BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS021A12

Length=611
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006359040.1|  PREDICTED: protein GIGANTEA-like isoform X2        319   5e-98   Solanum tuberosum [potatoes]
ref|XP_006359039.1|  PREDICTED: protein GIGANTEA-like isoform X1        320   5e-98   Solanum tuberosum [potatoes]
ref|XP_004237832.1|  PREDICTED: protein GIGANTEA                        316   7e-97   Solanum lycopersicum
ref|XP_007199688.1|  hypothetical protein PRUPE_ppa000556mg             313   4e-96   
ref|XP_010681263.1|  PREDICTED: protein GIGANTEA                        314   4e-96   
emb|CBI22760.3|  unnamed protein product                                301   4e-96   Vitis vinifera
gb|AJC01622.1|  gigantea                                                313   9e-96   Prunus dulcis [sweet almond]
ref|XP_008237480.1|  PREDICTED: protein GIGANTEA                        311   3e-95   
emb|CDP11443.1|  unnamed protein product                                310   8e-95   Coffea canephora [robusta coffee]
gb|EYU30283.1|  hypothetical protein MIMGU_mgv1a000455mg                310   1e-94   Erythranthe guttata [common monkey flower]
gb|ABV55998.1|  gigantea1A                                              291   1e-94   Zea mays [maize]
gb|ACA24490.1|  gigantea-like protein 2                                 305   9e-94   Glycine max [soybeans]
ref|XP_008793464.1|  PREDICTED: protein GIGANTEA-like                   307   2e-93   Phoenix dactylifera
gb|AGU91438.1|  GIGANTEA-like protein                                   304   2e-93   Chrysanthemum boreale
ref|XP_010915066.1|  PREDICTED: protein GIGANTEA-like                   306   3e-93   Elaeis guineensis
ref|XP_003556164.1|  PREDICTED: protein GIGANTEA isoformX1              306   4e-93   
dbj|BAJ22595.1|  GIGANTEA                                               306   5e-93   Glycine max [soybeans]
ref|NP_001239995.1|  uncharacterized protein LOC100800578               305   6e-93   
ref|XP_006588466.1|  PREDICTED: uncharacterized protein LOC100800...    305   7e-93   Glycine max [soybeans]
ref|XP_002264755.1|  PREDICTED: protein GIGANTEA                        305   7e-93   
emb|CAN81809.1|  hypothetical protein VITISV_032939                     305   9e-93   Vitis vinifera
ref|XP_010261025.1|  PREDICTED: protein GIGANTEA-like isoform X2        304   9e-93   Nelumbo nucifera [Indian lotus]
gb|ADK60834.1|  gigantea                                                281   9e-93   Arachis diogoi
dbj|BAN82581.1|  gigantea                                               305   1e-92   Glycine max [soybeans]
dbj|BAN82589.1|  gigantea                                               305   1e-92   Glycine max [soybeans]
dbj|BAN82586.1|  gigantea                                               305   1e-92   Glycine max [soybeans]
gb|KHN41309.1|  Protein GIGANTEA                                        305   1e-92   Glycine soja [wild soybean]
gb|ACJ65314.1|  GI3 protein                                             304   1e-92   Glycine max [soybeans]
gb|AES62297.2|  gigantea protein 1B                                     302   1e-92   Medicago truncatula
ref|XP_010261026.1|  PREDICTED: protein GIGANTEA-like isoform X3        303   2e-92   Nelumbo nucifera [Indian lotus]
ref|XP_010261024.1|  PREDICTED: protein GIGANTEA-like isoform X1        303   3e-92   Nelumbo nucifera [Indian lotus]
ref|XP_007143577.1|  hypothetical protein PHAVU_007G083500g             303   4e-92   Phaseolus vulgaris [French bean]
dbj|BAK19067.1|  GIGANTEA                                               302   6e-92   Ipomoea nil [qian niu]
ref|XP_008786518.1|  PREDICTED: protein GIGANTEA-like                   302   9e-92   
gb|KHN17039.1|  Protein GIGANTEA                                        301   1e-91   Glycine soja [wild soybean]
gb|AES62299.2|  gigantea protein 1B                                     301   1e-91   Medicago truncatula
gb|ACJ65312.1|  GI1 protein                                             301   2e-91   Glycine max [soybeans]
ref|XP_003592048.1|  Protein GIGANTEA                                   301   2e-91   
ref|XP_003592046.1|  Protein GIGANTEA                                   301   2e-91   
ref|XP_011100590.1|  PREDICTED: protein GIGANTEA-like                   301   3e-91   Sesamum indicum [beniseed]
gb|ABP81863.1|  LATE BLOOMER 1                                          301   3e-91   Pisum sativum [garden pea]
ref|XP_004496436.1|  PREDICTED: protein GIGANTEA-like isoform X2        300   4e-91   
gb|KHG25928.1|  Protein GIGANTEA                                        294   4e-91   Gossypium arboreum [tree cotton]
ref|XP_004496435.1|  PREDICTED: protein GIGANTEA-like isoform X1        299   1e-90   Cicer arietinum [garbanzo]
gb|AFW80279.1|  gigantea1A isoform 1                                    296   3e-90   
ref|XP_009408933.1|  PREDICTED: protein GIGANTEA-like isoform X1        298   3e-90   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408935.1|  PREDICTED: protein GIGANTEA-like isoform X2        298   4e-90   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002307516.1|  GIGANTEA family protein                            298   4e-90   
ref|XP_011044276.1|  PREDICTED: protein GIGANTEA-like                   297   4e-90   Populus euphratica
ref|XP_010925341.1|  PREDICTED: protein GIGANTEA-like                   296   8e-90   Elaeis guineensis
gb|KJB59490.1|  hypothetical protein B456_009G258800                    295   1e-89   Gossypium raimondii
ref|XP_008672375.1|  PREDICTED: uncharacterized protein LOC100272...    296   1e-89   Zea mays [maize]
ref|NP_001140728.1|  uncharacterized protein LOC100272803               296   1e-89   
gb|KJB59491.1|  hypothetical protein B456_009G258800                    294   1e-89   Gossypium raimondii
gb|AFW80282.1|  gigantea1A                                              295   1e-89   
gb|AFW80281.1|  gigantea1A                                              295   1e-89   
gb|KJB59493.1|  hypothetical protein B456_009G258800                    294   1e-89   Gossypium raimondii
ref|NP_001288586.1|  gigantea like1a                                    295   2e-89   Zea mays [maize]
gb|ABV55997.1|  gigantea1B                                              277   2e-89   Zea mays [maize]
ref|XP_010062090.1|  PREDICTED: protein GIGANTEA isoform X2             293   3e-89   Eucalyptus grandis [rose gum]
emb|CAB56058.1|  gigantea homologue                                     293   3e-89   Oryza sativa [red rice]
gb|KHN46389.1|  Protein GIGANTEA                                        295   3e-89   Glycine soja [wild soybean]
dbj|BAM67030.1|  gigantea-like                                          295   3e-89   Chrysanthemum seticuspe f. boreale
ref|XP_009336496.1|  PREDICTED: protein GIGANTEA-like                   295   3e-89   Pyrus x bretschneideri [bai li]
ref|XP_008461914.1|  PREDICTED: protein GIGANTEA-like isoform X3        293   3e-89   
gb|AFK65758.1|  GIGANTEA                                                295   3e-89   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AGL61504.1|  gigantea-like protein                                   295   4e-89   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_009335139.1|  PREDICTED: protein GIGANTEA-like                   295   4e-89   Pyrus x bretschneideri [bai li]
gb|KJB28963.1|  hypothetical protein B456_005G077100                    293   4e-89   Gossypium raimondii
gb|KJB59492.1|  hypothetical protein B456_009G258800                    294   4e-89   Gossypium raimondii
ref|XP_008386373.1|  PREDICTED: protein GIGANTEA-like                   295   5e-89   
gb|KJB28960.1|  hypothetical protein B456_005G077100                    293   5e-89   Gossypium raimondii
gb|KJB59494.1|  hypothetical protein B456_009G258800                    294   6e-89   Gossypium raimondii
ref|XP_007019601.1|  Gigantea protein isoform 1                         294   6e-89   
ref|XP_004163795.1|  PREDICTED: protein GIGANTEA-like                   293   6e-89   
ref|XP_007019603.1|  Gigantea protein isoform 3                         294   6e-89   
gb|EYU36555.1|  hypothetical protein MIMGU_mgv1a000427mg                294   6e-89   Erythranthe guttata [common monkey flower]
gb|ABZ81992.1|  gigantea                                                294   7e-89   Zea mays [maize]
gb|KDP36552.1|  hypothetical protein JCGZ_08319                         294   7e-89   Jatropha curcas
gb|AII99806.1|  gigantea                                                294   8e-89   Dimocarpus longan [longan]
ref|XP_011074106.1|  PREDICTED: protein GIGANTEA-like isoform X2        293   8e-89   
ref|XP_007019604.1|  Gigantea protein isoform 4                         293   9e-89   
ref|XP_008461913.1|  PREDICTED: protein GIGANTEA-like isoform X2        292   9e-89   
ref|XP_011074103.1|  PREDICTED: protein GIGANTEA-like isoform X1        293   1e-88   Sesamum indicum [beniseed]
ref|NP_001042220.1|  Os01g0182600                                       293   1e-88   
gb|KJB28964.1|  hypothetical protein B456_005G077100                    293   1e-88   Gossypium raimondii
gb|AAW66945.1|  gigantea-like protein                                   293   1e-88   Hordeum vulgare [barley]
dbj|BAO74118.1|  GIGANTEA                                               291   2e-88   Lotus japonicus
gb|EMS55238.1|  hypothetical protein TRIUR3_30834                       293   2e-88   Triticum urartu
dbj|BAO74110.1|  GIGANTEA                                               291   2e-88   Lotus japonicus
emb|CDM81775.1|  unnamed protein product                                293   2e-88   Triticum aestivum [Canadian hard winter wheat]
gb|AAT79487.1|  gigantea 3                                              293   2e-88   Triticum aestivum [Canadian hard winter wheat]
gb|KJB28961.1|  hypothetical protein B456_005G077100                    293   2e-88   Gossypium raimondii
gb|KJB28962.1|  hypothetical protein B456_005G077100                    292   2e-88   Gossypium raimondii
ref|XP_010062087.1|  PREDICTED: protein GIGANTEA isoform X1             293   2e-88   Eucalyptus grandis [rose gum]
ref|XP_006643836.1|  PREDICTED: protein GIGANTEA-like isoform X1        292   3e-88   Oryza brachyantha
ref|XP_008381855.1|  PREDICTED: protein GIGANTEA-like                   292   3e-88   
gb|EMT06342.1|  hypothetical protein F775_28583                         292   3e-88   
gb|ADR51711.1|  GI                                                      292   3e-88   Secale cereale
gb|AAQ11738.1|  gigantea                                                292   3e-88   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004290483.1|  PREDICTED: protein GIGANTEA                        292   4e-88   Fragaria vesca subsp. vesca
ref|XP_003564357.1|  PREDICTED: protein GIGANTEA                        291   6e-88   
ref|XP_008461912.1|  PREDICTED: protein GIGANTEA-like isoform X1        291   8e-88   Cucumis melo [Oriental melon]
gb|AGM20686.1|  GI1-2                                                   291   1e-87   Populus tomentosa [Chinese white poplar]
ref|XP_006416158.1|  hypothetical protein EUTSA_v10006603mg             289   1e-87   
ref|XP_009381150.1|  PREDICTED: protein GIGANTEA-like                   291   1e-87   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABP96482.1|  GIGANTEA                                                290   1e-87   Arabidopsis thaliana [mouse-ear cress]
gb|AGW52153.1|  GI                                                      291   1e-87   Populus tomentosa [Chinese white poplar]
gb|AAT79486.1|  gigantea 2                                              290   1e-87   Triticum aestivum [Canadian hard winter wheat]
emb|CAA72908.1|  hypothetical protein                                   290   2e-87   Arabidopsis thaliana [mouse-ear cress]
pir||T00767  hypothetical protein T22J18.6 - Arabidopsis thaliana       290   2e-87
gb|AIC83986.1|  gigantea-like protein                                   290   2e-87   Festuca pratensis [meadow ryegrass]
gb|ABP96496.1|  GIGANTEA                                                290   2e-87   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96497.1|  GIGANTEA                                                290   2e-87   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96485.1|  GIGANTEA                                                290   2e-87   Arabidopsis thaliana [mouse-ear cress]
gb|AAT80910.1|  GIGANTEA                                                290   2e-87   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96483.1|  GIGANTEA                                                290   2e-87   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96488.1|  GIGANTEA                                                290   2e-87   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96484.1|  GIGANTEA                                                290   2e-87   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564180.1|  protein GIGANTEA                                      290   2e-87   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96498.1|  GIGANTEA                                                290   2e-87   Arabidopsis thaliana [mouse-ear cress]
gb|AAT97404.1|  gigantea                                                290   2e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306336.1|  hypothetical protein CARUB_v10012213mg             290   2e-87   Capsella rubella
gb|ABP96481.1|  GIGANTEA                                                290   2e-87   Arabidopsis lyrata subsp. petraea
ref|XP_002890532.1|  hypothetical protein ARALYDRAFT_889789             290   2e-87   Arabidopsis lyrata subsp. lyrata
ref|XP_009802612.1|  PREDICTED: protein GIGANTEA-like                   290   2e-87   Nicotiana sylvestris
emb|CAY26028.1|  GIGANTEA                                               290   2e-87   Lolium perenne [perennial ryegrass]
gb|KCW69153.1|  hypothetical protein EUGRSUZ_F02686                     290   3e-87   Eucalyptus grandis [rose gum]
gb|KFK44368.1|  gigantea                                                290   3e-87   Arabis alpina [alpine rockcress]
ref|XP_004968438.1|  PREDICTED: protein GIGANTEA-like                   289   3e-87   Setaria italica
ref|XP_006416159.1|  hypothetical protein EUTSA_v10006603mg             289   4e-87   
ref|XP_006434519.1|  hypothetical protein CICLE_v10004044mg             288   4e-87   
gb|KDO83806.1|  hypothetical protein CISIN_1g001216mg                   288   5e-87   Citrus sinensis [apfelsine]
ref|XP_011042897.1|  PREDICTED: protein GIGANTEA-like                   289   5e-87   Populus euphratica
ref|XP_006361617.1|  PREDICTED: protein GIGANTEA-like isoform X2        288   7e-87   Solanum tuberosum [potatoes]
ref|XP_006361616.1|  PREDICTED: protein GIGANTEA-like isoform X1        288   8e-87   Solanum tuberosum [potatoes]
ref|XP_006473104.1|  PREDICTED: protein GIGANTEA-like isoform X1        288   8e-87   Citrus sinensis [apfelsine]
ref|XP_010535090.1|  PREDICTED: protein GIGANTEA                        288   9e-87   Tarenaya hassleriana [spider flower]
ref|XP_002524341.1|  Protein GIGANTEA, putative                         288   1e-86   
ref|XP_002300901.2|  GIGANTEA family protein                            288   1e-86   
ref|XP_006386299.1|  hypothetical protein POPTR_0002s06490g             287   2e-86   
ref|XP_007151935.1|  hypothetical protein PHAVU_004G088300g             287   2e-86   Phaseolus vulgaris [French bean]
ref|NP_001288824.1|  protein GIGANTEA                                   287   2e-86   Brassica rapa
ref|XP_010477543.1|  PREDICTED: protein GIGANTEA-like isoform X1        287   3e-86   Camelina sativa [gold-of-pleasure]
ref|XP_010477544.1|  PREDICTED: protein GIGANTEA-like isoform X2        287   3e-86   Camelina sativa [gold-of-pleasure]
ref|XP_010477546.1|  PREDICTED: protein GIGANTEA-like isoform X4        287   3e-86   Camelina sativa [gold-of-pleasure]
ref|XP_010477545.1|  PREDICTED: protein GIGANTEA-like isoform X3        287   3e-86   Camelina sativa [gold-of-pleasure]
ref|XP_009115601.1|  PREDICTED: protein GIGANTEA                        287   3e-86   Brassica rapa
emb|CDY04787.1|  BnaC05g18020D                                          287   3e-86   
ref|XP_010498761.1|  PREDICTED: protein GIGANTEA                        286   3e-86   Camelina sativa [gold-of-pleasure]
emb|CDY21388.1|  BnaA09g30390D                                          286   3e-86   Brassica napus [oilseed rape]
gb|AIR93790.1|  gigantea                                                286   4e-86   Kalanchoe fedtschenkoi [lavender-scallops]
ref|XP_010462850.1|  PREDICTED: protein GIGANTEA-like                   286   5e-86   Camelina sativa [gold-of-pleasure]
ref|XP_004160322.1|  PREDICTED: protein GIGANTEA-like                   284   7e-86   
ref|XP_004140955.1|  PREDICTED: protein GIGANTEA-like                   285   2e-85   Cucumis sativus [cucumbers]
gb|EEC70061.1|  hypothetical protein OsI_00663                          283   6e-85   Oryza sativa Indica Group [Indian rice]
gb|EEE54000.1|  hypothetical protein OsJ_00641                          283   6e-85   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004139688.1|  PREDICTED: protein GIGANTEA-like                   282   9e-85   
ref|XP_009631436.1|  PREDICTED: protein GIGANTEA-like isoform X7        280   1e-84   Nicotiana tomentosiformis
ref|XP_009631435.1|  PREDICTED: protein GIGANTEA-like isoform X6        280   1e-84   Nicotiana tomentosiformis
gb|ADP92454.1|  GIGANTEA 1                                              282   1e-84   x Doritaenopsis hybrid cultivar
ref|XP_009380419.1|  PREDICTED: protein GIGANTEA-like isoform X1        282   2e-84   
ref|XP_008456743.1|  PREDICTED: protein GIGANTEA-like                   281   2e-84   Cucumis melo [Oriental melon]
ref|XP_009610493.1|  PREDICTED: protein GIGANTEA-like                   281   3e-84   Nicotiana tomentosiformis
ref|XP_009631432.1|  PREDICTED: protein GIGANTEA-like isoform X3        279   2e-83   Nicotiana tomentosiformis
ref|XP_009631429.1|  PREDICTED: protein GIGANTEA-like isoform X1        278   2e-83   Nicotiana tomentosiformis
ref|XP_009631434.1|  PREDICTED: protein GIGANTEA-like isoform X5        278   2e-83   Nicotiana tomentosiformis
gb|ACT22765.1|  GIGANTEA                                                278   2e-83   Allium cepa
ref|XP_009631431.1|  PREDICTED: protein GIGANTEA-like isoform X2        278   2e-83   Nicotiana tomentosiformis
gb|ACT22764.1|  GIGANTEA                                                278   2e-83   Allium cepa
ref|XP_009631433.1|  PREDICTED: protein GIGANTEA-like isoform X4        278   3e-83   Nicotiana tomentosiformis
ref|XP_010097648.1|  hypothetical protein L484_023788                   277   9e-83   
ref|XP_009772049.1|  PREDICTED: protein GIGANTEA-like                   276   2e-82   Nicotiana sylvestris
ref|XP_010268583.1|  PREDICTED: protein GIGANTEA-like isoform X1        275   3e-82   Nelumbo nucifera [Indian lotus]
ref|XP_010268589.1|  PREDICTED: protein GIGANTEA-like isoform X2        275   4e-82   Nelumbo nucifera [Indian lotus]
ref|XP_004252566.1|  PREDICTED: protein GIGANTEA-like isoform X1        272   4e-81   Solanum lycopersicum
ref|XP_010314472.1|  PREDICTED: protein GIGANTEA-like isoform X2        272   4e-81   
ref|XP_006842209.1|  hypothetical protein AMTR_s00078p00173230          269   5e-80   
gb|AAL08497.2|  gigantea-like protein                                   259   3e-77   Hordeum vulgare [barley]
gb|AAF00023.1|  GIGANTEA                                                259   2e-76   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD97869.1|  GI homologue                                           258   5e-76   Lemna gibba
dbj|BAD97864.1|  GI homologue 1                                         256   2e-75   Lemna aequinoctialis
gb|ABR18021.1|  unknown                                                 254   7e-75   Picea sitchensis
gb|EPS68433.1|  hypothetical protein M569_06336                         251   7e-75   Genlisea aurea
gb|AGH20049.1|  GI                                                      253   3e-74   Picea abies
gb|ACY30446.1|  gigantea-like protein                                   241   5e-70   Liriodendron tulipifera
dbj|BAP76055.1|  putative GI                                            240   2e-69   Cryptomeria japonica
gb|AEK05801.1|  gigantea 2                                              227   4e-65   Populus balsamifera [balsam poplar]
gb|AEK05791.1|  gigantea 2                                              227   4e-65   Populus balsamifera [balsam poplar]
gb|AEK05803.1|  gigantea 2                                              227   4e-65   Populus balsamifera [balsam poplar]
gb|AEK05793.1|  gigantea 2                                              227   4e-65   Populus balsamifera [balsam poplar]
gb|AEK05795.1|  gigantea 2                                              227   4e-65   Populus balsamifera [balsam poplar]
gb|AEK05790.1|  gigantea 2                                              227   4e-65   Populus balsamifera [balsam poplar]
gb|AEK05807.1|  gigantea 2                                              225   3e-64   Populus balsamifera [balsam poplar]
gb|AEK05802.1|  gigantea 2                                              224   6e-64   Populus balsamifera [balsam poplar]
gb|AEK05799.1|  gigantea 2                                              224   6e-64   Populus balsamifera [balsam poplar]
ref|XP_002969462.1|  hypothetical protein SELMODRAFT_170553             208   2e-58   
ref|XP_002961231.1|  hypothetical protein SELMODRAFT_140066             207   6e-58   
dbj|BAO66507.1|  GIGANTEA                                               177   5e-47   Marchantia polymorpha
gb|KGN44455.1|  hypothetical protein Csa_7G293730                       152   3e-41   Cucumis sativus [cucumbers]
gb|KGN44456.1|  hypothetical protein Csa_7G293740                       148   2e-37   Cucumis sativus [cucumbers]
gb|AEK26575.1|  gigantea 5                                              132   2e-35   Populus tremula [European aspen]
gb|KJB59489.1|  hypothetical protein B456_009G258800                    135   9e-33   Gossypium raimondii
gb|AEK05815.1|  gigantea-5                                              122   1e-31   Populus balsamifera [balsam poplar]
gb|AEK05860.1|  gigantea-5                                              119   1e-30   Populus balsamifera [balsam poplar]
ref|XP_003592047.1|  Protein GIGANTEA                                   124   6e-29   
gb|EPS65289.1|  hypothetical protein M569_09488                       62.4    2e-08   Genlisea aurea
gb|AAR90092.1|  gigantea                                              55.5    2e-06   Brassica rapa
gb|AAQ55454.1|  gigantea                                              55.5    3e-06   Brassica rapa subsp. oleifera [biennial turnip rape]
dbj|BAP92497.1|  GIGANTEA homolog                                     53.5    2e-05   Rubus palmatus
dbj|BAP92532.1|  GIGANTEA homolog                                     53.5    2e-05   Rubus grayanus
dbj|BAP92451.1|  GIGANTEA homolog                                     53.1    2e-05   Rubus palmatus
dbj|BAP92538.1|  GIGANTEA homolog                                     53.1    2e-05   Rubus grayanus
dbj|BAP92476.1|  GIGANTEA homolog                                     53.1    2e-05   Rubus palmatus
dbj|BAP92550.1|  GIGANTEA homolog                                     53.1    2e-05   Rubus palmatus
dbj|BAP92498.1|  GIGANTEA homolog                                     53.1    2e-05   Rubus palmatus
dbj|BAP92460.1|  GIGANTEA homolog                                     53.1    2e-05   Rubus grayanus



>ref|XP_006359040.1| PREDICTED: protein GIGANTEA-like isoform X2 [Solanum tuberosum]
Length=1166

 Score =   319 bits (818),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 188/203 (93%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTTPMDEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  257  LSVCDEEVARYETATLTAAAVPALLLPPPTTPMDEHLVAGLPALEPYARLFHRYYAIATP  316

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDY SGLRLPRNWMHLHFLRAIGIA
Sbjct  317  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYTSGLRLPRNWMHLHFLRAIGIA  376

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFR+LSQPALLFPPLRQVEG+ VQHEPLGGYIS D+KQR +P  E
Sbjct  377  MSMRAGIAADAAAALLFRVLSQPALLFPPLRQVEGIEVQHEPLGGYISCDKKQRQVPLAE  436

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            ATVEATAQGIASMLCAHGPEVEW
Sbjct  437  ATVEATAQGIASMLCAHGPEVEW  459



>ref|XP_006359039.1| PREDICTED: protein GIGANTEA-like isoform X1 [Solanum tuberosum]
Length=1189

 Score =   320 bits (819),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 188/203 (93%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTTPMDEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  280  LSVCDEEVARYETATLTAAAVPALLLPPPTTPMDEHLVAGLPALEPYARLFHRYYAIATP  339

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDY SGLRLPRNWMHLHFLRAIGIA
Sbjct  340  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYTSGLRLPRNWMHLHFLRAIGIA  399

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFR+LSQPALLFPPLRQVEG+ VQHEPLGGYIS D+KQR +P  E
Sbjct  400  MSMRAGIAADAAAALLFRVLSQPALLFPPLRQVEGIEVQHEPLGGYISCDKKQRQVPLAE  459

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            ATVEATAQGIASMLCAHGPEVEW
Sbjct  460  ATVEATAQGIASMLCAHGPEVEW  482



>ref|XP_004237832.1| PREDICTED: protein GIGANTEA [Solanum lycopersicum]
Length=1167

 Score =   316 bits (810),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 186/203 (92%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTTPMDEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  257  LSVCDEEVARYETATLTAAAVPALLLPPPTTPMDEHLVAGLPALEPYARLFHRYYAIATP  316

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYA+ LRLPRNWMHLHFLRAIGIA
Sbjct  317  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYATNLRLPRNWMHLHFLRAIGIA  376

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFR+LSQPALLFPPLRQVEG+ VQHEPLGGYIS ++KQR +P  E
Sbjct  377  MSMRAGIAADAAAALLFRVLSQPALLFPPLRQVEGIEVQHEPLGGYISCNKKQRQVPLAE  436

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            ATVEATAQGIASMLCAHGPEVEW
Sbjct  437  ATVEATAQGIASMLCAHGPEVEW  459



>ref|XP_007199688.1| hypothetical protein PRUPE_ppa000556mg [Prunus persica]
 gb|EMJ00887.1| hypothetical protein PRUPE_ppa000556mg [Prunus persica]
Length=1098

 Score =   313 bits (803),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 184/203 (91%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  186  LSVCDEEVARYETATLTAVAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  245

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  246  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGIRLPRNWMHLHFLRAIGTA  305

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQV+GV VQHEPLGGYIS  +KQ ++PE E
Sbjct  306  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGVEVQHEPLGGYISSYKKQIEVPEAE  365

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  366  ATIEATAQGIASMLCAHGPEVEW  388



>ref|XP_010681263.1| PREDICTED: protein GIGANTEA [Beta vulgaris subsp. vulgaris]
 ref|XP_010681268.1| PREDICTED: protein GIGANTEA [Beta vulgaris subsp. vulgaris]
Length=1178

 Score =   314 bits (805),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 183/203 (90%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA+LTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  258  LSVCDEEVARYETASLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYAIATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLPRNWMHLHFLRAIGIA
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGMRLPRNWMHLHFLRAIGIA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMR GIAADAAAALLFRILSQPALLFPPLRQVEGV VQHEPLGGYIS  RKQ ++P  E
Sbjct  378  MSMREGIAADAAAALLFRILSQPALLFPPLRQVEGVDVQHEPLGGYISCYRKQIEMPSAE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  438  ATIEATAQGIASMLCAHGPEVEW  460



>emb|CBI22760.3| unnamed protein product [Vitis vinifera]
Length=549

 Score =   301 bits (772),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  258  LSVCDEEVARYETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGMRLPRNWMHLHFLRAIGTA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFR+LSQPALLFPPLRQVEG   QHEPL GYIS  +KQ ++P  E
Sbjct  378  MSMRAGIAADAAAALLFRVLSQPALLFPPLRQVEGFEFQHEPLDGYISSYKKQIEVPATE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  438  ATIEATAQGIASMLCAHGPEVEW  460



>gb|AJC01622.1| gigantea [Prunus dulcis]
Length=1170

 Score =   313 bits (802),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 184/203 (91%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  258  LSVCDEEVARYETATLTAVAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGIRLPRNWMHLHFLRAIGTA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQV+GV VQHEPLGGYIS  +KQ ++PE E
Sbjct  378  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGVEVQHEPLGGYISSYKKQIEVPEAE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  438  ATIEATAQGIASMLCAHGPEVEW  460



>ref|XP_008237480.1| PREDICTED: protein GIGANTEA [Prunus mume]
 ref|XP_008237481.1| PREDICTED: protein GIGANTEA [Prunus mume]
 ref|XP_008237482.1| PREDICTED: protein GIGANTEA [Prunus mume]
 ref|XP_008237483.1| PREDICTED: protein GIGANTEA [Prunus mume]
Length=1170

 Score =   311 bits (798),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 183/203 (90%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  258  LSVCDEEVARYETATLTAVAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNW+HLHFLRAIG A
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGIRLPRNWLHLHFLRAIGTA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQV+GV VQHEPLGGYIS  +KQ ++PE E
Sbjct  378  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGVEVQHEPLGGYISSYKKQIEVPEAE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  438  ATIEATAQGIASMLCAHGPEVEW  460



>emb|CDP11443.1| unnamed protein product [Coffea canephora]
Length=1167

 Score =   310 bits (795),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 184/203 (91%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTT MDEHLV GLPALEPYARLFHRYYAIASP
Sbjct  257  LSVCDEEVARYETATLTAAAVPALLLPPPTTAMDEHLVAGLPALEPYARLFHRYYAIASP  316

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAE+YASG+RLPRNWMHLHFLRAIGIA
Sbjct  317  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEEYASGMRLPRNWMHLHFLRAIGIA  376

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFR+LSQPALLFPPLRQVEG+ VQH P  GYIS +RKQ++IP  E
Sbjct  377  MSMRAGIAADAAAALLFRVLSQPALLFPPLRQVEGIEVQHGPTVGYISRERKQKEIPGAE  436

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            ATVEATAQGIASMLCAHGPEVEW
Sbjct  437  ATVEATAQGIASMLCAHGPEVEW  459



>gb|EYU30283.1| hypothetical protein MIMGU_mgv1a000455mg [Erythranthe guttata]
Length=1141

 Score =   310 bits (794),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 187/204 (92%), Positives = 198/204 (97%), Gaps = 2/204 (1%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTTPMDEHLV GLPALEPYARLFHRYYAIASP
Sbjct  258  LSVCDEEVARYETATLTAVAVPALLLPPPTTPMDEHLVAGLPALEPYARLFHRYYAIASP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGMRLPRNWMHLHFLRAIGIA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRK-QRDIPEI  538
            MSMRAGIAAD+AAALLFRILSQPALLFPPLRQV+G+ VQHEPLGGYIS +RK QR++P  
Sbjct  378  MSMRAGIAADSAAALLFRILSQPALLFPPLRQVDGIEVQHEPLGGYISSERKQQRELPA-  436

Query  539  EATVEATAQGIASMLCAHGPEVEW  610
            +ATVEATAQGIASMLCAHGPEVEW
Sbjct  437  KATVEATAQGIASMLCAHGPEVEW  460



>gb|ABV55998.1| gigantea1A, partial [Zea mays]
Length=335

 Score =   291 bits (745),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPTTP+DEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  33   LSVCDEEVARYETANLTAAAVPALLLPPPTTPLDEHLVAGLPPLEPYARLFHRYYAIATP  92

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL GLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLP+NWMHLHFLRAIG A
Sbjct  93   SATQRLLFGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGMRLPKNWMHLHFLRAIGTA  152

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAAD AAALLFRILSQP LLFPPLR  EGV V HEPLGGY+S  +KQ ++P  E
Sbjct  153  MSMRAGIAADTAAALLFRILSQPTLLFPPLRHAEGVEVHHEPLGGYVSSYKKQLEVPASE  212

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT++ATAQGIAS+LCAHGP+VEW
Sbjct  213  ATIDATAQGIASLLCAHGPDVEW  235



>gb|ACA24490.1| gigantea-like protein 2 [Glycine max]
Length=990

 Score =   305 bits (782),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+R ET TLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  263  LSVCDDEVARNETTTLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  322

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  323  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGIRLPRNWMHLHFLRAIGTA  382

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQV+GV VQHEPLGGYIS  +KQ ++P  E
Sbjct  383  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGVEVQHEPLGGYISSYKKQIEVPAAE  442

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            A++EATAQGIASMLCAHGPEVEW
Sbjct  443  ASIEATAQGIASMLCAHGPEVEW  465



>ref|XP_008793464.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
Length=1169

 Score =   307 bits (786),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  259  LSVCDEEVARYETANLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  319  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGMRLPRNWMHLHFLRAIGTA  378

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLR  EGV VQHEPLGGYIS  +KQ ++P  E
Sbjct  379  MSMRAGIAADAAAALLFRILSQPALLFPPLRHAEGVQVQHEPLGGYISSYKKQLEVPASE  438

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            ATVEATAQGIASMLCAHGP+VEW
Sbjct  439  ATVEATAQGIASMLCAHGPDVEW  461



>gb|AGU91438.1| GIGANTEA-like protein, partial [Chrysanthemum boreale]
Length=949

 Score =   304 bits (779),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTT MDEHLV GLPALEPYARLFHRYYAIASP
Sbjct  259  LSVCDEEVTRYETATLTAVAVPALLLPPPTTAMDEHLVAGLPALEPYARLFHRYYAIASP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLPRNWMHLHFLRAIG A
Sbjct  319  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGMRLPRNWMHLHFLRAIGTA  378

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPL QVEGV V  EP G Y+S  +KQR +P  E
Sbjct  379  MSMRAGIAADAAAALLFRILSQPALLFPPLSQVEGVEVPQEPTGDYVSTHKKQRQMPVAE  438

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  439  ATIEATAQGIASMLCAHGPEVEW  461



>ref|XP_010915066.1| PREDICTED: protein GIGANTEA-like [Elaeis guineensis]
Length=1171

 Score =   306 bits (784),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  259  LSVCDEEVARYETANLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLPRNWMHLHFLRAIG A
Sbjct  319  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGMRLPRNWMHLHFLRAIGTA  378

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLR  EGV VQHEPLGGYIS  +KQ ++P  E
Sbjct  379  MSMRAGIAADAAAALLFRILSQPALLFPPLRHAEGVQVQHEPLGGYISSYKKQLEVPASE  438

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            ATVEATAQGIASMLCAHGP+VEW
Sbjct  439  ATVEATAQGIASMLCAHGPDVEW  461



>ref|XP_003556164.1| PREDICTED: protein GIGANTEA isoformX1 [Glycine max]
 ref|XP_006606175.1| PREDICTED: protein GIGANTEA isoform X2 [Glycine max]
 ref|XP_006606176.1| PREDICTED: protein GIGANTEA isoform X3 [Glycine max]
 ref|XP_006606177.1| PREDICTED: protein GIGANTEA isoform X4 [Glycine max]
 gb|ACA24489.1| gigantea-like protein 1 [Glycine max]
Length=1175

 Score =   306 bits (783),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+R ET TLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  263  LSVCDDEVARNETTTLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  322

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  323  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGIRLPRNWMHLHFLRAIGTA  382

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQV+GV VQHEPLGGYIS  +KQ ++P  E
Sbjct  383  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGVEVQHEPLGGYISSYKKQIEVPAAE  442

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            A++EATAQGIASMLCAHGPEVEW
Sbjct  443  ASIEATAQGIASMLCAHGPEVEW  465



>dbj|BAJ22595.1| GIGANTEA [Glycine max]
Length=1168

 Score =   306 bits (783),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+R ET TLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  256  LSVCDDEVARNETTTLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  315

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  316  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGIRLPRNWMHLHFLRAIGTA  375

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQV+GV VQHEPLGGYIS  +KQ ++P  E
Sbjct  376  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGVEVQHEPLGGYISSYKKQIEVPAAE  435

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            A++EATAQGIASMLCAHGPEVEW
Sbjct  436  ASIEATAQGIASMLCAHGPEVEW  458



>ref|NP_001239995.1| uncharacterized protein LOC100800578 [Glycine max]
 gb|ACJ65313.1| GI2 protein [Glycine max]
 dbj|BAJ22594.1| GIGANTEA [Glycine max]
Length=1170

 Score =   305 bits (782),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+R ETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  256  LSVCDDEVARNETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  315

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  316  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGIRLPRNWMHLHFLRAIGTA  375

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQV+GV VQHEPLGGYIS  +KQ ++P  E
Sbjct  376  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGVEVQHEPLGGYISSYKKQIEVPAAE  435

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            A++EATAQGIASMLCAHGPEVEW
Sbjct  436  ASIEATAQGIASMLCAHGPEVEW  458



>ref|XP_006588466.1| PREDICTED: uncharacterized protein LOC100800578 isoform X1 [Glycine 
max]
 ref|XP_006588467.1| PREDICTED: uncharacterized protein LOC100800578 isoform X2 [Glycine 
max]
 ref|XP_006588468.1| PREDICTED: uncharacterized protein LOC100800578 isoform X3 [Glycine 
max]
Length=1177

 Score =   305 bits (782),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+R ETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  263  LSVCDDEVARNETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  322

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  323  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGIRLPRNWMHLHFLRAIGTA  382

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQV+GV VQHEPLGGYIS  +KQ ++P  E
Sbjct  383  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGVEVQHEPLGGYISSYKKQIEVPAAE  442

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            A++EATAQGIASMLCAHGPEVEW
Sbjct  443  ASIEATAQGIASMLCAHGPEVEW  465



>ref|XP_002264755.1| PREDICTED: protein GIGANTEA [Vitis vinifera]
 ref|XP_010665061.1| PREDICTED: protein GIGANTEA [Vitis vinifera]
 ref|XP_010665062.1| PREDICTED: protein GIGANTEA [Vitis vinifera]
Length=1170

 Score =   305 bits (781),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  258  LSVCDEEVARYETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGMRLPRNWMHLHFLRAIGTA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFR+LSQPALLFPPLRQVEG   QHEPL GYIS  +KQ ++P  E
Sbjct  378  MSMRAGIAADAAAALLFRVLSQPALLFPPLRQVEGFEFQHEPLDGYISSYKKQIEVPATE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  438  ATIEATAQGIASMLCAHGPEVEW  460



>emb|CAN81809.1| hypothetical protein VITISV_032939 [Vitis vinifera]
Length=1172

 Score =   305 bits (781),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  260  LSVCDEEVARYETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  319

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  320  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGMRLPRNWMHLHFLRAIGTA  379

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFR+LSQPALLFPPLRQVEG   QHEPL GYIS  +KQ ++P  E
Sbjct  380  MSMRAGIAADAAAALLFRVLSQPALLFPPLRQVEGFEFQHEPLDGYISSYKKQIEVPATE  439

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  440  ATIEATAQGIASMLCAHGPEVEW  462



>ref|XP_010261025.1| PREDICTED: protein GIGANTEA-like isoform X2 [Nelumbo nucifera]
Length=1102

 Score =   304 bits (779),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 192/204 (94%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTTP+DEHLV GLPALEPYARLFHRYYA+A+P
Sbjct  185  LSVCDEEVARYETATLTAAAVPALLLPPPTTPLDEHLVAGLPALEPYARLFHRYYAVATP  244

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASG-LRLPRNWMHLHFLRAIGI  358
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG +RLPRNWMHLHFLRAIGI
Sbjct  245  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGGMRLPRNWMHLHFLRAIGI  304

Query  359  AMSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEI  538
            AMSMRAGIAADAAAALLFRILSQ ALLFPPLRQ EGV VQHEPLGGYIS  RKQ ++P  
Sbjct  305  AMSMRAGIAADAAAALLFRILSQHALLFPPLRQAEGVEVQHEPLGGYISCHRKQIEVPGA  364

Query  539  EATVEATAQGIASMLCAHGPEVEW  610
            EAT+EATAQGIASM CAHGPEVEW
Sbjct  365  EATIEATAQGIASMFCAHGPEVEW  388



>gb|ADK60834.1| gigantea, partial [Arachis diogoi]
Length=184

 Score =   281 bits (718),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = +2

Query  98   MDEHLVVGLPALEPYARLFHRYYAIASPSATQRLLLGLLEAPPSWAPDALDASVQLVELL  277
            +DEHLV GLPALEPYARLFHRYYAIA+PSATQRLLLGLLEAPPSWAPDALDA+VQLVELL
Sbjct  1    LDEHLVAGLPALEPYARLFHRYYAIATPSATQRLLLGLLEAPPSWAPDALDAAVQLVELL  60

Query  278  RAAEDYASGLRLPRNWMHLHFLRAIGIAMSMRagiaadaaaaLLFRILSQPALLFPPLRQ  457
            RAAED+ASG+RLPRNWMH HFLRAIG AMSMRAG+AADAAAALLFRILSQPALLFPPLRQ
Sbjct  61   RAAEDFASGIRLPRNWMHFHFLRAIGTAMSMRAGVAADAAAALLFRILSQPALLFPPLRQ  120

Query  458  VEGVGVQHEPLGGYISWDRKQRDIPEIEATVEATAQGIASMLCAHGPEVEW  610
            V+GV VQHEP+GGYIS  RKQ +    EATV+ATAQGIASMLCAHGPEVEW
Sbjct  121  VDGVEVQHEPMGGYISSYRKQIEALAAEATVDATAQGIASMLCAHGPEVEW  171



>dbj|BAN82581.1| gigantea [Glycine max]
 dbj|BAN82582.1| gigantea [Glycine max]
 dbj|BAN82583.1| gigantea [Glycine max]
 dbj|BAN82584.1| gigantea [Glycine max]
 dbj|BAN82585.1| gigantea [Glycine max]
 dbj|BAN82587.1| gigantea [Glycine max]
 dbj|BAN82588.1| gigantea [Glycine max]
Length=1170

 Score =   305 bits (780),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+R ETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  256  LSVCDDEVARNETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  315

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  316  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGIRLPRNWMHLHFLRAIGTA  375

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQV+GV VQHEPLGGYIS  +KQ ++P  E
Sbjct  376  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGVEVQHEPLGGYISSYKKQIEVPAAE  435

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            A++EATAQGIASMLCAHGPEVEW
Sbjct  436  ASIEATAQGIASMLCAHGPEVEW  458



>dbj|BAN82589.1| gigantea [Glycine max]
Length=1171

 Score =   305 bits (780),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+R ETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  257  LSVCDDEVARNETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  316

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  317  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGIRLPRNWMHLHFLRAIGTA  376

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQV+GV VQHEPLGGYIS  +KQ ++P  E
Sbjct  377  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGVEVQHEPLGGYISSYKKQIEVPAAE  436

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            A++EATAQGIASMLCAHGPEVEW
Sbjct  437  ASIEATAQGIASMLCAHGPEVEW  459



>dbj|BAN82586.1| gigantea [Glycine max]
 dbj|BAN82590.1| gigantea [Glycine max]
 dbj|BAN82591.1| gigantea [Glycine max]
 dbj|BAN82592.1| gigantea [Glycine max]
Length=1170

 Score =   305 bits (780),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+R ETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  256  LSVCDDEVARNETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  315

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  316  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGIRLPRNWMHLHFLRAIGTA  375

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQV+GV VQHEPLGGYIS  +KQ ++P  E
Sbjct  376  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGVEVQHEPLGGYISSYKKQIEVPAAE  435

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            A++EATAQGIASMLCAHGPEVEW
Sbjct  436  ASIEATAQGIASMLCAHGPEVEW  458



>gb|KHN41309.1| Protein GIGANTEA [Glycine soja]
Length=1166

 Score =   305 bits (780),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  259  LSVCDDEVARYETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYA G+RLPRNWMH HFLRAIG A
Sbjct  319  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYACGIRLPRNWMHFHFLRAIGTA  378

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMR+G+AADAAAALLFRILSQPALLFPPLRQV+GV VQHEPLGGYIS +RKQ +    E
Sbjct  379  MSMRSGVAADAAAALLFRILSQPALLFPPLRQVDGVEVQHEPLGGYISSNRKQIEAASAE  438

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIAS+LCAHGPEVEW
Sbjct  439  ATIEATAQGIASVLCAHGPEVEW  461



>gb|ACJ65314.1| GI3 protein [Glycine max]
Length=1155

 Score =   304 bits (779),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  248  LSVCDDEVARYETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  307

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYA G+RLPRNWMH HFLRAIG A
Sbjct  308  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYACGIRLPRNWMHFHFLRAIGTA  367

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMR+G+AADAAAALLFRILSQPALLFPPLRQV+GV VQHEPLGGYIS +RKQ +    E
Sbjct  368  MSMRSGVAADAAAALLFRILSQPALLFPPLRQVDGVEVQHEPLGGYISSNRKQIEAASAE  427

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIAS+LCAHGPEVEW
Sbjct  428  ATIEATAQGIASVLCAHGPEVEW  450



>gb|AES62297.2| gigantea protein 1B [Medicago truncatula]
Length=975

 Score =   302 bits (773),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+R ETA LTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  263  LSVCDDEVARNETAILTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  322

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAE+YASG+RLPRNWMHLHFLRAIG A
Sbjct  323  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEEYASGIRLPRNWMHLHFLRAIGTA  382

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQV+GV VQHEPLGGYIS   KQ ++P  E
Sbjct  383  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGVEVQHEPLGGYISSYSKQIEVPSAE  442

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            A+++ATAQGIASMLCAHGPEVEW
Sbjct  443  ASIDATAQGIASMLCAHGPEVEW  465



>ref|XP_010261026.1| PREDICTED: protein GIGANTEA-like isoform X3 [Nelumbo nucifera]
Length=1079

 Score =   303 bits (776),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 192/204 (94%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTTP+DEHLV GLPALEPYARLFHRYYA+A+P
Sbjct  257  LSVCDEEVARYETATLTAAAVPALLLPPPTTPLDEHLVAGLPALEPYARLFHRYYAVATP  316

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASG-LRLPRNWMHLHFLRAIGI  358
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG +RLPRNWMHLHFLRAIGI
Sbjct  317  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGGMRLPRNWMHLHFLRAIGI  376

Query  359  AMSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEI  538
            AMSMRAGIAADAAAALLFRILSQ ALLFPPLRQ EGV VQHEPLGGYIS  RKQ ++P  
Sbjct  377  AMSMRAGIAADAAAALLFRILSQHALLFPPLRQAEGVEVQHEPLGGYISCHRKQIEVPGA  436

Query  539  EATVEATAQGIASMLCAHGPEVEW  610
            EAT+EATAQGIASM CAHGPEVEW
Sbjct  437  EATIEATAQGIASMFCAHGPEVEW  460



>ref|XP_010261024.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
Length=1174

 Score =   303 bits (777),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 192/204 (94%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTTP+DEHLV GLPALEPYARLFHRYYA+A+P
Sbjct  257  LSVCDEEVARYETATLTAAAVPALLLPPPTTPLDEHLVAGLPALEPYARLFHRYYAVATP  316

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASG-LRLPRNWMHLHFLRAIGI  358
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG +RLPRNWMHLHFLRAIGI
Sbjct  317  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGGMRLPRNWMHLHFLRAIGI  376

Query  359  AMSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEI  538
            AMSMRAGIAADAAAALLFRILSQ ALLFPPLRQ EGV VQHEPLGGYIS  RKQ ++P  
Sbjct  377  AMSMRAGIAADAAAALLFRILSQHALLFPPLRQAEGVEVQHEPLGGYISCHRKQIEVPGA  436

Query  539  EATVEATAQGIASMLCAHGPEVEW  610
            EAT+EATAQGIASM CAHGPEVEW
Sbjct  437  EATIEATAQGIASMFCAHGPEVEW  460



>ref|XP_007143577.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
 ref|XP_007143578.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
 gb|ESW15571.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
 gb|ESW15572.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
Length=1199

 Score =   303 bits (776),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+R ETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  265  LSVCDDEVARNETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  324

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  325  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGIRLPRNWMHLHFLRAIGTA  384

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLR V+GV VQHEPLGGYIS  +KQ ++P  E
Sbjct  385  MSMRAGIAADAAAALLFRILSQPALLFPPLRHVDGVEVQHEPLGGYISSYKKQIEVPAAE  444

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            A++EATAQGIASMLCAHGPEVEW
Sbjct  445  ASIEATAQGIASMLCAHGPEVEW  467



>dbj|BAK19067.1| GIGANTEA [Ipomoea nil]
Length=1166

 Score =   302 bits (774),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTAIAVPALLLPPPTTPMDEHLV GLPALEPYARLFHRYYAIASP
Sbjct  257  LSVCDEEVARYETATLTAIAVPALLLPPPTTPMDEHLVAGLPALEPYARLFHRYYAIASP  316

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASGLRLPRNWM LHFLRAIGIA
Sbjct  317  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGLRLPRNWMQLHFLRAIGIA  376

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPL QVEGV VQHEPLGGYIS D+KQR++P  E
Sbjct  377  MSMRAGIAADAAAALLFRILSQPALLFPPLGQVEGVEVQHEPLGGYISCDKKQREVPAAE  436

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            ATVEATAQGIASMLCAHGPEVEW
Sbjct  437  ATVEATAQGIASMLCAHGPEVEW  459



>ref|XP_008786518.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
 ref|XP_008786528.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
 ref|XP_008786537.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
Length=1170

 Score =   302 bits (773),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 178/203 (88%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  259  LSVCDEEVARYETANLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLPRNW+HLHFLRAIG A
Sbjct  319  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGMRLPRNWLHLHFLRAIGTA  378

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPP R  EGV VQHEPLGGYIS  +KQ ++P  E
Sbjct  379  MSMRAGIAADAAAALLFRILSQPALLFPPPRHAEGVEVQHEPLGGYISSYKKQLEVPASE  438

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            ATVEATAQGIASMLCAHGP+VEW
Sbjct  439  ATVEATAQGIASMLCAHGPDVEW  461



>gb|KHN17039.1| Protein GIGANTEA [Glycine soja]
Length=1149

 Score =   301 bits (772),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+R ETATLTA AVPALLLPPPTT +DEHLV GLPALEP ARLFHRYYAIA+P
Sbjct  263  LSVCDDEVARNETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPSARLFHRYYAIATP  322

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  323  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGIRLPRNWMHLHFLRAIGTA  382

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQV+GV VQHEPLGGYIS  +KQ ++P  E
Sbjct  383  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGVEVQHEPLGGYISSYKKQIEVPAAE  442

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            A++EATAQGIASMLCAHGPEVEW
Sbjct  443  ASIEATAQGIASMLCAHGPEVEW  465



>gb|AES62299.2| gigantea protein 1B [Medicago truncatula]
Length=1177

 Score =   301 bits (772),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+R ETA LTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  263  LSVCDDEVARNETAILTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  322

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAE+YASG+RLPRNWMHLHFLRAIG A
Sbjct  323  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEEYASGIRLPRNWMHLHFLRAIGTA  382

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQV+GV VQHEPLGGYIS   KQ ++P  E
Sbjct  383  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGVEVQHEPLGGYISSYSKQIEVPSAE  442

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            A+++ATAQGIASMLCAHGPEVEW
Sbjct  443  ASIDATAQGIASMLCAHGPEVEW  465



>gb|ACJ65312.1| GI1 protein [Glycine max]
Length=1176

 Score =   301 bits (771),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 179/204 (88%), Positives = 191/204 (94%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+R ET TLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  263  LSVCDDEVARNETTTLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  322

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLR-LPRNWMHLHFLRAIGI  358
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+R LPRNWMHLHFLRAIG 
Sbjct  323  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGIRALPRNWMHLHFLRAIGT  382

Query  359  AMSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEI  538
            AMSMRAGIAADAAAALLFRILSQPALLFPPLRQV+GV VQHEPLGGYIS  +KQ ++P  
Sbjct  383  AMSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGVEVQHEPLGGYISSYKKQIEVPAA  442

Query  539  EATVEATAQGIASMLCAHGPEVEW  610
            EA++EATAQGIASMLCAHGPEVEW
Sbjct  443  EASIEATAQGIASMLCAHGPEVEW  466



>ref|XP_003592048.1| Protein GIGANTEA [Medicago truncatula]
Length=1200

 Score =   301 bits (771),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+R ETA LTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  258  LSVCDDEVARNETAILTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAE+YASG+RLPRNWMHLHFLRAIG A
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEEYASGIRLPRNWMHLHFLRAIGTA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQV+GV VQHEPLGGYIS   KQ ++P  E
Sbjct  378  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGVEVQHEPLGGYISSYSKQIEVPSAE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            A+++ATAQGIASMLCAHGPEVEW
Sbjct  438  ASIDATAQGIASMLCAHGPEVEW  460



>ref|XP_003592046.1| Protein GIGANTEA [Medicago truncatula]
Length=1172

 Score =   301 bits (771),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+R ETA LTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  258  LSVCDDEVARNETAILTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAE+YASG+RLPRNWMHLHFLRAIG A
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEEYASGIRLPRNWMHLHFLRAIGTA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQV+GV VQHEPLGGYIS   KQ ++P  E
Sbjct  378  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGVEVQHEPLGGYISSYSKQIEVPSAE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            A+++ATAQGIASMLCAHGPEVEW
Sbjct  438  ASIDATAQGIASMLCAHGPEVEW  460



>ref|XP_011100590.1| PREDICTED: protein GIGANTEA-like [Sesamum indicum]
Length=1166

 Score =   301 bits (770),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 188/204 (92%), Positives = 198/204 (97%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTTPMDEHLVVGLPALEPYARLFHRYYAIASP
Sbjct  257  LSVCDEEVARYETATLTAAAVPALLLPPPTTPMDEHLVVGLPALEPYARLFHRYYAIASP  316

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLPRNWMHLHFLRAIGIA
Sbjct  317  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGMRLPRNWMHLHFLRAIGIA  376

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRK-QRDIPEI  538
            MSMRAG+AAD+AAALLFRILSQPALLFPPLRQV+GVGVQHEPLGGYIS + K QR++P  
Sbjct  377  MSMRAGVAADSAAALLFRILSQPALLFPPLRQVDGVGVQHEPLGGYISSELKLQRELPAA  436

Query  539  EATVEATAQGIASMLCAHGPEVEW  610
            EATVEATAQGIASMLCAHGPEVEW
Sbjct  437  EATVEATAQGIASMLCAHGPEVEW  460



>gb|ABP81863.1| LATE BLOOMER 1 [Pisum sativum]
Length=1175

 Score =   301 bits (770),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+R ETA LTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  261  LSVCDDEVARNETAILTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  320

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAE+YASG+RLPRNWMHLHFLRAIG A
Sbjct  321  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEEYASGIRLPRNWMHLHFLRAIGTA  380

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQV+GV VQHEPLGGYIS   KQ ++P  E
Sbjct  381  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGVEVQHEPLGGYISSYSKQIEVPAAE  440

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            A+++ATAQGIASMLCAHGPEVEW
Sbjct  441  ASIDATAQGIASMLCAHGPEVEW  463



>ref|XP_004496436.1| PREDICTED: protein GIGANTEA-like isoform X2 [Cicer arietinum]
Length=1152

 Score =   300 bits (769),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+R ETA LTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  235  LSVCDDEVARNETAILTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  294

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAE+YASG+RLPRNWMHLHFLRAIG A
Sbjct  295  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEEYASGIRLPRNWMHLHFLRAIGTA  354

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQV+GV VQHEPLGGYIS   KQ ++P  E
Sbjct  355  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGVEVQHEPLGGYISSYSKQIEVPAAE  414

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            A+++ATAQGIAS+LCAHGPEVEW
Sbjct  415  ASIDATAQGIASLLCAHGPEVEW  437



>gb|KHG25928.1| Protein GIGANTEA [Gossypium arboreum]
 gb|KHG25929.1| Protein GIGANTEA [Gossypium arboreum]
Length=755

 Score =   294 bits (752),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 182/203 (90%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  259  LSVCDEEVARYETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLPRNWMHLHFLRAIG A
Sbjct  319  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGIRLPRNWMHLHFLRAIGTA  378

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMR GIAADAAAALLFRILSQPALLFPPLRQVEGV VQHEP GGYIS  RKQ ++P  E
Sbjct  379  MSMRVGIAADAAAALLFRILSQPALLFPPLRQVEGVAVQHEPSGGYISCYRKQIEVPAAE  438

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  439  ATIEATAQGIASMLCAHGPEVEW  461



>ref|XP_004496435.1| PREDICTED: protein GIGANTEA-like isoform X1 [Cicer arietinum]
Length=1180

 Score =   299 bits (766),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+R ETA LTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  263  LSVCDDEVARNETAILTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  322

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAE+YASG+RLPRNWMHLHFLRAIG A
Sbjct  323  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEEYASGIRLPRNWMHLHFLRAIGTA  382

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQV+GV VQHEPLGGYIS   KQ ++P  E
Sbjct  383  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGVEVQHEPLGGYISSYSKQIEVPAAE  442

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            A+++ATAQGIAS+LCAHGPEVEW
Sbjct  443  ASIDATAQGIASLLCAHGPEVEW  465



>gb|AFW80279.1| gigantea1A isoform 1 [Zea mays]
 gb|AFW80280.1| gigantea1A isoform 2 [Zea mays]
Length=968

 Score =   296 bits (757),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPTTP+DEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  261  LSVCDEEVARYETANLTAAAVPALLLPPPTTPLDEHLVAGLPPLEPYARLFHRYYAIATP  320

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL GLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLP+NWMHLHFLRAIG A
Sbjct  321  SATQRLLFGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGMRLPKNWMHLHFLRAIGTA  380

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAAD AAALLFRILSQP LLFPPLR  EGV V HEPLGGY+S  +KQ ++P  E
Sbjct  381  MSMRAGIAADTAAALLFRILSQPTLLFPPLRHAEGVEVHHEPLGGYVSSYKKQLEVPASE  440

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT++ATAQGIAS+LCAHGP+VEW
Sbjct  441  ATIDATAQGIASLLCAHGPDVEW  463



>ref|XP_009408933.1| PREDICTED: protein GIGANTEA-like isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009408934.1| PREDICTED: protein GIGANTEA-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=1205

 Score =   298 bits (763),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+ YETA LTA AVPALLLPPPTTP+DEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  259  LSVCDEEVAHYETANLTAAAVPALLLPPPTTPLDEHLVAGLPPLEPYARLFHRYYAIATP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  319  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGMRLPRNWMHLHFLRAIGIA  378

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILSQP LLFPPLR  EGV V HEPLGG+IS  +KQ ++P  E
Sbjct  379  MSMRAGVAADAAAALLFRILSQPTLLFPPLRHAEGVEVHHEPLGGFISSYKKQLEVPASE  438

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            A++EATAQGIASMLCAHGP+VEW
Sbjct  439  ASIEATAQGIASMLCAHGPDVEW  461



>ref|XP_009408935.1| PREDICTED: protein GIGANTEA-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=1163

 Score =   298 bits (762),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+ YETA LTA AVPALLLPPPTTP+DEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  259  LSVCDEEVAHYETANLTAAAVPALLLPPPTTPLDEHLVAGLPPLEPYARLFHRYYAIATP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  319  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGMRLPRNWMHLHFLRAIGIA  378

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILSQP LLFPPLR  EGV V HEPLGG+IS  +KQ ++P  E
Sbjct  379  MSMRAGVAADAAAALLFRILSQPTLLFPPLRHAEGVEVHHEPLGGFISSYKKQLEVPASE  438

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            A++EATAQGIASMLCAHGP+VEW
Sbjct  439  ASIEATAQGIASMLCAHGPDVEW  461



>ref|XP_002307516.1| GIGANTEA family protein [Populus trichocarpa]
 gb|EEE94512.1| GIGANTEA family protein [Populus trichocarpa]
Length=1171

 Score =   298 bits (762),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 185/203 (91%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  259  LSVCDEEVARYETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  319  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGIRLPRNWMHLHFLRAIGTA  378

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGV VQHEPLGGYIS  RKQ ++P  E
Sbjct  379  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGVEVQHEPLGGYISCYRKQIEVPAAE  438

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  439  ATIEATAQGIASMLCAHGPEVEW  461



>ref|XP_011044276.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
Length=1171

 Score =   297 bits (761),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 185/203 (91%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  259  LSVCDEEVARYETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  319  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGIRLPRNWMHLHFLRAIGTA  378

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGV VQHEPLGGYIS  RKQ ++P  E
Sbjct  379  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGVEVQHEPLGGYISCYRKQIEVPAAE  438

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  439  ATIEATAQGIASMLCAHGPEVEW  461



>ref|XP_010925341.1| PREDICTED: protein GIGANTEA-like [Elaeis guineensis]
Length=1170

 Score =   296 bits (759),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPTTP+DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  259  LSVCDEEVARYETANLTAAAVPALLLPPPTTPLDEHLVAGLPALEPYARLFHRYYAIATP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLPR WMHLHFLRAIG A
Sbjct  319  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGMRLPRYWMHLHFLRAIGTA  378

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MS RAGIAADAAAALLFRILSQPALLFPPL+  EG  VQHEPLGGY+S  +KQ ++P  E
Sbjct  379  MSTRAGIAADAAAALLFRILSQPALLFPPLKHAEGAAVQHEPLGGYLSSYKKQLEVPASE  438

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            ATVEATAQGIASMLCAHGP+VEW
Sbjct  439  ATVEATAQGIASMLCAHGPDVEW  461



>gb|KJB59490.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=1022

 Score =   295 bits (755),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA+LTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  113  LSVCDEEVARYETASLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  172

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLPRNWMHLHFLRAIG A
Sbjct  173  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGIRLPRNWMHLHFLRAIGTA  232

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPP+RQVEGV VQHEP GGYIS  RKQ ++P  E
Sbjct  233  MSMRAGIAADAAAALLFRILSQPALLFPPIRQVEGVEVQHEPSGGYISCYRKQIEVPAAE  292

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  293  ATIEATAQGIASMLCAHGPEVEW  315



>ref|XP_008672375.1| PREDICTED: uncharacterized protein LOC100272803 isoform X1 [Zea 
mays]
 ref|XP_008672376.1| PREDICTED: uncharacterized protein LOC100272803 isoform X1 [Zea 
mays]
 ref|XP_008672377.1| PREDICTED: uncharacterized protein LOC100272803 isoform X1 [Zea 
mays]
 tpg|DAA53146.1| TPA: gigantea1B [Zea mays]
Length=1160

 Score =   296 bits (758),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPTTP+DEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  261  LSVCDEEVARYETANLTAAAVPALLLPPPTTPLDEHLVAGLPPLEPYARLFHRYYAIATP  320

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL GLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLP+NWMHLHFLRAIG A
Sbjct  321  SATQRLLFGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGMRLPKNWMHLHFLRAIGTA  380

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAAD AAALLFRILSQP LLFPPLR  EGV V HEPLGGY+S  +KQ ++P  E
Sbjct  381  MSMRAGIAADTAAALLFRILSQPTLLFPPLRHAEGVDVHHEPLGGYVSSYKKQLEVPASE  440

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT++ATAQGIAS+LCAHGP+VEW
Sbjct  441  ATIDATAQGIASLLCAHGPDVEW  463



>ref|NP_001140728.1| uncharacterized protein LOC100272803 [Zea mays]
 tpg|DAA06171.1| TPA_inf: gigantea 1B [Zea mays]
Length=1160

 Score =   296 bits (758),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPTTP+DEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  261  LSVCDEEVARYETANLTAAAVPALLLPPPTTPLDEHLVAGLPPLEPYARLFHRYYAIATP  320

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL GLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLP+NWMHLHFLRAIG A
Sbjct  321  SATQRLLFGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGMRLPKNWMHLHFLRAIGTA  380

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAAD AAALLFRILSQP LLFPPLR  EGV V HEPLGGY+S  +KQ ++P  E
Sbjct  381  MSMRAGIAADTAAALLFRILSQPTLLFPPLRHAEGVDVHHEPLGGYVSSYKKQLEVPASE  440

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT++ATAQGIAS+LCAHGP+VEW
Sbjct  441  ATIDATAQGIASLLCAHGPDVEW  463



>gb|KJB59491.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=975

 Score =   294 bits (753),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA+LTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  259  LSVCDEEVARYETASLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLPRNWMHLHFLRAIG A
Sbjct  319  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGIRLPRNWMHLHFLRAIGTA  378

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPP+RQVEGV VQHEP GGYIS  RKQ ++P  E
Sbjct  379  MSMRAGIAADAAAALLFRILSQPALLFPPIRQVEGVEVQHEPSGGYISCYRKQIEVPAAE  438

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  439  ATIEATAQGIASMLCAHGPEVEW  461



>gb|AFW80282.1| gigantea1A [Zea mays]
Length=1085

 Score =   295 bits (756),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPTTP+DEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  261  LSVCDEEVARYETANLTAAAVPALLLPPPTTPLDEHLVAGLPPLEPYARLFHRYYAIATP  320

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL GLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLP+NWMHLHFLRAIG A
Sbjct  321  SATQRLLFGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGMRLPKNWMHLHFLRAIGTA  380

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAAD AAALLFRILSQP LLFPPLR  EGV V HEPLGGY+S  +KQ ++P  E
Sbjct  381  MSMRAGIAADTAAALLFRILSQPTLLFPPLRHAEGVEVHHEPLGGYVSSYKKQLEVPASE  440

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT++ATAQGIAS+LCAHGP+VEW
Sbjct  441  ATIDATAQGIASLLCAHGPDVEW  463



>gb|AFW80281.1| gigantea1A [Zea mays]
Length=1086

 Score =   295 bits (756),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPTTP+DEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  261  LSVCDEEVARYETANLTAAAVPALLLPPPTTPLDEHLVAGLPPLEPYARLFHRYYAIATP  320

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL GLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLP+NWMHLHFLRAIG A
Sbjct  321  SATQRLLFGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGMRLPKNWMHLHFLRAIGTA  380

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAAD AAALLFRILSQP LLFPPLR  EGV V HEPLGGY+S  +KQ ++P  E
Sbjct  381  MSMRAGIAADTAAALLFRILSQPTLLFPPLRHAEGVEVHHEPLGGYVSSYKKQLEVPASE  440

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT++ATAQGIAS+LCAHGP+VEW
Sbjct  441  ATIDATAQGIASLLCAHGPDVEW  463



>gb|KJB59493.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=973

 Score =   294 bits (752),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA+LTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  259  LSVCDEEVARYETASLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLPRNWMHLHFLRAIG A
Sbjct  319  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGIRLPRNWMHLHFLRAIGTA  378

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPP+RQVEGV VQHEP GGYIS  RKQ ++P  E
Sbjct  379  MSMRAGIAADAAAALLFRILSQPALLFPPIRQVEGVEVQHEPSGGYISCYRKQIEVPAAE  438

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  439  ATIEATAQGIASMLCAHGPEVEW  461



>ref|NP_001288586.1| gigantea like1a [Zea mays]
 ref|XP_008655715.1| PREDICTED: protein GIGANTEA [Zea mays]
 ref|XP_008655716.1| PREDICTED: protein GIGANTEA [Zea mays]
 tpg|DAA06172.1| TPA_inf: gigantea 1A [Zea mays]
 gb|AFW80283.1| gigantea isoform 1 [Zea mays]
 gb|AFW80284.1| gigantea isoform 2 [Zea mays]
Length=1162

 Score =   295 bits (756),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPTTP+DEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  261  LSVCDEEVARYETANLTAAAVPALLLPPPTTPLDEHLVAGLPPLEPYARLFHRYYAIATP  320

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL GLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLP+NWMHLHFLRAIG A
Sbjct  321  SATQRLLFGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGMRLPKNWMHLHFLRAIGTA  380

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAAD AAALLFRILSQP LLFPPLR  EGV V HEPLGGY+S  +KQ ++P  E
Sbjct  381  MSMRAGIAADTAAALLFRILSQPTLLFPPLRHAEGVEVHHEPLGGYVSSYKKQLEVPASE  440

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT++ATAQGIAS+LCAHGP+VEW
Sbjct  441  ATIDATAQGIASLLCAHGPDVEW  463



>gb|ABV55997.1| gigantea1B [Zea mays]
Length=331

 Score =   277 bits (709),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = +2

Query  98   MDEHLVVGLPALEPYARLFHRYYAIASPSATQRLLLGLLEAPPSWAPDALDASVQLVELL  277
            +DEHLV GLP LEPYARLFHRYYAIA+PSATQRLL GLLEAPPSWAPDALDA+VQLVELL
Sbjct  9    LDEHLVAGLPPLEPYARLFHRYYAIATPSATQRLLFGLLEAPPSWAPDALDAAVQLVELL  68

Query  278  RAAEDYASGLRLPRNWMHLHFLRAIGIAMSMRagiaadaaaaLLFRILSQPALLFPPLRQ  457
            RAAEDYASG+RLP+NWMHLHFLRAIG AMSMRAGIAAD AAALLFRILSQP LLFPPLR 
Sbjct  69   RAAEDYASGMRLPKNWMHLHFLRAIGTAMSMRAGIAADTAAALLFRILSQPTLLFPPLRH  128

Query  458  VEGVGVQHEPLGGYISWDRKQRDIPEIEATVEATAQGIASMLCAHGPEVEW  610
             EGV V HEPLGGY+S  +KQ ++P  EAT++ATAQGIAS+LCAHGP+VEW
Sbjct  129  AEGVDVHHEPLGGYVSSYKKQLEVPASEATIDATAQGIASLLCAHGPDVEW  179



>ref|XP_010062090.1| PREDICTED: protein GIGANTEA isoform X2 [Eucalyptus grandis]
 ref|XP_010062091.1| PREDICTED: protein GIGANTEA isoform X2 [Eucalyptus grandis]
Length=983

 Score =   293 bits (751),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  72   LSVCDEEVARYETATLTAVAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  131

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAE+YASG+RLPRNWMHLHFLRAIG A
Sbjct  132  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEEYASGMRLPRNWMHLHFLRAIGTA  191

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFR+LSQPALLFPPLRQVEGV VQHEPLGGY+S  +KQ ++P  E
Sbjct  192  MSMRAGVAADAAAALLFRVLSQPALLFPPLRQVEGVEVQHEPLGGYVSSYKKQIEVPAAE  251

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  252  ATIEATAQGIASMLCAHGPEVEW  274



>emb|CAB56058.1| gigantea homologue [Oryza sativa]
Length=975

 Score =   293 bits (750),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPTTP+DEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  77   LSVCDEEVARYETANLTAAAVPALLLPPPTTPLDEHLVAGLPPLEPYARLFHRYYAIATP  136

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL GLLEAPPSWAPDALDA+VQLVELLRAAEDY SG+RLP+NWMHLHFLRAIG A
Sbjct  137  SATQRLLFGLLEAPPSWAPDALDAAVQLVELLRAAEDYDSGMRLPKNWMHLHFLRAIGTA  196

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAAD +AALLFRILSQP LLFPPLR  EGV + HEPLGGY+S  ++Q ++P  E
Sbjct  197  MSMRAGIAADTSAALLFRILSQPTLLFPPLRHAEGVELHHEPLGGYVSSYKRQLEVPASE  256

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT++ATAQGIASMLCAHGP+VEW
Sbjct  257  ATIDATAQGIASMLCAHGPDVEW  279



>gb|KHN46389.1| Protein GIGANTEA, partial [Glycine soja]
Length=1157

 Score =   295 bits (755),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 180/221 (81%), Positives = 192/221 (87%), Gaps = 18/221 (8%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+R ETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  227  LSVCDDEVARNETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  286

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLR-----------------  310
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+R                 
Sbjct  287  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGIRAIGESASFPEFVTLNSE  346

Query  311  -LPRNWMHLHFLRAIGIAMSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEP  487
             LPRNWMHLHFLRAIG AMSMRAGIAADAAAALLFRILSQPALLFPPLRQV+GV VQHEP
Sbjct  347  NLPRNWMHLHFLRAIGTAMSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGVEVQHEP  406

Query  488  LGGYISWDRKQRDIPEIEATVEATAQGIASMLCAHGPEVEW  610
            LGGYIS  +KQ ++P  EA++EATAQGIASMLCAHGPEVEW
Sbjct  407  LGGYISSYKKQIEVPAAEASIEATAQGIASMLCAHGPEVEW  447



>dbj|BAM67030.1| gigantea-like [Chrysanthemum seticuspe f. boreale]
Length=1145

 Score =   295 bits (755),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTT MDEHLV GLPALEPYARLFHRYYAIASP
Sbjct  258  LSVCDEEVARYETATLTAAAVPALLLPPPTTSMDEHLVAGLPALEPYARLFHRYYAIASP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGMRLPRNWMHLHFLRAIGTA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAAD+AAALLFRILSQPALLFPPL QVEGV  Q E      S  +KQR++P  E
Sbjct  378  MSMRAGIAADSAAALLFRILSQPALLFPPLTQVEGVEEQQESPNSDSSNHKKQREMPTTE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  438  ATIEATAQGIASMLCAHGPEVEW  460



>ref|XP_009336496.1| PREDICTED: protein GIGANTEA-like [Pyrus x bretschneideri]
Length=1170

 Score =   295 bits (755),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 183/203 (90%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  258  LSVCDEEVARYETATLTAVAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGIRLPRNWMHLHFLRAIGTA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQV+GV VQHEPLGGYIS  +KQ ++P  E
Sbjct  378  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGVDVQHEPLGGYISSYKKQIELPAAE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  438  ATIEATAQGIASMLCAHGPEVEW  460



>ref|XP_008461914.1| PREDICTED: protein GIGANTEA-like isoform X3 [Cucumis melo]
Length=954

 Score =   293 bits (749),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  43   LSVCDEEVARYETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  102

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAE+YA+G+RLPRNWMHLHFLRAIG A
Sbjct  103  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEEYATGIRLPRNWMHLHFLRAIGTA  162

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQVE   VQ E LGGY S  R+Q ++   E
Sbjct  163  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEETDVQCESLGGYESLYREQIEVSAAE  222

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT++ATAQGIASMLCAHGPEVEW
Sbjct  223  ATIDATAQGIASMLCAHGPEVEW  245



>gb|AFK65758.1| GIGANTEA, partial [Chrysanthemum x morifolium]
Length=1151

 Score =   295 bits (754),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+A PALLLPPPTT MDEHLV GLPALEPYARLFHRYYAIASP
Sbjct  260  LSVCDEEVTRYETATLTAVAGPALLLPPPTTSMDEHLVAGLPALEPYARLFHRYYAIASP  319

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  320  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGMRLPRNWMHLHFLRAIGTA  379

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAAD+AAALLFRILSQPALLFPPL QVEGV  Q E      S  +KQR++P  E
Sbjct  380  MSMRAGIAADSAAALLFRILSQPALLFPPLTQVEGVEEQQESPSSDSSNHKKQREMPTTE  439

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  440  ATIEATAQGIASMLCAHGPEVEW  462



>gb|AGL61504.1| gigantea-like protein [Chrysanthemum x morifolium]
Length=1145

 Score =   295 bits (754),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTT MDEHLV GLPALEPYARLFHRYYAIASP
Sbjct  258  LSVCDEEVARYETATLTAAAVPALLLPPPTTSMDEHLVAGLPALEPYARLFHRYYAIASP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGMRLPRNWMHLHFLRAIGTA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAAD+AAALLFRILSQPALLFPPL QVEGV  Q E      S  +KQR++P  E
Sbjct  378  MSMRAGIAADSAAALLFRILSQPALLFPPLTQVEGVEEQQESPSSDSSNHKKQREMPTTE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  438  ATIEATAQGIASMLCAHGPEVEW  460



>ref|XP_009335139.1| PREDICTED: protein GIGANTEA-like [Pyrus x bretschneideri]
 ref|XP_009335140.1| PREDICTED: protein GIGANTEA-like [Pyrus x bretschneideri]
Length=1169

 Score =   295 bits (754),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 183/203 (90%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  257  LSVCDEEVARYETATLTAVAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  316

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  317  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGIRLPRNWMHLHFLRAIGTA  376

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQV+GV VQHEPLGGYIS  +KQ ++P  E
Sbjct  377  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGVEVQHEPLGGYISSYKKQIELPAAE  436

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  437  ATIEATAQGIASMLCAHGPEVEW  459



>gb|KJB28963.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=970

 Score =   293 bits (749),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  259  LSVCDEEVARYETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLPRNWMHLHFLRAIG A
Sbjct  319  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGIRLPRNWMHLHFLRAIGTA  378

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMR GIAADAAAALLFRILSQPALLFPPLRQVEGV VQHEP  GYIS  RKQ ++P  E
Sbjct  379  MSMRVGIAADAAAALLFRILSQPALLFPPLRQVEGVAVQHEPSDGYISCYRKQIEVPAAE  438

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  439  ATIEATAQGIASMLCAHGPEVEW  461



>gb|KJB59492.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=1055

 Score =   294 bits (752),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA+LTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  259  LSVCDEEVARYETASLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLPRNWMHLHFLRAIG A
Sbjct  319  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGIRLPRNWMHLHFLRAIGTA  378

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPP+RQVEGV VQHEP GGYIS  RKQ ++P  E
Sbjct  379  MSMRAGIAADAAAALLFRILSQPALLFPPIRQVEGVEVQHEPSGGYISCYRKQIEVPAAE  438

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  439  ATIEATAQGIASMLCAHGPEVEW  461



>ref|XP_008386373.1| PREDICTED: protein GIGANTEA-like [Malus domestica]
Length=1169

 Score =   295 bits (754),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 183/203 (90%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  257  LSVCDEEVARYETATLTAVAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  316

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  317  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGIRLPRNWMHLHFLRAIGTA  376

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQV+GV VQHEPLGGYIS  +KQ ++P  E
Sbjct  377  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGVEVQHEPLGGYISSYKKQIELPAAE  436

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  437  ATIEATAQGIASMLCAHGPEVEW  459



>gb|KJB28960.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=1001

 Score =   293 bits (749),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  259  LSVCDEEVARYETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLPRNWMHLHFLRAIG A
Sbjct  319  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGIRLPRNWMHLHFLRAIGTA  378

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMR GIAADAAAALLFRILSQPALLFPPLRQVEGV VQHEP  GYIS  RKQ ++P  E
Sbjct  379  MSMRVGIAADAAAALLFRILSQPALLFPPLRQVEGVAVQHEPSDGYISCYRKQIEVPAAE  438

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  439  ATIEATAQGIASMLCAHGPEVEW  461



>gb|KJB59494.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59495.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59496.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59497.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59498.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=1168

 Score =   294 bits (753),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA+LTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  259  LSVCDEEVARYETASLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLPRNWMHLHFLRAIG A
Sbjct  319  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGIRLPRNWMHLHFLRAIGTA  378

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPP+RQVEGV VQHEP GGYIS  RKQ ++P  E
Sbjct  379  MSMRAGIAADAAAALLFRILSQPALLFPPIRQVEGVEVQHEPSGGYISCYRKQIEVPAAE  438

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  439  ATIEATAQGIASMLCAHGPEVEW  461



>ref|XP_007019601.1| Gigantea protein isoform 1 [Theobroma cacao]
 ref|XP_007019602.1| Gigantea protein isoform 1 [Theobroma cacao]
 gb|EOY16826.1| Gigantea protein isoform 1 [Theobroma cacao]
 gb|EOY16827.1| Gigantea protein isoform 1 [Theobroma cacao]
Length=1170

 Score =   294 bits (753),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 183/203 (90%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  259  LSVCDEEVARYETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLPRNWMHLHFLRAIG A
Sbjct  319  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGIRLPRNWMHLHFLRAIGTA  378

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGV VQHEP GGYIS  RKQ ++P  E
Sbjct  379  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGVEVQHEPSGGYISCYRKQIEVPAAE  438

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  439  ATIEATAQGIASMLCAHGPEVEW  461



>ref|XP_004163795.1| PREDICTED: protein GIGANTEA-like [Cucumis sativus]
Length=1016

 Score =   293 bits (749),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  136  LSVCDEEVARYETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  195

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAE+YA+G+RLPRNWMHLHFLRAIG A
Sbjct  196  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEEYATGIRLPRNWMHLHFLRAIGTA  255

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGI+ADAAAALLFRILSQPALLFPPLRQVE   VQ E LGGY S  R+Q ++   E
Sbjct  256  MSMRAGISADAAAALLFRILSQPALLFPPLRQVEETDVQCESLGGYDSSYREQIEVSAAE  315

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT++ATAQGIASMLCAHGPEVEW
Sbjct  316  ATIDATAQGIASMLCAHGPEVEW  338



>ref|XP_007019603.1| Gigantea protein isoform 3 [Theobroma cacao]
 gb|EOY16828.1| Gigantea protein isoform 3 [Theobroma cacao]
Length=1171

 Score =   294 bits (753),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 183/203 (90%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  259  LSVCDEEVARYETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLPRNWMHLHFLRAIG A
Sbjct  319  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGIRLPRNWMHLHFLRAIGTA  378

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGV VQHEP GGYIS  RKQ ++P  E
Sbjct  379  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGVEVQHEPSGGYISCYRKQIEVPAAE  438

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  439  ATIEATAQGIASMLCAHGPEVEW  461



>gb|EYU36555.1| hypothetical protein MIMGU_mgv1a000427mg [Erythranthe guttata]
Length=1160

 Score =   294 bits (753),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 185/204 (91%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA +VPALLLPPPTTPMDEHLV GLPALEPYARLFHRYYAIASP
Sbjct  257  LSVCDDEVARYETATLTAASVPALLLPPPTTPMDEHLVAGLPALEPYARLFHRYYAIASP  316

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  317  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGMRLPRNWMHLHFLRAIGIA  376

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRK-QRDIPEI  538
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEG+  QHEPLGG +S +RK QR++P  
Sbjct  377  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGIEAQHEPLGGCVSSERKQQRELPAA  436

Query  539  EATVEATAQGIASMLCAHGPEVEW  610
            EATVEATAQGIASMLCAHGPEVEW
Sbjct  437  EATVEATAQGIASMLCAHGPEVEW  460



>gb|ABZ81992.1| gigantea [Zea mays]
Length=1162

 Score =   294 bits (753),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPTTP+DEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  261  LSVCDEEVARYETANLTAAAVPALLLPPPTTPLDEHLVAGLPPLEPYARLFHRYYAIATP  320

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL GLLEAPPSWAPD LDA+VQLVELLRAAEDYASG+RLP+NWMHLHFLRAIG A
Sbjct  321  SATQRLLFGLLEAPPSWAPDTLDAAVQLVELLRAAEDYASGMRLPKNWMHLHFLRAIGTA  380

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAAD AAALLFRILSQP LLFPPLR  EGV V HEPLGGY+S  +KQ ++P  E
Sbjct  381  MSMRAGIAADTAAALLFRILSQPTLLFPPLRHAEGVEVHHEPLGGYVSSYKKQLEVPASE  440

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT++ATAQGIAS+LCAHGP+VEW
Sbjct  441  ATIDATAQGIASLLCAHGPDVEW  463



>gb|KDP36552.1| hypothetical protein JCGZ_08319 [Jatropha curcas]
Length=1168

 Score =   294 bits (753),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 184/203 (91%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  258  LSVCDDEVARYETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGIRLPRNWMHLHFLRAIGIA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGV VQHE LGGYIS  RKQ ++P  E
Sbjct  378  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGVEVQHELLGGYISNYRKQIEVPAAE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  438  ATIEATAQGIASMLCAHGPEVEW  460



>gb|AII99806.1| gigantea [Dimocarpus longan]
Length=1171

 Score =   294 bits (752),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA AVPALLLPP TT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  258  LSVCDDEVARYETATLTAAAVPALLLPPATTALDEHLVAGLPALEPYARLFHRYYAIATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL GLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLPRNWMHLHFLRAIGIA
Sbjct  318  SATQRLLRGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGIRLPRNWMHLHFLRAIGIA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGV VQHEPLGGYIS  RKQ ++P  E
Sbjct  378  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGVEVQHEPLGGYISCYRKQIEVPAAE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIAS+LCAHGPEVEW
Sbjct  438  ATIEATAQGIASVLCAHGPEVEW  460



>ref|XP_011074106.1| PREDICTED: protein GIGANTEA-like isoform X2 [Sesamum indicum]
Length=1138

 Score =   293 bits (751),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 188/204 (92%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTTPMDEHLV GLPALEPYARLFHRYYAIASP
Sbjct  260  LSVCDEEVARYETATLTAAAVPALLLPPPTTPMDEHLVAGLPALEPYARLFHRYYAIASP  319

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  320  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGMRLPRNWMHLHFLRAIGIA  379

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRK-QRDIPEI  538
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQV+G+ VQ EPLGGYIS  RK QR++P  
Sbjct  380  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGIEVQLEPLGGYISSGRKQQRELPAA  439

Query  539  EATVEATAQGIASMLCAHGPEVEW  610
            EATVEATAQGIASMLCAHGPEVEW
Sbjct  440  EATVEATAQGIASMLCAHGPEVEW  463



>ref|XP_007019604.1| Gigantea protein isoform 4 [Theobroma cacao]
 gb|EOY16829.1| Gigantea protein isoform 4 [Theobroma cacao]
Length=1147

 Score =   293 bits (751),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 183/203 (90%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  259  LSVCDEEVARYETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLPRNWMHLHFLRAIG A
Sbjct  319  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGIRLPRNWMHLHFLRAIGTA  378

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGV VQHEP GGYIS  RKQ ++P  E
Sbjct  379  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGVEVQHEPSGGYISCYRKQIEVPAAE  438

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  439  ATIEATAQGIASMLCAHGPEVEW  461



>ref|XP_008461913.1| PREDICTED: protein GIGANTEA-like isoform X2 [Cucumis melo]
Length=999

 Score =   292 bits (747),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  88   LSVCDEEVARYETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  147

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAE+YA+G+RLPRNWMHLHFLRAIG A
Sbjct  148  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEEYATGIRLPRNWMHLHFLRAIGTA  207

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQVE   VQ E LGGY S  R+Q ++   E
Sbjct  208  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEETDVQCESLGGYESLYREQIEVSAAE  267

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT++ATAQGIASMLCAHGPEVEW
Sbjct  268  ATIDATAQGIASMLCAHGPEVEW  290



>ref|XP_011074103.1| PREDICTED: protein GIGANTEA-like isoform X1 [Sesamum indicum]
 ref|XP_011074104.1| PREDICTED: protein GIGANTEA-like isoform X1 [Sesamum indicum]
 ref|XP_011074105.1| PREDICTED: protein GIGANTEA-like isoform X1 [Sesamum indicum]
Length=1169

 Score =   293 bits (751),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 188/204 (92%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTTPMDEHLV GLPALEPYARLFHRYYAIASP
Sbjct  260  LSVCDEEVARYETATLTAAAVPALLLPPPTTPMDEHLVAGLPALEPYARLFHRYYAIASP  319

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  320  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGMRLPRNWMHLHFLRAIGIA  379

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRK-QRDIPEI  538
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQV+G+ VQ EPLGGYIS  RK QR++P  
Sbjct  380  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGIEVQLEPLGGYISSGRKQQRELPAA  439

Query  539  EATVEATAQGIASMLCAHGPEVEW  610
            EATVEATAQGIASMLCAHGPEVEW
Sbjct  440  EATVEATAQGIASMLCAHGPEVEW  463



>ref|NP_001042220.1| Os01g0182600 [Oryza sativa Japonica Group]
 sp|Q9AWL7.2|GIGAN_ORYSJ RecName: Full=Protein GIGANTEA [Oryza sativa Japonica Group]
 dbj|BAD68052.1| putative gigantea [Oryza sativa Japonica Group]
 dbj|BAF04134.1| Os01g0182600 [Oryza sativa Japonica Group]
Length=1160

 Score =   293 bits (751),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPTTP+DEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  261  LSVCDEEVARYETANLTAAAVPALLLPPPTTPLDEHLVAGLPPLEPYARLFHRYYAIATP  320

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL GLLEAPPSWAPDALDA+VQLVELLRAAEDY SG+RLP+NWMHLHFLRAIG A
Sbjct  321  SATQRLLFGLLEAPPSWAPDALDAAVQLVELLRAAEDYDSGMRLPKNWMHLHFLRAIGTA  380

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAAD +AALLFRILSQP LLFPPLR  EGV + HEPLGGY+S  ++Q ++P  E
Sbjct  381  MSMRAGIAADTSAALLFRILSQPTLLFPPLRHAEGVELHHEPLGGYVSSYKRQLEVPASE  440

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT++ATAQGIASMLCAHGP+VEW
Sbjct  441  ATIDATAQGIASMLCAHGPDVEW  463



>gb|KJB28964.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=1080

 Score =   293 bits (749),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  259  LSVCDEEVARYETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLPRNWMHLHFLRAIG A
Sbjct  319  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGIRLPRNWMHLHFLRAIGTA  378

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMR GIAADAAAALLFRILSQPALLFPPLRQVEGV VQHEP  GYIS  RKQ ++P  E
Sbjct  379  MSMRVGIAADAAAALLFRILSQPALLFPPLRQVEGVAVQHEPSDGYISCYRKQIEVPAAE  438

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  439  ATIEATAQGIASMLCAHGPEVEW  461



>gb|AAW66945.1| gigantea-like protein [Hordeum vulgare]
 gb|AAW66946.1| gigantea-like protein [Hordeum vulgare subsp. vulgare]
Length=1155

 Score =   293 bits (750),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPTTP+DEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  255  LSVCDEEVARYETANLTAAAVPALLLPPPTTPLDEHLVAGLPPLEPYARLFHRYYAIATP  314

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL GLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLP+NW+HLHFLRAIG A
Sbjct  315  SATQRLLFGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGMRLPKNWLHLHFLRAIGTA  374

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAAD AAALLFRILSQP LLFPPLR  EGV VQHEPLGGY+S  ++Q ++P  E
Sbjct  375  MSMRAGIAADTAAALLFRILSQPTLLFPPLRHAEGVEVQHEPLGGYVSSYKRQLEVPASE  434

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
             T++ATAQGIAS+LCAHGP+VEW
Sbjct  435  TTIDATAQGIASLLCAHGPDVEW  457



>dbj|BAO74118.1| GIGANTEA, partial [Lotus japonicus]
Length=976

 Score =   291 bits (745),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 188/203 (93%), Gaps = 2/203 (1%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EVSRYETA LTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  150  LSVCDDEVSRYETAILTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  209

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAE+YASG+RLPRNWMHLHFLRAIG A
Sbjct  210  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEEYASGIRLPRNWMHLHFLRAIGTA  269

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFR+LSQPALLFPPLRQV+GV VQ+ P   YIS  +KQ ++P  E
Sbjct  270  MSMRAGIAADAAAALLFRVLSQPALLFPPLRQVDGVEVQNGPC--YISSYKKQIEVPAAE  327

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            A++EATAQGIASMLCAHGPEVEW
Sbjct  328  ASIEATAQGIASMLCAHGPEVEW  350



>gb|EMS55238.1| hypothetical protein TRIUR3_30834 [Triticum urartu]
Length=1126

 Score =   293 bits (749),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPTTP+DEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  226  LSVCDEEVARYETANLTAAAVPALLLPPPTTPLDEHLVAGLPPLEPYARLFHRYYAIATP  285

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL GLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLP+NW+HLHFLRAIG A
Sbjct  286  SATQRLLFGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGMRLPKNWLHLHFLRAIGTA  345

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAAD AAALLFRILSQP LLFPPLR  EGV VQHEPLGGY+S  ++Q ++P  E
Sbjct  346  MSMRAGIAADTAAALLFRILSQPTLLFPPLRHAEGVEVQHEPLGGYVSSYKRQLEVPASE  405

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
             T++ATAQGIAS+LCAHGP+VEW
Sbjct  406  TTIDATAQGIASLLCAHGPDVEW  428



>dbj|BAO74110.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74111.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74112.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74113.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74114.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74115.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74116.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74117.1| GIGANTEA, partial [Lotus japonicus]
Length=976

 Score =   291 bits (745),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 188/203 (93%), Gaps = 2/203 (1%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EVSRYETA LTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  150  LSVCDDEVSRYETAILTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  209

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAE+YASG+RLPRNWMHLHFLRAIG A
Sbjct  210  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEEYASGIRLPRNWMHLHFLRAIGTA  269

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFR+LSQPALLFPPLRQV+GV VQ+ P   YIS  +KQ ++P  E
Sbjct  270  MSMRAGIAADAAAALLFRVLSQPALLFPPLRQVDGVEVQNGPC--YISSYKKQIEVPAAE  327

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            A++EATAQGIASMLCAHGPEVEW
Sbjct  328  ASIEATAQGIASMLCAHGPEVEW  350



>emb|CDM81775.1| unnamed protein product [Triticum aestivum]
Length=1155

 Score =   293 bits (749),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPTTP+DEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  255  LSVCDEEVARYETANLTAAAVPALLLPPPTTPLDEHLVAGLPPLEPYARLFHRYYAIATP  314

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL GLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLP+NW+HLHFLRAIG A
Sbjct  315  SATQRLLFGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGMRLPKNWLHLHFLRAIGTA  374

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAAD AAALLFRILSQP LLFPPLR  EGV VQHEPLGGY+S  ++Q ++P  E
Sbjct  375  MSMRAGIAADTAAALLFRILSQPTLLFPPLRHAEGVEVQHEPLGGYVSSYKRQLEVPASE  434

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
             T++ATAQGIAS+LCAHGP+VEW
Sbjct  435  TTIDATAQGIASLLCAHGPDVEW  457



>gb|AAT79487.1| gigantea 3 [Triticum aestivum]
Length=1155

 Score =   293 bits (749),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPTTP+DEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  255  LSVCDEEVARYETANLTAAAVPALLLPPPTTPLDEHLVAGLPPLEPYARLFHRYYAIATP  314

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL GLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLP+NW+HLHFLRAIG A
Sbjct  315  SATQRLLFGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGMRLPKNWLHLHFLRAIGTA  374

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAAD AAALLFRILSQP LLFPPLR  EGV VQHEPLGGY+S  ++Q ++P  E
Sbjct  375  MSMRAGIAADTAAALLFRILSQPTLLFPPLRHAEGVEVQHEPLGGYVSSYKRQLEVPASE  434

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
             T++ATAQGIAS+LCAHGP+VEW
Sbjct  435  TTIDATAQGIASLLCAHGPDVEW  457



>gb|KJB28961.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=1155

 Score =   293 bits (749),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  259  LSVCDEEVARYETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLPRNWMHLHFLRAIG A
Sbjct  319  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGIRLPRNWMHLHFLRAIGTA  378

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMR GIAADAAAALLFRILSQPALLFPPLRQVEGV VQHEP  GYIS  RKQ ++P  E
Sbjct  379  MSMRVGIAADAAAALLFRILSQPALLFPPLRQVEGVAVQHEPSDGYISCYRKQIEVPAAE  438

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  439  ATIEATAQGIASMLCAHGPEVEW  461



>gb|KJB28962.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=1147

 Score =   292 bits (748),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  259  LSVCDEEVARYETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLPRNWMHLHFLRAIG A
Sbjct  319  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGIRLPRNWMHLHFLRAIGTA  378

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMR GIAADAAAALLFRILSQPALLFPPLRQVEGV VQHEP  GYIS  RKQ ++P  E
Sbjct  379  MSMRVGIAADAAAALLFRILSQPALLFPPLRQVEGVAVQHEPSDGYISCYRKQIEVPAAE  438

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  439  ATIEATAQGIASMLCAHGPEVEW  461



>ref|XP_010062087.1| PREDICTED: protein GIGANTEA isoform X1 [Eucalyptus grandis]
 ref|XP_010062088.1| PREDICTED: protein GIGANTEA isoform X1 [Eucalyptus grandis]
 ref|XP_010062089.1| PREDICTED: protein GIGANTEA isoform X1 [Eucalyptus grandis]
 gb|KCW69154.1| hypothetical protein EUGRSUZ_F02686 [Eucalyptus grandis]
Length=1166

 Score =   293 bits (749),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  255  LSVCDEEVARYETATLTAVAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  314

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAE+YASG+RLPRNWMHLHFLRAIG A
Sbjct  315  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEEYASGMRLPRNWMHLHFLRAIGTA  374

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFR+LSQPALLFPPLRQVEGV VQHEPLGGY+S  +KQ ++P  E
Sbjct  375  MSMRAGVAADAAAALLFRVLSQPALLFPPLRQVEGVEVQHEPLGGYVSSYKKQIEVPAAE  434

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  435  ATIEATAQGIASMLCAHGPEVEW  457



>ref|XP_006643836.1| PREDICTED: protein GIGANTEA-like isoform X1 [Oryza brachyantha]
 ref|XP_006643837.1| PREDICTED: protein GIGANTEA-like isoform X2 [Oryza brachyantha]
Length=1162

 Score =   292 bits (748),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPTTP+DEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  261  LSVCDEEVTRYETANLTAAAVPALLLPPPTTPLDEHLVAGLPPLEPYARLFHRYYAIATP  320

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL GLLEAPPSWAPDALDA+VQLVELLRAAEDY SG+RLP+NWMHLHFLRAIG A
Sbjct  321  SATQRLLFGLLEAPPSWAPDALDAAVQLVELLRAAEDYDSGMRLPKNWMHLHFLRAIGTA  380

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAAD AAALLFRILSQP LLFPPLR  EGV + HEPLGGY+S  ++Q ++P  E
Sbjct  381  MSMRAGIAADTAAALLFRILSQPTLLFPPLRHAEGVELHHEPLGGYVSSYKRQLEVPASE  440

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT++ATAQGIASMLCAHGP+VEW
Sbjct  441  ATIDATAQGIASMLCAHGPDVEW  463



>ref|XP_008381855.1| PREDICTED: protein GIGANTEA-like [Malus domestica]
Length=1170

 Score =   292 bits (748),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 182/203 (90%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  258  LSVCDEEVARYETATLTAVAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGIRLPRNWMHLHFLRAIGTA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQV+GV VQHEPLGGYIS  +KQ ++P  E
Sbjct  378  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGVEVQHEPLGGYISSYKKQIELPAAE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGP VEW
Sbjct  438  ATIEATAQGIASMLCAHGPXVEW  460



>gb|EMT06342.1| hypothetical protein F775_28583 [Aegilops tauschii]
Length=1146

 Score =   292 bits (748),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPTTP+DEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  248  LSVCDEEVARYETANLTAAAVPALLLPPPTTPLDEHLVAGLPPLEPYARLFHRYYAIATP  307

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL GLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLP+NW+HLHFLRAIG A
Sbjct  308  SATQRLLFGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGMRLPKNWLHLHFLRAIGTA  367

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAAD AAALLFRILSQP LLFPPLR  EGV VQHEPLGGY+S  ++Q ++P  E
Sbjct  368  MSMRAGIAADTAAALLFRILSQPTLLFPPLRHAEGVEVQHEPLGGYVSSYKRQLEVPASE  427

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
             T++ATAQGIAS+LCAHGP+VEW
Sbjct  428  TTIDATAQGIASLLCAHGPDVEW  450



>gb|ADR51711.1| GI [Secale cereale]
Length=1142

 Score =   292 bits (747),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPTTP+DEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  247  LSVCDEEVARYETANLTAAAVPALLLPPPTTPLDEHLVAGLPPLEPYARLFHRYYAIATP  306

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL GLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLP+NW+HLHFLRAIG A
Sbjct  307  SATQRLLFGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGMRLPKNWLHLHFLRAIGTA  366

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAAD AAALLFRILSQP LLFPPLR  EGV VQHEPLGGY+S  ++Q ++P  E
Sbjct  367  MSMRAGIAADTAAALLFRILSQPTLLFPPLRHAEGVEVQHEPLGGYVSSYKRQLEVPASE  426

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
             T++ATAQGIAS+LCAHGP+VEW
Sbjct  427  TTIDATAQGIASLLCAHGPDVEW  449



>gb|AAQ11738.1| gigantea [Triticum aestivum]
Length=1155

 Score =   292 bits (747),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPTTP+DEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  255  LSVCDEEVARYETANLTAAAVPALLLPPPTTPLDEHLVAGLPPLEPYARLFHRYYAIATP  314

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL GLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLP+NW+HLHFLRAIG A
Sbjct  315  SATQRLLFGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGMRLPKNWLHLHFLRAIGTA  374

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAAD AAALLFRILSQP LLFPPLR  EGV VQHEPLGGY+S  ++Q ++P  E
Sbjct  375  MSMRAGIAADTAAALLFRILSQPMLLFPPLRHAEGVEVQHEPLGGYVSSYKRQLEVPASE  434

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
             T++ATAQGIAS+LCAHGP+VEW
Sbjct  435  TTIDATAQGIASLLCAHGPDVEW  457



>ref|XP_004290483.1| PREDICTED: protein GIGANTEA [Fragaria vesca subsp. vesca]
 ref|XP_011458472.1| PREDICTED: protein GIGANTEA [Fragaria vesca subsp. vesca]
 ref|XP_011458473.1| PREDICTED: protein GIGANTEA [Fragaria vesca subsp. vesca]
Length=1178

 Score =   292 bits (747),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 182/203 (90%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEVSRYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  258  LSVCDEEVSRYETATLTAVAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGIRLPRNWMHLHFLRAIGTA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGV VQHEP+G  +S  RKQ ++P  E
Sbjct  378  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGVEVQHEPMGSRVSSYRKQIEVPAAE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  438  ATIEATAQGIASMLCAHGPEVEW  460



>ref|XP_003564357.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230544.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230545.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230546.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230547.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
Length=1155

 Score =   291 bits (745),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPTTP+DEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  255  LSVCDEEVARYETANLTAAAVPALLLPPPTTPLDEHLVAGLPPLEPYARLFHRYYAIATP  314

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL GLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLP+NW+HLHFLRAIG A
Sbjct  315  SATQRLLFGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGMRLPKNWLHLHFLRAIGTA  374

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AAD AAALLFRILSQP LLFPPLR  EG+ VQHEPLGGY+S  ++Q ++P  E
Sbjct  375  MSMRAGMAADTAAALLFRILSQPTLLFPPLRHAEGLEVQHEPLGGYVSSYKRQLEVPASE  434

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
             T++ATAQGIAS+LCAHGP+VEW
Sbjct  435  TTIDATAQGIASLLCAHGPDVEW  457



>ref|XP_008461912.1| PREDICTED: protein GIGANTEA-like isoform X1 [Cucumis melo]
Length=1168

 Score =   291 bits (745),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  257  LSVCDEEVARYETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  316

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAE+YA+G+RLPRNWMHLHFLRAIG A
Sbjct  317  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEEYATGIRLPRNWMHLHFLRAIGTA  376

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQVE   VQ E LGGY S  R+Q ++   E
Sbjct  377  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEETDVQCESLGGYESLYREQIEVSAAE  436

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT++ATAQGIASMLCAHGPEVEW
Sbjct  437  ATIDATAQGIASMLCAHGPEVEW  459



>gb|AGM20686.1| GI1-2 [Populus tomentosa]
Length=1170

 Score =   291 bits (744),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  247  LSVCDEEVARYETAALTAVAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  306

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAED+ASG+RLPRNWMHLHFLRAIG A
Sbjct  307  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDHASGIRLPRNWMHLHFLRAIGTA  366

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGV VQHEPL GY+S  RKQ ++P  E
Sbjct  367  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGVEVQHEPLVGYLSSYRKQIEVPAAE  426

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  427  ATIEATAQGIASMLCAHGPEVEW  449



>ref|XP_006416158.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
 gb|ESQ34511.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
Length=984

 Score =   289 bits (740),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  256  LSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYAIATP  315

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  316  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  375

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILSQPALLFPPL QVEGV +QH P+GGY S  RKQ ++P  E
Sbjct  376  MSMRAGVAADAAAALLFRILSQPALLFPPLCQVEGVEIQHAPIGGYSSNYRKQIEVPAAE  435

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  436  ATIEATAQGIASMLCAHGPEVEW  458



>ref|XP_009381150.1| PREDICTED: protein GIGANTEA-like [Musa acuminata subsp. malaccensis]
Length=1171

 Score =   291 bits (744),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPTTP+DEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  259  LSVCDEEVARYETANLTAAAVPALLLPPPTTPLDEHLVAGLPPLEPYARLFHRYYAIATP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAE+YASG+RLPRNWMHLHFLRAIGIA
Sbjct  319  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEEYASGMRLPRNWMHLHFLRAIGIA  378

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILSQP LLFPPL   EGV V HEPLGG IS  +KQ + P  E
Sbjct  379  MSMRAGVAADAAAALLFRILSQPTLLFPPLWHAEGVAVHHEPLGGCISSYKKQLEAPASE  438

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            A++EATAQGIA+MLCAHGP+VEW
Sbjct  439  ASIEATAQGIATMLCAHGPDVEW  461



>gb|ABP96482.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   290 bits (743),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 178/203 (88%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+A+PALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  258  LSVCDDEVARYETATLTAVALPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYAIATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILSQPALLFPPL QVEGV +QH P+GGY S  RKQ ++P  E
Sbjct  378  MSMRAGVAADAAAALLFRILSQPALLFPPLSQVEGVEIQHAPIGGYSSNYRKQIEVPAAE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  438  ATIEATAQGIASMLCAHGPEVEW  460



>gb|AGW52153.1| GI [Populus tomentosa]
Length=1241

 Score =   291 bits (744),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  318  LSVCDEEVARYETAALTAVAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  377

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAED+ASG+RLPRNWMHLHFLRAIG A
Sbjct  378  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDHASGIRLPRNWMHLHFLRAIGTA  437

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGV VQHEPL GY+S  RKQ ++P  E
Sbjct  438  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGVEVQHEPLVGYLSSYRKQIEVPAAE  497

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  498  ATIEATAQGIASMLCAHGPEVEW  520



>gb|AAT79486.1| gigantea 2 [Triticum aestivum]
Length=1153

 Score =   290 bits (743),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPTTP+DEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  255  LSVCDEEVARYETANLTAAAVPALLLPPPTTPLDEHLVAGLPPLEPYARLFHRYYAIATP  314

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL GLL APPSWAPDALDA+VQLVELLRAAEDYA+G+RLP+NW+HLHFLRAIG A
Sbjct  315  SATQRLLFGLLGAPPSWAPDALDAAVQLVELLRAAEDYATGMRLPKNWLHLHFLRAIGTA  374

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAAD AAALLFRILSQP LLFPPLR  EGV VQHEPLGGY+S  ++Q ++P  E
Sbjct  375  MSMRAGIAADTAAALLFRILSQPTLLFPPLRHAEGVEVQHEPLGGYVSSYKRQLEVPASE  434

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
             T++ATAQGIAS+LCAHGP+VEW
Sbjct  435  TTIDATAQGIASLLCAHGPDVEW  457



>emb|CAA72908.1| hypothetical protein [Arabidopsis thaliana]
Length=1167

 Score =   290 bits (743),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  252  LSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYAIATP  311

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  312  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  371

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILSQPALLFPPL QVEGV +QH P+GGY S  RKQ ++P  E
Sbjct  372  MSMRAGVAADAAAALLFRILSQPALLFPPLSQVEGVEIQHAPIGGYSSNYRKQIEVPAAE  431

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  432  ATIEATAQGIASMLCAHGPEVEW  454



>pir||T00767 hypothetical protein T22J18.6 - Arabidopsis thaliana
 gb|AAC25507.1|AAC25507 T22J18.6 [Arabidopsis thaliana]
Length=1070

 Score =   290 bits (741),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  270  LSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYAIATP  329

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  330  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  389

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILSQPALLFPPL QVEGV +QH P+GGY S  RKQ ++P  E
Sbjct  390  MSMRAGVAADAAAALLFRILSQPALLFPPLSQVEGVEIQHAPIGGYSSNYRKQIEVPAAE  449

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  450  ATIEATAQGIASMLCAHGPEVEW  472



>gb|AIC83986.1| gigantea-like protein [Festuca pratensis]
Length=1149

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 186/203 (92%), Gaps = 1/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPTTP+DEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  255  LSVCDEEVARYETANLTAAAVPALLLPPPTTPLDEHLVAGLPPLEPYARLFHRYYAIATP  314

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL GLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLP+NW+HLHFLRAIG A
Sbjct  315  SATQRLLFGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGMRLPKNWLHLHFLRAIGTA  374

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AAD AAALLFRILSQP LLFPPLR  EGV VQHEPLGGY+S  ++Q +IP  E
Sbjct  375  MSMRAGMAADTAAALLFRILSQPTLLFPPLRHAEGV-VQHEPLGGYVSSYKRQLEIPASE  433

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
             T++ATAQGIAS+LCAHGP+VEW
Sbjct  434  TTIDATAQGIASLLCAHGPDVEW  456



>gb|ABP96496.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  258  LSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYAIATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILSQPALLFPPL QVEGV +QH P+GGY S  RKQ ++P  E
Sbjct  378  MSMRAGVAADAAAALLFRILSQPALLFPPLSQVEGVEIQHAPIGGYSSNYRKQIEVPAAE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  438  ATIEATAQGIASMLCAHGPEVEW  460



>gb|ABP96497.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  258  LSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYAIATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILSQPALLFPPL QVEGV +QH P+GGY S  RKQ ++P  E
Sbjct  378  MSMRAGVAADAAAALLFRILSQPALLFPPLSQVEGVEIQHAPIGGYSSNYRKQIEVPAAE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  438  ATIEATAQGIASMLCAHGPEVEW  460



>gb|ABP96485.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96486.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96499.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  258  LSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYAIATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILSQPALLFPPL QVEGV +QH P+GGY S  RKQ ++P  E
Sbjct  378  MSMRAGVAADAAAALLFRILSQPALLFPPLSQVEGVEIQHAPIGGYSSNYRKQIEVPAAE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  438  ATIEATAQGIASMLCAHGPEVEW  460



>gb|AAT80910.1| GIGANTEA [Arabidopsis thaliana]
Length=1173

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  258  LSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYAIATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILSQPALLFPPL QVEGV +QH P+GGY S  RKQ ++P  E
Sbjct  378  MSMRAGVAADAAAALLFRILSQPALLFPPLSQVEGVEIQHAPIGGYSSNYRKQIEVPAAE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  438  ATIEATAQGIASMLCAHGPEVEW  460



>gb|ABP96483.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96490.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96491.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96492.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96493.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96494.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96495.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96502.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  258  LSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYAIATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILSQPALLFPPL QVEGV +QH P+GGY S  RKQ ++P  E
Sbjct  378  MSMRAGVAADAAAALLFRILSQPALLFPPLSQVEGVEIQHAPIGGYSSNYRKQIEVPAAE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  438  ATIEATAQGIASMLCAHGPEVEW  460



>gb|ABP96488.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  258  LSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYAIATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILSQPALLFPPL QVEGV +QH P+GGY S  RKQ ++P  E
Sbjct  378  MSMRAGVAADAAAALLFRILSQPALLFPPLSQVEGVEIQHAPIGGYSSNYRKQIEVPAAE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  438  ATIEATAQGIASMLCAHGPEVEW  460



>gb|ABP96484.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96487.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96489.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96500.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96501.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  258  LSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYAIATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILSQPALLFPPL QVEGV +QH P+GGY S  RKQ ++P  E
Sbjct  378  MSMRAGVAADAAAALLFRILSQPALLFPPLSQVEGVEIQHAPIGGYSSNYRKQIEVPAAE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  438  ATIEATAQGIASMLCAHGPEVEW  460



>ref|NP_564180.1| protein GIGANTEA [Arabidopsis thaliana]
 sp|Q9SQI2.2|GIGAN_ARATH RecName: Full=Protein GIGANTEA [Arabidopsis thaliana]
 gb|AAF00092.1|AF105064_1 GIGANTEA [Arabidopsis thaliana]
 emb|CAB56039.1| gigantea protein [Arabidopsis thaliana]
 gb|AAT97405.1| gigantea [Arabidopsis thaliana]
 gb|AEE30286.1| gigantea protein (GI) [Arabidopsis thaliana]
Length=1173

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  258  LSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYAIATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILSQPALLFPPL QVEGV +QH P+GGY S  RKQ ++P  E
Sbjct  378  MSMRAGVAADAAAALLFRILSQPALLFPPLSQVEGVEIQHAPIGGYSSNYRKQIEVPAAE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  438  ATIEATAQGIASMLCAHGPEVEW  460



>gb|ABP96498.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  258  LSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYAIATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILSQPALLFPPL QVEGV +QH P+GGY S  RKQ ++P  E
Sbjct  378  MSMRAGVAADAAAALLFRILSQPALLFPPLSQVEGVEIQHAPIGGYSSNYRKQIEVPAAE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  438  ATIEATAQGIASMLCAHGPEVEW  460



>gb|AAT97404.1| gigantea [Arabidopsis thaliana]
Length=1173

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  258  LSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYAIATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILSQPALLFPPL QVEGV +QH P+GGY S  RKQ ++P  E
Sbjct  378  MSMRAGVAADAAAALLFRILSQPALLFPPLSQVEGVEIQHAPIGGYSSNYRKQIEVPAAE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  438  ATIEATAQGIASMLCAHGPEVEW  460



>ref|XP_006306336.1| hypothetical protein CARUB_v10012213mg [Capsella rubella]
 gb|EOA39234.1| hypothetical protein CARUB_v10012213mg [Capsella rubella]
Length=1171

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  257  LSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYAIATP  316

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  317  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  376

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILSQPALLFPPL QVEGV +QH P+GGY S  RKQ ++P  E
Sbjct  377  MSMRAGVAADAAAALLFRILSQPALLFPPLSQVEGVEIQHAPIGGYSSNYRKQIEVPAAE  436

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  437  ATIEATAQGIASMLCAHGPEVEW  459



>gb|ABP96481.1| GIGANTEA [Arabidopsis lyrata subsp. petraea]
Length=1173

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  259  LSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYAIATP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  319  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  378

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILSQPALLFPPL QVEGV +QH P+GGY S  RKQ ++P  E
Sbjct  379  MSMRAGVAADAAAALLFRILSQPALLFPPLSQVEGVEIQHAPIGGYSSNYRKQIEVPAAE  438

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  439  ATIEATAQGIASMLCAHGPEVEW  461



>ref|XP_002890532.1| hypothetical protein ARALYDRAFT_889789 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66791.1| hypothetical protein ARALYDRAFT_889789 [Arabidopsis lyrata subsp. 
lyrata]
Length=1174

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  259  LSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYAIATP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  319  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  378

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILSQPALLFPPL QVEGV +QH P+GGY S  RKQ ++P  E
Sbjct  379  MSMRAGVAADAAAALLFRILSQPALLFPPLSQVEGVEIQHAPIGGYSSNYRKQIEVPAAE  438

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  439  ATIEATAQGIASMLCAHGPEVEW  461



>ref|XP_009802612.1| PREDICTED: protein GIGANTEA-like [Nicotiana sylvestris]
 ref|XP_009802613.1| PREDICTED: protein GIGANTEA-like [Nicotiana sylvestris]
Length=1156

 Score =   290 bits (741),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 186/203 (92%), Gaps = 10/203 (5%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTTPMDEHLV GLPALEPYARLFHRYYAIASP
Sbjct  260  LSVCDEEVARYETATLTAAAVPALLLPPPTTPMDEHLVAGLPALEPYARLFHRYYAIASP  319

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL+GLLEAPPSWAPDALDA+VQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA
Sbjct  320  SATQRLLVGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  379

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAAD+AAALLFRILSQPALLFPPLRQVEG+ VQHE +G   +          IE
Sbjct  380  MSMRAGIAADSAAALLFRILSQPALLFPPLRQVEGIEVQHEHVGAEAT----------IE  429

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            ATVEATAQGIASMLCAHGPEVEW
Sbjct  430  ATVEATAQGIASMLCAHGPEVEW  452



>emb|CAY26028.1| GIGANTEA [Lolium perenne]
 gb|ABF83898.2| GIGANTEA [Lolium perenne]
Length=1148

 Score =   290 bits (741),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 186/203 (92%), Gaps = 1/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPTTP+DEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  255  LSVCDEEVARYETANLTAAAVPALLLPPPTTPLDEHLVAGLPPLEPYARLFHRYYAIATP  314

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL GLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLP+NW+HLHFLRAIG A
Sbjct  315  SATQRLLFGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGMRLPKNWLHLHFLRAIGTA  374

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AAD AAALLFRILSQP LLFPPLR  EGV VQHEPLGGY+S  ++Q +IP  E
Sbjct  375  MSMRAGMAADTAAALLFRILSQPTLLFPPLRHAEGV-VQHEPLGGYVSSYKRQLEIPASE  433

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
             T++ATAQGIAS+LCAHGP+VEW
Sbjct  434  TTIDATAQGIASLLCAHGPDVEW  456



>gb|KCW69153.1| hypothetical protein EUGRSUZ_F02686 [Eucalyptus grandis]
Length=1167

 Score =   290 bits (741),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 179/204 (88%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  255  LSVCDEEVARYETATLTAVAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  314

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAE+YASG+RLPRNWMHLHFLRAIG A
Sbjct  315  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEEYASGMRLPRNWMHLHFLRAIGTA  374

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYI-SWDRKQRDIPEI  538
            MSMRAG+AADAAAALLFR+LSQPALLFPPLRQVEGV VQHEPLGGY+ S+ ++Q ++P  
Sbjct  375  MSMRAGVAADAAAALLFRVLSQPALLFPPLRQVEGVEVQHEPLGGYVSSYKKQQIEVPAA  434

Query  539  EATVEATAQGIASMLCAHGPEVEW  610
            EAT+EATAQGIASMLCAHGPEVEW
Sbjct  435  EATIEATAQGIASMLCAHGPEVEW  458



>gb|KFK44368.1| gigantea [Arabis alpina]
Length=1173

 Score =   290 bits (741),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  256  LSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYAIATP  315

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  316  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  375

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILSQPALLFPPL QVEGV +QH P+GGY S  RKQ ++P  E
Sbjct  376  MSMRAGVAADAAAALLFRILSQPALLFPPLCQVEGVEIQHAPIGGYSSNYRKQIEVPAAE  435

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  436  ATIEATAQGIASMLCAHGPEVEW  458



>ref|XP_004968438.1| PREDICTED: protein GIGANTEA-like [Setaria italica]
Length=1160

 Score =   289 bits (740),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPT  +DEHLV GLP LEP+ARLFHRYYAIA+P
Sbjct  261  LSVCDEEVARYETANLTAAAVPALLLPPPTPALDEHLVAGLPPLEPFARLFHRYYAIATP  320

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL GLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLP+NWMHLHFLRAIG A
Sbjct  321  SATQRLLFGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGMRLPKNWMHLHFLRAIGTA  380

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAAD AAALLFRILSQP LLFPPL   EGV V HEPLGGY+S  ++Q ++P  E
Sbjct  381  MSMRAGIAADTAAALLFRILSQPTLLFPPLGHAEGVEVHHEPLGGYVSSYKRQLEVPASE  440

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT++ATAQGIAS+LCAHGP+VEW
Sbjct  441  ATIDATAQGIASLLCAHGPDVEW  463



>ref|XP_006416159.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
 ref|XP_006416160.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
 gb|ESQ34512.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
 gb|ESQ34513.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
Length=1171

 Score =   289 bits (740),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  256  LSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYAIATP  315

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  316  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  375

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILSQPALLFPPL QVEGV +QH P+GGY S  RKQ ++P  E
Sbjct  376  MSMRAGVAADAAAALLFRILSQPALLFPPLCQVEGVEIQHAPIGGYSSNYRKQIEVPAAE  435

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  436  ATIEATAQGIASMLCAHGPEVEW  458



>ref|XP_006434519.1| hypothetical protein CICLE_v10004044mg [Citrus clementina]
 gb|ESR47759.1| hypothetical protein CICLE_v10004044mg [Citrus clementina]
Length=1082

 Score =   288 bits (738),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+E++RYETATLTA AVPALLLPP TT +DEHLV GLPALEPYARLFHRYYA A+P
Sbjct  186  LSVCDDELARYETATLTAAAVPALLLPPATTALDEHLVAGLPALEPYARLFHRYYAFATP  245

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAE+YA+G++LPRNWMHLHFLRAIG+A
Sbjct  246  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEEYATGIKLPRNWMHLHFLRAIGVA  305

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQV+GV VQHEPLGGYIS  RKQ ++P  E
Sbjct  306  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGVEVQHEPLGGYISCYRKQIEVPAAE  365

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIAS+LCAHGPEVEW
Sbjct  366  ATIEATAQGIASVLCAHGPEVEW  388



>gb|KDO83806.1| hypothetical protein CISIN_1g001216mg [Citrus sinensis]
Length=1122

 Score =   288 bits (738),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+E++RYETATLTA AVPALLLPP TT +DEHLV GLPALEPYARLFHRYYA A+P
Sbjct  215  LSVCDDELARYETATLTAAAVPALLLPPATTALDEHLVAGLPALEPYARLFHRYYAFATP  274

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAE+YA+G++LPRNWMHLHFLRAIG+A
Sbjct  275  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEEYATGIKLPRNWMHLHFLRAIGVA  334

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQV+GV VQHEPLGGYIS  RKQ ++P  E
Sbjct  335  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGVEVQHEPLGGYISCYRKQIEVPAAE  394

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIAS+LCAHGPEVEW
Sbjct  395  ATIEATAQGIASVLCAHGPEVEW  417



>ref|XP_011042897.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
 ref|XP_011042898.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
 ref|XP_011042899.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
Length=1169

 Score =   289 bits (739),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  258  LSVCDEEVTRYETAALTAVAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAED+ASG+RLPRNWMHLHFLRAIG A
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDHASGIRLPRNWMHLHFLRAIGTA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGV VQHEP  GY+S  RKQ ++P  E
Sbjct  378  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGVEVQHEPSVGYLSSYRKQIEVPAAE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  438  ATIEATAQGIASMLCAHGPEVEW  460



>ref|XP_006361617.1| PREDICTED: protein GIGANTEA-like isoform X2 [Solanum tuberosum]
Length=1170

 Score =   288 bits (738),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 182/203 (90%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEVSRYETATLTA AVPALLLPPPTTPMDEHLV GLP LEPYARLFHRYYAIASP
Sbjct  256  LSVCDEEVSRYETATLTAAAVPALLLPPPTTPMDEHLVAGLPPLEPYARLFHRYYAIASP  315

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL+GLLEAPPSWAPDALDA+VQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA
Sbjct  316  SATQRLLVGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  375

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAAD+AAALLFR+LSQPALLFPPLRQ+E + VQHEPLGG  S ++KQR++   E
Sbjct  376  MSMRAGIAADSAAALLFRVLSQPALLFPPLRQIEEIEVQHEPLGGDTSCNKKQREVTAAE  435

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            ATVEATAQGIASMLCAHGPEVEW
Sbjct  436  ATVEATAQGIASMLCAHGPEVEW  458



>ref|XP_006361616.1| PREDICTED: protein GIGANTEA-like isoform X1 [Solanum tuberosum]
Length=1171

 Score =   288 bits (738),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 182/203 (90%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEVSRYETATLTA AVPALLLPPPTTPMDEHLV GLP LEPYARLFHRYYAIASP
Sbjct  257  LSVCDEEVSRYETATLTAAAVPALLLPPPTTPMDEHLVAGLPPLEPYARLFHRYYAIASP  316

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL+GLLEAPPSWAPDALDA+VQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA
Sbjct  317  SATQRLLVGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  376

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAAD+AAALLFR+LSQPALLFPPLRQ+E + VQHEPLGG  S ++KQR++   E
Sbjct  377  MSMRAGIAADSAAALLFRVLSQPALLFPPLRQIEEIEVQHEPLGGDTSCNKKQREVTAAE  436

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            ATVEATAQGIASMLCAHGPEVEW
Sbjct  437  ATVEATAQGIASMLCAHGPEVEW  459



>ref|XP_006473104.1| PREDICTED: protein GIGANTEA-like isoform X1 [Citrus sinensis]
 ref|XP_006473105.1| PREDICTED: protein GIGANTEA-like isoform X2 [Citrus sinensis]
 ref|XP_006473106.1| PREDICTED: protein GIGANTEA-like isoform X3 [Citrus sinensis]
 ref|XP_006473107.1| PREDICTED: protein GIGANTEA-like isoform X4 [Citrus sinensis]
Length=1165

 Score =   288 bits (737),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+E++RYETATLTA AVPALLLPP TT +DEHLV GLPALEPYARLFHRYYA A+P
Sbjct  258  LSVCDDELARYETATLTAAAVPALLLPPATTALDEHLVAGLPALEPYARLFHRYYAFATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAE+YA+G++LPRNWMHLHFLRAIG+A
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEEYATGIKLPRNWMHLHFLRAIGVA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQV+GV VQHEPLGGYIS  RKQ ++P  E
Sbjct  378  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGVEVQHEPLGGYISCYRKQIEVPAAE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIAS+LCAHGPEVEW
Sbjct  438  ATIEATAQGIASVLCAHGPEVEW  460



>ref|XP_010535090.1| PREDICTED: protein GIGANTEA [Tarenaya hassleriana]
 ref|XP_010535098.1| PREDICTED: protein GIGANTEA [Tarenaya hassleriana]
 ref|XP_010535104.1| PREDICTED: protein GIGANTEA [Tarenaya hassleriana]
Length=1167

 Score =   288 bits (737),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  257  LSVCDDEVARYETATLTAVAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  316

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  317  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  376

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILSQPALLFPPL QVEGV + HEP GGY S  RKQ ++P  E
Sbjct  377  MSMRAGVAADAAAALLFRILSQPALLFPPLSQVEGVEILHEPTGGYSSNYRKQIEVPAAE  436

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  437  ATIEATAQGIASMLCAHGPEVEW  459



>ref|XP_002524341.1| Protein GIGANTEA, putative [Ricinus communis]
 gb|EEF38081.1| Protein GIGANTEA, putative [Ricinus communis]
Length=1161

 Score =   288 bits (737),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYA A+P
Sbjct  250  LSVCDDEVARYETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAFATP  309

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  310  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGIRLPRNWMHLHFLRAIGIA  369

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEG+ V HEPLG Y S  RKQ ++P  E
Sbjct  370  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGMEVHHEPLGAYSSSYRKQIEVPAAE  429

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  430  ATIEATAQGIASMLCAHGPEVEW  452



>ref|XP_002300901.2| GIGANTEA family protein [Populus trichocarpa]
 gb|EEE80174.2| GIGANTEA family protein [Populus trichocarpa]
Length=1194

 Score =   288 bits (736),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYA LFHRYYAIA+P
Sbjct  258  LSVCDEEVARYETATLTAVAVPALLLPPPTTALDEHLVAGLPALEPYACLFHRYYAIATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAED+ASG+RLPRNWMHLHFLRAIG A
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDHASGIRLPRNWMHLHFLRAIGTA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGV VQHEPL GY+S  RKQ ++P  E
Sbjct  378  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGVEVQHEPLVGYLSSYRKQIEVPAAE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  438  ATIEATAQGIASMLCAHGPEVEW  460



>ref|XP_006386299.1| hypothetical protein POPTR_0002s06490g [Populus trichocarpa]
 gb|ERP64096.1| hypothetical protein POPTR_0002s06490g [Populus trichocarpa]
Length=1171

 Score =   287 bits (735),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYA LFHRYYAIA+P
Sbjct  258  LSVCDEEVARYETATLTAVAVPALLLPPPTTALDEHLVAGLPALEPYACLFHRYYAIATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAED+ASG+RLPRNWMHLHFLRAIG A
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDHASGIRLPRNWMHLHFLRAIGTA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGV VQHEPL GY+S  RKQ ++P  E
Sbjct  378  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGVEVQHEPLVGYLSSYRKQIEVPAAE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  438  ATIEATAQGIASMLCAHGPEVEW  460



>ref|XP_007151935.1| hypothetical protein PHAVU_004G088300g [Phaseolus vulgaris]
 gb|ESW23929.1| hypothetical protein PHAVU_004G088300g [Phaseolus vulgaris]
Length=1169

 Score =   287 bits (734),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  262  LSVCDNEVARYETATLTAVAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  321

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAE+YA G+RLPRNWMH HFLRAIG A
Sbjct  322  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEEYACGIRLPRNWMHFHFLRAIGTA  381

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMR+G+AADAAAALLFRILSQPALLFPPLRQV+GV +QHEPLGGYIS +RKQ +    E
Sbjct  382  MSMRSGVAADAAAALLFRILSQPALLFPPLRQVDGVEIQHEPLGGYISSNRKQIEAAAAE  441

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  442  ATIEATAQGIASMLCAHGPEVEW  464



>ref|NP_001288824.1| protein GIGANTEA [Brassica rapa]
 gb|AEB33730.1| GIGANTEA [Brassica rapa]
Length=1183

 Score =   287 bits (734),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  267  LSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYAIATP  326

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  327  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  386

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILSQPALLFPPL Q EGV ++H P+GGY S  RKQ ++P  E
Sbjct  387  MSMRAGVAADAAAALLFRILSQPALLFPPLSQAEGVEIKHAPIGGYGSNYRKQIEVPAAE  446

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  447  ATIEATAQGIASMLCAHGPEVEW  469



>ref|XP_010477543.1| PREDICTED: protein GIGANTEA-like isoform X1 [Camelina sativa]
Length=1170

 Score =   287 bits (734),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYA+A+P
Sbjct  260  LSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYALATP  319

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  320  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  379

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILS+PALLFPPL QVEGV +QH P+GGY S  RKQ ++P  E
Sbjct  380  MSMRAGVAADAAAALLFRILSRPALLFPPLSQVEGVEIQHAPIGGYSSNYRKQIEVPAAE  439

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  440  ATIEATAQGIASMLCAHGPEVEW  462



>ref|XP_010477544.1| PREDICTED: protein GIGANTEA-like isoform X2 [Camelina sativa]
Length=1170

 Score =   287 bits (734),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYA+A+P
Sbjct  260  LSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYALATP  319

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  320  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  379

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILS+PALLFPPL QVEGV +QH P+GGY S  RKQ ++P  E
Sbjct  380  MSMRAGVAADAAAALLFRILSRPALLFPPLSQVEGVEIQHAPIGGYSSNYRKQIEVPAAE  439

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  440  ATIEATAQGIASMLCAHGPEVEW  462



>ref|XP_010477546.1| PREDICTED: protein GIGANTEA-like isoform X4 [Camelina sativa]
Length=1169

 Score =   287 bits (734),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYA+A+P
Sbjct  259  LSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYALATP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  319  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  378

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILS+PALLFPPL QVEGV +QH P+GGY S  RKQ ++P  E
Sbjct  379  MSMRAGVAADAAAALLFRILSRPALLFPPLSQVEGVEIQHAPIGGYSSNYRKQIEVPAAE  438

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  439  ATIEATAQGIASMLCAHGPEVEW  461



>ref|XP_010477545.1| PREDICTED: protein GIGANTEA-like isoform X3 [Camelina sativa]
Length=1169

 Score =   287 bits (734),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYA+A+P
Sbjct  259  LSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYALATP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  319  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  378

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILS+PALLFPPL QVEGV +QH P+GGY S  RKQ ++P  E
Sbjct  379  MSMRAGVAADAAAALLFRILSRPALLFPPLSQVEGVEIQHAPIGGYSSNYRKQIEVPAAE  438

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  439  ATIEATAQGIASMLCAHGPEVEW  461



>ref|XP_009115601.1| PREDICTED: protein GIGANTEA [Brassica rapa]
Length=1171

 Score =   287 bits (734),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  255  LSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYAIATP  314

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  315  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  374

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILSQPALLFPPL Q EGV ++H P+GGY S  RKQ ++P  E
Sbjct  375  MSMRAGVAADAAAALLFRILSQPALLFPPLSQAEGVEIKHAPIGGYGSNYRKQIEVPAAE  434

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  435  ATIEATAQGIASMLCAHGPEVEW  457



>emb|CDY04787.1| BnaC05g18020D [Brassica napus]
Length=1170

 Score =   287 bits (734),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  255  LSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYAIATP  314

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  315  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  374

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILSQPALLFPPL Q EGV ++H P+GGY S  RKQ ++P  E
Sbjct  375  MSMRAGVAADAAAALLFRILSQPALLFPPLSQAEGVEIKHAPIGGYGSNYRKQIEVPAAE  434

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  435  ATIEATAQGIASMLCAHGPEVEW  457



>ref|XP_010498761.1| PREDICTED: protein GIGANTEA [Camelina sativa]
Length=1169

 Score =   286 bits (733),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYA+A+P
Sbjct  259  LSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYALATP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  319  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  378

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILS+PALLFPPL QVEGV +QH P+GGY S  RKQ ++P  E
Sbjct  379  MSMRAGVAADAAAALLFRILSRPALLFPPLSQVEGVEIQHAPIGGYSSNYRKQIEVPAAE  438

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  439  ATIEATAQGIASMLCAHGPEVEW  461



>emb|CDY21388.1| BnaA09g30390D [Brassica napus]
Length=1171

 Score =   286 bits (733),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  255  LSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYAIATP  314

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  315  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  374

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILSQPALLFPPL Q EGV ++H P+GGY S  RKQ ++P  E
Sbjct  375  MSMRAGVAADAAAALLFRILSQPALLFPPLSQAEGVEIKHAPIGGYGSNYRKQIEVPAAE  434

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  435  ATIEATAQGIASMLCAHGPEVEW  457



>gb|AIR93790.1| gigantea [Kalanchoe fedtschenkoi]
Length=1149

 Score =   286 bits (732),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEVSRY+TATLTAIAVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIASP
Sbjct  245  LSVCDEEVSRYDTATLTAIAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIASP  304

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL+GLLEAPPSWAPDALDA+VQLVELLRAAE+YASG+RLPRNW+HLHFL+AIG A
Sbjct  305  SATQRLLVGLLEAPPSWAPDALDAAVQLVELLRAAEEYASGMRLPRNWIHLHFLQAIGTA  364

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEG+ VQH+ LG   S  RKQ ++   E
Sbjct  365  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGIEVQHDSLGRQASSYRKQIEVVGTE  424

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            A+++ATAQGIASMLCA+GPEVEW
Sbjct  425  ASIDATAQGIASMLCANGPEVEW  447



>ref|XP_010462850.1| PREDICTED: protein GIGANTEA-like [Camelina sativa]
Length=1138

 Score =   286 bits (731),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYA+A+P
Sbjct  258  LSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYALATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILS+PALLFPPL QVEGV +QH P+GGY S  RKQ ++P  E
Sbjct  378  MSMRAGVAADAAAALLFRILSRPALLFPPLSQVEGVEIQHAPIGGYSSNYRKQIEVPAAE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  438  ATIEATAQGIASMLCAHGPEVEW  460



>ref|XP_004160322.1| PREDICTED: protein GIGANTEA-like, partial [Cucumis sativus]
Length=994

 Score =   284 bits (727),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 178/203 (88%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  258  LSVCDEEVARYETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGIRLPRNWMHLHFLRAIGTA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMR GIAADAAAALLFRILSQPALLFPPLRQVEG  +QHEPLG YIS  ++Q ++P  E
Sbjct  378  MSMRVGIAADAAAALLFRILSQPALLFPPLRQVEGAEIQHEPLGDYISSYQRQIEVPAAE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHG EVEW
Sbjct  438  ATIEATAQGIASMLCAHGLEVEW  460



>ref|XP_004140955.1| PREDICTED: protein GIGANTEA-like [Cucumis sativus]
 gb|KGN46115.1| hypothetical protein Csa_6G055360 [Cucumis sativus]
Length=1170

 Score =   285 bits (728),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 178/203 (88%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  258  LSVCDEEVARYETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGIRLPRNWMHLHFLRAIGTA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMR GIAADAAAALLFRILSQPALLFPPLRQVEG  +QHEPLG YIS  ++Q ++P  E
Sbjct  378  MSMRVGIAADAAAALLFRILSQPALLFPPLRQVEGAEIQHEPLGDYISSYQRQIEVPAAE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHG EVEW
Sbjct  438  ATIEATAQGIASMLCAHGLEVEW  460



>gb|EEC70061.1| hypothetical protein OsI_00663 [Oryza sativa Indica Group]
Length=1176

 Score =   283 bits (724),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 169/219 (77%), Positives = 185/219 (84%), Gaps = 16/219 (7%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPTTP+DEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  261  LSVCDEEVARYETANLTAAAVPALLLPPPTTPLDEHLVAGLPPLEPYARLFHRYYAIATP  320

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL GLLEAPPSWAPDALDA+VQLVELLRAAEDY SG+RLP+NWMHLHFLRAIG A
Sbjct  321  SATQRLLFGLLEAPPSWAPDALDAAVQLVELLRAAEDYDSGMRLPKNWMHLHFLRAIGTA  380

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQ-------  520
            MSMRAGIAAD +AALLFRILSQP LLFPPLR  EGV + HEPLGGY+S  ++Q       
Sbjct  381  MSMRAGIAADTSAALLFRILSQPTLLFPPLRHAEGVELHHEPLGGYVSSYKRQLHIDLYF  440

Query  521  ---------RDIPEIEATVEATAQGIASMLCAHGPEVEW  610
                      ++P  EAT++ATAQGIASMLCAHGP+VEW
Sbjct  441  HTCSFNCTKLEVPASEATIDATAQGIASMLCAHGPDVEW  479



>gb|EEE54000.1| hypothetical protein OsJ_00641 [Oryza sativa Japonica Group]
Length=1176

 Score =   283 bits (724),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 169/219 (77%), Positives = 185/219 (84%), Gaps = 16/219 (7%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPTTP+DEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  261  LSVCDEEVARYETANLTAAAVPALLLPPPTTPLDEHLVAGLPPLEPYARLFHRYYAIATP  320

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL GLLEAPPSWAPDALDA+VQLVELLRAAEDY SG+RLP+NWMHLHFLRAIG A
Sbjct  321  SATQRLLFGLLEAPPSWAPDALDAAVQLVELLRAAEDYDSGMRLPKNWMHLHFLRAIGTA  380

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQ-------  520
            MSMRAGIAAD +AALLFRILSQP LLFPPLR  EGV + HEPLGGY+S  ++Q       
Sbjct  381  MSMRAGIAADTSAALLFRILSQPTLLFPPLRHAEGVELHHEPLGGYVSSYKRQLHIDLYF  440

Query  521  ---------RDIPEIEATVEATAQGIASMLCAHGPEVEW  610
                      ++P  EAT++ATAQGIASMLCAHGP+VEW
Sbjct  441  HMCSFNCTKLEVPASEATIDATAQGIASMLCAHGPDVEW  479



>ref|XP_004139688.1| PREDICTED: protein GIGANTEA-like [Cucumis sativus]
Length=1168

 Score =   282 bits (722),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  257  LSVCDEEVARYETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  316

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAE+YA+G+R+P+N  HLHFLRAIG A
Sbjct  317  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEEYATGIRIPKNKTHLHFLRAIGTA  376

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGI+ADAAAALLFRILSQPALLFPPLRQVE   VQ E LGGY S  R+Q ++   E
Sbjct  377  MSMRAGISADAAAALLFRILSQPALLFPPLRQVEETDVQCESLGGYDSSYREQIEVSAAE  436

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT++ATAQGIASMLCAHGPEVEW
Sbjct  437  ATIDATAQGIASMLCAHGPEVEW  459



>ref|XP_009631436.1| PREDICTED: protein GIGANTEA-like isoform X7 [Nicotiana tomentosiformis]
Length=941

 Score =   280 bits (717),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 188/203 (93%), Gaps = 11/203 (5%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTTPMDEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  43   LSVCDEEVARYETATLTAVAVPALLLPPPTTPMDEHLVAGLPALEPYARLFHRYYAIATP  102

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA
Sbjct  103  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  162

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGI+ADAAAALLFRILSQPALLFPPLRQVEG+ VQHE           QR++P  E
Sbjct  163  MSMRAGISADAAAALLFRILSQPALLFPPLRQVEGIEVQHE-----------QREVPAAE  211

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            ATVEATAQGIASMLCAHGPEVEW
Sbjct  212  ATVEATAQGIASMLCAHGPEVEW  234



>ref|XP_009631435.1| PREDICTED: protein GIGANTEA-like isoform X6 [Nicotiana tomentosiformis]
Length=945

 Score =   280 bits (717),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 188/203 (93%), Gaps = 11/203 (5%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTTPMDEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  47   LSVCDEEVARYETATLTAVAVPALLLPPPTTPMDEHLVAGLPALEPYARLFHRYYAIATP  106

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA
Sbjct  107  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  166

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGI+ADAAAALLFRILSQPALLFPPLRQVEG+ VQHE           QR++P  E
Sbjct  167  MSMRAGISADAAAALLFRILSQPALLFPPLRQVEGIEVQHE-----------QREVPAAE  215

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            ATVEATAQGIASMLCAHGPEVEW
Sbjct  216  ATVEATAQGIASMLCAHGPEVEW  238



>gb|ADP92454.1| GIGANTEA 1 [x Doritaenopsis hybrid cultivar]
Length=1160

 Score =   282 bits (721),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 188/203 (93%), Gaps = 1/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYE+A LTA AVPALLLPPPTTP+DEHLV GLPALEPYARLFHRYY+IA+P
Sbjct  255  LSVCDDEVARYESANLTAAAVPALLLPPPTTPLDEHLVAGLPALEPYARLFHRYYSIATP  314

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDY SG+RLPRNWMHLHFLRAIG A
Sbjct  315  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYESGMRLPRNWMHLHFLRAIGTA  374

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMR GIAADAAAALLFRILSQP LLFPPLR  EGV VQHEPL GYIS+ +KQ ++P  E
Sbjct  375  MSMRTGIAADAAAALLFRILSQPMLLFPPLRHTEGVEVQHEPLAGYISY-KKQLEVPAAE  433

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGP+VEW
Sbjct  434  ATIEATAQGIASMLCAHGPDVEW  456



>ref|XP_009380419.1| PREDICTED: protein GIGANTEA-like isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380420.1| PREDICTED: protein GIGANTEA-like isoform X2 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380421.1| PREDICTED: protein GIGANTEA-like isoform X3 [Musa acuminata subsp. 
malaccensis]
Length=1162

 Score =   282 bits (721),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPT  +DEHL   LPALEPYA LFHRYYA+A+P
Sbjct  257  LSVCDEEVARYETANLTAAAVPALLLPPPTNALDEHLDAALPALEPYACLFHRYYALATP  316

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG++LPRNWMHLHFLRAIGIA
Sbjct  317  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVKLPRNWMHLHFLRAIGIA  376

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMR GIAADAAAALLFRILSQP LLFPPLR  EG+ V HEP+ GYIS  ++Q +    +
Sbjct  377  MSMRVGIAADAAAALLFRILSQPTLLFPPLRHAEGIKVHHEPVDGYISPYKRQIEASICD  436

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGP+VEW
Sbjct  437  ATIEATAQGIASMLCAHGPDVEW  459



>ref|XP_008456743.1| PREDICTED: protein GIGANTEA-like [Cucumis melo]
 ref|XP_008456744.1| PREDICTED: protein GIGANTEA-like [Cucumis melo]
 ref|XP_008456745.1| PREDICTED: protein GIGANTEA-like [Cucumis melo]
Length=1170

 Score =   281 bits (720),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  258  LSVCDEEVARYETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGIRLPRNWMHLHFLRAIGTA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMR GIAADAAAALLFRILSQPALLFPPLRQVE   +QHEPLG YIS  ++Q ++P  E
Sbjct  378  MSMRVGIAADAAAALLFRILSQPALLFPPLRQVEEAEIQHEPLGDYISSYQRQIEVPAAE  437

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHG EVEW
Sbjct  438  ATIEATAQGIASMLCAHGLEVEW  460



>ref|XP_009610493.1| PREDICTED: protein GIGANTEA-like [Nicotiana tomentosiformis]
 ref|XP_009610494.1| PREDICTED: protein GIGANTEA-like [Nicotiana tomentosiformis]
Length=1158

 Score =   281 bits (719),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 184/203 (91%), Gaps = 11/203 (5%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTTPMDEHLV GLPALEPYARLFHRYYAIASP
Sbjct  260  LSVCDEEVARYETATLTAAAVPALLLPPPTTPMDEHLVAGLPALEPYARLFHRYYAIASP  319

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL+GLLEAPPSWAPDALDA+VQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA
Sbjct  320  SATQRLLVGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  379

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAAD+AAALLFRILSQPALLFPPLRQVEG+ VQ   +G   +          IE
Sbjct  380  MSMRAGIAADSAAALLFRILSQPALLFPPLRQVEGIEVQQH-VGTEAT----------IE  428

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            ATVEATAQGIASMLCAHGPEVEW
Sbjct  429  ATVEATAQGIASMLCAHGPEVEW  451



>ref|XP_009631432.1| PREDICTED: protein GIGANTEA-like isoform X3 [Nicotiana tomentosiformis]
Length=1165

 Score =   279 bits (713),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 188/203 (93%), Gaps = 11/203 (5%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTTPMDEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  267  LSVCDEEVARYETATLTAVAVPALLLPPPTTPMDEHLVAGLPALEPYARLFHRYYAIATP  326

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA
Sbjct  327  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  386

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGI+ADAAAALLFRILSQPALLFPPLRQVEG+ VQHE           QR++P  E
Sbjct  387  MSMRAGISADAAAALLFRILSQPALLFPPLRQVEGIEVQHE-----------QREVPAAE  435

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            ATVEATAQGIASMLCAHGPEVEW
Sbjct  436  ATVEATAQGIASMLCAHGPEVEW  458



>ref|XP_009631429.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009631430.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nicotiana tomentosiformis]
Length=1173

 Score =   278 bits (712),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 188/203 (93%), Gaps = 11/203 (5%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTTPMDEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  275  LSVCDEEVARYETATLTAVAVPALLLPPPTTPMDEHLVAGLPALEPYARLFHRYYAIATP  334

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA
Sbjct  335  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  394

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGI+ADAAAALLFRILSQPALLFPPLRQVEG+ VQHE           QR++P  E
Sbjct  395  MSMRAGISADAAAALLFRILSQPALLFPPLRQVEGIEVQHE-----------QREVPAAE  443

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            ATVEATAQGIASMLCAHGPEVEW
Sbjct  444  ATVEATAQGIASMLCAHGPEVEW  466



>ref|XP_009631434.1| PREDICTED: protein GIGANTEA-like isoform X5 [Nicotiana tomentosiformis]
Length=1155

 Score =   278 bits (712),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 188/203 (93%), Gaps = 11/203 (5%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTTPMDEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  257  LSVCDEEVARYETATLTAVAVPALLLPPPTTPMDEHLVAGLPALEPYARLFHRYYAIATP  316

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA
Sbjct  317  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  376

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGI+ADAAAALLFRILSQPALLFPPLRQVEG+ VQHE           QR++P  E
Sbjct  377  MSMRAGISADAAAALLFRILSQPALLFPPLRQVEGIEVQHE-----------QREVPAAE  425

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            ATVEATAQGIASMLCAHGPEVEW
Sbjct  426  ATVEATAQGIASMLCAHGPEVEW  448



>gb|ACT22765.1| GIGANTEA [Allium cepa]
Length=1109

 Score =   278 bits (711),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 185/203 (91%), Gaps = 3/203 (1%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPP    +EHLV GLPALEPYARLFHRYYAIA+P
Sbjct  258  LSVCDEEVARYETANLTAAAVPALLLPPP---TNEHLVAGLPALEPYARLFHRYYAIATP  314

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG++LPRNW+HLHFLRAIG A
Sbjct  315  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGMKLPRNWLHLHFLRAIGTA  374

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQP LLFPP+R  EGV V HEPLGGYIS  +KQ ++P  E
Sbjct  375  MSMRAGIAADAAAALLFRILSQPTLLFPPIRFAEGVEVHHEPLGGYISSYKKQLEVPAAE  434

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  435  ATIEATAQGIASMLCAHGPEVEW  457



>ref|XP_009631431.1| PREDICTED: protein GIGANTEA-like isoform X2 [Nicotiana tomentosiformis]
Length=1169

 Score =   278 bits (712),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 188/203 (93%), Gaps = 11/203 (5%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTTPMDEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  271  LSVCDEEVARYETATLTAVAVPALLLPPPTTPMDEHLVAGLPALEPYARLFHRYYAIATP  330

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA
Sbjct  331  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  390

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGI+ADAAAALLFRILSQPALLFPPLRQVEG+ VQHE           QR++P  E
Sbjct  391  MSMRAGISADAAAALLFRILSQPALLFPPLRQVEGIEVQHE-----------QREVPAAE  439

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            ATVEATAQGIASMLCAHGPEVEW
Sbjct  440  ATVEATAQGIASMLCAHGPEVEW  462



>gb|ACT22764.1| GIGANTEA [Allium cepa]
Length=1109

 Score =   278 bits (711),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 185/203 (91%), Gaps = 3/203 (1%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPP    +EHLV GLPALEPYARLFHRYYAIA+P
Sbjct  258  LSVCDEEVARYETANLTAAAVPALLLPPP---TNEHLVAGLPALEPYARLFHRYYAIATP  314

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG++LPRNW+HLHFLRAIG A
Sbjct  315  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGMKLPRNWLHLHFLRAIGTA  374

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQP LLFPP+R  EGV V HEPLGGYIS  +KQ ++P  E
Sbjct  375  MSMRAGIAADAAAALLFRILSQPTLLFPPIRFAEGVEVHHEPLGGYISSYKKQLEVPAAE  434

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  435  ATIEATAQGIASMLCAHGPEVEW  457



>ref|XP_009631433.1| PREDICTED: protein GIGANTEA-like isoform X4 [Nicotiana tomentosiformis]
Length=1159

 Score =   278 bits (712),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 188/203 (93%), Gaps = 11/203 (5%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTTPMDEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  261  LSVCDEEVARYETATLTAVAVPALLLPPPTTPMDEHLVAGLPALEPYARLFHRYYAIATP  320

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA
Sbjct  321  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  380

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGI+ADAAAALLFRILSQPALLFPPLRQVEG+ VQHE           QR++P  E
Sbjct  381  MSMRAGISADAAAALLFRILSQPALLFPPLRQVEGIEVQHE-----------QREVPAAE  429

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            ATVEATAQGIASMLCAHGPEVEW
Sbjct  430  ATVEATAQGIASMLCAHGPEVEW  452



>ref|XP_010097648.1| hypothetical protein L484_023788 [Morus notabilis]
 gb|EXB70603.1| hypothetical protein L484_023788 [Morus notabilis]
Length=1195

 Score =   277 bits (708),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 192/231 (83%), Gaps = 28/231 (12%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  256  LSVCDEEVARYETATLTAVAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  315

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRL----------------  313
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RL                
Sbjct  316  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGIRLVKAVRYNIMVPPKPAS  375

Query  314  ------------PRNWMHLHFLRAIGIAMSMRagiaadaaaaLLFRILSQPALLFPPLRQ  457
                        PRNWMHLHFLRAIG AMSMRAGIAADAAAALLFRILSQPALLFPPLRQ
Sbjct  376  SVVEKLPAFIVLPRNWMHLHFLRAIGTAMSMRAGIAADAAAALLFRILSQPALLFPPLRQ  435

Query  458  VEGVGVQHEPLGGYISWDRKQRDIPEIEATVEATAQGIASMLCAHGPEVEW  610
            VEGV VQHEPL GYIS   KQ ++P  EAT+EATAQGIASMLCAHGP+VEW
Sbjct  436  VEGVEVQHEPLDGYISSYSKQIEVPAAEATIEATAQGIASMLCAHGPDVEW  486



>ref|XP_009772049.1| PREDICTED: protein GIGANTEA-like [Nicotiana sylvestris]
Length=1155

 Score =   276 bits (706),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 186/203 (92%), Gaps = 11/203 (5%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTTPMDEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  257  LSVCDEEVARYETATLTAVAVPALLLPPPTTPMDEHLVAGLPALEPYARLFHRYYAIATP  316

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRL LGLLE PPSWAPDALDA+VQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA
Sbjct  317  SATQRLFLGLLEGPPSWAPDALDAAVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  376

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEG+ VQHE           QR++P  E
Sbjct  377  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGIEVQHE-----------QREVPAAE  425

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            ATVEATAQGIASMLCAHGPEVEW
Sbjct  426  ATVEATAQGIASMLCAHGPEVEW  448



>ref|XP_010268583.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
 ref|XP_010268584.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
 ref|XP_010268585.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
 ref|XP_010268586.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
 ref|XP_010268587.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
 ref|XP_010268588.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
Length=1083

 Score =   275 bits (703),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 189/206 (92%), Gaps = 3/206 (1%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA AVPALLLPPPTTP+DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  259  LSVCDDEVARYETATLTAAAVPALLLPPPTTPLDEHLVAGLPALEPYARLFHRYYAIATP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYAS-GLRLPRNWMHLHFLRAIGI  358
            SATQRLL+GLLEAPPSWAPDALDASVQLVELLRAAEDYAS G+RLPRNWMHLHFLRAIG 
Sbjct  319  SATQRLLVGLLEAPPSWAPDALDASVQLVELLRAAEDYASGGMRLPRNWMHLHFLRAIGT  378

Query  359  AMSMRagiaadaaaaLLFRILSQPALLFP--PLRQVEGVGVQHEPLGGYISWDRKQRDIP  532
            AMSMRAGIAADAAAALLFRILSQ ALLFP  PLRQ EGV VQHEPLG YIS   KQ ++P
Sbjct  379  AMSMRAGIAADAAAALLFRILSQHALLFPPHPLRQTEGVEVQHEPLGSYISCYGKQIEVP  438

Query  533  EIEATVEATAQGIASMLCAHGPEVEW  610
              EAT+EATAQGIASM CAHGPEVEW
Sbjct  439  AAEATIEATAQGIASMFCAHGPEVEW  464



>ref|XP_010268589.1| PREDICTED: protein GIGANTEA-like isoform X2 [Nelumbo nucifera]
Length=1081

 Score =   275 bits (702),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 189/206 (92%), Gaps = 3/206 (1%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA AVPALLLPPPTTP+DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  257  LSVCDDEVARYETATLTAAAVPALLLPPPTTPLDEHLVAGLPALEPYARLFHRYYAIATP  316

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYAS-GLRLPRNWMHLHFLRAIGI  358
            SATQRLL+GLLEAPPSWAPDALDASVQLVELLRAAEDYAS G+RLPRNWMHLHFLRAIG 
Sbjct  317  SATQRLLVGLLEAPPSWAPDALDASVQLVELLRAAEDYASGGMRLPRNWMHLHFLRAIGT  376

Query  359  AMSMRagiaadaaaaLLFRILSQPALLFP--PLRQVEGVGVQHEPLGGYISWDRKQRDIP  532
            AMSMRAGIAADAAAALLFRILSQ ALLFP  PLRQ EGV VQHEPLG YIS   KQ ++P
Sbjct  377  AMSMRAGIAADAAAALLFRILSQHALLFPPHPLRQTEGVEVQHEPLGSYISCYGKQIEVP  436

Query  533  EIEATVEATAQGIASMLCAHGPEVEW  610
              EAT+EATAQGIASM CAHGPEVEW
Sbjct  437  AAEATIEATAQGIASMFCAHGPEVEW  462



>ref|XP_004252566.1| PREDICTED: protein GIGANTEA-like isoform X1 [Solanum lycopersicum]
Length=1167

 Score =   272 bits (696),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 188/203 (93%), Gaps = 4/203 (2%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEVSRYETATLTA AVPALLLPPPTTPMDEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  257  LSVCDEEVSRYETATLTAAAVPALLLPPPTTPMDEHLVAGLPPLEPYARLFHRYYAIATP  316

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL+GLLEAPPSWAPDALDA+VQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA
Sbjct  317  SATQRLLVGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  376

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAAD+AAALLFR+LSQPALLFPPLRQ+E +    E LGG  S ++KQR++   E
Sbjct  377  MSMRAGIAADSAAALLFRVLSQPALLFPPLRQIEEI----EILGGDTSCNKKQREVTAAE  432

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            ATVEATAQGIASMLCAHGPEVEW
Sbjct  433  ATVEATAQGIASMLCAHGPEVEW  455



>ref|XP_010314472.1| PREDICTED: protein GIGANTEA-like isoform X2 [Solanum lycopersicum]
Length=1166

 Score =   272 bits (696),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 188/203 (93%), Gaps = 4/203 (2%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEVSRYETATLTA AVPALLLPPPTTPMDEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  256  LSVCDEEVSRYETATLTAAAVPALLLPPPTTPMDEHLVAGLPPLEPYARLFHRYYAIATP  315

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLL+GLLEAPPSWAPDALDA+VQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA
Sbjct  316  SATQRLLVGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  375

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAAD+AAALLFR+LSQPALLFPPLRQ+E +    E LGG  S ++KQR++   E
Sbjct  376  MSMRAGIAADSAAALLFRVLSQPALLFPPLRQIEEI----EILGGDTSCNKKQREVTAAE  431

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            ATVEATAQGIASMLCAHGPEVEW
Sbjct  432  ATVEATAQGIASMLCAHGPEVEW  454



>ref|XP_006842209.1| hypothetical protein AMTR_s00078p00173230 [Amborella trichopoda]
 gb|ERN03884.1| hypothetical protein AMTR_s00078p00173230 [Amborella trichopoda]
Length=1143

 Score =   269 bits (688),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 183/203 (90%), Gaps = 1/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETA LTA AVPALLLPPPT   DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  232  LSVCDEEVARYETANLTAAAVPALLLPPPTAA-DEHLVAGLPALEPYARLFHRYYAIATP  290

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLPRNWMHLHFLRAIGIA
Sbjct  291  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGMRLPRNWMHLHFLRAIGIA  350

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQP LLFPP R  EG+ VQ+EP GG  S  RKQ ++   E
Sbjct  351  MSMRAGIAADAAAALLFRILSQPTLLFPPPRHTEGIEVQNEPQGGSSSAYRKQVEVTAAE  410

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQG+AS+LCAHGPEVEW
Sbjct  411  ATIEATAQGVASLLCAHGPEVEW  433



>gb|AAL08497.2| gigantea-like protein [Hordeum vulgare]
Length=856

 Score =   259 bits (661),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  137  PYARLFHRYYAIASPSATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLP  316
            PYARLFHRYYAIA+PSATQRLL GLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLP
Sbjct  1    PYARLFHRYYAIATPSATQRLLFGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGMRLP  60

Query  317  RNWMHLHFLRAIGIAMSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGG  496
            +NW+HLHFLRAIG AMSMRAGIAAD AAALLFRILSQP LLFPPLR  EGV VQHEPLGG
Sbjct  61   KNWLHLHFLRAIGTAMSMRAGIAADTAAALLFRILSQPTLLFPPLRHAEGVEVQHEPLGG  120

Query  497  YISWDRKQRDIPEIEATVEATAQGIASMLCAHGPEVEW  610
            Y+S  ++Q ++P  E T++ATAQGIAS+LCAHGP+VEW
Sbjct  121  YVSSYKRQLEVPASETTIDATAQGIASLLCAHGPDVEW  158



>gb|AAF00023.1| GIGANTEA [Arabidopsis thaliana]
Length=1155

 Score =   259 bits (661),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 180/203 (89%), Gaps = 18/203 (9%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  258  LSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYAIATP  317

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIGIA
Sbjct  318  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIA  377

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAG+AADAAAALLFRILSQPALLFPPL QVEG+                  ++P  E
Sbjct  378  MSMRAGVAADAAAALLFRILSQPALLFPPLSQVEGI------------------EVPAAE  419

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  420  ATIEATAQGIASMLCAHGPEVEW  442



>dbj|BAD97869.1| GI homologue [Lemna gibba]
Length=1116

 Score =   258 bits (658),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 176/203 (87%), Gaps = 7/203 (3%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+R+ETA LTA AVPALLLPPPTTP+DEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  248  LSVCDEEVARHETANLTAAAVPALLLPPPTTPLDEHLVAGLPPLEPYARLFHRYYAIATP  307

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYA+G+RLPRNWMHLHFLRAIG A
Sbjct  308  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYATGMRLPRNWMHLHFLRAIGTA  367

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFR+LSQP LLFPP RQ E + + H+        +++       E
Sbjct  368  MSMRAGIAADAAAALLFRVLSQPTLLFPPPRQSERLDILHDQ-------NKQVESSSSDE  420

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT EATAQGIAS+LCAHGP+VEW
Sbjct  421  ATTEATAQGIASLLCAHGPDVEW  443



>dbj|BAD97864.1| GI homologue 1 [Lemna paucicostata]
Length=1115

 Score =   256 bits (654),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 172/203 (85%), Gaps = 9/203 (4%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+R+ETA LTA AVPALLLPPPTTP+DEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  254  LSVCDEEVARHETANLTAAAVPALLLPPPTTPLDEHLVAGLPPLEPYARLFHRYYAIATP  313

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  314  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGMRLPRNWMHLHFLRAIGTA  373

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMR GIAADAAAALLFR+LSQP LLFPP RQ E V    +      S D         E
Sbjct  374  MSMREGIAADAAAALLFRVLSQPTLLFPPPRQSERVDADQKKQIESTSSD---------E  424

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT EATAQGIAS+LCAHGP+VEW
Sbjct  425  ATTEATAQGIASLLCAHGPDVEW  447



>gb|ABR18021.1| unknown [Picea sitchensis]
Length=1179

 Score =   254 bits (650),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETA LTA AVPALLLPPPTT +DEHLV GLP LEPYARLFHRYYAIA+P
Sbjct  261  LSVCDDEVTRYETANLTAAAVPALLLPPPTTALDEHLVAGLPPLEPYARLFHRYYAIATP  320

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYAS +RLP+NW+HLHFLRAIG A
Sbjct  321  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASTMRLPKNWLHLHFLRAIGTA  380

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYI-SWDRKQRDIPEI  538
            +SMR GIAADAAAALLFR LSQPALLFPP R  +GV VQ +  G +  S   ++ ++   
Sbjct  381  LSMRVGIAADAAAALLFRTLSQPALLFPPPRLAQGVDVQCDVYGAFGPSSSGEEIEMETY  440

Query  539  EATVEATAQGIASMLCAHGPEVEW  610
            +A++EATAQG+AS++C HGPEVEW
Sbjct  441  QASIEATAQGVASLMCLHGPEVEW  464



>gb|EPS68433.1| hypothetical protein M569_06336, partial [Genlisea aurea]
Length=729

 Score =   251 bits (640),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 144/152 (95%), Gaps = 1/152 (1%)
 Frame = +2

Query  158  RYYAIASPSATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLH  337
            RYYAIASPSATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAE+YASG+RLPRNWMHLH
Sbjct  1    RYYAIASPSATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEEYASGMRLPRNWMHLH  60

Query  338  FLRAIGIAMSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRK  517
            FLRAIG+AMSMRAGIAAD+AAALLFRILSQPALLFPPLRQV+GV VQ EPL GYIS ++K
Sbjct  61   FLRAIGVAMSMRAGIAADSAAALLFRILSQPALLFPPLRQVDGVEVQFEPLAGYISSEKK  120

Query  518  -QRDIPEIEATVEATAQGIASMLCAHGPEVEW  610
             Q+++P   ATVEATAQGIASMLCAHGPEVEW
Sbjct  121  QQKELPAAGATVEATAQGIASMLCAHGPEVEW  152



>gb|AGH20049.1| GI [Picea abies]
Length=1179

 Score =   253 bits (646),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 175/204 (86%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYETA LTA AVPALLLPPPTT +DEHLV GLP LEPYA LFHRYYAIA+P
Sbjct  261  LSVCDDEVTRYETANLTAAAVPALLLPPPTTALDEHLVAGLPPLEPYACLFHRYYAIATP  320

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYAS +RLP+NW+HLHFLRAIG A
Sbjct  321  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASTMRLPKNWLHLHFLRAIGTA  380

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYI-SWDRKQRDIPEI  538
            +SMR GIAAD AAALLFR LSQPALLFPP R  +GV VQ +  G +  S   ++ ++   
Sbjct  381  LSMRVGIAADTAAALLFRTLSQPALLFPPPRLAQGVDVQCDVYGAFGPSSSGEEIEMETY  440

Query  539  EATVEATAQGIASMLCAHGPEVEW  610
            +A++EATAQG+AS++C HGPEVEW
Sbjct  441  QASIEATAQGVASLMCLHGPEVEW  464



>gb|ACY30446.1| gigantea-like protein [Liriodendron tulipifera]
Length=1209

 Score =   241 bits (616),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 160/203 (79%), Gaps = 9/203 (4%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+        A     LL PP T  +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  279  LSVCDEEVAAMNCYLTAAAVPALLLPPPTTA-LDEHLVAGLPALEPYARLFHRYYAIATP  337

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAEDYASG+RLPRNWMHLHFLRAIG A
Sbjct  338  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGMRLPRNWMHLHFLRAIGTA  397

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAA  FRIL    LL PP   +  V VQHEPLGG I     Q+ I    
Sbjct  398  MSMRAGIAADAAAA-YFRIL-HTTLLSPP--SMLRVDVQHEPLGGSI----HQKQIESAR  449

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            +T+EATAQGIASMLCAHGPEVEW
Sbjct  450  STIEATAQGIASMLCAHGPEVEW  472



>dbj|BAP76055.1| putative GI [Cryptomeria japonica]
Length=1197

 Score =   240 bits (612),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 168/204 (82%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EV+RYE+  LT+ AVP LLLPPPTT +DEHL+ GLP LEP+A LFHRYYAIASP
Sbjct  269  LSVCDDEVARYESVNLTSTAVPVLLLPPPTTALDEHLIAGLPPLEPFANLFHRYYAIASP  328

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            S+T+RLLLGLLEAPPSWAPDALDA+VQLV LLR AEDYAS +RLP+NW H+HFL AIG A
Sbjct  329  SSTERLLLGLLEAPPSWAPDALDAAVQLVGLLRHAEDYASTMRLPKNWFHMHFLHAIGTA  388

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGY-ISWDRKQRDIPEI  538
            +SMR  IAA+AAAALLFRI+SQP LLFPP R  +GV VQ +  G +  S   +Q ++   
Sbjct  389  LSMRGSIAAEAAAALLFRIISQPGLLFPPPRHAQGVDVQCDIYGAFGPSRLGEQMEVSAH  448

Query  539  EATVEATAQGIASMLCAHGPEVEW  610
            +A VEATAQG+AS++C HGP+VEW
Sbjct  449  QANVEATAQGVASLMCIHGPDVEW  472



>gb|AEK05801.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   227 bits (579),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYA LFHRYYAIA+P
Sbjct  210  LSVCDEEVARYETATLTAVAVPALLLPPPTTALDEHLVAGLPALEPYACLFHRYYAIATP  269

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELL                         G A
Sbjct  270  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLXXXXXXXXXXXXXXXXXXXXXXXXXGTA  329

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGV VQHEPL GY+S  RKQ ++P  E
Sbjct  330  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGVEVQHEPLVGYLSSYRKQIEVPAAE  389

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  390  ATIEATAQGIASMLCAHGPEVEW  412



>gb|AEK05791.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05792.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   227 bits (579),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYA LFHRYYAIA+P
Sbjct  210  LSVCDEEVARYETATLTAVAVPALLLPPPTTALDEHLVAGLPALEPYACLFHRYYAIATP  269

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELL                         G A
Sbjct  270  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLXXXXXXXXXXXXXXXXXXXXXXXXXGTA  329

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGV VQHEPL GY+S  RKQ ++P  E
Sbjct  330  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGVEVQHEPLVGYLSSYRKQIEVPAAE  389

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  390  ATIEATAQGIASMLCAHGPEVEW  412



>gb|AEK05803.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   227 bits (579),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYA LFHRYYAIA+P
Sbjct  210  LSVCDEEVARYETATLTAVAVPALLLPPPTTALDEHLVAGLPALEPYACLFHRYYAIATP  269

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELL                         G A
Sbjct  270  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLXXXXXXXXXXXXXXXXXXXXXXXXXGTA  329

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGV VQHEPL GY+S  RKQ ++P  E
Sbjct  330  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGVEVQHEPLVGYLSSYRKQIEVPAAE  389

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  390  ATIEATAQGIASMLCAHGPEVEW  412



>gb|AEK05793.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05794.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05796.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05797.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05798.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05804.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05805.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05806.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05809.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   227 bits (579),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYA LFHRYYAIA+P
Sbjct  210  LSVCDEEVARYETATLTAVAVPALLLPPPTTALDEHLVAGLPALEPYACLFHRYYAIATP  269

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELL                         G A
Sbjct  270  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLXXXXXXXXXXXXXXXXXXXXXXXXXGTA  329

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGV VQHEPL GY+S  RKQ ++P  E
Sbjct  330  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGVEVQHEPLVGYLSSYRKQIEVPAAE  389

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  390  ATIEATAQGIASMLCAHGPEVEW  412



>gb|AEK05795.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05800.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   227 bits (579),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYA LFHRYYAIA+P
Sbjct  210  LSVCDEEVARYETATLTAVAVPALLLPPPTTALDEHLVAGLPALEPYACLFHRYYAIATP  269

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELL                         G A
Sbjct  270  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLXXXXXXXXXXXXXXXXXXXXXXXXXGTA  329

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGV VQHEPL GY+S  RKQ ++P  E
Sbjct  330  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGVEVQHEPLVGYLSSYRKQIEVPAAE  389

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  390  ATIEATAQGIASMLCAHGPEVEW  412



>gb|AEK05790.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05808.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   227 bits (579),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYA LFHRYYAIA+P
Sbjct  210  LSVCDEEVARYETATLTAVAVPALLLPPPTTALDEHLVAGLPALEPYACLFHRYYAIATP  269

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELL                         G A
Sbjct  270  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLXXXXXXXXXXXXXXXXXXXXXXXXXGTA  329

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGV VQHEPL GY+S  RKQ ++P  E
Sbjct  330  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGVEVQHEPLVGYLSSYRKQIEVPAAE  389

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  390  ATIEATAQGIASMLCAHGPEVEW  412



>gb|AEK05807.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05810.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05811.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   225 bits (573),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYA LFHRYYAIA+P
Sbjct  210  LSVCDEEVARYETATLTAVAVPALLLPPPTTALDEHLVAGLPALEPYACLFHRYYAIATP  269

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELL                         G A
Sbjct  270  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLXXXXXXXXXXXXXXXXXXXXXXXXXGTA  329

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
             SMRAGIAADAAAALLFRILSQPALLFPPLRQVEGV VQHEPL GY+S  RKQ ++P  E
Sbjct  330  XSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGVEVQHEPLVGYLSSYRKQIEVPAAE  389

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  390  ATIEATAQGIASMLCAHGPEVEW  412



>gb|AEK05802.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   224 bits (571),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEPYA LFHRYYAIA+P
Sbjct  210  LSVCDEEVARYETATLTAVAVPALLLPPPTTALDEHLVAGLPALEPYACLFHRYYAIATP  269

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELL                         G A
Sbjct  270  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLXXXXXXXXXXXXXXXXXXXXXXXXXGTA  329

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGV VQHEPL G +S  RKQ ++P  E
Sbjct  330  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGVEVQHEPLVGXLSSYRKQIEVPAAE  389

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  390  ATIEATAQGIASMLCAHGPEVEW  412



>gb|AEK05799.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   224 bits (571),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA+AVPALLLPPPTT +DEHLV GLPALEP A LFHRYYAIA+P
Sbjct  210  LSVCDEEVARYETATLTAVAVPALLLPPPTTALDEHLVAGLPALEPXACLFHRYYAIATP  269

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELL                         G A
Sbjct  270  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLXXXXXXXXXXXXXXXXXXXXXXXXXGTA  329

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGV VQHEPL GY+S  RKQ ++P  E
Sbjct  330  MSMRAGIAADAAAALLFRILSQPALLFPPLRQVEGVEVQHEPLVGYLSSYRKQIEVPAAE  389

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            AT+EATAQGIASMLCAHGPEVEW
Sbjct  390  ATIEATAQGIASMLCAHGPEVEW  412



>ref|XP_002969462.1| hypothetical protein SELMODRAFT_170553 [Selaginella moellendorffii]
 gb|EFJ29550.1| hypothetical protein SELMODRAFT_170553 [Selaginella moellendorffii]
Length=1056

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 156/203 (77%), Gaps = 7/203 (3%)
 Frame = +2

Query  5    SVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASPS  184
            SVCD+EV RYETA LTA AVPALLLPPP+T +DEHLV GLP LEP+ARLFHRYYAIA+P 
Sbjct  255  SVCDDEVLRYETADLTAAAVPALLLPPPSTSLDEHLVAGLPPLEPFARLFHRYYAIATPG  314

Query  185  ATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDY-ASGLRLPRNWMHLHFLRAIGIA  361
            ATQRLLLGLLEAP SWAPDALDA+VQLVELLRAAEDY +S  RLP NW  LHFLR +G A
Sbjct  315  ATQRLLLGLLEAPASWAPDALDAAVQLVELLRAAEDYSSSSFRLPENWFRLHFLRPMGAA  374

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            M+M+ GIA+DAAAALLFR+ SQPALLFPP    +G  V     G  I  D  +      E
Sbjct  375  MTMKQGIASDAAAALLFRLFSQPALLFPPRGHAQGAQVVQPLYGPPIRLDGSE------E  428

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
               EATA+G+AS++  HG +VEW
Sbjct  429  VNEEATAKGVASLMRDHGRDVEW  451



>ref|XP_002961231.1| hypothetical protein SELMODRAFT_140066 [Selaginella moellendorffii]
 gb|EFJ38770.1| hypothetical protein SELMODRAFT_140066 [Selaginella moellendorffii]
Length=1063

 Score =   207 bits (527),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 157/206 (76%), Gaps = 4/206 (2%)
 Frame = +2

Query  5    SVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASPS  184
            SVCD+EV RYETA LTA AVPALLLPPP+T +DEHLV GLP LEP+ARLFHRYYAIA+P 
Sbjct  255  SVCDDEVLRYETADLTAAAVPALLLPPPSTSLDEHLVAGLPPLEPFARLFHRYYAIATPG  314

Query  185  ATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDY-ASGLRLPRNWMHLHFLRAIGIA  361
            ATQRLLLGLLEAP SWAPDALDA+VQLVELLRAAEDY +S  RLP NW  LHFLR +G A
Sbjct  315  ATQRLLLGLLEAPASWAPDALDAAVQLVELLRAAEDYSSSSFRLPENWFRLHFLRPMGAA  374

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWD---RKQRDIP  532
            M+M+ GIA+DAAAALLFR+ SQPALLFPP    +G  V     G  I  D     Q +  
Sbjct  375  MTMKQGIASDAAAALLFRLFSQPALLFPPRGHAQGAQVVQPLYGPPIRIDVLFHAQMEAL  434

Query  533  EIEATVEATAQGIASMLCAHGPEVEW  610
              +   EATA+G+AS++  HG +VEW
Sbjct  435  ATQVNEEATAKGVASLMRDHGRDVEW  460



>dbj|BAO66507.1| GIGANTEA [Marchantia polymorpha]
Length=1187

 Score =   177 bits (448),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 149/204 (73%), Gaps = 2/204 (1%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCD+EVSRYETA LTA AVPALL+PPPT   +  LV GLP LEPYA LFHRYYA+A+P
Sbjct  259  LSVCDDEVSRYETADLTAAAVPALLIPPPTAQNENLLVSGLPFLEPYAHLFHRYYAVATP  318

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMHLHFLRAIGIA  361
             ATQRLL GLLEAPP+WAPDAL  +V LVELLRAA++Y S ++LPR+W+ +HFLR +G A
Sbjct  319  GATQRLLFGLLEAPPTWAPDALVVAVALVELLRAADNYTSSVQLPRDWLTIHFLRPVGAA  378

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            M+ R+G AADAAAALL+ I S+PALLFPP  Q +G+      L G  S    + +     
Sbjct  379  MAQRSGTAADAAAALLYHIFSRPALLFPPPSQSQGLFSTQTLLYGTSSLAASREEAKAAA  438

Query  542  ATVE--ATAQGIASMLCAHGPEVE  607
            A     ATA G+A++L  HG +VE
Sbjct  439  AQESEVATASGLAALLTGHGIDVE  462



>gb|KGN44455.1| hypothetical protein Csa_7G293730 [Cucumis sativus]
Length=284

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  166  LSVCDEEVARYETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  225

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELLRAAEDYASGLRLPRNWMH  331
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELLRAAE+YA+G+R+ R   H
Sbjct  226  SATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEEYATGIRVSRILYH  275



>gb|KGN44456.1| hypothetical protein Csa_7G293740 [Cucumis sativus]
Length=811

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +2

Query  305  LRLPRNWMHLHFLRAIGIAMSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHE  484
            ++LPRNWMHLHFLRAIG AMSMRAGI+ADAAAALLFRILSQPALLFPPLRQVE   VQ E
Sbjct  1    MQLPRNWMHLHFLRAIGTAMSMRAGISADAAAALLFRILSQPALLFPPLRQVEETDVQCE  60

Query  485  PLGGYISWDRKQRDIPEIEATVEATAQGIASMLCAHGPEVEW  610
             LGGY S  R+Q ++   EAT++ATAQGIASMLCAHGPEVEW
Sbjct  61   SLGGYDSSYREQIEVSAAEATIDATAQGIASMLCAHGPEVEW  102



>gb|AEK26575.1| gigantea 5 [Populus tremula]
Length=110

 Score =   132 bits (332),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/92 (92%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  19   LSVCDEEVARYETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  78

Query  182  SATQRLLLGLLEAPPSWAPDALDASVQLVELL  277
            SATQRLLLGLLEAPPSWAPDALDA+VQLVELL
Sbjct  79   SATQRLLLGLLEAPPSWAPDALDAAVQLVELL  110



>gb|KJB59489.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=802

 Score =   135 bits (339),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  326  MHLHFLRAIGIAMSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYIS  505
            MHLHFLRAIG AMSMRAGIAADAAAALLFRILSQPALLFPP+RQVEGV VQHEP GGYIS
Sbjct  1    MHLHFLRAIGTAMSMRAGIAADAAAALLFRILSQPALLFPPIRQVEGVEVQHEPSGGYIS  60

Query  506  WDRKQRDIPEIEATVEATAQGIASMLCAHGPEVEW  610
              RKQ ++P  EAT+EATAQGIASMLCAHGPEVEW
Sbjct  61   CYRKQIEVPAAEATIEATAQGIASMLCAHGPEVEW  95



>gb|AEK05815.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05820.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05825.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05830.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05835.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05840.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05845.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05850.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05855.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05865.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05870.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05875.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05880.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05885.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05890.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05895.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05900.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05905.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05910.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05915.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05920.1| gigantea-5, partial [Populus balsamifera]
Length=97

 Score =   122 bits (305),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPPTT +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  12   LSVCDEEVARYETATLTAAAVPALLLPPPTTALDEHLVAGLPALEPYARLFHRYYAIATP  71

Query  182  SATQRLLLGLLEAPPSWAPDALDASV  259
            SATQRLLLGLLEAPPSWAPDALDA+V
Sbjct  72   SATQRLLLGLLEAPPSWAPDALDAAV  97



>gb|AEK05860.1| gigantea-5, partial [Populus balsamifera]
Length=97

 Score =   119 bits (298),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHRYYAIASP  181
            LSVCDEEV+RYETATLTA AVPALLLPPP T +DEHLV GLPALEPYARLFHRYYAIA+P
Sbjct  12   LSVCDEEVARYETATLTAAAVPALLLPPPXTALDEHLVAGLPALEPYARLFHRYYAIATP  71

Query  182  SATQRLLLGLLEAPPSWAPDALDASV  259
            SATQRLLLGLLEAPPSWAPDALDA+V
Sbjct  72   SATQRLLLGLLEAPPSWAPDALDAAV  97



>ref|XP_003592047.1| Protein GIGANTEA [Medicago truncatula]
Length=795

 Score =   124 bits (311),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +2

Query  362  MSMRagiaadaaaaLLFRILSQPALLFPPLRQVEGVGVQHEPLGGYISWDRKQRDIPEIE  541
            MSMRAGIAADAAAALLFRILSQPALLFPPLRQV+GV VQHEPLGGYIS   KQ ++P  E
Sbjct  1    MSMRAGIAADAAAALLFRILSQPALLFPPLRQVDGVEVQHEPLGGYISSYSKQIEVPSAE  60

Query  542  ATVEATAQGIASMLCAHGPEVEW  610
            A+++ATAQGIASMLCAHGPEVEW
Sbjct  61   ASIDATAQGIASMLCAHGPEVEW  83



>gb|EPS65289.1| hypothetical protein M569_09488 [Genlisea aurea]
Length=305

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    LSVCDEEVSRYEtatltaiavpalllpppttpMDEHLVVGLPALEPYARLFHR  160
            LSVCDEEV+RYETATLT+ AVPALLLPPPTTPMDEHLV GLPALEPYARLFHR
Sbjct  253  LSVCDEEVARYETATLTSAAVPALLLPPPTTPMDEHLVAGLPALEPYARLFHR  305



>gb|AAR90092.1| gigantea [Brassica rapa]
Length=207

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +2

Query  524  DIPEIEATVEATAQGIASMLCAHGPEVEW  610
            ++P  EAT+EATAQG ASMLCAHGPEVEW
Sbjct  2    EVPSAEATIEATAQGTASMLCAHGPEVEW  30



>gb|AAQ55454.1| gigantea [Brassica rapa subsp. oleifera]
Length=207

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +2

Query  524  DIPEIEATVEATAQGIASMLCAHGPEVEW  610
            ++P  EAT+EATAQG ASMLCAHGPEVEW
Sbjct  2    EVPSAEATIEATAQGTASMLCAHGPEVEW  30



>dbj|BAP92497.1| GIGANTEA homolog, partial [Rubus palmatus]
Length=214

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/24 (96%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +2

Query  539  EATVEATAQGIASMLCAHGPEVEW  610
            EAT+EATAQGIASMLCAHGPEVEW
Sbjct  2    EATIEATAQGIASMLCAHGPEVEW  25



>dbj|BAP92532.1| GIGANTEA homolog, partial [Rubus grayanus]
Length=214

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/24 (96%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +2

Query  539  EATVEATAQGIASMLCAHGPEVEW  610
            EAT+EATAQGIASMLCAHGPEVEW
Sbjct  2    EATIEATAQGIASMLCAHGPEVEW  25



>dbj|BAP92451.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92452.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92453.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92454.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92455.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92456.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92457.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92458.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92459.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92477.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92479.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92480.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92481.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92482.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92483.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92484.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92485.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92486.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92487.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92488.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92489.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92490.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92491.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92492.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92493.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92494.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92495.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92496.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92499.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92500.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92501.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92502.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92503.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92504.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92505.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92506.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92507.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92508.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92509.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92510.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92511.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92512.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92544.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92545.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92546.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92547.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92548.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92549.1| GIGANTEA homolog, partial [Rubus palmatus]
Length=214

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/24 (96%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +2

Query  539  EATVEATAQGIASMLCAHGPEVEW  610
            EAT+EATAQGIASMLCAHGPEVEW
Sbjct  2    EATIEATAQGIASMLCAHGPEVEW  25



>dbj|BAP92538.1| GIGANTEA homolog, partial [Rubus grayanus]
Length=214

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/24 (96%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +2

Query  539  EATVEATAQGIASMLCAHGPEVEW  610
            EAT+EATAQGIASMLCAHGPEVEW
Sbjct  2    EATIEATAQGIASMLCAHGPEVEW  25



>dbj|BAP92476.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92478.1| GIGANTEA homolog, partial [Rubus palmatus]
Length=214

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/24 (96%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +2

Query  539  EATVEATAQGIASMLCAHGPEVEW  610
            EAT+EATAQGIASMLCAHGPEVEW
Sbjct  2    EATIEATAQGIASMLCAHGPEVEW  25



>dbj|BAP92550.1| GIGANTEA homolog, partial [Rubus palmatus]
 dbj|BAP92557.1| GIGANTEA homolog, partial [Rubus grayanus]
Length=214

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/24 (96%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +2

Query  539  EATVEATAQGIASMLCAHGPEVEW  610
            EAT+EATAQGIASMLCAHGPEVEW
Sbjct  2    EATIEATAQGIASMLCAHGPEVEW  25



>dbj|BAP92498.1| GIGANTEA homolog, partial [Rubus palmatus]
Length=214

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/24 (96%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +2

Query  539  EATVEATAQGIASMLCAHGPEVEW  610
            EAT+EATAQGIASMLCAHGPEVEW
Sbjct  2    EATIEATAQGIASMLCAHGPEVEW  25



>dbj|BAP92460.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92461.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92462.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92463.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92464.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92465.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92466.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92467.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92468.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92469.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92470.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92471.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92472.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92473.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92474.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92475.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92513.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92514.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92515.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92516.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92517.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92518.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92519.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92520.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92521.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92522.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92523.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92524.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92525.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92526.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92527.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92528.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92529.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92530.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92531.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92533.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92534.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92535.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92536.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92537.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92539.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92540.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92541.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92542.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92543.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92551.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92552.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92553.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92554.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92555.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92556.1| GIGANTEA homolog, partial [Rubus grayanus]
 dbj|BAP92558.1| GIGANTEA homolog, partial [Rubus grayanus]
Length=214

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/24 (96%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +2

Query  539  EATVEATAQGIASMLCAHGPEVEW  610
            EAT+EATAQGIASMLCAHGPEVEW
Sbjct  2    EATIEATAQGIASMLCAHGPEVEW  25



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230