = 1/157 (1%)
 Frame = +2

Query  131  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  310
            P +ACD  +N   +SL FC   L +  RV DL+ RLTLPEKI  LVN A +V RLGI  Y
Sbjct  30   PPFACDP-RNGLTRSLRFCRTNLPIHVRVRDLLGRLTLPEKIRLLVNNAIDVPRLGIRGY  88

Query  311  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  490
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+S EARAM+N
Sbjct  89   EWWSEALHGVSNVGPGTKFGGSFPGATSFPQVITTAASFNESLWERIGQVVSDEARAMYN  148

Query  491  YGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGS  601
             G+A LTYWSPN+NIFRDPRWGRGQE PGEDP L G 
Sbjct  149  GGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGK  185



>gb|EYU18509.1| hypothetical protein MIMGU_mgv1a001665mg [Erythranthe guttata]
Length=777

 Score =   218 bits (555),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 125/166 (75%), Gaps = 2/166 (1%)
 Frame = +2

Query  104  IGPVQSQTAPV-YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  280
            I PV S   P  +ACD  KNP L+S  FCN  LD++TRVADLV +LTL EKI ++++ + 
Sbjct  27   ITPVFSAGKPGPFACDVSKNPDLESFTFCNPSLDIETRVADLVNKLTLKEKIGWVISGSE  86

Query  281  NVSRLGIPTYEWWSEALHGLSYTGPGVNFT-GVVPAATSFPQPLLTAASFNETLFHTIGK  457
             VSRLGIP Y WWSEALHG+   GPG  F    V AATSFPQ +LTAASFN +LFH IGK
Sbjct  87   GVSRLGIPGYWWWSEALHGIGSNGPGSKFEPDNVRAATSFPQVILTAASFNVSLFHLIGK  146

Query  458  VISTEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
             ISTEARAMHN G A LT+WSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  147  AISTEARAMHNVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLS  192



>ref|XP_004976988.1| PREDICTED: beta-D-xylosidase 4-like isoform X1 [Setaria italica]
Length=833

 Score =   218 bits (555),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 117/155 (75%), Gaps = 1/155 (1%)
 Frame = +2

Query  131  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  310
            PV+ACD   N  L +  FCN+      R ADLV RL L EK+ FLV+    + RLGIP Y
Sbjct  33   PVFACDA-SNATLAAYGFCNRSATPAARAADLVSRLKLAEKVGFLVDKQAALPRLGIPAY  91

Query  311  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  490
            EWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN TLF  IG+V+S EARAMHN
Sbjct  92   EWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNVTLFRAIGEVVSNEARAMHN  151

Query  491  YGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
             GLA LT+WSPN+NIFRDPRWGRGQE PGEDP LT
Sbjct  152  VGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLT  186



>ref|XP_008661822.1| PREDICTED: uncharacterized protein LOC100279996 isoform X1 [Zea 
mays]
 gb|AFW59620.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=773

 Score =   217 bits (552),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 121/160 (76%), Gaps = 2/160 (1%)
 Frame = +2

Query  116  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  295
            ++QT P +ACD   N  L S  FCN+      R ADLV RLTL EK+ FLV+    + RL
Sbjct  34   RAQT-PAFACD-ASNATLASYGFCNRSAAAAARAADLVSRLTLAEKVGFLVDKQAALPRL  91

Query  296  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  475
            G+P YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN TLF  IG+V+S EA
Sbjct  92   GVPLYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNATLFRAIGEVVSNEA  151

Query  476  RAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
            RAMHN GLA LT+WSPN+NIFRDPRWGRGQE PGEDP LT
Sbjct  152  RAMHNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLT  191



>ref|XP_006855294.1| hypothetical protein AMTR_s00057p00049120 [Amborella trichopoda]
 gb|ERN16761.1| hypothetical protein AMTR_s00057p00049120 [Amborella trichopoda]
Length=768

 Score =   216 bits (551),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 122/163 (75%), Gaps = 4/163 (2%)
 Frame = +2

Query  110  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  289
            P   +  P +ACD      + S PFC++ L +  RV+DL++RLTLPEK   LVN A  ++
Sbjct  20   PAIVEPGPSFACDGQ----MGSFPFCDRSLPINARVSDLIRRLTLPEKTRLLVNNAEGLA  75

Query  290  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  469
            RLG+P YEWWSEALHG+S  GPG  F G VP ATSFPQ +LTAASFN +L+  IG+ +ST
Sbjct  76   RLGVPHYEWWSEALHGVSNVGPGTRFGGNVPGATSFPQVILTAASFNSSLWEEIGQAVST  135

Query  470  EARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            EARAM+N GLA LT+WSPN+NIFRDPRWGRGQE PGEDPT+ G
Sbjct  136  EARAMYNEGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPTVVG  178



>ref|XP_010657638.1| PREDICTED: beta-D-xylosidase 4-like [Vitis vinifera]
Length=242

 Score =   204 bits (519),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +2

Query  215  VADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATS  394
            VADLVKRLTL EKI FLVN+A  VSRLGIP YEWWS+ALHG+SY GPG +F  VVP ATS
Sbjct  71   VADLVKRLTLEEKIGFLVNSAARVSRLGIPKYEWWSQALHGVSYVGPGTHFNSVVPGATS  130

Query  395  FPQPLLTAASFNETLFHTIGKVISTEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVP  574
            FPQ +L AASF  +LF  IGKV+STEARAM+N GLA LT+WSPN+NIF+DPRWGRGQE P
Sbjct  131  FPQVILPAASFYASLFEAIGKVVSTEARAMYNVGLAGLTFWSPNVNIFQDPRWGRGQETP  190

Query  575  GEDPTLT  595
            GEDP L+
Sbjct  191  GEDPLLS  197



>ref|XP_002974833.1| hypothetical protein SELMODRAFT_101733 [Selaginella moellendorffii]
 gb|EFJ24353.1| hypothetical protein SELMODRAFT_101733 [Selaginella moellendorffii]
Length=784

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 124/165 (75%), Gaps = 2/165 (1%)
 Frame = +2

Query  101  IIGPVQSQTAPV-YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  277
            I+   ++ TA + YACD   N  L S PFC+ +L +  RV DLV RLTL EK+  +VN A
Sbjct  23   ILSNARASTAQLRYACDVSSNASLGSFPFCDTKLGIDVRVQDLVSRLTLDEKVDEMVNAA  82

Query  278  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  457
              + RLG+P+Y+WW EALHG++ + PGV F G+ PAATSFP P+ TAASFN TLF++IG+
Sbjct  83   QGIPRLGVPSYQWWQEALHGVA-SSPGVQFGGLAPAATSFPMPIATAASFNSTLFYSIGE  141

Query  458  VISTEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
             +S+EARA+HN G A LT+WSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  142  AVSSEARALHNLGRAGLTFWSPNVNIFRDPRWGRGQETPGEDPLL  186



>ref|XP_006653810.1| PREDICTED: beta-D-xylosidase 4-like [Oryza brachyantha]
Length=776

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 119/162 (73%), Gaps = 1/162 (1%)
 Frame = +2

Query  107  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  286
            G V     PV+ACD   N  +    FC++      R ADL+ RLTL EK+ FLVN    +
Sbjct  25   GNVARAQTPVFACDA-SNATVAGYGFCDRSKSAAARAADLLGRLTLAEKVGFLVNKQAAL  83

Query  287  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  466
             RLGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+S
Sbjct  84   PRLGIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVS  143

Query  467  TEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            TEARAMHN GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  144  TEARAMHNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLL  185



>ref|XP_002963750.1| hypothetical protein SELMODRAFT_80102 [Selaginella moellendorffii]
 gb|EFJ35621.1| hypothetical protein SELMODRAFT_80102 [Selaginella moellendorffii]
Length=785

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 118/158 (75%), Gaps = 1/158 (1%)
 Frame = +2

Query  119  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  298
            S   P YACD   N  L S PFC+ +L V  RV DLV RLTL EK+  +VN A  + RLG
Sbjct  31   STAQPRYACDVSSNASLGSFPFCDTKLGVDVRVQDLVSRLTLDEKVDEMVNAAQGIPRLG  90

Query  299  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  478
            +P+Y+WW EALHG++ + PGV F G+ PAATSFP P+  AASFN TLF++IG+ +S+EAR
Sbjct  91   VPSYQWWQEALHGVA-SSPGVQFGGLAPAATSFPMPIAMAASFNSTLFYSIGEAVSSEAR  149

Query  479  AMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            A+HN G A LT+WSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  150  ALHNLGRAGLTFWSPNVNIFRDPRWGRGQETPGEDPLL  187



>emb|CDP18762.1| unnamed protein product [Coffea canephora]
Length=506

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 121/163 (74%), Gaps = 6/163 (4%)
 Frame = +2

Query  122  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  301
            +  P YAC +       +  F    LDVKTRV DL+K+L+L EKI  LV+ A  VSRL I
Sbjct  15   RITPAYACAS------GNYTFYYTSLDVKTRVDDLIKKLSLQEKIGNLVDGAAGVSRLRI  68

Query  302  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARA  481
            P YEWWSE LHG+S TGPGV+FT +VP ATSFPQ +LTAASFN++LF   GKV+STEARA
Sbjct  69   PIYEWWSEILHGVSNTGPGVHFTSLVPGATSFPQVILTAASFNQSLFEINGKVVSTEARA  128

Query  482  MHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGSMLQ  610
            M+N GL  LT WSPN+NIFRDP+WGR QE PGEDPTLT  ML+
Sbjct  129  MYNVGLGGLTNWSPNVNIFRDPKWGRSQETPGEDPTLTSIMLE  171



>ref|XP_002515300.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF47284.1| Beta-glucosidase, putative [Ricinus communis]
Length=768

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 116/154 (75%), Gaps = 1/154 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD+ K+   K+LPFC  +L ++ RV DL+ RLTL EK+  LVN AG VSRLGI  YEW
Sbjct  28   FACDS-KDGTTKNLPFCQVKLPIQDRVKDLIGRLTLAEKVGLLVNNAGAVSRLGIKGYEW  86

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S EARAM+N G
Sbjct  87   WSEALHGVSNVGPGTKFGGSFPGATSFPQVITTAASFNSTLWEAIGRVVSDEARAMYNGG  146

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
             A LTYWSPN+NI RDPRWGRGQE PGEDP L G
Sbjct  147  AAGLTYWSPNVNILRDPRWGRGQETPGEDPLLVG  180



>ref|XP_003580652.1| PREDICTED: beta-D-xylosidase 4-like [Brachypodium distachyon]
Length=774

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 121/159 (76%), Gaps = 2/159 (1%)
 Frame = +2

Query  116  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  295
            ++QT PV+ACD   N  +    FC++      R ADLV RLTL +K+ FLVN    ++RL
Sbjct  32   RAQT-PVFACDAA-NSTVAGYAFCDRAKSASARAADLVSRLTLADKVGFLVNKQPALARL  89

Query  296  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  475
            GIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+S EA
Sbjct  90   GIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVSNEA  149

Query  476  RAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            RAMHN GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  150  RAMHNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLL  188



>ref|XP_004170761.1| PREDICTED: beta-D-xylosidase 1-like [Cucumis sativus]
Length=241

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 112/151 (74%), Gaps = 1/151 (1%)
 Frame = +2

Query  143  CDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEWWS  322
            CD  +N G +++ FC + L ++ RV DL+ RLTL EKI  LVN A  V RLGI  YEWWS
Sbjct  34   CDK-RNVGTRNMGFCQESLGIEERVKDLIGRLTLGEKIRLLVNNAIAVPRLGIRGYEWWS  92

Query  323  EALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYGLA  502
            EALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N G A
Sbjct  93   EALHGVSNVGPGTKFGGTFPGATSFPQVITTAASFNQSLWLLIGRVVSDEARAMYNGGTA  152

Query  503  ALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
             LTYWSPN+NIFRDPRWGRGQE PGEDP L 
Sbjct  153  GLTYWSPNVNIFRDPRWGRGQETPGEDPILA  183



>ref|XP_003625957.1| Beta-xylosidase [Medicago truncatula]
 gb|AES82175.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Medicago truncatula]
Length=771

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 117/154 (76%), Gaps = 1/154 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD  K+   K+LPFCN +L +  RV DL+ RLT+ EK+  LVN A  V R+G+ +YEW
Sbjct  28   FACDA-KDAATKNLPFCNVKLAIPERVKDLIGRLTMQEKVNLLVNNAPAVPRVGMKSYEW  86

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG  F GV PAATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  87   WSEALHGVSNVGPGTRFGGVFPAATSFPQVITTAASFNASLWEAIGRVVSDEARAMYNGG  146

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
             A LTYWSPN+NIFRDPRWGRGQE PGEDP L G
Sbjct  147  AAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAG  180



>gb|KJB38536.1| hypothetical protein B456_006G259500 [Gossypium raimondii]
Length=589

 Score =   209 bits (532),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 116/156 (74%), Gaps = 1/156 (1%)
 Frame = +2

Query  131  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  310
            P +ACD  +N   +SL FC   L +  RV DL+ RLTLPEKI  LVN A +V RLGI  Y
Sbjct  31   PPFACDP-RNGLTRSLRFCRTNLPIHVRVRDLLGRLTLPEKIRLLVNNAIDVPRLGIRGY  89

Query  311  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  490
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+S EARAM+N
Sbjct  90   EWWSEALHGVSNVGPGTKFGGSFPGATSFPQVITTAASFNESLWERIGQVVSDEARAMYN  149

Query  491  YGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
             G+A LTYWSPN+NIFRDPRWGRGQE PGEDP L G
Sbjct  150  GGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAG  185



>gb|KDO87027.1| hypothetical protein CISIN_1g0041902mg, partial [Citrus sinensis]
 gb|KDO87028.1| hypothetical protein CISIN_1g0041902mg, partial [Citrus sinensis]
Length=226

 Score =   199 bits (506),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 113/154 (73%), Gaps = 1/154 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD  K+   ++LPFC   L +  RV DL+ RL+L EK+  L++ A  V RLGI  YEW
Sbjct  28   FACDP-KDATTRTLPFCQVSLPIPQRVNDLIGRLSLQEKVKLLISGAAAVPRLGIKGYEW  86

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG  F G  P ATSFPQ + TA+SFN TL+  IG+V+S EARAM+N G
Sbjct  87   WSEALHGVSNVGPGTKFGGDFPGATSFPQVITTASSFNATLWEAIGRVVSDEARAMYNGG  146

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
             A LTYWSPN+NIFRDPRWGRGQE PGEDP L+G
Sbjct  147  TAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLSG  180



>ref|XP_010113184.1| putative beta-D-xylosidase 5 [Morus notabilis]
 gb|EXC72717.1| putative beta-D-xylosidase 5 [Morus notabilis]
Length=293

 Score =   201 bits (510),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 115/161 (71%), Gaps = 3/161 (2%)
 Frame = +2

Query  104  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  283
            I P+ +Q    +ACD    P     PFC+  L    R  D++ RLTL EK+  LV+ +  
Sbjct  20   ILPIATQK---HACDVTSFPQASQFPFCDTSLSYDIRAKDIISRLTLQEKVQQLVSGSAG  76

Query  284  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  463
            +SRLG+P+YEWWSEALHG+S  GPG  F   VP ATSFP  +L+AA+FN +L++ +G+ +
Sbjct  77   ISRLGVPSYEWWSEALHGVSNVGPGTTFNATVPGATSFPAVILSAAAFNASLWYKMGQAV  136

Query  464  STEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDP  586
            STEARAM+N GLA LTYWSPN+N+FRDPRWGRGQE PGEDP
Sbjct  137  STEARAMYNAGLAGLTYWSPNVNVFRDPRWGRGQETPGEDP  177



>gb|KDP44489.1| hypothetical protein JCGZ_16322 [Jatropha curcas]
Length=796

 Score =   211 bits (536),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 113/150 (75%), Gaps = 1/150 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            YACD  KNP      FCN  L  + R  DL+ RLTL EK+  LVN A  +SRLGIP YEW
Sbjct  27   YACDQ-KNPETSQYAFCNTTLPYQDRAKDLISRLTLQEKVQQLVNHAAGISRLGIPAYEW  85

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  G GV+F   VP ATSFP  +L+AASFNETL+  +G+V+STEARAMHN G
Sbjct  86   WSEALHGVSNVGYGVHFNETVPGATSFPAVILSAASFNETLWLKMGQVVSTEARAMHNVG  145

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDP  586
            LA LTYWSPN+N+FRDPRWGRGQE PGEDP
Sbjct  146  LAGLTYWSPNVNVFRDPRWGRGQETPGEDP  175



>gb|KHN30647.1| Putative beta-D-xylosidase 2 [Glycine soja]
Length=582

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 111/154 (72%), Gaps = 1/154 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD  KN   K+LPFC   L    RV DL+ RLTL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KNTATKNLPFCKAWLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEW  85

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+  IG+V S EARAM+N G
Sbjct  86   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGRVASDEARAMYNGG  145

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
             A LTYWSPN+NIFRDPRWGRGQE PGEDP L G
Sbjct  146  TAGLTYWSPNVNIFRDPRWGRGQETPGEDPILAG  179



>gb|KDP28242.1| hypothetical protein JCGZ_14013 [Jatropha curcas]
Length=772

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 115/154 (75%), Gaps = 1/154 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD  K    ++LPFC  +L ++ RV DL+ RLTL EK+  LVN A +VSRLGI  YEW
Sbjct  30   FACDP-KEETTRNLPFCQVKLPIQDRVKDLIGRLTLQEKVVLLVNNAASVSRLGIKGYEW  88

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S EARAM+N G
Sbjct  89   WSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNATLWEAIGRVVSDEARAMYNGG  148

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            +  LTYWSPN+NIFRDPRWGRGQE PGEDP + G
Sbjct  149  MGGLTYWSPNVNIFRDPRWGRGQETPGEDPLVVG  182



>ref|XP_002885319.1| beta-1,4-xylosidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61578.1| beta-1,4-xylosidase [Arabidopsis lyrata subsp. lyrata]
Length=865

 Score =   210 bits (534),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 112/150 (75%), Gaps = 1/150 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD   +P      FCN  L  + R  DLV RL+L EK+  LVN A  VSRLG+P YEW
Sbjct  27   FACDR-NDPATAKYGFCNVSLSYEARAKDLVSRLSLKEKVQQLVNKATGVSRLGVPPYEW  85

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPGV F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN G
Sbjct  86   WSEALHGVSDVGPGVRFNGTVPGATSFPATILTAASFNTSLWLKMGEVVSTEARAMHNVG  145

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDP  586
            LA LTYWSPN+NIFRDPRWGRGQE PGEDP
Sbjct  146  LAGLTYWSPNVNIFRDPRWGRGQETPGEDP  175



>gb|KJB77632.1| hypothetical protein B456_012G147500 [Gossypium raimondii]
Length=788

 Score =   209 bits (532),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 119/164 (73%), Gaps = 2/164 (1%)
 Frame = +2

Query  101  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  280
            ++ P  +Q  P +ACD   +P     PFC+  L  + R  DLV RLTL EK+  LVNTA 
Sbjct  18   VLVPYNTQAQP-FACDK-NDPNTSKFPFCDTTLSYQDRTKDLVSRLTLQEKVQQLVNTAS  75

Query  281  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  460
             + RLG+P Y+WWSEALHG+S  GPG  F   VP ATSFP  +L+AASFNE L+  +G+V
Sbjct  76   GIPRLGVPAYQWWSEALHGVSDLGPGTRFNATVPGATSFPAVILSAASFNEMLWLEMGRV  135

Query  461  ISTEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            +STEARAM+N GLA LTYWSPN+N+FRDPRWGRGQE PGEDPT+
Sbjct  136  VSTEARAMYNVGLAGLTYWSPNVNVFRDPRWGRGQETPGEDPTV  179



>ref|XP_007035744.1| Periplasmic beta-glucosidase, putative [Theobroma cacao]
 gb|EOY06670.1| Periplasmic beta-glucosidase, putative [Theobroma cacao]
Length=776

 Score =   209 bits (532),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 121/166 (73%), Gaps = 3/166 (2%)
 Frame = +2

Query  101  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  280
            +I  V+S+  P +ACD  +N   +SL FC   L +  RV DL+ RLTL EKI  LVN A 
Sbjct  26   VISLVESR--PPFACDP-RNGLTRSLRFCRVNLPLHVRVRDLLGRLTLQEKIRLLVNNAA  82

Query  281  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  460
             V RLGI  YEWWSEALHG+S  GPG  F G VP ATSFPQ + TAASFNE+L+  IG+V
Sbjct  83   AVPRLGIQGYEWWSEALHGVSNVGPGAKFGGAVPGATSFPQVITTAASFNESLWEQIGRV  142

Query  461  ISTEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            +S EARAM+N G+A LTYWSPN+NIFRDPRWGRGQE PGEDP L G
Sbjct  143  VSDEARAMYNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAG  188



>gb|KHG14371.1| Beta-D-xylosidase 1 -like protein [Gossypium arboreum]
Length=772

 Score =   209 bits (531),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 116/160 (73%), Gaps = 1/160 (1%)
 Frame = +2

Query  119  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  298
            +++ P +ACD  +N   +SL FC   L +  R  DL+ RLTL EKI  LVN A  V RLG
Sbjct  25   AESRPPFACDP-RNGLTRSLKFCRANLPIHVRARDLIGRLTLAEKIRLLVNNAAAVPRLG  83

Query  299  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  478
            I  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+S EAR
Sbjct  84   IQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWEQIGRVVSDEAR  143

Query  479  AMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            AM+N G+A LTYWSPN+NIFRDPRWGRGQE PGEDP L G
Sbjct  144  AMYNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAG  183



>ref|XP_002980053.1| hypothetical protein SELMODRAFT_112087 [Selaginella moellendorffii]
 gb|EFJ18923.1| hypothetical protein SELMODRAFT_112087 [Selaginella moellendorffii]
Length=772

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 116/153 (76%), Gaps = 2/153 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            YACD   N  L + PFCN  L +  RV D V RLTL EKI+ L+NTA  + RLG+P Y+W
Sbjct  30   YACDQ-SNATLAAFPFCNTSLAITDRVEDYVARLTLEEKISQLINTATGIPRLGVPKYQW  88

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            W EALHG++ + PGV F G VPAATSFP P+ TAASFN +LF+ IG+ +STEARAMHN G
Sbjct  89   WQEALHGVA-SSPGVQFGGSVPAATSFPMPITTAASFNTSLFYGIGQAVSTEARAMHNLG  147

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
             + LT+WSPN+NI+RDPRWGRGQE PGEDP L+
Sbjct  148  QSGLTFWSPNINIYRDPRWGRGQETPGEDPLLS  180



>gb|KJB38535.1| hypothetical protein B456_006G259500 [Gossypium raimondii]
Length=774

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 116/156 (74%), Gaps = 1/156 (1%)
 Frame = +2

Query  131  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  310
            P +ACD  +N   +SL FC   L +  RV DL+ RLTLPEKI  LVN A +V RLGI  Y
Sbjct  31   PPFACDP-RNGLTRSLRFCRTNLPIHVRVRDLLGRLTLPEKIRLLVNNAIDVPRLGIRGY  89

Query  311  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  490
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+S EARAM+N
Sbjct  90   EWWSEALHGVSNVGPGTKFGGSFPGATSFPQVITTAASFNESLWERIGQVVSDEARAMYN  149

Query  491  YGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
             G+A LTYWSPN+NIFRDPRWGRGQE PGEDP L G
Sbjct  150  GGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAG  185



>ref|XP_002987446.1| hypothetical protein SELMODRAFT_426206 [Selaginella moellendorffii]
 gb|EFJ11533.1| hypothetical protein SELMODRAFT_426206 [Selaginella moellendorffii]
Length=772

 Score =   208 bits (530),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 116/153 (76%), Gaps = 2/153 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            YACD   N  L + PFCN  L +  RV D V RLTL EKI+ L+NTA  + RLG+P Y+W
Sbjct  30   YACDQ-SNATLAAFPFCNTSLPITDRVEDYVARLTLEEKISQLINTATGIPRLGVPKYQW  88

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            W EALHG++ + PGV F G VPAATSFP P+ TAASFN +LF+ IG+ +STEARAMHN G
Sbjct  89   WQEALHGVA-SSPGVQFGGSVPAATSFPMPITTAASFNTSLFYGIGQAVSTEARAMHNLG  147

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
             + LT+WSPN+NI+RDPRWGRGQE PGEDP L+
Sbjct  148  QSGLTFWSPNINIYRDPRWGRGQETPGEDPLLS  180



>ref|XP_011015623.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   207 bits (528),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 115/154 (75%), Gaps = 1/154 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD  K+   ++LPFC  +L ++TRV DL+ R+TL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KDGTKRNLPFCQVKLPIQTRVKDLIGRMTLQEKVGLLVNNAAAVPRLGIKRYEW  85

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S EARAM N G
Sbjct  86   WSEALHGVSNVGPGTKFGGAFPVATSFPQVITTAASFNATLWEAIGQVVSDEARAMFNGG  145

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            +A LTYWSPN+NIFRDPRWGRGQE PGEDP + G
Sbjct  146  VAGLTYWSPNVNIFRDPRWGRGQETPGEDPVVVG  179



>gb|ACD93208.1| beta xylosidase [Camellia sinensis]
Length=767

 Score =   207 bits (528),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 116/160 (73%), Gaps = 4/160 (3%)
 Frame = +2

Query  119  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  298
            S++ P +ACD       ++LPFC   L ++ RV DL+ RLTL EKI  LVN A  V RLG
Sbjct  25   SESRPAFACDGAT----RNLPFCRVSLPIQDRVRDLIGRLTLQEKIRLLVNNAAAVPRLG  80

Query  299  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  478
            I  YEWWSEALHG+S   PGV F G  P ATSFPQ + TAASFN +L+  IG+V+S EAR
Sbjct  81   IKGYEWWSEALHGVSNADPGVKFGGAFPGATSFPQVISTAASFNASLWEHIGRVVSDEAR  140

Query  479  AMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            AM+N G+A LTYWSPN+NIFRDPRWGRGQE PGEDP L G
Sbjct  141  AMYNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAG  180



>ref|XP_011041424.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   207 bits (528),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 115/154 (75%), Gaps = 1/154 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD  K+   ++LPFC  +L ++TRV DL+ R+TL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KDGTKRNLPFCQVKLPIQTRVKDLIGRMTLQEKVGLLVNNAAAVPRLGIKRYEW  85

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S EARAM N G
Sbjct  86   WSEALHGVSNVGPGTKFGGAFPVATSFPQVITTAASFNATLWEAIGQVVSDEARAMFNGG  145

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            +A LTYWSPN+NIFRDPRWGRGQE PGEDP + G
Sbjct  146  VAGLTYWSPNVNIFRDPRWGRGQETPGEDPVVVG  179



>ref|XP_008445351.1| PREDICTED: probable beta-D-xylosidase 7 [Cucumis melo]
Length=783

 Score =   207 bits (528),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 121/161 (75%), Gaps = 2/161 (1%)
 Frame = +2

Query  119  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  298
            S + P YACD+  NP  K+LPFC   L +K R  DLV RLTL EK+  LVNTA  + RLG
Sbjct  32   SSSQPPYACDS-SNPLTKTLPFCRTSLPIKLRARDLVSRLTLDEKVLQLVNTAPAIPRLG  90

Query  299  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  478
            IP YEWWSEALHG++  G G+   G +PAATSFPQ +LTAASF+E L++ IG+ I TEAR
Sbjct  91   IPAYEWWSEALHGVADVGYGIRLNGTIPAATSFPQVILTAASFDENLWYQIGQAIGTEAR  150

Query  479  AMHNYGLA-ALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            A++N G A  +T+W+PN+NIFRDPRWGRGQE PGEDP +TG
Sbjct  151  AVYNAGQAKGMTFWTPNINIFRDPRWGRGQETPGEDPLMTG  191



>gb|KJB72795.1| hypothetical protein B456_011G198200 [Gossypium raimondii]
Length=772

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 116/160 (73%), Gaps = 1/160 (1%)
 Frame = +2

Query  119  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  298
            +++ P +ACD  +N   +SL FC   L +  R  DL+ RLTL EKI  LVN A  V RLG
Sbjct  25   AESRPPFACDP-RNGLTRSLKFCRANLPIHVRARDLIGRLTLAEKIRLLVNNAAAVPRLG  83

Query  299  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  478
            I  YEWWSEALHG+S  GPG  F G  P ATSFPQ + +AASFNE+L+  IG+V+S EAR
Sbjct  84   IQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITSAASFNESLWEQIGRVVSDEAR  143

Query  479  AMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            AM+N G+A LTYWSPN+NIFRDPRWGRGQE PGEDP L G
Sbjct  144  AMYNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAG  183



>ref|XP_002519194.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
 gb|EEF43058.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
Length=782

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 114/154 (74%), Gaps = 1/154 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD  +N   ++L FC   L +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  42   FACDP-RNGVTRNLKFCRANLPIHVRVRDLISRLTLQEKIRLLVNNAAAVPRLGIQGYEW  100

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPGV F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N G
Sbjct  101  WSEALHGVSNVGPGVKFGGAFPGATSFPQVITTAASFNQSLWEQIGRVVSDEARAMYNGG  160

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            LA LTYWSPN+N+FRDPRWGRGQE PGEDP L G
Sbjct  161  LAGLTYWSPNVNVFRDPRWGRGQETPGEDPVLAG  194



>ref|XP_003519750.1| PREDICTED: probable beta-D-xylosidase 2-like [Glycine max]
Length=772

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 111/154 (72%), Gaps = 1/154 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD  KN   K+LPFC   L    RV DL+ RLTL EK+  LVN A  V RLGI  YEW
Sbjct  28   FACDP-KNTATKNLPFCKASLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEW  86

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+  IG+V S EARAM+N G
Sbjct  87   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGRVASDEARAMYNGG  146

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
             A LTYWSPN+NIFRDPRWGRGQE PGEDP L G
Sbjct  147  TAGLTYWSPNVNIFRDPRWGRGQETPGEDPILAG  180



>ref|XP_010259348.1| PREDICTED: putative beta-D-xylosidase [Nelumbo nucifera]
Length=775

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 116/166 (70%), Gaps = 1/166 (1%)
 Frame = +2

Query  101  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  280
             + P      P +ACD  +N   ++LPFC   L +  RV DL+ RLTL EKI  LVN A 
Sbjct  21   FVSPRTGDARPAFACDP-RNGLTRNLPFCRPSLPIPNRVRDLIGRLTLQEKIRLLVNNAA  79

Query  281  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  460
             V RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V
Sbjct  80   PVPRLGIRGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNASLWEQIGRV  139

Query  461  ISTEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            +S EARAM+N G+A LTYWSPN+NIFRDPRWGRGQE PGEDP L G
Sbjct  140  VSDEARAMYNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLAG  185



>ref|XP_007163167.1| hypothetical protein PHAVU_001G212100g [Phaseolus vulgaris]
 gb|ESW35161.1| hypothetical protein PHAVU_001G212100g [Phaseolus vulgaris]
Length=775

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 115/155 (74%), Gaps = 1/155 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD  KN   K+LPFC   + +  RV DL+ RLTL EK+  LVN A  V RLG+  YEW
Sbjct  31   FACDP-KNAVTKNLPFCKVSVAITERVKDLIGRLTLEEKVRLLVNNAAAVPRLGMKGYEW  89

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPGV F    P ATSFPQ + TAASFN +L+ +IG+V+S EARAM+N G
Sbjct  90   WSEALHGVSNVGPGVKFNAQFPGATSFPQVITTAASFNASLWESIGRVVSDEARAMYNGG  149

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGS  601
            +A LTYWSPN+NIFRDPRWGRGQE PGEDP L G+
Sbjct  150  VAGLTYWSPNINIFRDPRWGRGQETPGEDPVLAGT  184



>emb|CDP17081.1| unnamed protein product [Coffea canephora]
Length=643

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 112/156 (72%), Gaps = 1/156 (1%)
 Frame = +2

Query  131  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  310
            P +ACD  ++   K   FC   L +  RV+DL+ RLTL EK+  LVN A  V+RLGI  Y
Sbjct  96   PAFACD-ARDARTKGWGFCGTNLGIAERVSDLIGRLTLQEKVRLLVNNAAEVARLGIKGY  154

Query  311  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  490
            EWWSEALHG+S  GPG  F G  PAATSFPQ + TAA+FN +L+  IG+V+S E RAM+N
Sbjct  155  EWWSEALHGVSNVGPGTKFGGEFPAATSFPQVITTAAAFNASLWEEIGRVVSDEGRAMYN  214

Query  491  YGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
             GL  LTYWSPN+NIFRDPRWGRGQE PGEDP L G
Sbjct  215  GGLGGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAG  250



>emb|CDY67410.1| BnaCnng54810D [Brassica napus]
Length=525

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 110/150 (73%), Gaps = 1/150 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD   +P      FC   L  + R  DLV RL+L EK+  LVN A  V RLG+P YEW
Sbjct  27   FACDR-NDPATVKYTFCKASLSYEARAKDLVSRLSLTEKVQQLVNKATGVPRLGVPPYEW  85

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPGV F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN G
Sbjct  86   WSEALHGVSNVGPGVRFNGTVPGATSFPAVILTAASFNTSLWLKMGEVVSTEARAMHNVG  145

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDP  586
            LA LTYWSPN+N+FRDPRWGRGQE PGEDP
Sbjct  146  LAGLTYWSPNINVFRDPRWGRGQETPGEDP  175



>ref|XP_011100796.1| PREDICTED: beta-D-xylosidase 1 [Sesamum indicum]
Length=770

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 115/152 (76%), Gaps = 1/152 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD   N    +LPFC+  L ++ RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  28   FACDPT-NHITTTLPFCSVSLHIRDRVKDLIGRLTLQEKIRLLVNNAAPVDRLGIRGYEW  86

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S TGPGV F G  P ATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  87   WSEALHGVSNTGPGVKFGGQFPGATSFPQVITTAASFNSSLWEAIGQVVSDEARAMYNGG  146

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            +A LTYWSPN+NIFRDPRWGRGQE PGEDPT+
Sbjct  147  VAGLTYWSPNVNIFRDPRWGRGQETPGEDPTV  178



>ref|NP_188596.1| putative beta-D-xylosidase 5 [Arabidopsis thaliana]
 sp|Q9LJN4.2|BXL5_ARATH RecName: Full=Probable beta-D-xylosidase 5; Short=AtBXL5; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AEE76268.1| putative beta-D-xylosidase 5 [Arabidopsis thaliana]
Length=781

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 118/164 (72%), Gaps = 3/164 (2%)
 Frame = +2

Query  101  IIGPVQS--QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNT  274
            II  V S  ++   +ACD +  P      FCN  L  + R  DLV RL+L EK+  LVN 
Sbjct  13   IIALVSSLCESQKNFACD-ISAPATAKYGFCNVSLSYEARAKDLVSRLSLKEKVQQLVNK  71

Query  275  AGNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIG  454
            A  V RLG+P YEWWSEALHG+S  GPGV+F G VP ATSFP  +LTAASFN +L+  +G
Sbjct  72   ATGVPRLGVPPYEWWSEALHGVSDVGPGVHFNGTVPGATSFPATILTAASFNTSLWLKMG  131

Query  455  KVISTEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDP  586
            +V+STEARAMHN GLA LTYWSPN+N+FRDPRWGRGQE PGEDP
Sbjct  132  EVVSTEARAMHNVGLAGLTYWSPNVNVFRDPRWGRGQETPGEDP  175



>dbj|BAB02547.1| beta-1,4-xylosidase [Arabidopsis thaliana]
Length=876

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 118/164 (72%), Gaps = 3/164 (2%)
 Frame = +2

Query  101  IIGPVQS--QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNT  274
            II  V S  ++   +ACD +  P      FCN  L  + R  DLV RL+L EK+  LVN 
Sbjct  13   IIALVSSLCESQKNFACD-ISAPATAKYGFCNVSLSYEARAKDLVSRLSLKEKVQQLVNK  71

Query  275  AGNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIG  454
            A  V RLG+P YEWWSEALHG+S  GPGV+F G VP ATSFP  +LTAASFN +L+  +G
Sbjct  72   ATGVPRLGVPPYEWWSEALHGVSDVGPGVHFNGTVPGATSFPATILTAASFNTSLWLKMG  131

Query  455  KVISTEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDP  586
            +V+STEARAMHN GLA LTYWSPN+N+FRDPRWGRGQE PGEDP
Sbjct  132  EVVSTEARAMHNVGLAGLTYWSPNVNVFRDPRWGRGQETPGEDP  175



>ref|XP_003535953.1| PREDICTED: probable beta-D-xylosidase 2 [Glycine max]
Length=771

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 111/154 (72%), Gaps = 1/154 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD  KN   K+LPFC   L    RV DL+ RLTL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KNTATKNLPFCKAWLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEW  85

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+  IG+V S EARAM+N G
Sbjct  86   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGRVASDEARAMYNGG  145

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
             A LTYWSPN+NIFRDPRWGRGQE PGEDP L G
Sbjct  146  TAGLTYWSPNVNIFRDPRWGRGQETPGEDPILAG  179



>gb|KHN08645.1| Putative beta-D-xylosidase 2 [Glycine soja]
Length=749

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 111/154 (72%), Gaps = 1/154 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD  KN   K+LPFC   L    RV DL+ RLTL EK+  LVN A  V RLGI  YEW
Sbjct  28   FACDP-KNTATKNLPFCKAWLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEW  86

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+  IG+V S EARAM+N G
Sbjct  87   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGRVASDEARAMYNGG  146

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
             A LTYWSPN+NIFRDPRWGRGQE PGEDP L G
Sbjct  147  TAGLTYWSPNVNIFRDPRWGRGQETPGEDPILAG  180



>ref|XP_009804071.1| PREDICTED: beta-D-xylosidase 1 isoform X2 [Nicotiana sylvestris]
Length=665

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 115/159 (72%), Gaps = 1/159 (1%)
 Frame = +2

Query  122  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  301
            ++ P +ACD   N G ++LPFC   L +  RV DL++RLTL EKI  LVN A  V RLG+
Sbjct  27   ESRPAFACDPA-NAGTRNLPFCKTSLPIHVRVQDLIQRLTLQEKIRLLVNNAAPVERLGV  85

Query  302  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARA  481
              YEWWSEALHG+S TGPGV F G  P+ATSFPQ + TAASFN +L+  IG+V+S E RA
Sbjct  86   NGYEWWSEALHGVSSTGPGVKFGGAFPSATSFPQVITTAASFNASLWEQIGQVVSDEGRA  145

Query  482  MHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            M+N G A LT+WSPN+NI RDPRWGR QE PGEDP L  
Sbjct  146  MYNGGAAGLTFWSPNVNILRDPRWGRCQETPGEDPHLVA  184



>gb|KHG05051.1| putative beta-D-xylosidase 2 -like protein [Gossypium arboreum]
Length=776

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 115/161 (71%), Gaps = 1/161 (1%)
 Frame = +2

Query  119  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  298
            +Q    +ACD+ K+    SLPFC   + +  RV DL+ RLT+ EK+  LVN A  V RLG
Sbjct  28   AQARDPFACDS-KDAKTSSLPFCKVSMPIPNRVTDLLGRLTMQEKVRLLVNNAAAVPRLG  86

Query  299  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  478
            I  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S EAR
Sbjct  87   IKGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVISTAASFNATLWEAIGRVVSDEAR  146

Query  479  AMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGS  601
            AM+N G A LTYWSPN+NIFRDPRWGRGQE PGEDP L G+
Sbjct  147  AMYNGGAAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGT  187



>gb|KJB09457.1| hypothetical protein B456_001G143600 [Gossypium raimondii]
Length=797

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 115/161 (71%), Gaps = 1/161 (1%)
 Frame = +2

Query  119  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  298
            +Q    +ACD+ K+    SLPFC   + +  RV DL+ RLT+ EK+  LVN A  V RLG
Sbjct  49   AQARDPFACDS-KDAKTSSLPFCKVSMPIPNRVTDLLGRLTMQEKVRLLVNNAAAVPRLG  107

Query  299  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  478
            I  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S EAR
Sbjct  108  IKGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNATLWEAIGRVVSDEAR  167

Query  479  AMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGS  601
            AM+N G A LTYWSPN+NIFRDPRWGRGQE PGEDP L G+
Sbjct  168  AMYNGGAAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGT  208



>ref|XP_002320310.2| hypothetical protein POPTR_0014s11730g [Populus trichocarpa]
 gb|EEE98625.2| hypothetical protein POPTR_0014s11730g [Populus trichocarpa]
Length=765

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 114/154 (74%), Gaps = 1/154 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD  K+   + LPFC  +L ++TRV DL+ R+TL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KDGTTRDLPFCQVKLPIQTRVNDLIGRMTLQEKVGLLVNNAAAVPRLGIKGYEW  85

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG  F G  P ATSFPQ + TAA+FN TL+  IG+V+S EARAM N G
Sbjct  86   WSEALHGVSNVGPGTKFGGAFPVATSFPQVITTAAAFNATLWEAIGQVVSDEARAMFNGG  145

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            +A LTYWSPN+NIFRDPRWGRGQE PGEDP + G
Sbjct  146  VAGLTYWSPNVNIFRDPRWGRGQETPGEDPVVVG  179



>ref|XP_003615012.1| Auxin-induced beta-glucosidase, partial [Medicago truncatula]
Length=190

 Score =   193 bits (490),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 115/158 (73%), Gaps = 2/158 (1%)
 Frame = +2

Query  131  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  310
            P Y+CDT  NP  KSLPFCN  L +  R  D+V RLTL EKI+ LVNTA ++ RLGIP+Y
Sbjct  34   PPYSCDTT-NPLTKSLPFCNLNLTITQRAKDIVSRLTLDEKISQLVNTAPSIPRLGIPSY  92

Query  311  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  490
            +WW EALHG++  G G+   G V  ATSFPQ +LTAASF+  L++ I KVI TEAR ++N
Sbjct  93   QWWDEALHGVANAGKGIRLNGSVAGATSFPQVILTAASFDSKLWYQISKVIGTEARGVYN  152

Query  491  YGLA-ALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGS  601
             G A  +T+W+PN+NIFRDPRWGRGQE  GEDP +  S
Sbjct  153  AGQAQGMTFWAPNINIFRDPRWGRGQETAGEDPLVNSS  190



>ref|XP_007042636.1| Glycosyl hydrolase family protein [Theobroma cacao]
 gb|EOX98467.1| Glycosyl hydrolase family protein [Theobroma cacao]
Length=852

 Score =   206 bits (523),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 111/150 (74%), Gaps = 1/150 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD   +P     PFC+  L  + R  DLV  LTL EK+  LVNTA  +SRLG+P YEW
Sbjct  85   FACDK-NDPNTSQFPFCDYALSYEDRAKDLVSHLTLQEKVQQLVNTASGISRLGVPAYEW  143

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG  F   VP ATSFP  +L+AASFN TL+  +G+V+STEARAM+N G
Sbjct  144  WSEALHGVSDLGPGTRFNATVPGATSFPAVILSAASFNATLWFKMGQVVSTEARAMYNVG  203

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDP  586
            LA LTYWSPN+N+FRDPRWGRGQE PGEDP
Sbjct  204  LAGLTYWSPNVNVFRDPRWGRGQETPGEDP  233



>emb|CDY15255.1| BnaC05g01340D [Brassica napus]
Length=762

 Score =   205 bits (522),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 116/162 (72%), Gaps = 1/162 (1%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            +   +   +ACDT K+    +L FC Q + +  RV DL+ RLTL EK++ L NTA  + R
Sbjct  16   IHVHSRETFACDT-KDAATATLRFCQQSVPIPERVKDLIGRLTLAEKVSLLGNTAAAIPR  74

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGI  YEWWSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+ +IG+V+S E
Sbjct  75   LGIKGYEWWSEALHGVSNVGPGTKFGGTFPAATSFPQVITTAASFNASLWESIGRVVSNE  134

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            ARAM+N G+  LTYWSPN+NI RDPRWGRGQE PGEDP L G
Sbjct  135  ARAMYNGGVGGLTYWSPNVNILRDPRWGRGQETPGEDPVLAG  176



>dbj|BAF00595.1| xylosidase [Arabidopsis thaliana]
Length=303

 Score =   196 bits (498),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 112/157 (71%), Gaps = 1/157 (1%)
 Frame = +2

Query  131  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  310
            P++ACD   N   ++L FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  33   PLFACDPA-NGLTRTLRFCRANVPIHVRVQDLLGRLTLQEKIRNLVNNAAAVPRLGIGGY  91

Query  311  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  490
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  92   EWWSEALHGISDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  151

Query  491  YGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGS  601
             G+A LTYWSPN+NI RDPRWGRGQE PGEDP +   
Sbjct  152  GGVAGLTYWSPNVNILRDPRWGRGQETPGEDPIVAAK  188



>gb|KHN19223.1| Putative beta-D-xylosidase 2 [Glycine soja]
Length=681

 Score =   204 bits (520),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 113/155 (73%), Gaps = 1/155 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD  KN   +++PFC   L +  RV DLV RLTL EK+  LVN A  V RLG+  YEW
Sbjct  31   FACDP-KNGATENMPFCKASLAIPERVKDLVGRLTLQEKVRLLVNNAAAVPRLGMKGYEW  89

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPGV F    P ATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  90   WSEALHGVSNVGPGVKFNAQFPGATSFPQVITTAASFNASLWEAIGQVVSDEARAMYNGG  149

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGS  601
             A LTYWSPN+NIFRDPRWGRGQE PGEDP L G+
Sbjct  150  TAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGT  184



>gb|KDP27887.1| hypothetical protein JCGZ_18967 [Jatropha curcas]
Length=775

 Score =   205 bits (522),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 114/154 (74%), Gaps = 1/154 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD  +N   ++L FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  34   FACDP-RNGLTRNLIFCRVNVPIHVRVRDLLGRLTLQEKIRLLVNNAAAVPRLGIQGYEW  92

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPGV F G  P ATSFPQ + TAASFNE+L+  IG+V+S EARAM+N G
Sbjct  93   WSEALHGVSNVGPGVKFGGAFPGATSFPQVITTAASFNESLWEQIGRVVSDEARAMYNGG  152

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            LA LTYWSPN+NIFRDPRWGRGQE PGEDP L G
Sbjct  153  LAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAG  186



>ref|XP_007145157.1| hypothetical protein PHAVU_007G215100g [Phaseolus vulgaris]
 gb|ESW17151.1| hypothetical protein PHAVU_007G215100g [Phaseolus vulgaris]
Length=767

 Score =   205 bits (521),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 110/154 (71%), Gaps = 1/154 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD  KN    SLPFC   L +  RV DL+ RLT+ EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KNAATSSLPFCKASLAIAERVKDLIGRLTMEEKVGLLVNNAAAVPRLGIKGYEW  85

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+  IG+V S EARAM+N G
Sbjct  86   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGRVASDEARAMYNGG  145

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
               LTYWSPN+NIFRDPRWGRGQE PGEDP L G
Sbjct  146  TGGLTYWSPNVNIFRDPRWGRGQETPGEDPILAG  179



>ref|XP_003592512.1| Xylosidase [Medicago truncatula]
 gb|AES62763.1| beta-D-xylosidase-like protein [Medicago truncatula]
Length=781

 Score =   205 bits (522),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 118/161 (73%), Gaps = 4/161 (2%)
 Frame = +2

Query  104  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  283
            I P+ SQ    +ACD   +P   + PFCN  L  +TR  DLV RLTL EK   LVN +  
Sbjct  16   ILPITSQK---HACDK-GSPKTSNFPFCNTSLSYETRAKDLVSRLTLQEKAQQLVNPSTG  71

Query  284  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  463
            +SRLG+P YEWWSEALHG+S  GPG  F   VP ATSFP  +L+AASFNETL++T+G+V+
Sbjct  72   ISRLGVPAYEWWSEALHGVSNVGPGTRFDSRVPGATSFPAVILSAASFNETLWYTMGQVV  131

Query  464  STEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDP  586
            S EARAM+N  LA LT+WSPN+N+FRDPRWGRGQE PGEDP
Sbjct  132  SNEARAMYNVDLAGLTFWSPNVNVFRDPRWGRGQETPGEDP  172



>ref|XP_004494414.1| PREDICTED: probable beta-D-xylosidase 2-like [Cicer arietinum]
Length=771

 Score =   205 bits (521),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 115/160 (72%), Gaps = 1/160 (1%)
 Frame = +2

Query  122  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  301
            ++   +ACD  K+   K LPFC+ +L +  RV D++ RLTL EK+  LVN A  V R GI
Sbjct  22   ESRDTFACDP-KDGTTKKLPFCSVKLAIPERVKDIIGRLTLQEKVNLLVNNAAAVPRFGI  80

Query  302  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARA  481
              YEWWSEALHG+S  GPG  F  + P ATSFPQ + TAASFN +L+  IG+V+S EARA
Sbjct  81   KGYEWWSEALHGVSNVGPGTKFGALFPGATSFPQVITTAASFNASLWEAIGRVVSDEARA  140

Query  482  MHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGS  601
            M+N G A LTYWSPN+NIFRDPRWGRGQE PGEDP L GS
Sbjct  141  MYNGGAAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGS  180



>dbj|BAG28345.1| arabinofuranosidase [Citrus unshiu]
Length=769

 Score =   205 bits (521),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 113/154 (73%), Gaps = 1/154 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD  +N   +SL FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  28   FACDP-RNGLTRSLRFCRTSVPIHVRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIQGYEW  86

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG  F G  P ATSFPQ + TAA+FNE+L+  IG+V+S EARAM+N G
Sbjct  87   WSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAAAFNESLWEEIGRVVSDEARAMYNGG  146

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            +A LTYWSPN+NIFRDPRWGRGQE PGEDP L G
Sbjct  147  MAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAG  180



>ref|XP_008454299.1| PREDICTED: probable beta-D-xylosidase 2 isoform X2 [Cucumis melo]
Length=741

 Score =   204 bits (520),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 113/155 (73%), Gaps = 1/155 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD   N      PFC + L V  RV DL+ RLTL EK+  LV+ AG V RLGI  Y+W
Sbjct  27   FACDP-NNSATTDYPFCRRSLGVGERVKDLIGRLTLEEKVKLLVSNAGGVPRLGIKAYQW  85

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG +F G  PAATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  86   WSEALHGVSNVGPGTSFGGEFPAATSFPQVISTAASFNASLWEAIGRVVSDEARAMYNGG  145

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGS  601
            +  LTYWSPN+NIFRDPRWGRGQE PGEDP L G+
Sbjct  146  VGGLTYWSPNVNIFRDPRWGRGQETPGEDPILAGT  180



>ref|XP_010457247.1| PREDICTED: probable beta-D-xylosidase 2 [Camelina sativa]
Length=769

 Score =   205 bits (521),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 115/154 (75%), Gaps = 1/154 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACDT K+    +L FC   + ++ RV DL+ RLTLPEK++ L NTA  + RLGI  YEW
Sbjct  31   FACDT-KDAATATLRFCQLSVPIQERVKDLIGRLTLPEKVSLLGNTAAAIPRLGIKGYEW  89

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG  F GV PAATSFPQ + T ASFN +L+ +IG+V+S EARAM+N G
Sbjct  90   WSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGRVVSNEARAMYNGG  149

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            +  LTYWSPN+NI RDPRWGRGQE PGEDP + G
Sbjct  150  VGGLTYWSPNVNILRDPRWGRGQETPGEDPVVAG  183



>emb|CDX89954.1| BnaA10g01280D [Brassica napus]
Length=767

 Score =   204 bits (520),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 116/162 (72%), Gaps = 1/162 (1%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            +   +   +ACDT K+    +L FC Q + +  RV DL+ RLTL EK++ L NTA  + R
Sbjct  21   IHVHSRETFACDT-KDAATATLRFCQQSVPIPERVKDLIGRLTLAEKVSLLGNTAAAIPR  79

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGI  YEWWSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+ +IG+V+S E
Sbjct  80   LGIKGYEWWSEALHGVSNVGPGTKFAGPFPAATSFPQVITTAASFNASLWESIGRVVSNE  139

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            ARAM+N G+  LTYWSPN+NI RDPRWGRGQE PGEDP L G
Sbjct  140  ARAMYNGGVGGLTYWSPNVNILRDPRWGRGQETPGEDPVLAG  181



>ref|XP_009804070.1| PREDICTED: beta-D-xylosidase 1 isoform X1 [Nicotiana sylvestris]
Length=774

 Score =   205 bits (521),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 115/159 (72%), Gaps = 1/159 (1%)
 Frame = +2

Query  122  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  301
            ++ P +ACD   N G ++LPFC   L +  RV DL++RLTL EKI  LVN A  V RLG+
Sbjct  27   ESRPAFACDPA-NAGTRNLPFCKTSLPIHVRVQDLIQRLTLQEKIRLLVNNAAPVERLGV  85

Query  302  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARA  481
              YEWWSEALHG+S TGPGV F G  P+ATSFPQ + TAASFN +L+  IG+V+S E RA
Sbjct  86   NGYEWWSEALHGVSSTGPGVKFGGAFPSATSFPQVITTAASFNASLWEQIGQVVSDEGRA  145

Query  482  MHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            M+N G A LT+WSPN+NI RDPRWGR QE PGEDP L  
Sbjct  146  MYNGGAAGLTFWSPNVNILRDPRWGRCQETPGEDPHLVA  184



>ref|XP_009119616.1| PREDICTED: probable beta-D-xylosidase 2 [Brassica rapa]
Length=767

 Score =   204 bits (520),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 116/162 (72%), Gaps = 1/162 (1%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            +   +   +ACDT K+    +L FC Q + +  RV DL+ RLTL EK++ L NTA  + R
Sbjct  21   IHVHSRETFACDT-KDAATATLRFCQQSVPIPERVKDLIGRLTLAEKVSLLGNTAAAIPR  79

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGI  YEWWSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+ +IG+V+S E
Sbjct  80   LGIKGYEWWSEALHGVSNVGPGTKFAGPFPAATSFPQVITTAASFNASLWESIGRVVSNE  139

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            ARAM+N G+  LTYWSPN+NI RDPRWGRGQE PGEDP L G
Sbjct  140  ARAMYNGGVGGLTYWSPNVNILRDPRWGRGQETPGEDPVLAG  181



>ref|XP_006419427.1| hypothetical protein CICLE_v10004369mg [Citrus clementina]
 gb|ESR32667.1| hypothetical protein CICLE_v10004369mg [Citrus clementina]
Length=777

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 113/155 (73%), Gaps = 1/155 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD  +N   +SL FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  28   FACDP-RNGLTRSLRFCRTSVPIHVRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIQGYEW  86

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG  F G  P ATSFPQ + TAA+FNE+L+  IG+V+S EARAM+N G
Sbjct  87   WSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAAAFNESLWEEIGRVVSDEARAMYNGG  146

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGS  601
            +A LTYWSPN+NIFRDPRWGRGQE PGEDP L G 
Sbjct  147  MAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGK  181



>ref|XP_002527511.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF34909.1| Beta-glucosidase, putative [Ricinus communis]
Length=810

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 116/162 (72%), Gaps = 4/162 (2%)
 Frame = +2

Query  101  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  280
            +I P+ SQ    +ACD   +P      FCN  L  + R  DL+ RLTL EK+  +VN A 
Sbjct  16   VIFPIASQN---FACDK-NSPQTNDYSFCNTSLSYQDRAKDLISRLTLQEKVQQVVNHAA  71

Query  281  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  460
             + RLGIP YEWWSEALHG+S  G GV F G VP ATSFP  +L+AASFNETL+  +G+V
Sbjct  72   GIPRLGIPAYEWWSEALHGVSNVGFGVRFNGTVPGATSFPAMILSAASFNETLWLKMGQV  131

Query  461  ISTEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDP  586
            +STEAR MH+ GLA LTYWSPN+N+FRDPRWGRGQE PGEDP
Sbjct  132  VSTEARTMHSVGLAGLTYWSPNVNVFRDPRWGRGQETPGEDP  173



>ref|XP_008223305.1| PREDICTED: putative beta-D-xylosidase [Prunus mume]
Length=775

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 117/163 (72%), Gaps = 3/163 (2%)
 Frame = +2

Query  104  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  283
            IG V ++  P +ACD   NP  + L FC   + +  RV DL+ RLTL EKI  LVN A  
Sbjct  23   IGVVHAR--PPFACDP-HNPITRGLKFCRVTVPIHVRVQDLIGRLTLQEKIRLLVNNAIA  79

Query  284  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  463
            V RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+
Sbjct  80   VPRLGIQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWQEIGRVV  139

Query  464  STEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            S EARAM+N G+A LTYWSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  140  SDEARAMYNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVL  182



>ref|XP_006406478.1| hypothetical protein EUTSA_v10022061mg [Eutrema salsugineum]
 gb|ESQ47931.1| hypothetical protein EUTSA_v10022061mg [Eutrema salsugineum]
Length=749

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 112/151 (74%), Gaps = 3/151 (2%)
 Frame = +2

Query  137  YACDTVKN-PGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYE  313
            +ACD  KN P      FCN  L  + R  DLV RL+L EK+  LVN A  V RLG+P YE
Sbjct  27   FACD--KNAPATAKYGFCNVSLSYEARAKDLVSRLSLKEKVQQLVNRATGVPRLGVPPYE  84

Query  314  WWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNY  493
            WWSEALHG+S  GPGV F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN 
Sbjct  85   WWSEALHGVSDVGPGVRFNGTVPGATSFPAVILTAASFNTSLWLKMGEVVSTEARAMHNV  144

Query  494  GLAALTYWSPNMNIFRDPRWGRGQEVPGEDP  586
            GLA LTYWSPN+N+FRDPRWGRGQE PGEDP
Sbjct  145  GLAGLTYWSPNVNVFRDPRWGRGQETPGEDP  175



>gb|AAS17751.2| beta xylosidase [Fragaria x ananassa]
Length=772

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 113/155 (73%), Gaps = 1/155 (1%)
 Frame = +2

Query  131  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  310
            P +ACD  +NP  +   FC  R+ V  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  30   PPFACDP-RNPLTRGFKFCRTRVPVHVRVQDLIGRLTLQEKIRLLVNNAIAVPRLGIQGY  88

Query  311  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  490
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  89   EWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNQSLWQEIGQVVSDEARAMYN  148

Query  491  YGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  595
             G A LTYWSPN+NIFRDPRWGRGQE PGEDP L+
Sbjct  149  GGQAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLS  183



>ref|XP_003520749.2| PREDICTED: probable beta-D-xylosidase 2-like [Glycine max]
Length=802

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 113/155 (73%), Gaps = 1/155 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD  KN   +++PFC   L +  RV DLV RLTL EK+  LVN A  V RLG+  YEW
Sbjct  58   FACDP-KNGATENMPFCKASLAIPERVKDLVGRLTLQEKVRLLVNNAAAVPRLGMKGYEW  116

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPGV F    P ATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  117  WSEALHGVSNVGPGVKFNAQFPGATSFPQVITTAASFNASLWEAIGQVVSDEARAMYNGG  176

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGS  601
             A LTYWSPN+NIFRDPRWGRGQE PGEDP L G+
Sbjct  177  TAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGT  211



>emb|CDY00033.1| BnaC09g02680D [Brassica napus]
Length=788

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 115/157 (73%), Gaps = 1/157 (1%)
 Frame = +2

Query  131  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  310
            P++ACD+  N   ++L FC   + V+ RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  49   PLFACDSA-NELTRTLRFCQVNIPVRMRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIGGY  107

Query  311  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  490
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  108  EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  167

Query  491  YGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGS  601
             G+A LTYWSPN+NI RDPRWGRGQE PGEDP + G 
Sbjct  168  GGVAGLTYWSPNVNILRDPRWGRGQETPGEDPVVVGK  204



>ref|XP_007225668.1| hypothetical protein PRUPE_ppa001718mg [Prunus persica]
 gb|EMJ26867.1| hypothetical protein PRUPE_ppa001718mg [Prunus persica]
Length=775

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 117/163 (72%), Gaps = 3/163 (2%)
 Frame = +2

Query  104  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  283
            IG V ++  P +ACD   NP  + L FC   + +  RV DL+ RLTL EKI  LVN A  
Sbjct  23   IGVVHAR--PPFACDP-HNPITRGLKFCRVTVPIHVRVQDLIGRLTLQEKIRLLVNNAIA  79

Query  284  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  463
            V RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+
Sbjct  80   VPRLGIQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWQEIGRVV  139

Query  464  STEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            S EARAM+N G+A LTYWSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  140  SDEARAMYNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVL  182



>ref|XP_008454298.1| PREDICTED: probable beta-D-xylosidase 2 isoform X1 [Cucumis melo]
Length=768

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 113/155 (73%), Gaps = 1/155 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD   N      PFC + L V  RV DL+ RLTL EK+  LV+ AG V RLGI  Y+W
Sbjct  27   FACDP-NNSATTDYPFCRRSLGVGERVKDLIGRLTLEEKVKLLVSNAGGVPRLGIKAYQW  85

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG +F G  PAATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  86   WSEALHGVSNVGPGTSFGGEFPAATSFPQVISTAASFNASLWEAIGRVVSDEARAMYNGG  145

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGS  601
            +  LTYWSPN+NIFRDPRWGRGQE PGEDP L G+
Sbjct  146  VGGLTYWSPNVNIFRDPRWGRGQETPGEDPILAGT  180



>ref|XP_010094323.1| Beta-D-xylosidase 1 [Morus notabilis]
 gb|EXB55743.1| Beta-D-xylosidase 1 [Morus notabilis]
Length=783

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 114/155 (74%), Gaps = 3/155 (2%)
 Frame = +2

Query  137  YACDTVKNPGL-KSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYE  313
            +ACD     GL +SL FC   L V  RV+DL+ RLTL EKI  LVN A  V RLGI  YE
Sbjct  39   FACD--PRSGLTRSLRFCRTTLPVHVRVSDLIGRLTLQEKIRLLVNNAIEVPRLGIQGYE  96

Query  314  WWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNY  493
            WWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+S EARAM+N 
Sbjct  97   WWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWEEIGRVVSDEARAMYNG  156

Query  494  GLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L G
Sbjct  157  GLAGLTFWSPNVNIFRDPRWGRGQETPGEDPVLAG  191



>emb|CDY58860.1| BnaCnng33860D [Brassica napus]
Length=771

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 110/150 (73%), Gaps = 1/150 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD   +P      FC   L  + R  DLV RL+L EK+  LVN A  V RLG+P YEW
Sbjct  27   FACDR-NDPATAKYTFCKASLSYEARAKDLVSRLSLKEKVQQLVNKATGVPRLGVPPYEW  85

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPGV F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN G
Sbjct  86   WSEALHGVSNVGPGVRFNGTVPGATSFPAVILTAASFNTSLWLKMGEVVSTEARAMHNVG  145

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDP  586
            LA LTYWSPN+N+FRDPRWGRGQE PGEDP
Sbjct  146  LAGLTYWSPNINVFRDPRWGRGQETPGEDP  175



>ref|XP_008384517.1| PREDICTED: probable beta-D-xylosidase 5 [Malus domestica]
Length=802

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 114/150 (76%), Gaps = 1/150 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD  +       PFCN  L  +TR  DLV RLTL EK+  LV+ +  ++RLG+P YEW
Sbjct  32   FACDN-RASATSQFPFCNTSLPYETRAKDLVSRLTLQEKVIQLVDKSTGIARLGVPAYEW  90

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG +F G VP ATSFP  +L+AASFN++L+  +G+V+STEARAM+N G
Sbjct  91   WSEALHGVSNVGPGTSFNGTVPGATSFPAVILSAASFNQSLWLKMGQVVSTEARAMYNVG  150

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDP  586
            LA LTYWSPN+N+FRDPRWGRGQE PGEDP
Sbjct  151  LAGLTYWSPNVNVFRDPRWGRGQETPGEDP  180



>ref|XP_003591420.1| Beta xylosidase [Medicago truncatula]
 gb|AES61671.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Medicago truncatula]
Length=765

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 114/162 (70%), Gaps = 1/162 (1%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            + S+    +ACD  KN    + PFC   L + TRV DL+ RLTL EK++ LVN A  V R
Sbjct  15   MSSEARDPFACDP-KNTSTNNFPFCKASLPIPTRVNDLIGRLTLQEKVSMLVNNAAAVPR  73

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            +GI  YEWWSEALHG+S  GPG  F G  PAATSFPQ + T ASFN +L+  IG+V S E
Sbjct  74   VGIKGYEWWSEALHGVSNVGPGTKFAGQFPAATSFPQVITTVASFNASLWEAIGRVASDE  133

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            ARAM+N G A LTYWSPN+NIFRDPRWGRGQE PGEDP L G
Sbjct  134  ARAMYNGGTAGLTYWSPNVNIFRDPRWGRGQETPGEDPILAG  175



>ref|XP_006830079.1| hypothetical protein AMTR_s00125p00113140 [Amborella trichopoda]
 gb|ERM97495.1| hypothetical protein AMTR_s00125p00113140 [Amborella trichopoda]
Length=801

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 113/152 (74%), Gaps = 3/152 (2%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            YACD  +      LPFCN  L +  R  DLV RL L EK+  LVN A  V+RLG+P YEW
Sbjct  38   YACDKGE---AAPLPFCNISLPIHDRAQDLVSRLNLTEKVQQLVNKAAGVARLGVPPYEW  94

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GP V+F G +P ATSFP  +L+ ASFNETL+  +G+V+STEARAM+N G
Sbjct  95   WSEALHGVSNVGPAVHFNGTIPGATSFPAVILSGASFNETLWFVMGQVVSTEARAMYNTG  154

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
            LA LTYWSPN+N+FRDPRWGRGQE PGEDP +
Sbjct  155  LAGLTYWSPNVNVFRDPRWGRGQETPGEDPVV  186



>ref|XP_006488872.1| PREDICTED: LOW QUALITY PROTEIN: beta-D-xylosidase 1-like [Citrus 
sinensis]
Length=826

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 113/154 (73%), Gaps = 1/154 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD  +N   +SL FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  68   FACDP-RNGLTRSLRFCRTSVPIHVRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIQGYEW  126

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG  F G  P ATSFPQ + TAA+FNE+L+  IG+V+S EARAM+N G
Sbjct  127  WSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAAAFNESLWEEIGRVVSDEARAMYNGG  186

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            +A LTYWSPN+NIFRDPRWGRGQE PGEDP L G
Sbjct  187  MAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAG  220



>ref|XP_010466113.1| PREDICTED: probable beta-D-xylosidase 5 [Camelina sativa]
Length=781

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 112/151 (74%), Gaps = 3/151 (2%)
 Frame = +2

Query  137  YACDTVKN-PGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYE  313
            +ACD  KN P      FCN  L  + R  DL+ RL+L EK+  LVN A  V RLG+P YE
Sbjct  27   FACD--KNAPATAKYGFCNVSLSYEARAKDLISRLSLTEKVQQLVNKATGVPRLGVPPYE  84

Query  314  WWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNY  493
            WWSEALHG+S  GPGV F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN 
Sbjct  85   WWSEALHGVSDVGPGVRFNGTVPGATSFPATILTAASFNTSLWLKMGEVVSTEARAMHNV  144

Query  494  GLAALTYWSPNMNIFRDPRWGRGQEVPGEDP  586
            GLA LTYWSPN+N+FRDPRWGRGQE PGEDP
Sbjct  145  GLAGLTYWSPNVNVFRDPRWGRGQETPGEDP  175



>ref|XP_002302758.2| hypothetical protein POPTR_0002s19830g [Populus trichocarpa]
 gb|EEE82031.2| hypothetical protein POPTR_0002s19830g [Populus trichocarpa]
Length=770

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 115/154 (75%), Gaps = 1/154 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD  ++   ++ PFC  +L +++RV+DL+ R+TL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-EDGTSRNFPFCQVKLPIQSRVSDLIGRMTLQEKVGLLVNDAAAVPRLGIKGYEW  85

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S EARAM N G
Sbjct  86   WSEALHGVSNVGPGTQFGGAFPGATSFPQVITTAASFNATLWEAIGRVVSDEARAMFNGG  145

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            +A LTYWSPN+NIFRDPRWGRGQE PGEDP + G
Sbjct  146  VAGLTYWSPNVNIFRDPRWGRGQETPGEDPVVAG  179



>ref|XP_009111875.1| PREDICTED: beta-D-xylosidase 1-like [Brassica rapa]
Length=787

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 114/157 (73%), Gaps = 1/157 (1%)
 Frame = +2

Query  131  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  310
            P++ACD   N   ++L FC   L V+ RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  49   PLFACDPA-NELTRTLRFCQVNLPVRVRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIGGY  107

Query  311  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  490
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  108  EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  167

Query  491  YGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGS  601
             G+A LTYWSPN+NI RDPRWGRGQE PGEDP + G 
Sbjct  168  GGVAGLTYWSPNVNILRDPRWGRGQETPGEDPVVVGK  204



>ref|XP_006298950.1| hypothetical protein CARUB_v10015075mg [Capsella rubella]
 gb|EOA31848.1| hypothetical protein CARUB_v10015075mg [Capsella rubella]
Length=762

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 112/151 (74%), Gaps = 3/151 (2%)
 Frame = +2

Query  137  YACDTVKN-PGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYE  313
            +ACD  KN P      FCN  L  + R  DLV RL+L EK+  LVN A  V RLG+P YE
Sbjct  27   FACD--KNAPATAKYGFCNVSLSYEARAKDLVLRLSLNEKVQQLVNKATGVPRLGVPPYE  84

Query  314  WWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNY  493
            WWSEALHG+S  GPGV F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN 
Sbjct  85   WWSEALHGVSNVGPGVRFNGTVPGATSFPATILTAASFNTSLWLKMGEVVSTEARAMHNV  144

Query  494  GLAALTYWSPNMNIFRDPRWGRGQEVPGEDP  586
            GLA LTYWSPN+NIFRDPRWGRGQE PGEDP
Sbjct  145  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDP  175



>ref|XP_003554544.1| PREDICTED: probable beta-D-xylosidase 2-like [Glycine max]
Length=771

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 112/155 (72%), Gaps = 1/155 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD  KN G K + FC   L +  RV DL+ RLTL EK+  LVN A  V RLG+  YEW
Sbjct  27   FACDP-KNGGTKKMAFCKVSLAIAERVKDLIGRLTLEEKVRLLVNNAAAVPRLGMKGYEW  85

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GP V F    PAATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  86   WSEALHGVSNLGPAVKFNAQFPAATSFPQVITTAASFNASLWEAIGQVVSDEARAMYNGG  145

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGS  601
             A LTYWSPN+NIFRDPRWGRGQE PGEDP L G+
Sbjct  146  TAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGT  180



>ref|XP_004295104.1| PREDICTED: putative beta-D-xylosidase [Fragaria vesca subsp. 
vesca]
Length=772

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 112/154 (73%), Gaps = 1/154 (1%)
 Frame = +2

Query  131  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  310
            P +ACD  +NP  +   FC  R+ V  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  30   PPFACDP-RNPLTRGFKFCRTRVPVHVRVQDLIGRLTLQEKIRLLVNNAIAVPRLGIQGY  88

Query  311  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  490
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  89   EWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNQSLWQEIGQVVSDEARAMYN  148

Query  491  YGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
             G A LTYWSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  149  GGQAGLTYWSPNVNIFRDPRWGRGQETPGEDPVL  182



>ref|XP_008386729.1| PREDICTED: probable beta-D-xylosidase 2 [Malus domestica]
Length=788

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 116/163 (71%), Gaps = 1/163 (1%)
 Frame = +2

Query  110  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  289
            P   +    +AC+  K+   K LPFC   L V+ RV DL+ RLTL EK+  LVNTA  V 
Sbjct  28   PKTCEGGESFACNP-KDAATKDLPFCRATLPVQDRVRDLLGRLTLQEKVKLLVNTALPVP  86

Query  290  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  469
            RLGI  YEWWSEALHG+S  GPG  F GV P ATSFPQ + TAASFN +L+  IG+V+S 
Sbjct  87   RLGIKGYEWWSEALHGVSNVGPGTKFGGVFPGATSFPQVITTAASFNASLWEAIGRVVSD  146

Query  470  EARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            EARAM+N G+A LTYWSPN+NI RDPRWGR QE PGEDPT+ G
Sbjct  147  EARAMYNGGVAGLTYWSPNVNILRDPRWGRAQETPGEDPTVVG  189



>ref|XP_010087253.1| putative beta-D-xylosidase 2 [Morus notabilis]
 gb|EXB28603.1| putative beta-D-xylosidase 2 [Morus notabilis]
Length=779

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 116/164 (71%), Gaps = 1/164 (1%)
 Frame = +2

Query  110  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  289
            P  S +   +ACD   +   + LPFC   L ++ RV DL+ RL L EK+  LVN A  V+
Sbjct  25   PSSSASREPFACDPT-DKTTRGLPFCRTSLPIQERVKDLIGRLALQEKVRLLVNNAAAVT  83

Query  290  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  469
            RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V+S 
Sbjct  84   RLGIKGYEWWSEALHGVSNVGPGSKFGGDFPGATSFPQVITTAASFNASLWEAIGRVVSD  143

Query  470  EARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGS  601
            EARAM+N G+A LTYWSPN+NIFRDPRWGRGQE PGEDP + G+
Sbjct  144  EARAMYNGGVAGLTYWSPNVNIFRDPRWGRGQETPGEDPVVVGT  187



>ref|XP_009145766.1| PREDICTED: probable beta-D-xylosidase 5 [Brassica rapa]
Length=782

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 110/150 (73%), Gaps = 1/150 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD   +P      FC   L  + R  DLV RL+L EK+  LVN A  V RLG+P YEW
Sbjct  27   FACDR-NDPATVKYTFCKASLSYEARAKDLVSRLSLTEKVQQLVNKATGVPRLGVPPYEW  85

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPGV F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN G
Sbjct  86   WSEALHGVSNVGPGVRFNGTVPGATSFPAVILTAASFNTSLWLKMGEVVSTEARAMHNVG  145

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDP  586
            LA LTYWSPN+N+FRDPRWGRGQE PGEDP
Sbjct  146  LAGLTYWSPNINVFRDPRWGRGQETPGEDP  175



>ref|XP_011042236.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 117/160 (73%), Gaps = 1/160 (1%)
 Frame = +2

Query  119  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  298
            S+    +ACD  ++   ++ PFC  +L +++RV DL+ R+TL EK+  LVN A  V RLG
Sbjct  21   SEALDAFACDP-EDGTSRNFPFCQVKLPIQSRVGDLIGRMTLQEKVGLLVNDAAAVPRLG  79

Query  299  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  478
            I  YEWWSEALHG+S  GPG  F GV P ATSFPQ + T+ASFN TL+  IG+V+S EAR
Sbjct  80   IKGYEWWSEALHGVSNVGPGTQFGGVFPGATSFPQVITTSASFNATLWEAIGQVVSDEAR  139

Query  479  AMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            AM N G+A LT+WSPN+NIFRDPRWGRGQE PGEDP + G
Sbjct  140  AMFNGGVAGLTFWSPNVNIFRDPRWGRGQETPGEDPVVVG  179



>ref|XP_004487789.1| PREDICTED: beta-D-xylosidase 1-like [Cicer arietinum]
Length=776

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 114/155 (74%), Gaps = 1/155 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD  KN   +   FCN+ + +  RV DL+ RLTL EKI  +VN A  V RLGI  YEW
Sbjct  31   FACDP-KNGLTRGYIFCNKNVPIHVRVQDLIGRLTLAEKIRLVVNNAIEVQRLGIQGYEW  89

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN++L+  IG+V+S EARAM+N G
Sbjct  90   WSEALHGVSNVGPGTKFGGPFPAATSFPQVITTAASFNQSLWLQIGRVVSDEARAMYNGG  149

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGS  601
             A LTYWSPN+NIFRDPRWGRGQE PGEDPTL G 
Sbjct  150  AAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLAGK  184



>ref|XP_009339788.1| PREDICTED: probable beta-D-xylosidase 2 [Pyrus x bretschneideri]
Length=788

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 114/154 (74%), Gaps = 1/154 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +AC+  K+   K LPFC   L V+ RV DL+ RLTL EK+  LVNTA  V RLGI  YEW
Sbjct  37   FACNP-KDAATKDLPFCRATLPVQDRVRDLLGRLTLQEKVKLLVNTALPVPRLGIKGYEW  95

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG  F GV P ATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  96   WSEALHGVSNVGPGTKFGGVFPGATSFPQVITTAASFNASLWEAIGRVVSDEARAMYNGG  155

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            +A LTYWSPN+NI RDPRWGR QE PGEDPT+ G
Sbjct  156  VAGLTYWSPNVNILRDPRWGRAQETPGEDPTVVG  189



>ref|XP_007051080.1| Beta-xylosidase 2 [Theobroma cacao]
 gb|EOX95237.1| Beta-xylosidase 2 [Theobroma cacao]
Length=818

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 113/155 (73%), Gaps = 1/155 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD  K+    +LPFC   + +  RV DL+ RLTL EK+  LVN A  V RLGI  YEW
Sbjct  76   FACDP-KDATTPNLPFCKVSMPISIRVKDLLGRLTLQEKVRLLVNNAAAVPRLGIKGYEW  134

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG  F    PAATSFPQ + TAASFN TL+  IG+V+S EARAM+N G
Sbjct  135  WSEALHGVSNVGPGTKFGRAFPAATSFPQVITTAASFNATLWEAIGRVVSDEARAMYNGG  194

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGS  601
            +A LTYWSPN+NIFRDPRWGRGQE PGEDP L G+
Sbjct  195  MAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGT  229



>ref|XP_002270249.1| PREDICTED: probable beta-D-xylosidase 2 isoform X1 [Vitis vinifera]
 emb|CBI36935.3| unnamed protein product [Vitis vinifera]
Length=768

 Score =   203 bits (516),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 115/166 (69%), Gaps = 1/166 (1%)
 Frame = +2

Query  101  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  280
            ++  V  +    +ACD  K+      PFC + + +  RV DL+ RLTL EK+  LVN A 
Sbjct  17   VLAVVSGEARDPFACDP-KDGANAGFPFCRKSIGIGERVKDLIGRLTLEEKVRLLVNNAA  75

Query  281  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  460
             V RLGI  YEWWSEALHG+S  GPG  F+G  P ATSFPQ + TAASFN +L+  IG+V
Sbjct  76   GVPRLGIKGYEWWSEALHGVSNVGPGTKFSGDFPGATSFPQVITTAASFNSSLWEAIGQV  135

Query  461  ISTEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            +S EARAM+N G A LT+WSPN+NIFRDPRWGRGQE PGEDP L G
Sbjct  136  VSDEARAMYNGGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPVLAG  181



>ref|XP_009757165.1| PREDICTED: probable beta-D-xylosidase 2 [Nicotiana sylvestris]
Length=770

 Score =   203 bits (516),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 114/162 (70%), Gaps = 1/162 (1%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            +  Q  P +ACD  ++   K+ PFC   L +  RV DL+ RLTL EK+  L NTA  VSR
Sbjct  22   ISVQARPPFACDP-RDRATKNFPFCQTNLAIGDRVRDLIGRLTLQEKVKLLGNTAAAVSR  80

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V+S E
Sbjct  81   LGIKGYEWWSEALHGVSNVGPGTKFGGDFPGATSFPQVISTAASFNASLWEEIGRVVSDE  140

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            ARAM+N  +  LTYWSPN+NIFRDPRWGRGQE PGEDP + G
Sbjct  141  ARAMYNGEMGGLTYWSPNVNIFRDPRWGRGQETPGEDPVVAG  182



>ref|XP_002264114.2| PREDICTED: probable beta-D-xylosidase 5 [Vitis vinifera]
Length=794

 Score =   203 bits (516),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 116/156 (74%), Gaps = 1/156 (1%)
 Frame = +2

Query  119  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  298
            SQ    YACD   +P     PFCN  L  + R +DLV RLTL EK   L+N+A  +SRLG
Sbjct  21   SQPTHRYACDRT-DPNSSQFPFCNTSLPYQDRASDLVSRLTLQEKAKQLINSATGISRLG  79

Query  299  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  478
            +P YEWWSEALHG+S +G GV+F   +PA T FP  +L+AASFNE+L++T+G+V+STE R
Sbjct  80   VPDYEWWSEALHGVSNSGIGVHFHDPIPAVTIFPAVILSAASFNESLWYTMGQVVSTEGR  139

Query  479  AMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDP  586
            AM+N G A LTYWSPN+NIFRDPRWGRGQE PGEDP
Sbjct  140  AMYNVGQAGLTYWSPNVNIFRDPRWGRGQETPGEDP  175



>ref|XP_010481135.1| PREDICTED: probable beta-D-xylosidase 2 [Camelina sativa]
Length=769

 Score =   202 bits (515),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 114/154 (74%), Gaps = 1/154 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACDT K+    +L FC   + ++ RV DL+ RLTL EK++ L NTA  + RLGI  YEW
Sbjct  31   FACDT-KDAATATLRFCQLSVAIQERVKDLIGRLTLAEKVSLLGNTAAAIPRLGIKGYEW  89

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG  F GV PAATSFPQ + T ASFN +L+ +IG+V+S EARAM+N G
Sbjct  90   WSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGRVVSNEARAMYNGG  149

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            +  LTYWSPN+NI RDPRWGRGQE PGEDP + G
Sbjct  150  VGGLTYWSPNVNILRDPRWGRGQETPGEDPVVAG  183



>ref|XP_004156823.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-D-xylosidase 2-like 
[Cucumis sativus]
Length=769

 Score =   202 bits (515),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 113/155 (73%), Gaps = 1/155 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD   N      PFC + L V+ RV DL+ RLTL EK+  LV+ AG V RLGI  Y+W
Sbjct  27   FACDP-NNSVTTDYPFCRRSLVVEERVKDLIGRLTLEEKVKLLVSNAGGVPRLGIKAYQW  85

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  86   WSEALHGVSNVGPGTRFGGEFPAATSFPQVISTAASFNASLWEAIGRVVSDEARAMYNGG  145

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGS  601
            +  LTYWSPN+NIFRDPRWGRGQE PGEDP L G+
Sbjct  146  VGGLTYWSPNVNIFRDPRWGRGQETPGEDPILAGT  180



>ref|XP_008808663.1| PREDICTED: beta-D-xylosidase 1-like [Phoenix dactylifera]
Length=772

 Score =   202 bits (515),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 114/163 (70%), Gaps = 3/163 (2%)
 Frame = +2

Query  110  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  289
            P  +   P +AC      GL   PFC   L ++ RVADL+ RLTL EKI  LVN A  V 
Sbjct  20   PGGAAARPAFACGGGPAVGL---PFCRAALPIRARVADLIGRLTLDEKIRLLVNNAAGVP  76

Query  290  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  469
            RLGI  YEWWSEALHG+S  GPGV+F G  P ATSFPQ + +AASFN TL+  IGK +S 
Sbjct  77   RLGIGGYEWWSEALHGVSNVGPGVHFGGAYPGATSFPQVISSAASFNATLWELIGKAVSD  136

Query  470  EARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            EARAM+N G A LT+WSPN+NIFRDPRWGRGQE PGEDP + G
Sbjct  137  EARAMYNGGQAGLTFWSPNVNIFRDPRWGRGQETPGEDPGVAG  179



>ref|XP_002311398.2| beta-D-xylosidase family protein [Populus trichocarpa]
 gb|EEE88765.2| beta-D-xylosidase family protein [Populus trichocarpa]
Length=771

 Score =   202 bits (515),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 112/155 (72%), Gaps = 1/155 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD  KN   +SL FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  31   FACDA-KNGLTRSLKFCRVNMPLHVRVRDLIGRLTLQEKIRLLVNNAAAVPRLGIQGYEW  89

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM N G
Sbjct  90   WSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNKSLWEEIGRVVSDEARAMFNGG  149

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGS  601
            +A LTYWSPN+N+FRDPRWGRGQE PGEDP + G 
Sbjct  150  MAGLTYWSPNVNVFRDPRWGRGQETPGEDPVVAGK  184



>ref|XP_010687347.1| PREDICTED: probable beta-D-xylosidase 5 [Beta vulgaris subsp. 
vulgaris]
Length=790

 Score =   202 bits (515),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 114/150 (76%), Gaps = 1/150 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            YAC+  +   + +L FCN+ L    R  DLV RLTL EK   LVN A  + RLG+P YEW
Sbjct  24   YACNK-REVDINNLSFCNKSLPYHDRAKDLVSRLTLDEKARQLVNAARGIPRLGVPAYEW  82

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S TGPGV+F   VP ATSFP  +L+AASFN +L++ +G+V+STEARAM+N G
Sbjct  83   WSEALHGVSNTGPGVHFNATVPGATSFPAVILSAASFNTSLWYMMGQVVSTEARAMYNVG  142

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDP  586
            LA LTYWSPN+N++RDPRWGRGQE PGEDP
Sbjct  143  LAGLTYWSPNVNVYRDPRWGRGQETPGEDP  172



>ref|XP_009603126.1| PREDICTED: probable beta-D-xylosidase 5 [Nicotiana tomentosiformis]
Length=790

 Score =   202 bits (515),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 111/159 (70%), Gaps = 4/159 (3%)
 Frame = +2

Query  110  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  289
            P  SQ    Y  D    P   +  FCN  L    R  D+V RLTL EK+  LVN+A  + 
Sbjct  19   PCNSQIHACYKSD----PNTSTYGFCNTSLAYTDRAKDIVSRLTLQEKVRQLVNSASGIP  74

Query  290  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  469
            RLG+P YEWWSEALHG+S TGPGV F   VP ATS P  +L+AASFN +L++T+GKV+ST
Sbjct  75   RLGVPAYEWWSEALHGVSNTGPGVRFNATVPGATSLPAVILSAASFNVSLWYTLGKVVST  134

Query  470  EARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDP  586
            EARAMHN GLA LTYWSPN+N+ RDPRWGR QE PGEDP
Sbjct  135  EARAMHNVGLAGLTYWSPNVNVLRDPRWGRAQETPGEDP  173



>ref|XP_003594795.1| Beta xylosidase [Medicago truncatula]
 gb|AES65046.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Medicago truncatula]
Length=762

 Score =   202 bits (514),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 114/155 (74%), Gaps = 1/155 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD  KN   +S  FCN R+ +  RV DL+ RL LPEKI  +VN A  V RLGI  YEW
Sbjct  27   FACDP-KNGLTRSYKFCNTRVPIHARVQDLIGRLALPEKIRLVVNNAIAVPRLGIQGYEW  85

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG  F G   AATSFPQ + TAASFN++L+  IG+++S EARAM+N G
Sbjct  86   WSEALHGVSNVGPGTKFGGAFSAATSFPQVITTAASFNQSLWLEIGRIVSDEARAMYNGG  145

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGS  601
             A LT+WSPN+NIFRDPRWGRGQE PGEDPT+ G 
Sbjct  146  AAGLTFWSPNVNIFRDPRWGRGQETPGEDPTVAGK  180



>ref|XP_008234021.1| PREDICTED: probable beta-D-xylosidase 7 [Prunus mume]
Length=781

 Score =   202 bits (514),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 122/165 (74%), Gaps = 3/165 (2%)
 Frame = +2

Query  110  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  289
            P +S T P YACD+ + P   S PFC   L +  RV DLV RLTL EKI+ LVN+A  + 
Sbjct  25   PTES-TQPPYACDSSQ-PSTSSYPFCKTALPINQRVQDLVSRLTLDEKISQLVNSAPPIP  82

Query  290  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  469
            RLGIP+YEWWSEALHG++  G G+N  G +  ATSFPQ +LTAASFNE L++ IG+VI T
Sbjct  83   RLGIPSYEWWSEALHGVADVGKGINLYGTISNATSFPQVILTAASFNEHLWYRIGQVIGT  142

Query  470  EARAMHNYGLA-ALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGS  601
            EARA++N G A  +T+W+PN+NIFRDPRWGRGQE PGEDP + G 
Sbjct  143  EARALYNAGQATGMTFWAPNINIFRDPRWGRGQETPGEDPLVVGK  187



>emb|CBI22460.3| unnamed protein product [Vitis vinifera]
Length=896

 Score =   202 bits (515),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 116/156 (74%), Gaps = 1/156 (1%)
 Frame = +2

Query  119  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  298
            SQ    YACD   +P     PFCN  L  + R +DLV RLTL EK   L+N+A  +SRLG
Sbjct  45   SQPTHRYACDRT-DPNSSQFPFCNTSLPYQDRASDLVSRLTLQEKAKQLINSATGISRLG  103

Query  299  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  478
            +P YEWWSEALHG+S +G GV+F   +PA T FP  +L+AASFNE+L++T+G+V+STE R
Sbjct  104  VPDYEWWSEALHGVSNSGIGVHFHDPIPAVTIFPAVILSAASFNESLWYTMGQVVSTEGR  163

Query  479  AMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDP  586
            AM+N G A LTYWSPN+NIFRDPRWGRGQE PGEDP
Sbjct  164  AMYNVGQAGLTYWSPNVNIFRDPRWGRGQETPGEDP  199



>gb|AFU54452.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Prunus salicina]
Length=775

 Score =   202 bits (514),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 116/163 (71%), Gaps = 3/163 (2%)
 Frame = +2

Query  104  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  283
            IG V ++  P +ACD   NP  + L FC   + +  RV DL+ RLTL EKI  LVN A  
Sbjct  23   IGVVHAR--PPFACDP-HNPITRGLKFCRVTVPIHVRVQDLIGRLTLQEKIRLLVNNAIA  79

Query  284  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  463
            V RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+
Sbjct  80   VPRLGIQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWQEIGRVV  139

Query  464  STEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
              EARAM+N G+A LTYWSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  140  PDEARAMYNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVL  182



>ref|XP_009593976.1| PREDICTED: probable beta-D-xylosidase 2 [Nicotiana tomentosiformis]
Length=773

 Score =   202 bits (513),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 113/162 (70%), Gaps = 1/162 (1%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            +  Q  P +ACD  ++   K+ PFC   L +  RV DLV RLTL EK+  L NTA  V R
Sbjct  22   ISVQARPPFACDP-RDRATKNFPFCQTNLAIGDRVRDLVGRLTLQEKVKLLGNTAAAVPR  80

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V+S E
Sbjct  81   LGIKGYEWWSEALHGVSNVGPGTKFGGDFPGATSFPQVITTAASFNASLWEEIGRVVSDE  140

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            ARAM+N  +  LTYWSPN+NIFRDPRWGRGQE PGEDP + G
Sbjct  141  ARAMYNGDMGGLTYWSPNVNIFRDPRWGRGQETPGEDPVVAG  182



>emb|CAN82161.1| hypothetical protein VITISV_035506 [Vitis vinifera]
Length=925

 Score =   202 bits (515),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 116/156 (74%), Gaps = 1/156 (1%)
 Frame = +2

Query  119  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  298
            SQ    YACD   +P     PFCN  L  + R +DLV RLTL EK   L+N+A  +SRLG
Sbjct  21   SQPTHRYACDRT-DPNSSQFPFCNTSLPYQDRASDLVSRLTLQEKAKQLINSATGISRLG  79

Query  299  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  478
            +P YEWWSEALHG+S +G GV+F   +PA T FP  +L+AASFNE+L++T+G+V+STE R
Sbjct  80   VPDYEWWSEALHGVSNSGIGVHFHDPIPAVTIFPAVILSAASFNESLWYTMGQVVSTEGR  139

Query  479  AMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDP  586
            AM+N G A LTYWSPN+NIFRDPRWGRGQE PGEDP
Sbjct  140  AMYNVGQAGLTYWSPNVNIFRDPRWGRGQETPGEDP  175



>ref|XP_010679361.1| PREDICTED: probable beta-D-xylosidase 2 [Beta vulgaris subsp. 
vulgaris]
Length=765

 Score =   202 bits (513),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 112/155 (72%), Gaps = 1/155 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +AC+  K+ G ++ PFC   L V  RV DL+ RLTL EK+  LV+ A  V RLGI  YEW
Sbjct  26   FACNP-KHAGFRAFPFCKTTLPVGDRVRDLIGRLTLQEKVKLLVDNAAAVPRLGIQDYEW  84

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  85   WSEALHGVSNVGPGTKFGGKFPTATSFPQVITTAASFNASLWEEIGRVVSDEARAMYNGG  144

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGS  601
            +A LTYWSPN+NI RDPRWGRGQE PGEDP L G 
Sbjct  145  MAGLTYWSPNVNILRDPRWGRGQETPGEDPVLAGK  179



>ref|XP_004300463.1| PREDICTED: probable beta-D-xylosidase 2 [Fragaria vesca subsp. 
vesca]
Length=790

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 115/162 (71%), Gaps = 1/162 (1%)
 Frame = +2

Query  116  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  295
            QS T+  +AC+   +   K LPFC  +L +  RV DL+ RLTL EK+  LVN+A  V RL
Sbjct  28   QSPTSSSFACNP-NDASTKDLPFCRVKLPIHVRVRDLIGRLTLQEKVKLLVNSAKAVPRL  86

Query  296  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  475
            GI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+ +S EA
Sbjct  87   GIKDYEWWSEALHGVSNVGPGTKFGGEFPGATSFPQVITTAASFNASLWEAIGQAVSDEA  146

Query  476  RAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGS  601
            RAM+N G+  LTYWSPN+N+ RDPRWGRGQE PGEDP + G+
Sbjct  147  RAMYNGGMGGLTYWSPNVNVLRDPRWGRGQETPGEDPVVVGA  188



>ref|XP_004152230.1| PREDICTED: probable beta-D-xylosidase 2-like [Cucumis sativus]
 gb|KGN52846.1| hypothetical protein Csa_4G003600 [Cucumis sativus]
Length=769

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 112/155 (72%), Gaps = 1/155 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD   N      PFC + L V  RV DL+ RLTL EK+  LV+ AG V RLGI  Y+W
Sbjct  27   FACDP-NNSVTTDYPFCRRSLVVGERVKDLIGRLTLEEKVKLLVSNAGGVPRLGIKAYQW  85

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  86   WSEALHGVSNVGPGTRFGGEFPAATSFPQVISTAASFNASLWEAIGRVVSDEARAMYNGG  145

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGS  601
            +  LTYWSPN+NIFRDPRWGRGQE PGEDP L G+
Sbjct  146  VGGLTYWSPNVNIFRDPRWGRGQETPGEDPILAGT  180



>ref|XP_002889410.1| hypothetical protein ARALYDRAFT_470222 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65669.1| hypothetical protein ARALYDRAFT_470222 [Arabidopsis lyrata subsp. 
lyrata]
Length=763

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 115/159 (72%), Gaps = 1/159 (1%)
 Frame = +2

Query  122  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  301
            Q+   +ACD +K+    +L FC   + +  RV DL+ RLTL EK++ L NTA  + RLGI
Sbjct  20   QSRETFACD-IKDAATATLRFCQLSVPITERVKDLIGRLTLVEKVSLLGNTAAAIPRLGI  78

Query  302  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARA  481
              YEWWSEALHG+S  GPG  F GV PAATSFPQ + T ASFN +L+ +IG+V+S EARA
Sbjct  79   KGYEWWSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGRVVSNEARA  138

Query  482  MHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            M+N G+  LTYWSPN+NI RDPRWGRGQE PGEDP + G
Sbjct  139  MYNGGVGGLTYWSPNVNILRDPRWGRGQETPGEDPVVAG  177



>ref|XP_004150696.1| PREDICTED: probable beta-D-xylosidase 7-like [Cucumis sativus]
 gb|KGN62174.1| Periplasmic beta-glucosidase [Cucumis sativus]
Length=783

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 119/161 (74%), Gaps = 2/161 (1%)
 Frame = +2

Query  119  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  298
            S + P YACD+  NP  K+LPFC   L +K R  DLV RLTL EK+  LVNT   + RLG
Sbjct  32   SSSQPPYACDS-SNPLTKTLPFCKTYLPIKLRARDLVSRLTLDEKVLQLVNTVPPIPRLG  90

Query  299  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  478
            IP YEWWSEALHG++  G G+   G + AATSFPQ +LTAASF+E L++ IG+ I TEAR
Sbjct  91   IPAYEWWSEALHGVANVGYGIRLNGTITAATSFPQVILTAASFDENLWYQIGQAIGTEAR  150

Query  479  AMHNYGLA-ALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            A++N G A  +T+W+PN+NIFRDPRWGRGQE PGEDP +TG
Sbjct  151  AVYNAGQAKGMTFWTPNINIFRDPRWGRGQETPGEDPLMTG  191



>ref|XP_004163321.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-D-xylosidase 7-like 
[Cucumis sativus]
Length=783

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 119/161 (74%), Gaps = 2/161 (1%)
 Frame = +2

Query  119  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  298
            S + P YACD+  NP  K+LPFC   L +K R  DLV RLTL EK+  LVNT   + RLG
Sbjct  32   SSSQPPYACDS-SNPLTKTLPFCKTYLPIKLRARDLVSRLTLDEKVLQLVNTVPPIPRLG  90

Query  299  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  478
            IP YEWWSEALHG++  G G+   G + AATSFPQ +LTAASF+E L++ IG+ I TEAR
Sbjct  91   IPAYEWWSEALHGVANVGYGIRLNGTITAATSFPQVILTAASFDENLWYQIGQAIGTEAR  150

Query  479  AMHNYGLA-ALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            A++N G A  +T+W+PN+NIFRDPRWGRGQE PGEDP +TG
Sbjct  151  AVYNAGQAKGMTFWTPNINIFRDPRWGRGQETPGEDPLMTG  191



>ref|XP_006306829.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
 gb|EOA39727.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
Length=768

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 115/162 (71%), Gaps = 1/162 (1%)
 Frame = +2

Query  113  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  292
            V+      +ACDT K+    +L FC   + +  RV DL+ RLTL EK++ L NTA  + R
Sbjct  22   VRVHCRETFACDT-KDAATATLRFCQMSVPIPERVRDLIGRLTLAEKVSLLGNTAAAIPR  80

Query  293  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  472
            LGI  YEWWSEALHG+S  GPG  F GV PAATSFPQ + T ASFN +L+ +IG+V+S E
Sbjct  81   LGIKGYEWWSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGRVVSNE  140

Query  473  ARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            ARAM+N G+  LTYWSPN+NI RDPRWGRGQE PGEDP + G
Sbjct  141  ARAMYNGGVGGLTYWSPNVNILRDPRWGRGQETPGEDPVVAG  182



>ref|NP_001266104.1| SlArf/Xyl1 protein precursor [Solanum lycopersicum]
 dbj|BAL44716.1| SlArf/Xyl1 [Solanum lycopersicum]
Length=771

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 111/152 (73%), Gaps = 1/152 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD   N G+++L FC   L +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  25   FACDPA-NAGIRNLRFCKTSLPIHVRVQDLIARLTLQEKIRLLVNNAAPVQRLGISGYEW  83

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S TG GV F G  P ATSFPQ + TAASFN +L+  IG+V+S E RAM+N G
Sbjct  84   WSEALHGVSNTGYGVKFGGAFPGATSFPQVITTAASFNASLWEEIGRVVSEEGRAMYNGG  143

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
             A LT+WSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  144  AAGLTFWSPNVNIFRDPRWGRGQETPGEDPHL  175



>ref|XP_009369955.1| PREDICTED: putative beta-D-xylosidase [Pyrus x bretschneideri]
Length=776

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 112/152 (74%), Gaps = 1/152 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD  +NP  ++L FC  R  +  RV DL+ RLTL EKI  LVN A +V RLGI  YEW
Sbjct  33   FACDP-RNPITRTLKFCRVRASIHVRVQDLIGRLTLQEKIRLLVNNAIDVPRLGIQGYEW  91

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG  F G    ATSFPQ + TAASFNE+L+  IG+V+S EARAM+N G
Sbjct  92   WSEALHGVSNVGPGTKFGGAFLGATSFPQVITTAASFNESLWEEIGRVVSDEARAMYNGG  151

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
             A LT+WSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  152  AAGLTFWSPNVNIFRDPRWGRGQETPGEDPVL  183



>ref|XP_002316021.1| beta-D-xylosidase family protein [Populus trichocarpa]
 gb|EEF02192.1| beta-D-xylosidase family protein [Populus trichocarpa]
Length=768

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 113/158 (72%), Gaps = 7/158 (4%)
 Frame = +2

Query  137  YACDTVKNPGL---KSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPT  307
            +ACD    P L   +SL FC   L +  RV DL+ RLTL EKI  LVN A  V RLGI  
Sbjct  28   FACD----PKLGLTRSLKFCRVNLPIHVRVRDLIGRLTLQEKIRLLVNNAAAVPRLGIQG  83

Query  308  YEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMH  487
            YEWWSEALHG+S  GPG  F G  P AT+FPQ + TAASFNE+L+  IG+V+S EARAM+
Sbjct  84   YEWWSEALHGVSNVGPGTKFGGAFPGATAFPQVITTAASFNESLWEEIGRVVSDEARAMY  143

Query  488  NYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGS  601
            N G+A LTYWSPN+N+FRDPRWGRGQE PGEDP + G 
Sbjct  144  NGGMAGLTYWSPNVNVFRDPRWGRGQETPGEDPVVAGK  181



>emb|CDY49607.1| BnaA09g03310D [Brassica napus]
Length=788

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 113/157 (72%), Gaps = 1/157 (1%)
 Frame = +2

Query  131  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  310
            P++ACD   N   ++L FC   + V+ RV DL+ R TL EKI  LVN A  V RLGI  Y
Sbjct  49   PLFACDPA-NELTRTLRFCQVNIPVRVRVQDLIGRFTLQEKIRLLVNNAAAVPRLGIGGY  107

Query  311  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  490
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  108  EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  167

Query  491  YGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGS  601
             G+A LTYWSPN+NI RDPRWGRGQE PGEDP + G 
Sbjct  168  GGVAGLTYWSPNVNILRDPRWGRGQETPGEDPVVVGK  204



>ref|XP_010507856.1| PREDICTED: probable beta-D-xylosidase 5 [Camelina sativa]
Length=781

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 111/151 (74%), Gaps = 3/151 (2%)
 Frame = +2

Query  137  YACDTVKN-PGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYE  313
            +ACD  KN P      FCN  L  + R  DLV RL+L EK+  LVN A  V RLG+P YE
Sbjct  27   FACD--KNAPATAKYGFCNVSLSYEARAKDLVSRLSLTEKVQQLVNKATGVPRLGVPPYE  84

Query  314  WWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNY  493
            WWSEALHG+S  GPGV F G VP ATSFP  +LT A+FN +L+  +G+V+STEARAMHN 
Sbjct  85   WWSEALHGVSDVGPGVRFNGTVPGATSFPATILTTANFNTSLWLKMGEVVSTEARAMHNV  144

Query  494  GLAALTYWSPNMNIFRDPRWGRGQEVPGEDP  586
            GLA LTYWSPN+N+FRDPRWGRGQE PGEDP
Sbjct  145  GLAGLTYWSPNVNVFRDPRWGRGQETPGEDP  175



>ref|XP_010111676.1| putative beta-D-xylosidase 5 [Morus notabilis]
 gb|EXC31467.1| putative beta-D-xylosidase 5 [Morus notabilis]
Length=802

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 115/161 (71%), Gaps = 3/161 (2%)
 Frame = +2

Query  104  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  283
            I P+ +Q    +ACD    P     PFC+  L    R  D++ RLTL EK+  LV+ +  
Sbjct  20   ILPIATQK---HACDVTSFPQASQFPFCDTSLSYDIRAKDIISRLTLQEKVQQLVSGSAG  76

Query  284  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  463
            +SRLG+P+YEWWSEALHG+S  GPG  F   VP ATSFP  +L+AA+FN +L++ +G+ +
Sbjct  77   ISRLGVPSYEWWSEALHGVSNVGPGTTFNATVPGATSFPAVILSAAAFNASLWYKMGQAV  136

Query  464  STEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDP  586
            STEARAM+N GLA LTYWSPN+N+FRDPRWGRGQE PGEDP
Sbjct  137  STEARAMYNAGLAGLTYWSPNVNVFRDPRWGRGQETPGEDP  177



>gb|KFK42620.1| hypothetical protein AALP_AA1G019000 [Arabis alpina]
Length=766

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 116/166 (70%), Gaps = 1/166 (1%)
 Frame = +2

Query  101  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  280
            I   V   +   +ACDT  N   K+L FC   + +  RV DL+ RLTL EK++ L NTA 
Sbjct  17   ITSSVCVHSRETFACDT-NNAATKTLRFCQVSVPLPERVRDLIGRLTLAEKVSLLGNTAA  75

Query  281  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  460
             + RLGI  YEWWSEALHG+S  GPG  F GV PAATSFPQ + T ASFN +L+ +IG+V
Sbjct  76   AIPRLGIKGYEWWSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNTSLWESIGRV  135

Query  461  ISTEARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            +S EARAM+N G+  LTYWSPN+NI RDPRWGRGQE PGEDP + G
Sbjct  136  VSNEARAMYNGGVGGLTYWSPNVNILRDPRWGRGQETPGEDPVVAG  181



>ref|XP_008341125.1| PREDICTED: putative beta-D-xylosidase [Malus domestica]
Length=776

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 113/154 (73%), Gaps = 1/154 (1%)
 Frame = +2

Query  131  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  310
            P +ACD  +NP  + L FC  R+ +  RV DL+ RLTL EKI  LVN A +V RLGI  Y
Sbjct  31   PPFACDP-RNPITRXLKFCRVRVPIXDRVHDLIGRLTLQEKIRLLVNNAIDVPRLGIQGY  89

Query  311  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  490
            EWWSEALHG+S  GPG  F G    ATSFPQ + TAASFNE+L+  IG+V+S EARAM+N
Sbjct  90   EWWSEALHGVSNVGPGTKFGGTFLGATSFPQVITTAASFNESLWEEIGRVVSDEARAMYN  149

Query  491  YGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
             G A LT+WSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  150  GGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPVL  183



>ref|XP_008390557.1| PREDICTED: putative beta-D-xylosidase [Malus domestica]
Length=776

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 113/154 (73%), Gaps = 1/154 (1%)
 Frame = +2

Query  131  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  310
            P +ACD  +NP  + L FC  R+ +  RV DL+ RLTL EKI  LVN A +V RLGI  Y
Sbjct  31   PPFACDP-RNPITRXLKFCRVRVPIXDRVHDLIGRLTLQEKIRLLVNNAIDVPRLGIQGY  89

Query  311  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  490
            EWWSEALHG+S  GPG  F G    ATSFPQ + TAASFNE+L+  IG+V+S EARAM+N
Sbjct  90   EWWSEALHGVSNVGPGTKFGGTFLGATSFPQVITTAASFNESLWEEIGRVVSDEARAMYN  149

Query  491  YGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTL  592
             G A LT+WSPN+NIFRDPRWGRGQE PGEDP L
Sbjct  150  GGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPVL  183



>ref|XP_008362602.1| PREDICTED: probable beta-D-xylosidase 7 [Malus domestica]
Length=410

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 119/159 (75%), Gaps = 2/159 (1%)
 Frame = +2

Query  125  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  304
            T P Y+CD+ + P   S PFC   L +  RV DL+ RLTL EKI+ LVN+A  + RLGIP
Sbjct  33   TQPPYSCDSSQ-PSTSSYPFCKTTLPINQRVQDLISRLTLDEKISQLVNSAPPIPRLGIP  91

Query  305  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAM  484
            +YEWWSEALHG++  G G+     +  ATSFPQ +LTAASFN+ L++ IG+VI TEARA+
Sbjct  92   SYEWWSEALHGVADVGKGIKLYPTIHXATSFPQVILTAASFNDHLWYRIGQVIGTEARAV  151

Query  485  HNYGLA-ALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            +N G A  +T+W+PN+NIFRDPRWGRGQE PGEDPT+TG
Sbjct  152  YNAGQATGMTFWAPNINIFRDPRWGRGQETPGEDPTVTG  190



>dbj|BAO45878.1| beta-D-xylosidase [Acacia mangium]
Length=763

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 112/154 (73%), Gaps = 1/154 (1%)
 Frame = +2

Query  137  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  316
            +ACD  KN   +   FC   +    RV DL+ RLTL EKI  LVN A  + RLGI  YEW
Sbjct  27   FACDP-KNAITRGFKFCRVNVATHARVQDLIGRLTLQEKIRLLVNNAIAIPRLGIQGYEW  85

Query  317  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  496
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN++L++ IG+V+S EARAM+N G
Sbjct  86   WSEALHGVSNVGPGTKFGGAFPAATSFPQVISTAASFNQSLWNQIGRVVSDEARAMYNGG  145

Query  497  LAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            +A LTYWSPN+NIFRDPRWGRGQE PGEDP L G
Sbjct  146  MAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAG  179



>ref|XP_009378701.1| PREDICTED: probable beta-D-xylosidase 2 [Pyrus x bretschneideri]
Length=789

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 115/163 (71%), Gaps = 1/163 (1%)
 Frame = +2

Query  110  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  289
            P   +    +AC+  K+   K LPFC   L V+ RV DL+ RLTL EK+  LVNTA  V 
Sbjct  28   PKTCEAGESFACNP-KDAATKDLPFCRATLPVQDRVRDLLGRLTLQEKVKLLVNTALPVP  86

Query  290  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  469
            RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V+S 
Sbjct  87   RLGIKGYEWWSEALHGVSNVGPGTKFGGDFPGATSFPQVITTAASFNASLWEAIGRVVSD  146

Query  470  EARAMHNYGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
            EARAM+N G+A LTYWSPN+N+ RDPRWGR QE PGEDPT+ G
Sbjct  147  EARAMYNGGVAGLTYWSPNVNVLRDPRWGRAQETPGEDPTVVG  189



>emb|CDY33913.1| BnaA02g30740D [Brassica napus]
Length=772

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 113/156 (72%), Gaps = 1/156 (1%)
 Frame = +2

Query  131  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  310
            P++ACD   N   ++L FC   + V  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  33   PLFACDPA-NGLTRTLRFCRVNVPVHARVQDLIGRLTLQEKIRLLVNNAAAVPRLGIGGY  91

Query  311  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  490
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  92   EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  151

Query  491  YGLAALTYWSPNMNIFRDPRWGRGQEVPGEDPTLTG  598
             G+A LTYWSPN+NI RDPRWGRGQE PGEDP + G
Sbjct  152  GGVAGLTYWSPNVNILRDPRWGRGQETPGEDPVVAG  187



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520