BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS020F07

Length=616
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAO18731.1|  cysteine protease                                       127   6e-31   Gossypium hirsutum [American cotton]
gb|KHG12401.1|  hypothetical protein F383_03889                         126   2e-30   Gossypium arboreum [tree cotton]
gb|KJB66816.1|  hypothetical protein B456_010G159600                    126   2e-30   Gossypium raimondii
gb|KJB66817.1|  hypothetical protein B456_010G159600                    125   2e-30   Gossypium raimondii
gb|KJB66818.1|  hypothetical protein B456_010G159600                    125   3e-30   Gossypium raimondii
gb|KJB66815.1|  hypothetical protein B456_010G159600                    125   3e-30   Gossypium raimondii
ref|XP_009613580.1|  PREDICTED: low-temperature-induced cysteine ...    121   1e-28   Nicotiana tomentosiformis
ref|XP_004233038.1|  PREDICTED: low-temperature-induced cysteine ...    121   1e-28   Solanum lycopersicum
ref|XP_009797427.1|  PREDICTED: low-temperature-induced cysteine ...    119   7e-28   Nicotiana sylvestris
ref|XP_010999738.1|  PREDICTED: low-temperature-induced cysteine ...    119   8e-28   Populus euphratica
ref|XP_010317333.1|  PREDICTED: xylem cysteine proteinase 2-like        119   1e-27   
ref|XP_009613579.1|  PREDICTED: low-temperature-induced cysteine ...    118   1e-27   Nicotiana tomentosiformis
ref|XP_006362442.1|  PREDICTED: uncharacterized protein LOC102602011    121   1e-27   
gb|AGV15822.1|  cysteine protease CP14                                  118   2e-27   Nicotiana tabacum [American tobacco]
gb|KHN08431.1|  Xylem cysteine proteinase 1                             117   3e-27   Glycine soja [wild soybean]
ref|XP_002305743.2|  hypothetical protein POPTR_0004s05640g             117   3e-27   Populus trichocarpa [western balsam poplar]
ref|XP_007025363.1|  Xylem bark cysteine peptidase 3 isoform 1          116   7e-27   
ref|XP_003542981.1|  PREDICTED: cysteine proteinase RD21a-like          115   2e-26   Glycine max [soybeans]
ref|XP_009797432.1|  PREDICTED: low-temperature-induced cysteine ...    115   2e-26   Nicotiana sylvestris
ref|XP_004233043.1|  PREDICTED: low-temperature-induced cysteine ...    114   5e-26   Solanum lycopersicum
emb|CDO96804.1|  unnamed protein product                                113   7e-26   Coffea canephora [robusta coffee]
ref|XP_006467643.1|  PREDICTED: cysteine proteinase RD21a-like          112   2e-25   Citrus sinensis [apfelsine]
gb|KDO77866.1|  hypothetical protein CISIN_1g043774mg                   112   2e-25   Citrus sinensis [apfelsine]
ref|XP_006449509.1|  hypothetical protein CICLE_v10015066mg             112   2e-25   Citrus clementina [clementine]
ref|XP_002317417.2|  hypothetical protein POPTR_0011s07300g             111   4e-25   Populus trichocarpa [western balsam poplar]
ref|XP_008225294.1|  PREDICTED: cysteine proteinase COT44-like          111   5e-25   Prunus mume [ume]
ref|XP_007211825.1|  hypothetical protein PRUPE_ppa004381mg             111   5e-25   Prunus persica
ref|XP_002533962.1|  cysteine protease, putative                        110   7e-25   Ricinus communis
gb|ABQ10203.1|  cysteine protease Cp5                                   110   7e-25   Actinidia deliciosa [Chinese gooseberry]
ref|XP_002317418.2|  hypothetical protein POPTR_0011s07310g             109   2e-24   Populus trichocarpa [western balsam poplar]
ref|XP_006362441.1|  PREDICTED: oryzain alpha chain-like                110   2e-24   
ref|XP_006852404.1|  hypothetical protein AMTR_s00021p00031000          109   2e-24   Amborella trichopoda
ref|XP_010052188.1|  PREDICTED: low-temperature-induced cysteine ...    109   3e-24   Eucalyptus grandis [rose gum]
gb|KCW76106.1|  hypothetical protein EUGRSUZ_D00484                     109   3e-24   Eucalyptus grandis [rose gum]
ref|XP_011039435.1|  PREDICTED: low-temperature-induced cysteine ...    108   3e-24   Populus euphratica
ref|XP_006362397.1|  PREDICTED: oryzain alpha chain-like                108   5e-24   Solanum tuberosum [potatoes]
ref|XP_011039436.1|  PREDICTED: low-temperature-induced cysteine ...    108   5e-24   Populus euphratica
ref|XP_010277012.1|  PREDICTED: low-temperature-induced cysteine ...    107   1e-23   Nelumbo nucifera [Indian lotus]
gb|KHN28613.1|  P34 putative thiol protease                             105   1e-23   Glycine soja [wild soybean]
gb|ABK95906.1|  unknown                                                 107   1e-23   Populus trichocarpa [western balsam poplar]
ref|XP_010279138.1|  PREDICTED: histone-lysine N-methyltransferas...    108   2e-23   Nelumbo nucifera [Indian lotus]
ref|XP_004293953.1|  PREDICTED: low-temperature-induced cysteine ...    105   5e-23   Fragaria vesca subsp. vesca
ref|XP_008789986.1|  PREDICTED: low-temperature-induced cysteine ...    104   1e-22   Phoenix dactylifera
ref|XP_008371471.1|  PREDICTED: low-temperature-induced cysteine ...    104   2e-22   
ref|XP_009350090.1|  PREDICTED: low-temperature-induced cysteine ...    103   3e-22   Pyrus x bretschneideri [bai li]
gb|AHM88211.1|  CAC1 protein                                            102   6e-22   Malus hybrid cultivar
ref|XP_007148042.1|  hypothetical protein PHAVU_006G175500g             102   6e-22   Phaseolus vulgaris [French bean]
ref|XP_010915506.1|  PREDICTED: low-temperature-induced cysteine ...    100   3e-21   Elaeis guineensis
ref|XP_003590277.1|  Cysteine protease                                99.0    1e-20   
gb|KEH36599.1|  papain family cysteine protease                       98.6    2e-20   Medicago truncatula
gb|KDP21101.1|  hypothetical protein JCGZ_21572                       97.8    4e-20   Jatropha curcas
ref|XP_002266308.2|  PREDICTED: low-temperature-induced cysteine ...  93.6    1e-18   Vitis vinifera
gb|KCW74111.1|  hypothetical protein EUGRSUZ_E02751                   92.8    3e-18   Eucalyptus grandis [rose gum]
ref|XP_010057104.1|  PREDICTED: low-temperature-induced cysteine ...  92.8    3e-18   Eucalyptus grandis [rose gum]
ref|XP_004485897.1|  PREDICTED: cysteine proteinase RD21a-like        92.4    3e-18   Cicer arietinum [garbanzo]
ref|XP_009404511.1|  PREDICTED: xylem cysteine proteinase 1-like      92.0    4e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001242660.1|  uncharacterized protein LOC100807362 precursor   89.7    7e-18   Glycine max [soybeans]
ref|NP_001241331.1|  uncharacterized protein LOC100811719 precursor   89.4    1e-17   Glycine max [soybeans]
gb|AAP41846.1|  cysteine protease                                     90.5    1e-17   Anthurium andraeanum [flamingo-lily]
gb|KHN48002.1|  P34 putative thiol protease                           88.6    1e-17   Glycine soja [wild soybean]
ref|XP_003636796.1|  Cysteine proteinase                              86.7    2e-16   
ref|XP_003580684.2|  PREDICTED: oryzain alpha chain-like              86.3    3e-16   Brachypodium distachyon [annual false brome]
ref|XP_009613581.1|  PREDICTED: low-temperature-induced cysteine ...  85.5    6e-16   
gb|KHN04480.1|  Cysteine proteinase RD21a                             84.3    7e-16   Glycine soja [wild soybean]
gb|AGV54734.1|  cysteine proteinase                                   84.0    1e-15   Phaseolus vulgaris [French bean]
ref|XP_004486273.1|  PREDICTED: P34 probable thiol protease-like      82.8    2e-15   Cicer arietinum [garbanzo]
ref|XP_011097243.1|  PREDICTED: cysteine proteinase COT44             82.8    2e-15   Sesamum indicum [beniseed]
gb|AES64023.2|  papain family cysteine protease                       82.8    3e-15   Medicago truncatula
gb|KDP21086.1|  hypothetical protein JCGZ_21557                       80.1    3e-15   Jatropha curcas
dbj|BAJ92693.1|  predicted protein                                    81.6    3e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001054087.2|  Os04g0650000                                     79.7    4e-15   
ref|XP_010436251.1|  PREDICTED: xylem cysteine proteinase 1-like      81.3    5e-15   Camelina sativa [gold-of-pleasure]
gb|AAD54424.1|AF182079_1  thiol protease                              82.8    5e-15   Matricaria chamomilla
ref|XP_008779806.1|  PREDICTED: ervatamin-B-like                      81.3    6e-15   
ref|XP_010109882.1|  Oryzain alpha chain                              82.4    7e-15   Morus notabilis
ref|XP_007159458.1|  hypothetical protein PHAVU_002G239300g           81.6    7e-15   Phaseolus vulgaris [French bean]
dbj|BAJ85145.1|  predicted protein                                    82.0    7e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAQ00105.1|  papain-like cysteine proteinase                      82.4    8e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001066557.2|  Os12g0273800                                     79.3    1e-14   
ref|XP_010686210.1|  PREDICTED: xylem cysteine proteinase 2-like      82.0    1e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008810168.1|  PREDICTED: ervatamin-B-like isoform X2           80.1    1e-14   
gb|KEH30224.1|  papain family cysteine protease                       80.5    1e-14   Medicago truncatula
ref|XP_004499026.1|  PREDICTED: cysteine proteinase RD21a-like        81.6    1e-14   Cicer arietinum [garbanzo]
gb|KJB69615.1|  hypothetical protein B456_011G034200                  80.1    1e-14   Gossypium raimondii
gb|ABI30276.1|  VXH-C                                                 79.7    1e-14   Vasconcellea x heilbornii [babaco]
ref|XP_008810167.1|  PREDICTED: ervatamin-B-like isoform X1           80.5    1e-14   
gb|AAQ55450.1|  34 kDa maturing seed vacuolar thiol protease prec...  78.2    1e-14   Glycine max [soybeans]
ref|XP_004504420.1|  PREDICTED: P34 probable thiol protease-like      80.5    1e-14   
ref|XP_006434711.1|  hypothetical protein CICLE_v100010541mg          78.2    2e-14   
gb|KJB69616.1|  hypothetical protein B456_011G034300                  80.1    2e-14   Gossypium raimondii
ref|XP_011088223.1|  PREDICTED: low-temperature-induced cysteine ...  81.6    2e-14   Sesamum indicum [beniseed]
gb|AJA74414.1|  cysteine protease                                     81.6    2e-14   Cicer arietinum [garbanzo]
ref|XP_010274468.1|  PREDICTED: xylem cysteine proteinase 2-like ...  79.0    2e-14   
ref|XP_010091715.1|  hypothetical protein L484_001478                 80.1    2e-14   Morus notabilis
ref|XP_002525124.1|  cysteine protease, putative                      79.7    2e-14   Ricinus communis
gb|KDP41692.1|  hypothetical protein JCGZ_16099                       80.9    2e-14   Jatropha curcas
ref|XP_010028191.1|  PREDICTED: cysteine proteinase COT44-like        80.1    2e-14   Eucalyptus grandis [rose gum]
sp|P25776.2|ORYA_ORYSJ  RecName: Full=Oryzain alpha chain; Flags:...  80.9    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010274467.1|  PREDICTED: P34 probable thiol protease-like ...  79.0    2e-14   Nelumbo nucifera [Indian lotus]
emb|CAE04498.2|  OSJNBb0059K02.8                                      80.9    2e-14   Oryza sativa Japonica Group [Japonica rice]
gb|EEE61807.1|  hypothetical protein OsJ_16426                        80.9    2e-14   Oryza sativa Japonica Group [Japonica rice]
gb|EPS62067.1|  cysteine proteinase                                   79.3    2e-14   Genlisea aurea
ref|XP_010274464.1|  PREDICTED: zingipain-2-like                      80.1    3e-14   Nelumbo nucifera [Indian lotus]
dbj|BAA14402.1|  oryzain alpha precursor                              80.9    3e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006849993.1|  hypothetical protein AMTR_s00022p00166050        79.7    3e-14   Amborella trichopoda
ref|NP_001147086.1|  thiol protease SEN102 precursor                  79.7    3e-14   Zea mays [maize]
ref|XP_004291075.1|  PREDICTED: cysteine proteinase RD21a             80.5    3e-14   Fragaria vesca subsp. vesca
ref|XP_010274466.1|  PREDICTED: zingipain-2-like isoform X2           79.0    3e-14   
ref|XP_004977049.1|  PREDICTED: oryzain alpha chain-like              80.5    3e-14   Setaria italica
ref|XP_008796668.1|  PREDICTED: oryzain alpha chain-like              80.5    3e-14   Phoenix dactylifera
gb|EEC78138.1|  hypothetical protein OsI_17694                        80.5    3e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_008779585.1|  PREDICTED: zingipain-2-like                      79.0    4e-14   
gb|EAY97106.1|  hypothetical protein OsI_19029                        79.3    4e-14   Oryza sativa Indica Group [Indian rice]
gb|ABA97421.1|  Vignain precursor, putative                           79.0    4e-14   Oryza sativa Japonica Group [Japonica rice]
emb|CAJ86180.1|  H0212B02.7                                           80.1    4e-14   Oryza sativa [red rice]
gb|AFW85695.1|  thiol protease SEN102                                 79.3    4e-14   
ref|XP_010274465.1|  PREDICTED: zingipain-2-like isoform X1           79.0    5e-14   Nelumbo nucifera [Indian lotus]
ref|XP_003593772.1|  Cysteine proteinase                              78.6    6e-14   
dbj|BAH11164.1|  cysteine protease                                    79.7    6e-14   Hordeum vulgare [barley]
ref|XP_011074404.1|  PREDICTED: low-temperature-induced cysteine ...  79.7    6e-14   Sesamum indicum [beniseed]
ref|XP_009384829.1|  PREDICTED: xylem cysteine proteinase 1-like      78.6    6e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010248205.1|  PREDICTED: zingipain-2-like                      78.6    7e-14   Nelumbo nucifera [Indian lotus]
ref|XP_010028205.1|  PREDICTED: cysteine proteinase COT44-like        78.6    7e-14   Eucalyptus grandis [rose gum]
ref|XP_009398671.1|  PREDICTED: oryzain alpha chain-like              79.3    7e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010446933.1|  PREDICTED: xylem cysteine proteinase 1           78.2    8e-14   Camelina sativa [gold-of-pleasure]
gb|KEH36581.1|  papain family cysteine protease                       78.6    8e-14   Medicago truncatula
ref|XP_010437483.1|  PREDICTED: xylem cysteine proteinase 1-like ...  78.2    9e-14   Camelina sativa [gold-of-pleasure]
ref|XP_004171356.1|  PREDICTED: cysteine proteinase RD21a-like        75.9    1e-13   
ref|XP_008453002.1|  PREDICTED: xylem cysteine proteinase 2           77.8    1e-13   Cucumis melo [Oriental melon]
ref|XP_010928804.1|  PREDICTED: xylem cysteine proteinase 1-like      77.8    1e-13   Elaeis guineensis
ref|XP_004168497.1|  PREDICTED: xylem cysteine proteinase 1-like      77.8    1e-13   
dbj|BAD29958.1|  cysteine protease                                    79.0    1e-13   Daucus carota [carrots]
ref|XP_002519955.1|  cysteine protease, putative                      77.4    1e-13   
ref|XP_004145553.1|  PREDICTED: xylem cysteine proteinase 1-like      77.8    1e-13   
dbj|BAC75927.1|  cysteine protease-5                                  77.8    1e-13   Helianthus annuus
dbj|BAA25899.1|  Bd 30K                                               78.2    1e-13   Glycine max [soybeans]
ref|XP_002869093.1|  hypothetical protein ARALYDRAFT_491113           77.8    1e-13   Arabidopsis lyrata subsp. lyrata
ref|XP_002965654.1|  hypothetical protein SELMODRAFT_230713           77.4    1e-13   
ref|XP_006284015.1|  hypothetical protein CARUB_v10005136mg           77.8    1e-13   Capsella rubella
dbj|BAF02546.1|  triticain alpha                                      78.6    2e-13   Triticum aestivum [Canadian hard winter wheat]
gb|EMS56635.1|  Oryzain alpha chain                                   78.6    2e-13   Triticum urartu
gb|KDO85216.1|  hypothetical protein CISIN_1g0186492mg                76.6    2e-13   Citrus sinensis [apfelsine]
emb|CAA53377.1|  cysteine protease                                    77.8    2e-13   Vicia sativa [spring vetch]
emb|CDP01294.1|  unnamed protein product                              78.6    2e-13   Coffea canephora [robusta coffee]
gb|EMT10408.1|  Oryzain alpha chain                                   78.6    2e-13   
ref|NP_001047923.1|  Os02g0715000                                     77.4    2e-13   
ref|XP_008782844.1|  PREDICTED: xylem cysteine proteinase 1-like      77.4    2e-13   Phoenix dactylifera
emb|CAQ00115.1|  papain-like cysteine proteinase                      75.5    2e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAD16614.1|  cysteine proteinase                                  78.2    2e-13   Dianthus caryophyllus [carnation]
ref|XP_006647791.1|  PREDICTED: xylem cysteine proteinase 1-like      77.4    2e-13   
gb|KHG05637.1|  Cysteinease RD21a -like protein                       78.2    2e-13   Gossypium arboreum [tree cotton]
gb|KHN47997.1|  P34 putative thiol protease                           77.8    2e-13   Glycine soja [wild soybean]
gb|EAY87283.1|  hypothetical protein OsI_08685                        77.4    2e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_006473845.1|  PREDICTED: xylem cysteine proteinase 2-like      77.4    2e-13   Citrus sinensis [apfelsine]
ref|XP_010919166.1|  PREDICTED: oryzain alpha chain-like              75.9    2e-13   
gb|EYU34557.1|  hypothetical protein MIMGU_mgv1a007408mg              77.8    2e-13   Erythranthe guttata [common monkey flower]
gb|ABG33750.1|  cysteine protease                                     77.8    2e-13   Hevea brasiliensis [jebe]
ref|XP_009796444.1|  PREDICTED: xylem cysteine proteinase 1-like      77.0    2e-13   Nicotiana sylvestris
ref|XP_001783545.1|  predicted protein                                77.8    2e-13   
ref|XP_008659257.1|  PREDICTED: ervatamin-B-like                      77.0    3e-13   
ref|XP_002273243.2|  PREDICTED: xylem cysteine proteinase 1           76.6    3e-13   Vitis vinifera
ref|XP_007135981.1|  hypothetical protein PHAVU_009G008200g           76.6    3e-13   Phaseolus vulgaris [French bean]
ref|XP_008660699.1|  PREDICTED: ervatamin-B-like                      77.0    3e-13   
emb|CDP18154.1|  unnamed protein product                              76.6    3e-13   Coffea canephora [robusta coffee]
ref|XP_002305073.2|  hypothetical protein POPTR_0004s05540g           76.6    3e-13   
ref|XP_009359945.1|  PREDICTED: low-temperature-induced cysteine ...  77.8    3e-13   Pyrus x bretschneideri [bai li]
emb|CDX69132.1|  BnaC01g03210D                                        76.6    4e-13   
ref|XP_006849990.1|  hypothetical protein AMTR_s00022p00165270        76.3    4e-13   Amborella trichopoda
ref|XP_008393776.1|  PREDICTED: low-temperature-induced cysteine ...  77.4    4e-13   
ref|XP_006307431.1|  hypothetical protein CARUB_v10009056mg           77.4    4e-13   
ref|XP_009599970.1|  PREDICTED: xylem cysteine proteinase 1-like      76.3    4e-13   Nicotiana tomentosiformis
ref|XP_007042494.1|  Granulin repeat cysteine protease family pro...  77.8    4e-13   
ref|XP_006492717.1|  PREDICTED: xylem cysteine proteinase 1-like      76.3    4e-13   Citrus sinensis [apfelsine]
ref|XP_004136967.1|  PREDICTED: cysteine proteinase RD21a-like        77.4    4e-13   Cucumis sativus [cucumbers]
dbj|BAC75923.1|  cysteine protease-1                                  77.4    4e-13   Helianthus annuus
ref|XP_006599887.1|  PREDICTED: P34 probable thiol protease-like      76.3    4e-13   
ref|XP_010276986.1|  PREDICTED: ervatamin-B-like                      76.3    4e-13   Nelumbo nucifera [Indian lotus]
gb|KHN41568.1|  P34 putative thiol protease                           76.3    4e-13   Glycine soja [wild soybean]
ref|XP_008796470.1|  PREDICTED: oryzain alpha chain-like              77.0    4e-13   Phoenix dactylifera
ref|XP_010932205.1|  PREDICTED: oryzain alpha chain-like              77.0    4e-13   Elaeis guineensis
ref|XP_003527269.1|  PREDICTED: xylem cysteine proteinase 2-like      76.3    4e-13   Glycine max [soybeans]
dbj|BAD29959.1|  cysteine protease                                    76.3    5e-13   Daucus carota [carrots]
ref|XP_003563708.2|  PREDICTED: ervatamin-B-like                      76.3    5e-13   Brachypodium distachyon [annual false brome]
ref|XP_006435429.1|  hypothetical protein CICLE_v10001665mg           76.3    5e-13   
ref|XP_002283263.1|  PREDICTED: cysteine proteinase COT44             76.3    5e-13   Vitis vinifera
gb|KJB14609.1|  hypothetical protein B456_002G133800                  77.0    5e-13   Gossypium raimondii
ref|XP_006857795.1|  hypothetical protein AMTR_s00061p00215070        75.9    5e-13   Amborella trichopoda
ref|XP_011100156.1|  PREDICTED: xylem cysteine proteinase 2-like      75.9    5e-13   Sesamum indicum [beniseed]
gb|KDO63024.1|  hypothetical protein CISIN_1g018958mg                 75.1    6e-13   Citrus sinensis [apfelsine]
gb|KJB14610.1|  hypothetical protein B456_002G133800                  76.6    6e-13   Gossypium raimondii
gb|KCW66364.1|  hypothetical protein EUGRSUZ_F00184                   77.0    6e-13   Eucalyptus grandis [rose gum]
ref|XP_010059895.1|  PREDICTED: low-temperature-induced cysteine ...  76.6    6e-13   Eucalyptus grandis [rose gum]
ref|XP_004500831.1|  PREDICTED: xylem cysteine proteinase 2-like      75.9    6e-13   
gb|KHN33772.1|  Xylem cysteine proteinase 2                           75.1    6e-13   Glycine soja [wild soybean]
ref|XP_010061721.1|  PREDICTED: low-temperature-induced cysteine ...  76.6    6e-13   Eucalyptus grandis [rose gum]
gb|KCW68708.1|  hypothetical protein EUGRSUZ_F02310                   76.6    6e-13   Eucalyptus grandis [rose gum]
ref|XP_009102734.1|  PREDICTED: xylem cysteine proteinase 1           75.9    6e-13   Brassica rapa
ref|XP_003522988.1|  PREDICTED: xylem cysteine proteinase 2-like      75.9    6e-13   
ref|XP_004506025.1|  PREDICTED: vignain-like                          75.5    6e-13   Cicer arietinum [garbanzo]
ref|XP_002522572.1|  cysteine protease, putative                      75.5    7e-13   
ref|XP_007136708.1|  hypothetical protein PHAVU_009G067300g           75.9    7e-13   Phaseolus vulgaris [French bean]
gb|KJB48623.1|  hypothetical protein B456_008G078300                  74.3    7e-13   Gossypium raimondii
emb|CAN61026.1|  hypothetical protein VITISV_001146                   76.6    7e-13   Vitis vinifera
ref|XP_002510170.1|  cysteine protease, putative                      76.6    7e-13   Ricinus communis
gb|KDO63025.1|  hypothetical protein CISIN_1g018958mg                 75.5    8e-13   Citrus sinensis [apfelsine]
ref|XP_002284973.1|  PREDICTED: low-temperature-induced cysteine ...  76.3    8e-13   Vitis vinifera
ref|XP_006362435.1|  PREDICTED: fruit bromelain-like                  75.5    8e-13   
ref|XP_010274447.1|  PREDICTED: ervatamin-B-like                      75.5    8e-13   Nelumbo nucifera [Indian lotus]
gb|KEH31479.1|  papain family cysteine protease                       75.5    9e-13   Medicago truncatula
gb|AAP32193.1|  cysteine protease 14                                  75.5    9e-13   Trifolium repens [creeping white clover]
ref|XP_007017153.1|  Granulin repeat cysteine protease family pro...  76.3    9e-13   Theobroma cacao [chocolate]
ref|XP_006422409.1|  hypothetical protein CICLE_v10028739mg           75.1    9e-13   Citrus clementina [clementine]
gb|KJB43804.1|  hypothetical protein B456_007G216900                  74.3    1e-12   Gossypium raimondii
ref|XP_010274449.1|  PREDICTED: zingipain-2-like                      75.5    1e-12   Nelumbo nucifera [Indian lotus]
ref|XP_007132822.1|  hypothetical protein PHAVU_011G127400g           75.1    1e-12   Phaseolus vulgaris [French bean]
gb|KJB48626.1|  hypothetical protein B456_008G078300                  74.3    1e-12   Gossypium raimondii
gb|AAK48495.1|AF259983_1  putative cysteine protease                  76.3    1e-12   Ipomoea batatas [batate]
gb|AFW76903.1|  hypothetical protein ZEAMMB73_202256                  72.8    1e-12   
ref|XP_010091714.1|  Fruit bromelain                                  76.6    1e-12   
dbj|BAC75926.1|  cysteine protease-4                                  75.1    1e-12   Helianthus annuus
ref|XP_007018686.1|  Xylem cysteine peptidase 1                       75.1    1e-12   
ref|XP_002305072.2|  hypothetical protein POPTR_0004s05520g           75.1    1e-12   
ref|XP_010094652.1|  Cysteine proteinase RD21a                        75.9    1e-12   Morus notabilis
ref|XP_011000919.1|  PREDICTED: cysteine proteinase RD21a-like        76.3    1e-12   Populus euphratica
ref|XP_011074065.1|  PREDICTED: xylem cysteine proteinase 2-like      75.1    1e-12   Sesamum indicum [beniseed]
sp|P00784.1|PAPA1_CARPA  RecName: Full=Papain; AltName: Full=Papa...  75.1    1e-12   Carica papaya [mamon]
gb|ABQ10200.1|  cysteine protease Cp2                                 75.5    1e-12   Actinidia deliciosa [Chinese gooseberry]
ref|XP_002446222.1|  hypothetical protein SORBIDRAFT_06g005410        74.7    1e-12   Sorghum bicolor [broomcorn]
emb|CDX75496.1|  BnaA01g02060D                                        75.1    1e-12   
ref|NP_001238219.1|  P34 probable thiol protease precursor            75.1    1e-12   
emb|CAE54307.1|  cysteine proteinase                                  75.1    1e-12   Gossypium hirsutum [American cotton]
ref|XP_010501397.1|  PREDICTED: zingipain-2-like                      75.5    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_008799257.1|  PREDICTED: xylem cysteine proteinase 1-like      74.7    1e-12   
sp|P22895.1|P34_SOYBN  RecName: Full=P34 probable thiol protease;...  75.1    1e-12   Glycine max [soybeans]
gb|EPS65491.1|  hypothetical protein M569_09284                       74.7    1e-12   Genlisea aurea
gb|AAX84673.1|  cysteine protease CP1                                 75.9    1e-12   Manihot esculenta [manioc]
ref|XP_006857794.1|  hypothetical protein AMTR_s00061p00214890        74.7    1e-12   Amborella trichopoda
emb|CAA46863.1|  thiolprotease                                        75.5    1e-12   Pisum sativum [garden pea]
gb|KJB48624.1|  hypothetical protein B456_008G078300                  74.3    1e-12   Gossypium raimondii
ref|XP_006857797.1|  hypothetical protein AMTR_s00061p00215400        74.7    2e-12   
ref|XP_008659254.1|  PREDICTED: ervatamin-B-like                      74.7    2e-12   
ref|XP_002313136.2|  hypothetical protein POPTR_0009s10090g           75.5    2e-12   
ref|XP_010270819.1|  PREDICTED: cysteine proteinase RD21a-like        75.5    2e-12   Nelumbo nucifera [Indian lotus]
ref|NP_974687.1|  xylem cysteine proteinase 1                         73.9    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006445658.1|  hypothetical protein CICLE_v10015798mg           74.7    2e-12   Citrus clementina [clementine]
gb|KJB48622.1|  hypothetical protein B456_008G078300                  74.7    2e-12   Gossypium raimondii
dbj|BAE80740.1|  cysteine proteinase                                  75.5    2e-12   Platycodon grandiflorus [balloon-flower]
gb|KJB48625.1|  hypothetical protein B456_008G078300                  74.7    2e-12   Gossypium raimondii
tpg|DAA35682.1|  TPA: cysteine proteinase Mir3                        75.5    2e-12   
ref|XP_007025398.1|  Senescence-associated gene 12                    74.3    2e-12   Theobroma cacao [chocolate]
gb|KHG00992.1|  Cysteinease RD21a -like protein                       74.7    2e-12   Gossypium arboreum [tree cotton]
pdb|3TNX|A  Chain A, Structure Of The Precursor Of A Thermostable...  74.7    2e-12   Carica papaya [mamon]
ref|NP_001105993.1|  cysteine protease component of protease-inhi...  75.1    2e-12   
ref|XP_004234718.1|  PREDICTED: cysteine proteinase COT44-like        74.7    2e-12   
gb|AER60490.1|  cysteine proteases                                    74.7    2e-12   Gossypium hirsutum [American cotton]
ref|XP_009358749.1|  PREDICTED: cysteine proteinase RD21a-like        75.1    2e-12   Pyrus x bretschneideri [bai li]
dbj|BAH82657.1|  cysteine protease                                    73.6    2e-12   Lotus japonicus
ref|XP_009396437.1|  PREDICTED: oryzain alpha chain-like              75.1    2e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK22314.1|  unknown                                               74.7    2e-12   Picea sitchensis
gb|KJB43805.1|  hypothetical protein B456_007G216900                  74.3    2e-12   Gossypium raimondii
gb|ABI30274.1|  VS-B                                                  74.3    2e-12   Vasconcellea stipulata
gb|KJB43803.1|  hypothetical protein B456_007G216900                  74.3    2e-12   Gossypium raimondii
gb|AAB60738.1|  Strong similarity to Dianthus cysteine proteinase...  74.7    2e-12   Arabidopsis thaliana [mouse-ear cress]
gb|AGV15823.1|  cysteine protease CP15                                75.1    2e-12   Nicotiana tabacum [American tobacco]
ref|XP_003589134.1|  Cysteine proteinase                              73.6    2e-12   
ref|XP_010279091.1|  PREDICTED: ervatamin-B                           73.9    2e-12   Nelumbo nucifera [Indian lotus]
ref|XP_007135980.1|  hypothetical protein PHAVU_009G008100g           73.9    2e-12   Phaseolus vulgaris [French bean]
ref|XP_003550321.1|  PREDICTED: cysteine proteinase RD21a-like        75.1    3e-12   Glycine max [soybeans]
gb|KDP47124.1|  hypothetical protein JCGZ_22120                       72.8    3e-12   Jatropha curcas
ref|XP_010928427.1|  PREDICTED: xylem cysteine proteinase 2-like      73.9    3e-12   
ref|XP_007132821.1|  hypothetical protein PHAVU_011G127300g           73.9    3e-12   Phaseolus vulgaris [French bean]
ref|XP_007132882.1|  hypothetical protein PHAVU_011G1328001g          71.2    3e-12   Phaseolus vulgaris [French bean]
gb|KHN08598.1|  Cysteine proteinase RD21a                             74.7    3e-12   Glycine soja [wild soybean]
gb|ACE96957.1|  peptidase C1A papain                                  70.9    3e-12   Populus tremula [European aspen]
ref|XP_010556436.1|  PREDICTED: cysteine proteinase RD21a-like        74.7    3e-12   Tarenaya hassleriana [spider flower]
gb|AFW59666.1|  hypothetical protein ZEAMMB73_680472                  72.0    3e-12   
ref|NP_001148706.1|  cysteine protease 1 precursor                    74.7    3e-12   Zea mays [maize]
gb|AAP32192.1|  cysteine protease 14                                  73.9    3e-12   Trifolium repens [creeping white clover]
gb|AFK47737.1|  unknown                                               73.9    3e-12   Medicago truncatula
gb|AFJ15103.1|  mexicain-like cystein protease                        73.9    3e-12   
ref|XP_010070600.1|  PREDICTED: cysteine proteinase COT44-like        74.3    3e-12   
ref|XP_008454976.1|  PREDICTED: low-temperature-induced cysteine ...  74.7    3e-12   
ref|XP_010317330.1|  PREDICTED: uncharacterized protein LOC101251741  75.1    3e-12   
ref|XP_008803660.1|  PREDICTED: ervatamin-B-like                      73.6    3e-12   
gb|KCW70346.1|  hypothetical protein EUGRSUZ_F03589                   72.8    3e-12   
ref|XP_011069730.1|  PREDICTED: low-temperature-induced cysteine ...  74.7    3e-12   
ref|XP_010244743.1|  PREDICTED: zingipain-2-like                      73.9    3e-12   
ref|XP_008350332.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...  74.3    4e-12   
ref|XP_003612210.1|  Cysteine proteinase                              73.6    4e-12   
ref|XP_006473275.1|  PREDICTED: cysteine proteinase RD21a-like        74.3    4e-12   
gb|ACC91281.1|  putative cysteine proteinase                          73.2    4e-12   
ref|NP_563855.1|  papain-like cysteine peptidase                      74.3    4e-12   
ref|XP_004496966.1|  PREDICTED: cysteine proteinase RD21a-like is...  74.3    4e-12   
gb|KHN18913.1|  P34 putative thiol protease                           73.6    4e-12   
dbj|BAH20463.1|  cysteine protease                                    74.3    4e-12   
gb|KJB57411.1|  hypothetical protein B456_009G163200                  72.8    4e-12   
ref|XP_003526208.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  73.6    4e-12   
ref|XP_010244238.1|  PREDICTED: cysteine proteinase RD21a-like        74.3    4e-12   
ref|XP_001781010.1|  predicted protein                                74.3    4e-12   
ref|XP_010235884.1|  PREDICTED: xylem cysteine proteinase 1-like      73.6    4e-12   
ref|NP_001150062.1|  thiol protease SEN102 precursor                  73.6    4e-12   
ref|XP_004496965.1|  PREDICTED: cysteine proteinase RD21a-like is...  74.3    4e-12   
gb|AAK71314.1|AF388175_1  papain-like cysteine peptidase XBCP3        74.3    4e-12   
ref|XP_007160879.1|  hypothetical protein PHAVU_001G024500g           74.3    4e-12   
ref|XP_006595983.1|  PREDICTED: cysteine proteinase RD21a-like        72.0    4e-12   
ref|XP_003526215.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  73.2    4e-12   
emb|CAB17076.1|  cysteine proteinase precursor                        74.3    4e-12   
ref|XP_009618803.1|  PREDICTED: cysteine proteinase COT44-like        73.6    4e-12   
gb|ACL52702.1|  unknown                                               73.6    4e-12   
ref|XP_003547166.1|  PREDICTED: P34 probable thiol protease-like      73.6    4e-12   
ref|XP_003603871.1|  Cysteine proteinase                              73.6    4e-12   
ref|XP_006285150.1|  hypothetical protein CARUB_v10006494mg           73.6    4e-12   
ref|XP_004253117.1|  PREDICTED: xylem cysteine proteinase 1-like      73.6    4e-12   
gb|KHN22488.1|  Cysteine proteinase RD21a                             73.9    5e-12   
ref|XP_011078435.1|  PREDICTED: senescence-specific cysteine prot...  73.2    5e-12   
ref|XP_009604895.1|  PREDICTED: low-temperature-induced cysteine ...  73.9    5e-12   
gb|KHN27801.1|  Vignain                                               72.8    5e-12   
ref|XP_011000142.1|  PREDICTED: cysteine proteinase RD21a-like        73.9    5e-12   
gb|KEH44128.1|  papain family cysteine protease                       73.9    5e-12   
ref|XP_009405198.1|  PREDICTED: zingipain-1-like                      72.8    5e-12   
ref|XP_006367781.1|  PREDICTED: LOW QUALITY PROTEIN: KDEL-tailed ...  72.8    6e-12   
ref|XP_009798360.1|  PREDICTED: zingipain-2-like                      73.2    6e-12   
ref|XP_007132868.1|  hypothetical protein PHAVU_011G1314000g          72.0    6e-12   
ref|XP_003589135.1|  Cysteine proteinase                              73.9    6e-12   
ref|XP_006342530.1|  PREDICTED: xylem cysteine proteinase 1-like      73.2    6e-12   
emb|CDP18645.1|  unnamed protein product                              72.8    6e-12   
ref|XP_008659445.1|  PREDICTED: ervatamin-B-like                      72.8    6e-12   
gb|AFW76902.1|  hypothetical protein ZEAMMB73_056195                  72.8    6e-12   
ref|XP_004975180.1|  PREDICTED: thiol protease SEN102-like            72.8    6e-12   
gb|ABK26996.1|  unknown                                               73.2    6e-12   
ref|XP_003539989.1|  PREDICTED: vignain-like                          72.8    6e-12   
ref|XP_002889773.1|  hypothetical protein ARALYDRAFT_471096           73.6    6e-12   
gb|ACE96974.1|  peptidase C1A papain                                  70.1    6e-12   
gb|KDO59789.1|  hypothetical protein CISIN_1g012022mg                 73.6    6e-12   
ref|XP_006487026.1|  PREDICTED: cysteine proteinase RD21a-like        73.6    6e-12   
ref|XP_003589133.1|  Cysteine proteinase                              73.6    6e-12   
gb|AFO83614.1|  papain-like cysteine protease                         73.6    6e-12   
gb|ABQ10204.1|  cysteine protease Cp6                                 73.6    6e-12   
ref|XP_010927504.1|  PREDICTED: oryzain alpha chain-like              73.6    7e-12   
gb|KDO79088.1|  hypothetical protein CISIN_1g017419mg                 73.2    7e-12   
ref|XP_010090710.1|  Xylem cysteine proteinase 1                      72.8    7e-12   
ref|XP_003578721.1|  PREDICTED: senescence-specific cysteine prot...  72.8    7e-12   
ref|XP_006494485.1|  PREDICTED: cysteine proteinase RD21a-like        73.2    7e-12   
ref|XP_007222885.1|  hypothetical protein PRUPE_ppa005199mg           73.6    7e-12   
gb|ACE96960.1|  peptidase C1A papain                                  70.1    7e-12   
sp|P05994.3|PAPA4_CARPA  RecName: Full=Papaya proteinase 4; AltNa...  72.8    8e-12   
gb|KHN32068.1|  Vignain                                               72.0    8e-12   
ref|NP_567983.1|  xylem cysteine proteinase 1                         72.8    8e-12   
gb|AAP32195.1|  cysteine protease 5                                   72.8    8e-12   
ref|XP_004238454.1|  PREDICTED: xylem cysteine proteinase 1           72.8    8e-12   
ref|XP_007043092.1|  Xylem cysteine peptidase 1                       72.8    8e-12   
ref|XP_006422960.1|  hypothetical protein CICLE_v10028338mg           73.6    8e-12   
ref|XP_010521644.1|  PREDICTED: ervatamin-B-like                      72.4    9e-12   
ref|XP_010063152.1|  PREDICTED: xylem cysteine proteinase 2           72.4    9e-12   
gb|KJB58559.1|  hypothetical protein B456_009G214900                  73.2    9e-12   
dbj|BAB13759.1|  cysteine proteinase                                  72.4    9e-12   
ref|XP_003539970.1|  PREDICTED: vignain-like                          72.4    9e-12   
ref|XP_006362429.1|  PREDICTED: fruit bromelain-like                  72.4    1e-11   
ref|XP_004252652.2|  PREDICTED: senescence-specific cysteine prot...  72.0    1e-11   
ref|XP_006445663.1|  hypothetical protein CICLE_v10015799mg           72.4    1e-11   
gb|KJB58558.1|  hypothetical protein B456_009G214900                  73.2    1e-11   
emb|CDP18644.1|  unnamed protein product                              72.0    1e-11   
gb|AFP73348.1|  cysteine protease                                     72.4    1e-11   
ref|XP_003603086.1|  Cysteine proteinase                              73.2    1e-11   
gb|AHA62774.1|  papain-like cysteine protease                         72.4    1e-11   
ref|XP_009354165.1|  PREDICTED: low-temperature-induced cysteine ...  73.2    1e-11   
gb|KJB58557.1|  hypothetical protein B456_009G214900                  73.2    1e-11   
gb|KHG18408.1|  Cysteinease RD21a -like protein                       72.4    1e-11   
ref|XP_006855225.1|  hypothetical protein AMTR_s00051p00208220        73.2    1e-11   
ref|XP_010691718.1|  PREDICTED: cysteine proteinase RD21a-like        73.2    1e-11   
ref|XP_010645699.1|  PREDICTED: xylem cysteine proteinase 1           72.4    1e-11   
ref|XP_009609440.1|  PREDICTED: ananain-like                          70.1    1e-11   
ref|XP_009774375.1|  PREDICTED: fruit bromelain-like                  70.5    1e-11   
ref|XP_007025413.1|  Maternal effect embryo arrest 18                 73.9    1e-11   
gb|AFW59667.1|  hypothetical protein ZEAMMB73_680472                  72.0    1e-11   
ref|XP_006592467.1|  PREDICTED: vignain-like                          72.0    1e-11   
ref|XP_007132818.1|  hypothetical protein PHAVU_011G127100g           72.0    1e-11   
gb|AHA62776.1|  papain-like cysteine protease                         72.0    1e-11   
ref|XP_004975325.1|  PREDICTED: fruit bromelain-like                  72.0    1e-11   
gb|AFW59668.1|  LOW QUALITY PROTEIN: cysteine protease 1              72.8    1e-11   
ref|XP_003557016.1|  PREDICTED: vignain-like                          72.0    1e-11   
gb|KFK43284.1|  hypothetical protein AALP_AA1G104100                  72.8    1e-11   
ref|XP_009767259.1|  PREDICTED: xylem cysteine proteinase 1-like      72.0    1e-11   
ref|XP_010548429.1|  PREDICTED: germination-specific cysteine pro...  72.4    1e-11   
ref|XP_001755855.1|  predicted protein                                72.8    1e-11   
ref|XP_006592465.1|  PREDICTED: vignain-like                          72.0    1e-11   
gb|ADY68475.1|  stem bromelain                                        71.2    1e-11   
gb|ACU18142.1|  unknown                                               72.0    1e-11   
ref|XP_008220266.1|  PREDICTED: low-temperature-induced cysteine ...  72.8    1e-11   
ref|XP_007132871.1|  hypothetical protein PHAVU_011G131700g           70.9    1e-11   
ref|XP_002525123.1|  cysteine protease, putative                      72.0    1e-11   
ref|NP_001275606.1|  fruit bromelain-like precursor                   72.0    1e-11   
gb|KJB57412.1|  hypothetical protein B456_009G163300                  72.0    1e-11   
gb|KHN13720.1|  Vignain                                               71.2    1e-11   
ref|XP_008811650.1|  PREDICTED: vignain-like                          71.2    1e-11   
ref|XP_009400290.1|  PREDICTED: oryzain alpha chain-like              72.8    1e-11   
gb|KHN08187.1|  Thiol protease SEN102                                 71.6    1e-11   
ref|XP_010912736.1|  PREDICTED: senescence-specific cysteine prot...  71.6    1e-11   
gb|KHN13721.1|  Vignain                                               71.6    2e-11   
gb|KJB77459.1|  hypothetical protein B456_012G138700                  72.0    2e-11   
ref|NP_001149658.1|  cysteine protease 1 precursor                    72.4    2e-11   
gb|KHN32069.1|  Vignain                                               71.6    2e-11   
ref|XP_006435079.1|  hypothetical protein CICLE_v10001178mg           72.4    2e-11   
ref|XP_011086001.1|  PREDICTED: senescence-specific cysteine prot...  71.6    2e-11   
ref|XP_006362428.1|  PREDICTED: vignain-like                          71.6    2e-11   
ref|NP_001104879.1|  cysteine proteinase Mir3 precursor               72.4    2e-11   
gb|KDO37366.1|  hypothetical protein CISIN_1g048025mg                 70.5    2e-11   
gb|AFW86317.1|  hypothetical protein ZEAMMB73_339067                  72.4    2e-11   
ref|XP_008678577.1|  PREDICTED: oryzain alpha chain-like              72.0    2e-11   
gb|AFP73357.1|  cysteine protease                                     71.6    2e-11   
ref|XP_008382503.1|  PREDICTED: xylem cysteine proteinase 1-like      71.6    2e-11   
ref|XP_003607571.1|  Cysteine proteinase EP-B                         71.6    2e-11   
ref|XP_009629965.1|  PREDICTED: ervatamin-B-like                      71.6    2e-11   
gb|AAP32198.1|  cysteine protease 12                                  71.6    2e-11   
ref|XP_004292313.1|  PREDICTED: xylem cysteine proteinase 1           71.6    2e-11   
gb|KHN22490.1|  Cysteine proteinase RD21a                             71.6    2e-11   
ref|XP_008659446.1|  PREDICTED: ervatamin-B-like                      71.6    2e-11   
ref|XP_003522989.1|  PREDICTED: xylem cysteine proteinase 2           71.6    2e-11   
dbj|BAF46304.1|  cysteine proteinase precursor                        72.4    2e-11   
ref|XP_003545327.1|  PREDICTED: cysteine proteinase RD21a-like        72.4    2e-11   
ref|XP_002436842.1|  hypothetical protein SORBIDRAFT_10g009850        70.9    2e-11   
ref|XP_006652923.1|  PREDICTED: oryzain alpha chain-like              72.4    2e-11   
ref|XP_006663940.1|  PREDICTED: thiol protease SEN102-like            71.6    2e-11   
ref|XP_009404402.1|  PREDICTED: zingipain-1-like                      70.9    2e-11   
gb|AHA62772.1|  papain-like cysteine protease                         71.6    2e-11   
ref|XP_010270545.1|  PREDICTED: xylem cysteine proteinase 1           71.6    2e-11   
ref|XP_006425969.1|  hypothetical protein CICLE_v10025887mg           71.6    2e-11   
dbj|BAC10906.1|  cysteine proteinase                                  71.6    2e-11   
ref|XP_009405199.1|  PREDICTED: zingipain-1-like                      71.2    2e-11   
gb|KJB63901.1|  hypothetical protein B456_010G022700                  72.0    2e-11   
ref|XP_010912725.1|  PREDICTED: zingipain-2-like                      71.2    2e-11   
gb|EYU36591.1|  hypothetical protein MIMGU_mgv1a009120mg              71.6    2e-11   
ref|XP_002436841.1|  hypothetical protein SORBIDRAFT_10g009840        71.2    2e-11   
ref|XP_009340788.1|  PREDICTED: xylem cysteine proteinase 1-like      71.6    2e-11   
dbj|BAD29960.1|  cysteine protease                                    72.0    2e-11   
ref|XP_009620556.1|  PREDICTED: xylem cysteine proteinase 1-like      71.6    2e-11   
ref|XP_003607548.1|  Cysteine protease                                71.2    2e-11   
ref|XP_003526232.1|  PREDICTED: vignain-like                          71.2    2e-11   
ref|XP_008451198.1|  PREDICTED: xylem cysteine proteinase 1-like      71.2    2e-11   
ref|XP_006384862.1|  XYLEM CYSTEINE PEPTIDASE 1 family protein        71.2    2e-11   
ref|NP_001233949.1|  phytophthora-inhibited protease 1                71.2    2e-11   
gb|EPS63305.1|  hypothetical protein M569_11479                       72.0    2e-11   
ref|XP_010103045.1|  KDEL-tailed cysteine endopeptidase CEP1          71.2    2e-11   
ref|XP_010091034.1|  KDEL-tailed cysteine endopeptidase CEP1          71.2    2e-11   
ref|XP_008805390.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...  71.2    2e-11   
gb|KCW45396.1|  hypothetical protein EUGRSUZ_L00916                   71.2    2e-11   
ref|XP_003527330.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  71.2    2e-11   
ref|XP_010448692.1|  PREDICTED: zingipain-2-like                      71.2    2e-11   
ref|XP_006342169.1|  PREDICTED: xylem cysteine proteinase 1-like      71.2    2e-11   
ref|XP_002436840.1|  hypothetical protein SORBIDRAFT_10g009830        70.9    3e-11   
gb|AAM19208.1|AF493233_1  cysteine protease                           71.2    3e-11   
gb|AFP73356.1|  cysteine protease                                     70.9    3e-11   
dbj|BAA21848.1|  bromelain                                            71.2    3e-11   
ref|XP_010458294.1|  PREDICTED: low-temperature-induced cysteine ...  71.6    3e-11   
gb|AFP73359.1|  cysteine protease                                     71.2    3e-11   
gb|AFJ15104.1|  mexicain-like cystein protease                        70.9    3e-11   
gb|ACU18172.1|  unknown                                               71.2    3e-11   
gb|KHG12125.1|  Cysteinease RD21a -like protein                       72.0    3e-11   
dbj|BAG16371.1|  cysteine protease                                    71.6    3e-11   
ref|XP_007155893.1|  hypothetical protein PHAVU_003G240800g           71.2    3e-11   
gb|AFP73362.1|  cysteine protease                                     70.9    3e-11   
ref|XP_010906194.1|  PREDICTED: senescence-specific cysteine prot...  70.9    3e-11   
ref|XP_010054318.1|  PREDICTED: ervatamin-B-like                      70.9    3e-11   
ref|XP_004161017.1|  PREDICTED: xylem cysteine proteinase 1-like      70.9    3e-11   
ref|XP_010274448.1|  PREDICTED: zingipain-2-like                      71.2    3e-11   
gb|ACU13684.1|  unknown                                               69.3    3e-11   
gb|AFP73358.1|  cysteine protease                                     70.9    3e-11   
ref|XP_004239155.1|  PREDICTED: vignain-like                          71.2    3e-11   
gb|AFP73327.1|  cysteine protease                                     70.9    3e-11   
gb|EYU36326.1|  hypothetical protein MIMGU_mgv1a005614mg              71.6    3e-11   
ref|XP_010939512.1|  PREDICTED: senescence-specific cysteine prot...  70.9    3e-11   
ref|XP_004141903.1|  PREDICTED: germination-specific cysteine pro...  71.2    3e-11   
gb|KHN27075.1|  Cysteine proteinase RD21a                             71.2    3e-11   
ref|XP_009617815.1|  PREDICTED: ervatamin-B-like                      70.9    3e-11   
ref|XP_004144898.1|  PREDICTED: xylem cysteine proteinase 1-like      70.9    3e-11   
emb|CDY17093.1|  BnaC06g00260D                                        71.6    3e-11   
gb|KCW76118.1|  hypothetical protein EUGRSUZ_D00495                   70.9    3e-11   
gb|KDP45355.1|  hypothetical protein JCGZ_09604                       70.5    3e-11   
gb|AAC49455.1|  Pseudotzain                                           71.6    3e-11   
gb|AAP32196.1|  cysteine protease 8                                   70.9    3e-11   
ref|XP_003550041.1|  PREDICTED: cysteine proteinase RD21a-like        70.9    3e-11   
ref|XP_006417526.1|  hypothetical protein EUTSA_v10007640mg           71.6    3e-11   
gb|AAK07730.1|  CPR1-like cysteine proteinase                         71.2    3e-11   
gb|AHA62778.1|  RCR3-like cysteine protease                           70.9    4e-11   
ref|XP_006471123.1|  PREDICTED: xylem cysteine proteinase 1-like      68.6    4e-11   
ref|XP_011029381.1|  PREDICTED: cysteine proteinase RD21a             71.2    4e-11   
ref|XP_008440309.1|  PREDICTED: cysteine proteinase COT44-like        70.9    4e-11   
ref|XP_009784112.1|  PREDICTED: cysteine proteinase COT44-like        70.9    4e-11   
ref|XP_009775915.1|  PREDICTED: ervatamin-B-like                      70.5    4e-11   
emb|CAL64936.1|  putative cysteine protease 8                         70.9    4e-11   
gb|AAL60580.1|AF454958_1  senescence-associated cysteine protease     71.6    4e-11   
ref|XP_002298740.2|  hypothetical protein POPTR_0001s30950g           71.2    4e-11   
ref|XP_008669676.1|  PREDICTED: ervatamin-B-like                      70.9    4e-11   
gb|ACE96966.1|  peptidase C1A papain                                  67.8    4e-11   
dbj|BAF43527.1|  cysteine proteinase                                  70.9    4e-11   
emb|CAQ00103.1|  papain-like cysteine proteinase                      70.9    4e-11   
gb|KCW76121.1|  hypothetical protein EUGRSUZ_D00498                   69.3    4e-11   
ref|XP_006470294.1|  PREDICTED: xylem cysteine proteinase 1-like ...  70.5    4e-11   
gb|AFV30165.1|  cysteine proteinase                                   70.5    4e-11   
ref|XP_010433893.1|  PREDICTED: zingipain-2-like                      70.5    4e-11   



>gb|AAO18731.1| cysteine protease [Gossypium hirsutum]
Length=389

 Score =   127 bits (318),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 88/127 (69%), Gaps = 9/127 (7%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            + EE+VL +F++WKE++ KVYR  EE E+RF+NFKGNLKY+ E+    + ++WE  VGLN
Sbjct  40   LSEERVLEIFQQWKEKHRKVYRHAEEAEKRFENFKGNLKYILERNAKRKANKWEHHVGLN  99

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKV-SCEAPFSVDWRKRGA  595
            KFAD+ NEEF+  + SK+K P  K  GI +       R  ++KV SC+AP S+DWR  G 
Sbjct  100  KFADMSNEEFRKAYLSKVKKPINK--GITL------SRNMRRKVQSCDAPSSLDWRNYGV  151

Query  596  VTRVKDQ  616
            VT VKDQ
Sbjct  152  VTAVKDQ  158



>gb|KHG12401.1| hypothetical protein F383_03889 [Gossypium arboreum]
Length=497

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 88/127 (69%), Gaps = 9/127 (7%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            + EE+VL +F++WKE+N KVYR  EE E+RF+NFKGNLKY+ E+    + ++WE  VGLN
Sbjct  40   LSEERVLEIFQQWKEKNQKVYRQAEEAEKRFENFKGNLKYILERNAKRKANKWEHHVGLN  99

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKV-SCEAPFSVDWRKRGA  595
            KFAD+ NEEF+  + SK+K P  K  GI +       R  ++KV SC+AP S++WR  G 
Sbjct  100  KFADMSNEEFRKAYLSKVKKPINK--GITL------SRNMRRKVQSCDAPSSLNWRNYGV  151

Query  596  VTRVKDQ  616
            VT VKDQ
Sbjct  152  VTAVKDQ  158



>gb|KJB66816.1| hypothetical protein B456_010G159600 [Gossypium raimondii]
Length=457

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 86/127 (68%), Gaps = 9/127 (7%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            + EE+VL +F++WKE++ KVYR  EE E+RF+NFKGNLKY+ E+    + ++WE  VGLN
Sbjct  40   LSEERVLEIFQQWKEKHRKVYRHAEEAEKRFENFKGNLKYILERNAKRKANKWEHHVGLN  99

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKV-SCEAPFSVDWRKRGA  595
            KFAD+ NEEF+  + SK+K P  K   +         R  ++KV SC+AP S+DWR  G 
Sbjct  100  KFADMSNEEFRKAYLSKVKKPINKGTTLS--------RNMRRKVQSCDAPSSLDWRNYGV  151

Query  596  VTRVKDQ  616
            VT VKDQ
Sbjct  152  VTAVKDQ  158



>gb|KJB66817.1| hypothetical protein B456_010G159600 [Gossypium raimondii]
Length=484

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 86/127 (68%), Gaps = 9/127 (7%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            + EE+VL +F++WKE++ KVYR  EE E+RF+NFKGNLKY+ E+    + ++WE  VGLN
Sbjct  40   LSEERVLEIFQQWKEKHRKVYRHAEEAEKRFENFKGNLKYILERNAKRKANKWEHHVGLN  99

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKV-SCEAPFSVDWRKRGA  595
            KFAD+ NEEF+  + SK+K P  K   +         R  ++KV SC+AP S+DWR  G 
Sbjct  100  KFADMSNEEFRKAYLSKVKKPINKGTTLS--------RNMRRKVQSCDAPSSLDWRNYGV  151

Query  596  VTRVKDQ  616
            VT VKDQ
Sbjct  152  VTAVKDQ  158



>gb|KJB66818.1| hypothetical protein B456_010G159600 [Gossypium raimondii]
 gb|KJB66819.1| hypothetical protein B456_010G159600 [Gossypium raimondii]
Length=497

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 86/127 (68%), Gaps = 9/127 (7%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            + EE+VL +F++WKE++ KVYR  EE E+RF+NFKGNLKY+ E+    + ++WE  VGLN
Sbjct  40   LSEERVLEIFQQWKEKHRKVYRHAEEAEKRFENFKGNLKYILERNAKRKANKWEHHVGLN  99

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKV-SCEAPFSVDWRKRGA  595
            KFAD+ NEEF+  + SK+K P  K   +         R  ++KV SC+AP S+DWR  G 
Sbjct  100  KFADMSNEEFRKAYLSKVKKPINKGTTLS--------RNMRRKVQSCDAPSSLDWRNYGV  151

Query  596  VTRVKDQ  616
            VT VKDQ
Sbjct  152  VTAVKDQ  158



>gb|KJB66815.1| hypothetical protein B456_010G159600 [Gossypium raimondii]
Length=496

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 86/127 (68%), Gaps = 9/127 (7%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            + EE+VL +F++WKE++ KVYR  EE E+RF+NFKGNLKY+ E+    + ++WE  VGLN
Sbjct  40   LSEERVLEIFQQWKEKHRKVYRHAEEAEKRFENFKGNLKYILERNAKRKANKWEHHVGLN  99

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKV-SCEAPFSVDWRKRGA  595
            KFAD+ NEEF+  + SK+K P  K   +         R  ++KV SC+AP S+DWR  G 
Sbjct  100  KFADMSNEEFRKAYLSKVKKPINKGTTLS--------RNMRRKVQSCDAPSSLDWRNYGV  151

Query  596  VTRVKDQ  616
            VT VKDQ
Sbjct  152  VTAVKDQ  158



>ref|XP_009613580.1| PREDICTED: low-temperature-induced cysteine proteinase-like isoform 
X1 [Nicotiana tomentosiformis]
Length=502

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 87/126 (69%), Gaps = 5/126 (4%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            +PEE++ +LF+EWK++ GKVY++E+E E R + F+ N+KY+ EK    R S  +  VGL 
Sbjct  41   LPEERIFQLFQEWKQKQGKVYKNEKEEEMRLEKFRRNVKYIVEKN-SKRKSDSDHLVGLT  99

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
             FAD+ NEEF+ V TSKIK+PF K++ IQM +      +K   V C+AP S DWRK GAV
Sbjct  100  NFADMSNEEFRQVHTSKIKIPFDKRKTIQMKNV----EKKPTPVYCDAPPSRDWRKHGAV  155

Query  599  TRVKDQ  616
            T VK+Q
Sbjct  156  TEVKNQ  161



>ref|XP_004233038.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Solanum 
lycopersicum]
Length=500

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 89/126 (71%), Gaps = 5/126 (4%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            + EE V +LF+EWK+++GKVY +++E E + +NFK N+KY+ EK    R S  +  VGL 
Sbjct  44   LSEETVFQLFQEWKQKHGKVYMNKKEEEMKLENFKRNVKYIVEKN-SKRKSDSDYLVGLT  102

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
            KFAD+ NEEF+ V TSKIK+PF K++ I+M  A     ++    SC+AP S+DWRK GAV
Sbjct  103  KFADMSNEEFRQVHTSKIKIPFNKRKTIRMKVA----EKETTSFSCDAPPSMDWRKHGAV  158

Query  599  TRVKDQ  616
            T+VKDQ
Sbjct  159  TKVKDQ  164



>ref|XP_009797427.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
sylvestris]
Length=502

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 87/126 (69%), Gaps = 5/126 (4%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            + EE++ +LF+EWK+++GK+Y +E+E E R + F+ N+KY+ EK    R S  +  VGL 
Sbjct  41   LSEERIFQLFQEWKQKHGKLYNNEKEEEMRLEKFRRNVKYIVEKN-SKRKSDSDHLVGLT  99

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
             FAD+ NEEF+ V TSKIK+PF K++ IQM +A     +K   V C+AP S DWRK GAV
Sbjct  100  NFADMSNEEFRQVHTSKIKIPFDKRKTIQMKNA----EKKPTPVYCDAPPSRDWRKYGAV  155

Query  599  TRVKDQ  616
            T VKDQ
Sbjct  156  TEVKDQ  161



>ref|XP_010999738.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Populus 
euphratica]
Length=508

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 85/125 (68%), Gaps = 8/125 (6%)
 Frame = +2

Query  242  PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK  421
            P+E ++ +F+ W++R+ KVY+  EE E+RF NFK NLKY+ EKT  G+ +    KVGLNK
Sbjct  47   PDESIIEIFQRWRDRHQKVYKHAEEAEKRFGNFKRNLKYIIEKT--GKETTLRHKVGLNK  104

Query  422  FADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVT  601
            FADL NEEFK+++ SK+K P  K++           R ++   SC+AP S+DWRK+G VT
Sbjct  105  FADLSNEEFKELYLSKVKKPINKRRFDA------EDRSRRNLQSCDAPSSLDWRKKGVVT  158

Query  602  RVKDQ  616
             VKDQ
Sbjct  159  AVKDQ  163



>ref|XP_010317333.1| PREDICTED: xylem cysteine proteinase 2-like, partial [Solanum 
lycopersicum]
Length=607

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 86/126 (68%), Gaps = 5/126 (4%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            + +E V +LF+EWK+++GKVY+DE+E E R + F+ N+KY+ EK    R S  E  VGL 
Sbjct  40   ISDESVFQLFQEWKQKHGKVYKDEKEEEMRLEKFRWNVKYIVEKN-SERKSASEHFVGLT  98

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
             FAD+ NEEF++V  SKIK+PF K+  IQM +      EK   +SC+AP S DWRK GAV
Sbjct  99   NFADMSNEEFREVHGSKIKIPFNKRNIIQMKNV----EEKPTSISCDAPRSRDWRKHGAV  154

Query  599  TRVKDQ  616
            T VK+Q
Sbjct  155  TEVKNQ  160



>ref|XP_009613579.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
tomentosiformis]
Length=505

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 84/126 (67%), Gaps = 5/126 (4%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            + EE+V +LF+EWK+R+GKVY++E+E E R   FK N+KY+ EK    + S  +  VGL 
Sbjct  44   LSEERVFQLFQEWKQRHGKVYKNEKEEEMRLDKFKRNVKYIVEKN-SKKKSDSDHLVGLT  102

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
            KFAD+ NEEF+ V TS IK+PF K++ IQM S       K    SC+ P S DWRK GAV
Sbjct  103  KFADMSNEEFRQVHTSNIKIPFNKRKTIQMRSV----ERKPSTASCDVPPSKDWRKHGAV  158

Query  599  TRVKDQ  616
            T VK+Q
Sbjct  159  TEVKNQ  164



>ref|XP_006362442.1| PREDICTED: uncharacterized protein LOC102602011 [Solanum tuberosum]
Length=1047

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 87/126 (69%), Gaps = 5/126 (4%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            + +E V +LF+EWK+++GKVY+DE+E E R + F+ N+KY+ EK    R S  E  VGL 
Sbjct  116  ISDESVFQLFQEWKQKHGKVYKDEKEEEMRLEKFRWNVKYIVEKN-SERKSASEHFVGLT  174

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
             FAD+ NEEF++V  SKIK+PF K++ IQM +      EK   +SC+AP S DWRK GAV
Sbjct  175  NFADMSNEEFREVHGSKIKIPFNKRKIIQMKNV----EEKSTSISCDAPPSRDWRKHGAV  230

Query  599  TRVKDQ  616
            T VK+Q
Sbjct  231  TEVKNQ  236



>gb|AGV15822.1| cysteine protease CP14 [Nicotiana tabacum]
Length=505

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 84/126 (67%), Gaps = 5/126 (4%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            + EE+V +LF+EWK+R+GKVY++E+E E R   FK N+KY+ EK    + S  +  VGL 
Sbjct  44   LSEERVFQLFQEWKQRHGKVYKNEKEEEMRLDKFKRNVKYIVEKN-SKKKSDSDHFVGLT  102

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
            KFAD+ NEEF+ V TS IK+PF K++ IQM S       K    SC+ P S DWRK GAV
Sbjct  103  KFADMSNEEFRQVHTSNIKIPFNKRKTIQMRSV----ERKPSTASCDVPPSKDWRKHGAV  158

Query  599  TRVKDQ  616
            T VK+Q
Sbjct  159  TEVKNQ  164



>gb|KHN08431.1| Xylem cysteine proteinase 1 [Glycine soja]
Length=424

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 100/167 (60%), Gaps = 17/167 (10%)
 Frame = +2

Query  125  CSLQGCGFLVFLIVAA--VWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKV  298
            C L+   FL+FL+  +    C G+   Y   A+         EE V+ LF+ WKE N K+
Sbjct  3    CQLKTQLFLLFLVWGSWTFLCYGLPSEYSILALEIDKFPS--EEGVIELFQRWKEENKKI  60

Query  299  YRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKM  478
            YR  ++ + RF+NFK NLKY+ EK    R S +   +GLN+FAD+ NEEFK  FTSK+K 
Sbjct  61   YRSPDQEKLRFENFKRNLKYIAEKN-SKRISPYGQSLGLNRFADMSNEEFKSKFTSKVKK  119

Query  479  PFRKKQGIQMVSAVHSGREKKKKVSCE-APFSVDWRKRGAVTRVKDQ  616
            PF K+ G+       SG++     SCE AP+S+DWRK+G VT VKDQ
Sbjct  120  PFSKRNGL-------SGKDH----SCEDAPYSLDWRKKGVVTAVKDQ  155



>ref|XP_002305743.2| hypothetical protein POPTR_0004s05640g [Populus trichocarpa]
 gb|EEE86254.2| hypothetical protein POPTR_0004s05640g [Populus trichocarpa]
Length=506

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 85/125 (68%), Gaps = 8/125 (6%)
 Frame = +2

Query  242  PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK  421
            P+E ++ +F++W++R+ K Y+  EE E+RF NFK NLKY+ EKT  G+ +    +VGLNK
Sbjct  47   PDESIIEIFQQWRDRHQKAYKHAEEAEKRFGNFKRNLKYIIEKT--GKETTLRHRVGLNK  104

Query  422  FADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVT  601
            FADL NEEFK ++ SK+K P  K +    + A    R ++   SC+AP S+DWRK+G VT
Sbjct  105  FADLSNEEFKQLYLSKVKKPINKTR----IDA--EDRSRRNLQSCDAPSSLDWRKKGVVT  158

Query  602  RVKDQ  616
             VKDQ
Sbjct  159  AVKDQ  163



>ref|XP_007025363.1| Xylem bark cysteine peptidase 3 isoform 1 [Theobroma cacao]
 gb|EOY27985.1| Xylem bark cysteine peptidase 3 isoform 1 [Theobroma cacao]
Length=501

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 95/157 (61%), Gaps = 9/157 (6%)
 Frame = +2

Query  149  LVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEER  328
             VFLI+A+  C   S   +   +      F+ +E+V+ +F +WKE++ KVY+  EE E+R
Sbjct  10   FVFLILASRTCLSSSLPTEYSILEHDLDAFLSDERVVEIFRQWKEKHQKVYKHVEEAEKR  69

Query  329  FQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGIQM  508
            F+NFKGNLKY+ E+    + +    +VGLNKFAD+ NEEF+  + +K+K P  K   +  
Sbjct  70   FENFKGNLKYILERNAKRKSTEGGHRVGLNKFADMSNEEFRKAYLAKVKKPINKGSTLS-  128

Query  509  VSAVHSGREKKKKV-SCEAPFSVDWRKRGAVTRVKDQ  616
                   R  ++KV SC+AP S+DWR  G VT VKDQ
Sbjct  129  -------RNMRRKVQSCDAPSSLDWRNYGIVTGVKDQ  158



>ref|XP_003542981.1| PREDICTED: cysteine proteinase RD21a-like [Glycine max]
Length=517

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 100/167 (60%), Gaps = 17/167 (10%)
 Frame = +2

Query  125  CSLQGCGFLVFLIVAA--VWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKV  298
            C L+   FL+FL+  +    C G+   Y   A+         EE V+ LF+ WKE N K+
Sbjct  3    CQLKTQLFLLFLVWGSWTFLCYGLPSEYSILALEIDKFPS--EEGVIELFQRWKEENKKI  60

Query  299  YRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKM  478
            YR  ++ + RF+NFK NLKY+ EK    R S +   +GLN+FAD+ NEEFK  FTSK+K 
Sbjct  61   YRSPDQEKLRFENFKRNLKYIAEKN-SKRISPYGQSLGLNRFADMSNEEFKSKFTSKVKK  119

Query  479  PFRKKQGIQMVSAVHSGREKKKKVSCE-APFSVDWRKRGAVTRVKDQ  616
            PF K+ G+       SG++     SCE AP+S+DWRK+G VT VKDQ
Sbjct  120  PFSKRNGL-------SGKDH----SCEDAPYSLDWRKKGVVTAVKDQ  155



>ref|XP_009797432.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
sylvestris]
Length=505

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 83/126 (66%), Gaps = 5/126 (4%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            + EE+V ++F+EWK+++GK Y++E+E E R + FK N+KY+  K    R    +  VGL 
Sbjct  44   LSEERVFQIFQEWKQKHGKFYKNEKEEEMRLEIFKTNVKYIVGKN-SKRKPDSDHLVGLT  102

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
            KFAD+ NEEF+ V TSKIK+PF K++ IQM S       K    SC+ P S DWRK GAV
Sbjct  103  KFADMSNEEFRQVHTSKIKIPFNKRKTIQMRSV----EIKPSTTSCDVPPSKDWRKHGAV  158

Query  599  TRVKDQ  616
            T VKDQ
Sbjct  159  TEVKDQ  164



>ref|XP_004233043.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Solanum 
lycopersicum]
Length=480

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 84/126 (67%), Gaps = 12/126 (10%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            + EE+V +LF+EWK+++GK+Y++E+E E R +NFK N+KY+ +K    R S  +  VGLN
Sbjct  45   LTEERVFQLFQEWKQKHGKIYKNEKEEERRLENFKRNVKYIVDKN-SKRRSESDHLVGLN  103

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
             FAD+ NEEF  V TSKIKMPF K+Q    +SA           SC+AP + DWRK G V
Sbjct  104  NFADMSNEEFSQVHTSKIKMPF-KQQNKTTISA----------NSCDAPPAKDWRKHGVV  152

Query  599  TRVKDQ  616
            T VK+Q
Sbjct  153  TEVKNQ  158



>emb|CDO96804.1| unnamed protein product [Coffea canephora]
Length=506

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 81/126 (64%), Gaps = 4/126 (3%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            + EE+V  +F+EWKE++GKVY+  +E E+RFQNF+ NLKY+ EK    R S     VGLN
Sbjct  46   LSEERVAEIFQEWKEKHGKVYKHVQEAEKRFQNFRKNLKYIVEKN-SMRQSNSGHVVGLN  104

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
            KFAD+ NEEFK V+ SKIK     K+        +    K K  SCEAP S+DWRK G V
Sbjct  105  KFADMSNEEFKKVYISKIK---DGKRITDQRGEFNIALRKSKAASCEAPTSLDWRKHGVV  161

Query  599  TRVKDQ  616
            T VKDQ
Sbjct  162  TGVKDQ  167



>ref|XP_006467643.1| PREDICTED: cysteine proteinase RD21a-like [Citrus sinensis]
Length=485

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 80/126 (63%), Gaps = 10/126 (8%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            V EE+V  LF+ WK+++GK Y+  EE E RF+NFK NL+YV EK     G      VGLN
Sbjct  33   VSEERVFELFQRWKDKHGKAYKHTEEAERRFRNFKNNLEYVVEKKNNPGGHV----VGLN  88

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
            KFAD+ NEEF++++  KI+ P  K  G    S +H     K   SCEAP S+DWRKRG V
Sbjct  89   KFADMSNEEFREIYLKKIQKPIGKAIG-NAKSNLH-----KTVQSCEAPSSLDWRKRGIV  142

Query  599  TRVKDQ  616
            T VKDQ
Sbjct  143  TPVKDQ  148



>gb|KDO77866.1| hypothetical protein CISIN_1g043774mg [Citrus sinensis]
Length=485

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 80/126 (63%), Gaps = 10/126 (8%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            V EE+V  LF+ WK+++GK Y+  EE E RF+NFK NL+YV EK     G      VGLN
Sbjct  33   VSEERVFELFQRWKDKHGKAYKHTEEAERRFRNFKNNLEYVVEKKNNPGGHV----VGLN  88

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
            KFAD+ NEEF++++  KI+ P  K  G    S +H     K   SCEAP S+DWRKRG V
Sbjct  89   KFADMSNEEFREIYLKKIQKPIGKAIG-NAKSNLH-----KTVQSCEAPSSLDWRKRGIV  142

Query  599  TRVKDQ  616
            T VKDQ
Sbjct  143  TPVKDQ  148



>ref|XP_006449509.1| hypothetical protein CICLE_v10015066mg [Citrus clementina]
 gb|ESR62749.1| hypothetical protein CICLE_v10015066mg [Citrus clementina]
Length=485

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 80/126 (63%), Gaps = 10/126 (8%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            V EE+V  LF+ WK+++GK Y+  EE E RF+NFK NL+YV EK     G      VGLN
Sbjct  33   VSEERVFELFQRWKDKHGKAYKHTEEAERRFRNFKNNLEYVVEKKNNPGGHV----VGLN  88

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
            KFAD+ NEEF++++  KI+ P  K  G    S +H     K   SCEAP S+DWRKRG V
Sbjct  89   KFADMSNEEFREIYLKKIQKPIGKAIG-NAKSNLH-----KTVQSCEAPSSLDWRKRGIV  142

Query  599  TRVKDQ  616
            T VKDQ
Sbjct  143  TPVKDQ  148



>ref|XP_002317417.2| hypothetical protein POPTR_0011s07300g [Populus trichocarpa]
 gb|EEE98029.2| hypothetical protein POPTR_0011s07300g [Populus trichocarpa]
Length=498

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 90/157 (57%), Gaps = 11/157 (7%)
 Frame = +2

Query  146  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  325
              +FL++A + C       +   ++      + EE +  +F+ WKE++ KVY+  EE E 
Sbjct  10   LFIFLLLAPLACLSSGLPGEYSTVSNDLHEGLTEEGITEVFKLWKEKHQKVYKHAEEAER  69

Query  326  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGIQ  505
            R  NFK NLKY+ EK  G R S  E KVGLNKFADL NEEF++++ SK+K P        
Sbjct  70   RIGNFKRNLKYIIEKN-GKRKSGLEHKVGLNKFADLSNEEFREMYLSKVKKPI-------  121

Query  506  MVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
                +   R+ +   +C+AP S+DWR +G VT VKDQ
Sbjct  122  ---TIEEKRKHRHLQTCDAPSSLDWRNKGVVTAVKDQ  155



>ref|XP_008225294.1| PREDICTED: cysteine proteinase COT44-like [Prunus mume]
Length=513

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 85/128 (66%), Gaps = 10/128 (8%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTV---GGRGSRWEGKVGL  415
            EE+V+ LF  WK+++GKVYR  EE E RF+NFK NLK+V EKT        +    +VGL
Sbjct  46   EERVVELFRLWKQKHGKVYRHAEESERRFENFKRNLKFVLEKTAKKRAANNAHDSQRVGL  105

Query  416  NKFADLRNEEFKDVFTS-KIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRG  592
            N+FAD+ NEEF+  + S K+KMP  K+    M+  +H    ++   SCEAP ++DWRK+G
Sbjct  106  NRFADMSNEEFRKTYLSKKLKMPTSKRN--NMMRRMH----EEPVHSCEAPSALDWRKKG  159

Query  593  AVTRVKDQ  616
            AVT VKDQ
Sbjct  160  AVTGVKDQ  167



>ref|XP_007211825.1| hypothetical protein PRUPE_ppa004381mg [Prunus persica]
 gb|EMJ13024.1| hypothetical protein PRUPE_ppa004381mg [Prunus persica]
Length=513

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 85/128 (66%), Gaps = 10/128 (8%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTV---GGRGSRWEGKVGL  415
            EE+V+ LF  WK+++GKVYR  EE E RF+NFK NLK+V EKT        +    +VGL
Sbjct  46   EERVVELFRLWKQKHGKVYRQAEESERRFENFKRNLKFVLEKTAKKRAANNAHDSQRVGL  105

Query  416  NKFADLRNEEFKDVFTS-KIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRG  592
            N+FAD+ NEEF+  + S K+KMP  K+    M+  +H    ++   SCEAP ++DWRK+G
Sbjct  106  NRFADMSNEEFRKTYLSKKLKMPTNKRN--SMMRRMH----EEPVHSCEAPSALDWRKKG  159

Query  593  AVTRVKDQ  616
            AVT VKDQ
Sbjct  160  AVTGVKDQ  167



>ref|XP_002533962.1| cysteine protease, putative [Ricinus communis]
 gb|EEF28418.1| cysteine protease, putative [Ricinus communis]
Length=417

 Score =   110 bits (274),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 90/157 (57%), Gaps = 6/157 (4%)
 Frame = +2

Query  146  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  325
             ++FL+V  + C   +   +   +       + EE+V  LF++WKE++ KVY+  EE E+
Sbjct  9    LIIFLLVGPLTCLSFTLPDEYSIVGNDLHELLSEERVKELFQQWKEKHRKVYKHVEEAEK  68

Query  326  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGIQ  505
            R +NF+ NLKYV EK    +       VGLNKFAD+ N EF+  + SK+K P +K+    
Sbjct  69   RLENFRRNLKYVVEKNQKKKNLGSAHTVGLNKFADMSNVEFRQKYLSKVKKPIKKRNNNL  128

Query  506  MVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
            M S       ++   SC AP S+DWRK+G VT VKDQ
Sbjct  129  MTS------RQRNLQSCVAPSSLDWRKKGVVTPVKDQ  159



>gb|ABQ10203.1| cysteine protease Cp5 [Actinidia deliciosa]
Length=509

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 84/126 (67%), Gaps = 2/126 (2%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            + EE+V+ LF++W E++GKVY+  +E E++FQNF+ NL+YV EK  G RG+     VGLN
Sbjct  42   IAEERVVELFKKWTEKHGKVYKHGQEVEKKFQNFRDNLRYVMEKN-GERGASGGHLVGLN  100

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
            KFAD+ NEEF++V+ SK+K P  K+  I+           K   +C+ P S+DWRK G V
Sbjct  101  KFADMSNEEFREVYVSKVKKPTSKRMAIERRRQ-GKAAAAKAVAACDGPTSLDWRKYGIV  159

Query  599  TRVKDQ  616
            T VKDQ
Sbjct  160  TGVKDQ  165



>ref|XP_002317418.2| hypothetical protein POPTR_0011s07310g [Populus trichocarpa]
 gb|EEE98030.2| hypothetical protein POPTR_0011s07310g [Populus trichocarpa]
Length=503

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 84/126 (67%), Gaps = 7/126 (6%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            V EE ++ +F++W++R+ KVY    E E+R++NFK NLKY+ EK  G + +     VGLN
Sbjct  41   VSEESIIEIFQQWRDRHQKVYEHAAESEKRYRNFKRNLKYIIEK-AGKKTAALGHSVGLN  99

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
            KFADL NEEFK+++ SK+K P   K+     S     R++  + +C+AP S+DWRK+G V
Sbjct  100  KFADLSNEEFKELYLSKVKKPINIKR-----STARDWRQRNLQ-TCDAPSSLDWRKKGVV  153

Query  599  TRVKDQ  616
            T VKDQ
Sbjct  154  TAVKDQ  159



>ref|XP_006362441.1| PREDICTED: oryzain alpha chain-like [Solanum tuberosum]
Length=628

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 83/126 (66%), Gaps = 12/126 (10%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            + EE+V +LF+EWK+++GK+Y++E+E E R +NFK N+KY+ +K    R S  +  VGLN
Sbjct  187  LSEERVFQLFQEWKQKHGKIYKNEKEEEMRLENFKRNVKYIVDKN-SKRRSESDHLVGLN  245

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
             FAD+ NEEF  V TSKIKMPF  +Q   ++SA           SC AP S DWRK G V
Sbjct  246  NFADMSNEEFSQVHTSKIKMPF-NQQNKTVISA----------NSCVAPPSKDWRKHGVV  294

Query  599  TRVKDQ  616
            T VK+Q
Sbjct  295  TEVKNQ  300



>ref|XP_006852404.1| hypothetical protein AMTR_s00021p00031000 [Amborella trichopoda]
 gb|ERN13871.1| hypothetical protein AMTR_s00021p00031000 [Amborella trichopoda]
Length=501

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 94/157 (60%), Gaps = 12/157 (8%)
 Frame = +2

Query  146  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  325
             LVFL   A+      C +   +I G     + EE++  LFE W++R+GK+YR +EE E 
Sbjct  4    LLVFLATFALSLTSSECSF---SITGYDPKDLSEERLSSLFETWRQRHGKIYRHQEERER  60

Query  326  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGIQ  505
            RFQ F+ NL ++ + T     S+   +VGLNKFAD+ N+EFK++++SKIK P  +++   
Sbjct  61   RFQAFRENLLFI-DATNRNTSSKSRHRVGLNKFADMTNKEFKEIYSSKIKRPGNRERA--  117

Query  506  MVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
                      K +  SCEA  S+DWRK+GAVT VKDQ
Sbjct  118  ------GAGAKSQAASCEASSSLDWRKKGAVTGVKDQ  148



>ref|XP_010052188.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Eucalyptus 
grandis]
Length=521

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 91/161 (57%), Gaps = 11/161 (7%)
 Frame = +2

Query  146  FLVFLIVAAVW----CGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEE  313
             LVFLI A+V        +   Y            + E +VL LF  WKE++ KVY+   
Sbjct  16   ILVFLIWASVLYLSSTSNLPSKYSIVGGENPESSLLSESRVLELFRRWKEKHNKVYKHAA  75

Query  314  EYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKK  493
            E E+R +NFK NL+YV EK+   + S    +VGLNKFADL NEEF++++ SK+K P  KK
Sbjct  76   EAEKRLENFKRNLRYVIEKSSNLK-SPTTPRVGLNKFADLSNEEFREIYLSKVKKPASKK  134

Query  494  QGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
               + +S       K K  +C+AP S+DWR  G VT VKDQ
Sbjct  135  WNSKNISL------KGKMKTCDAPSSLDWRNYGIVTGVKDQ  169



>gb|KCW76106.1| hypothetical protein EUGRSUZ_D00484 [Eucalyptus grandis]
Length=512

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 91/161 (57%), Gaps = 11/161 (7%)
 Frame = +2

Query  146  FLVFLIVAAVW----CGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEE  313
             LVFLI A+V        +   Y            + E +VL LF  WKE++ KVY+   
Sbjct  7    ILVFLIWASVLYLSSTSNLPSKYSIVGGENPESSLLSESRVLELFRRWKEKHNKVYKHAA  66

Query  314  EYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKK  493
            E E+R +NFK NL+YV EK+   + S    +VGLNKFADL NEEF++++ SK+K P  KK
Sbjct  67   EAEKRLENFKRNLRYVIEKSSNLK-SPTTPRVGLNKFADLSNEEFREIYLSKVKKPASKK  125

Query  494  QGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
               + +S       K K  +C+AP S+DWR  G VT VKDQ
Sbjct  126  WNSKNISL------KGKMKTCDAPSSLDWRNYGIVTGVKDQ  160



>ref|XP_011039435.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Populus 
euphratica]
Length=501

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 91/157 (58%), Gaps = 11/157 (7%)
 Frame = +2

Query  146  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  325
              +FL++A + C       +   ++      + EE +  +F+ WKE++ KVY+  EE E 
Sbjct  10   LFIFLLLAPLACLSSGLPGENSTVSSDLHEGLTEEGITEVFKLWKEKHRKVYKHAEEAER  69

Query  326  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGIQ  505
            R  NFK NLKY+ EK   G+ S +E KVGLNKFADL NEEF++++ SK++ P   ++   
Sbjct  70   RIGNFKRNLKYIIEKNGKGK-SGFEHKVGLNKFADLSNEEFREMYLSKVRKPITTEE---  125

Query  506  MVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
                    R  +   +C+AP S+DWR +G VT VKDQ
Sbjct  126  -------KRTHRHLQTCDAPSSLDWRNKGVVTAVKDQ  155



>ref|XP_006362397.1| PREDICTED: oryzain alpha chain-like [Solanum tuberosum]
Length=496

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 88/126 (70%), Gaps = 5/126 (4%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            + EE+V +LF+EWK+++GKVY+ E+E E + +NFK N+KY+ EK    R S  +  VGL 
Sbjct  44   LSEERVFQLFQEWKQKHGKVYKKEKEEEVKLENFKRNVKYIVEKN-SKRKSDSDYLVGLT  102

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
            KFAD+ NEEF+ V TSKI MPF K++ IQM        +K    SC+AP S+DWRK GAV
Sbjct  103  KFADMSNEEFRQVHTSKITMPFNKRKTIQMKKV----GKKPTPFSCDAPPSMDWRKHGAV  158

Query  599  TRVKDQ  616
            T+VKDQ
Sbjct  159  TKVKDQ  164



>ref|XP_011039436.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Populus 
euphratica]
Length=499

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 83/126 (66%), Gaps = 8/126 (6%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            V EE ++ +F +W++R+ KVY    E E+R++NFK NLKY+ EK  G + +    +VGLN
Sbjct  41   VSEENIIEIFRQWRDRHQKVYEHAAESEKRYRNFKRNLKYIIEK-AGKKTAALGHRVGLN  99

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
            KFADL NEEFK+++ SK+K P  K+      S     R++  + +C+AP S DWRK+G V
Sbjct  100  KFADLSNEEFKELYLSKVKKPINKR------SIARDWRQRNLQ-TCDAPSSFDWRKKGVV  152

Query  599  TRVKDQ  616
            T VKDQ
Sbjct  153  TAVKDQ  158



>ref|XP_010277012.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nelumbo 
nucifera]
Length=495

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 78/124 (63%), Gaps = 11/124 (9%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            EE+V  LF  W+E++GKVYR  EE E RF+NFK NLKYV EK    R S     VGLN F
Sbjct  43   EERVSELFGRWREKHGKVYRHAEELERRFENFKRNLKYVMEKNSKRRSSG--HLVGLNGF  100

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            AD+ NEEF++ + SKIK P  K++              +K  SC+AP S+DWRK+G VT 
Sbjct  101  ADMSNEEFREKYLSKIKKPVEKRK---------KNSSLRKMSSCDAPSSLDWRKKGVVTA  151

Query  605  VKDQ  616
            VK+Q
Sbjct  152  VKNQ  155



>gb|KHN28613.1| P34 putative thiol protease [Glycine soja]
Length=294

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 90/164 (55%), Gaps = 21/164 (13%)
 Frame = +2

Query  125  CSLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfV----PEEKVLRLFEEWKERNG  292
            C L+   FL+F+    VW       YD  +        +     EE V+ LF+ WKE N 
Sbjct  3    CQLKTHLFLLFI----VWGSWSFLCYDLPSEYSILALEIDKFPSEEGVVELFQRWKEENK  58

Query  293  KVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKI  472
            K+YR+ EE + RF+NFK NLKY+ EK    R S +   +GLN+FAD+ NEEFK  F SK+
Sbjct  59   KIYRNPEEEKLRFENFKRNLKYIVEKN-SKRISPYGQSLGLNQFADMSNEEFKSKFMSKV  117

Query  473  KMPFRKKQGIQMVSAVHSGREKKKKVSCE-APFSVDWRKRGAVT  601
            K PF K+ G+             K  SCE  P+S+DWRK+G VT
Sbjct  118  KKPFSKRNGVS-----------SKDHSCEDEPYSLDWRKKGVVT  150



>gb|ABK95906.1| unknown [Populus trichocarpa]
Length=498

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 79/126 (63%), Gaps = 11/126 (9%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            + EE +  +F+ WKE++ KVY+  EE E R  NFK NLKY+ EK  G R S  E KVGLN
Sbjct  41   LTEEGITEVFKLWKEKHQKVYKHAEEAERRIGNFKRNLKYIIEKN-GKRKSGLEHKVGLN  99

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
            KFADL NEEF++++ SK+K P            +   R+ +   +C+AP S+DWR +G V
Sbjct  100  KFADLSNEEFREMYLSKVKKPI----------TIEEKRKHRHLQTCDAPSSLDWRNKGVV  149

Query  599  TRVKDQ  616
            T VKDQ
Sbjct  150  TAVKDQ  155



>ref|XP_010279138.1| PREDICTED: histone-lysine N-methyltransferase SETD1B-like [Nelumbo 
nucifera]
Length=809

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 81/125 (65%), Gaps = 17/125 (14%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGK-VGLNK  421
            EEKV  LF +W+E++GKVY+ E E + RF NF+ NL+YV EK    R +   G+ VGLNK
Sbjct  42   EEKVFELFGQWREKHGKVYKHEGELQWRFLNFRKNLQYVIEKNSERRST---GRFVGLNK  98

Query  422  FADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVT  601
            FAD+ NEEF++V+ SK+K P RK               K    +C+AP S+DWRKRGAVT
Sbjct  99   FADMSNEEFREVYLSKVKRPVRKWM-------------KNNGGTCDAPRSLDWRKRGAVT  145

Query  602  RVKDQ  616
             VKDQ
Sbjct  146  PVKDQ  150



>ref|XP_004293953.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Fragaria 
vesca subsp. vesca]
Length=519

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 97/160 (61%), Gaps = 8/160 (5%)
 Frame = +2

Query  149  LVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEER  328
            L F I A++ C   S   +   +      F  EE+V+ LF  W+E++ KVY+  EE+E+R
Sbjct  10   LAFFICASLACLSYSLPTEYSIVGSETVNFPAEERVVELFRLWREKHRKVYKHAEEHEKR  69

Query  329  FQNFKGNLKYVKEKTVGGRGS---RWEGKVGLNKFADLRNEEFKDVFT-SKIKMPFRKKQ  496
            F+NFK NL++V EK    + +       KVGLNKFADL NEEF+ ++  +KI+MP  K++
Sbjct  70   FENFKRNLRFVLEKHAQKKAAANKHDTQKVGLNKFADLSNEEFRAIYMPTKIQMPISKRE  129

Query  497  GIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
             +    A    ++ K ++  +AP S+DWRK+G VT +KDQ
Sbjct  130  RM----ARRMQQQAKAELPKDAPSSLDWRKKGIVTPIKDQ  165



>ref|XP_008789986.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Phoenix 
dactylifera]
Length=496

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 81/124 (65%), Gaps = 8/124 (6%)
 Frame = +2

Query  248  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTV-GGRGSRWEGKVGLNKF  424
            E  L LFE+W+ ++GKVYR   E   RF+NF  NL+Y++E+    G  S     VGLNKF
Sbjct  42   EHGLELFEQWRTKHGKVYRHPAEKARRFENFLRNLEYIRERNARRGTASPPGHIVGLNKF  101

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEEF+ ++ S  +MP+RK+  +     V  GRE+    SCEAP+S+DWRK+G VT 
Sbjct  102  ADLSNEEFRAMYLS--RMPWRKEIRVGRKDMVE-GREE----SCEAPYSLDWRKKGVVTP  154

Query  605  VKDQ  616
            VKDQ
Sbjct  155  VKDQ  158



>ref|XP_008371471.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Malus 
domestica]
Length=512

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 94/161 (58%), Gaps = 9/161 (6%)
 Frame = +2

Query  149  LVFLIVAAVWCGGVSCYYDgfaiagagggfVP-EEKVLRLFEEWKERNGKVYRDEEEYEE  325
            L  LI A++ C   S   +   +        P EE+V+ LF  WK+++ KVYR   E+E 
Sbjct  10   LALLIWASLACLSSSLPSEYSIVGQEIVEHFPAEERVVELFRLWKQKHRKVYRHAGEHER  69

Query  326  RFQNFKGNLKYVKEKTV---GGRGSRWEGKVGLNKFADLRNEEFKDVFTS-KIKMPFRKK  493
            RF++FK NLK+V EK       + +    +VGLN FAD+ NEEF+  + S K++MP  K+
Sbjct  70   RFEHFKKNLKFVLEKNAKKRDAKNAHRSQRVGLNGFADMSNEEFRXTYLSKKVQMPLLKR  129

Query  494  QGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
            + + +V  +  G+  K   SC+AP S DWRK+G VT +KDQ
Sbjct  130  ENLNLVKKM-GGKPVK---SCDAPSSFDWRKKGVVTGIKDQ  166



>ref|XP_009350090.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Pyrus 
x bretschneideri]
Length=514

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 83/128 (65%), Gaps = 8/128 (6%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTV---GGRGSRWEGKVGL  415
            EE+V+ LF  WK+++ KVYR   E+E RF++FK NLK+V EK       + +    +VGL
Sbjct  43   EERVVELFRLWKQKHRKVYRHAGEHERRFEHFKKNLKFVLEKNARKRDAKNAHRSQRVGL  102

Query  416  NKFADLRNEEFKDVFTS-KIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRG  592
            N FAD+ NEEF+  + S K++MP  K++ + +V  +  G+  K   SC+AP S DWRK+G
Sbjct  103  NGFADMSNEEFRKTYLSKKVQMPLLKRENLNLVKKM-GGKPVK---SCDAPSSFDWRKQG  158

Query  593  AVTRVKDQ  616
             VT VKDQ
Sbjct  159  VVTAVKDQ  166



>gb|AHM88211.1| CAC1 protein [Malus hybrid cultivar]
Length=511

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 83/128 (65%), Gaps = 8/128 (6%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTV---GGRGSRWEGKVGL  415
            EE+V+ LF  WK+++ KVYR   E+E RF++FK NLK+V EK       + +    +VGL
Sbjct  43   EERVVELFRLWKQKHRKVYRHAGEHERRFEHFKKNLKFVLEKNAKKRDAKNAHRSQRVGL  102

Query  416  NKFADLRNEEFKDVFTS-KIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRG  592
            N FAD+ NEEF+  + S K++MP  K++ + +V  +  G+  K   SC+AP S DWRK+G
Sbjct  103  NGFADMSNEEFRKTYLSKKVQMPLLKRENLNLVKKM-GGKPVK---SCDAPSSFDWRKKG  158

Query  593  AVTRVKDQ  616
             VT +KDQ
Sbjct  159  VVTGIKDQ  166



>ref|XP_007148042.1| hypothetical protein PHAVU_006G175500g [Phaseolus vulgaris]
 gb|ESW20036.1| hypothetical protein PHAVU_006G175500g [Phaseolus vulgaris]
Length=507

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 77/125 (62%), Gaps = 13/125 (10%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            EE V+ LF+ WKE + K Y   EE + R +NFK NLKY+ EK    R   +  ++GLN+F
Sbjct  56   EEGVVELFQRWKEEHLKFYNHPEEAKLRLENFKRNLKYIVEKN-AKRIYPYGHRLGLNRF  114

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCE-APFSVDWRKRGAVT  601
            AD+ NEEFK  F SKIK PF K+ G+ +              SCE AP+++DWRK+G VT
Sbjct  115  ADMSNEEFKHKFISKIKKPFSKRNGLPV-----------NDDSCEDAPYTLDWRKKGVVT  163

Query  602  RVKDQ  616
             VKDQ
Sbjct  164  GVKDQ  168



>ref|XP_010915506.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Elaeis 
guineensis]
Length=492

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 83/124 (67%), Gaps = 8/124 (6%)
 Frame = +2

Query  248  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGK-VGLNKF  424
            E  L+LFE+W+ ++GKVY+   E   RF+NF  NL+Y++E+      S  +G  VGLNKF
Sbjct  42   EHGLKLFEQWRAKHGKVYQHPAEKARRFENFLKNLEYIRERNARRGMSSPKGHVVGLNKF  101

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEEF+ ++ S  +MP+ +++ +     V  GRE+    SCEAP+++DWRK+G VT 
Sbjct  102  ADLSNEEFRAMYLS--RMPWSREKRVGRKDMVE-GREE----SCEAPYTLDWRKKGVVTA  154

Query  605  VKDQ  616
            VKDQ
Sbjct  155  VKDQ  158



>ref|XP_003590277.1| Cysteine protease [Medicago truncatula]
Length=514

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 78/125 (62%), Gaps = 12/125 (10%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            EE+V+ LF++WK+ + K Y   EE   R +NFK NLKY+ E+    R S     +GLN+F
Sbjct  45   EEQVVELFQQWKKEHQKFYIHPEEAALRLENFKRNLKYIVERN-AMRNSPVGHHLGLNRF  103

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSC-EAPFSVDWRKRGAVT  601
            AD+ NEEFK+ F SK+K P  K+      S +H   E     SC +AP+S+DWRK+G VT
Sbjct  104  ADMSNEEFKNKFISKVKKPISKR-----ASNLHVKVE-----SCDDAPYSLDWRKKGVVT  153

Query  602  RVKDQ  616
             VKDQ
Sbjct  154  GVKDQ  158



>gb|KEH36599.1| papain family cysteine protease [Medicago truncatula]
Length=490

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 78/125 (62%), Gaps = 12/125 (10%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            EE+V+ LF++WK+ + K Y   EE   R +NFK NLKY+ E+    R S     +GLN+F
Sbjct  44   EEQVVELFQQWKKEHQKFYIHPEEAALRLENFKRNLKYIVERN-AMRNSPVGHHLGLNRF  102

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSC-EAPFSVDWRKRGAVT  601
            AD+ NEEFK+ F SK+K P  K+      S +H   E     SC +AP+S+DWRK+G VT
Sbjct  103  ADMSNEEFKNKFISKVKKPISKR-----ASNLHVKVE-----SCDDAPYSLDWRKKGVVT  152

Query  602  RVKDQ  616
             VKDQ
Sbjct  153  GVKDQ  157



>gb|KDP21101.1| hypothetical protein JCGZ_21572 [Jatropha curcas]
Length=508

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 91/158 (58%), Gaps = 8/158 (5%)
 Frame = +2

Query  149  LVFLIVAAV--WCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYE  322
            +VFL+++ V   C   S   +   +       +  E+V+ LF++WK  + K+Y+  EE E
Sbjct  10   IVFLVLSLVPLTCFSFSLPSEYSIVGNDLHELLSHERVIELFQQWKLEHKKIYKHAEEAE  69

Query  323  ERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGI  502
            +R +NF+ NLKYV EK           KVGLNKFADL NEEFK  + SK+K P  KK+  
Sbjct  70   KRLENFRRNLKYVIEKNAKNAEMGTGFKVGLNKFADLSNEEFKQTYLSKVKKPISKKKNT  129

Query  503  QMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
             M +       ++   +CEAP S+DWRK+G VT +K+Q
Sbjct  130  MMTTG------QRNLQACEAPSSLDWRKKGVVTPIKNQ  161



>ref|XP_002266308.2| PREDICTED: low-temperature-induced cysteine proteinase-like [Vitis 
vinifera]
Length=501

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 78/126 (62%), Gaps = 8/126 (6%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
              EE+V  LF  WKER+ +VY+  EE  +RF+ FK NLKYV E+   G        +G+N
Sbjct  37   ASEERVRELFHLWKERHKRVYKHAEETAKRFEIFKENLKYVIERNSKGH----RHTLGMN  92

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
            KFAD+ NEEFK+ + SKIK P  KK          S ++KK   SCEAP S+DWRK+G V
Sbjct  93   KFADMSNEEFKEKYLSKIKKPINKKNNYLR----RSMQQKKGTASCEAPSSLDWRKKGVV  148

Query  599  TRVKDQ  616
            T +KDQ
Sbjct  149  TGIKDQ  154



>gb|KCW74111.1| hypothetical protein EUGRSUZ_E02751 [Eucalyptus grandis]
Length=521

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 79/128 (62%), Gaps = 8/128 (6%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKT--VGGRGSRWEGKVG  412
            V +E+ + LF  W+ ++ KVY+   E E R +NFK NL+YV E++   GG+    +  VG
Sbjct  48   VSDERAVELFRRWQAQHKKVYKHAGEAERRLENFKRNLRYVMERSRRDGGK----QHGVG  103

Query  413  LNKFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRG  592
            LNKFADL NEEF+ ++ SK+K    +K   +  S + + R  K   SC+AP S+DWR  G
Sbjct  104  LNKFADLSNEEFRQLYLSKVKKSVNQKWRAKRESLMRNKR--KGAESCKAPSSLDWRNYG  161

Query  593  AVTRVKDQ  616
             VT VKDQ
Sbjct  162  IVTGVKDQ  169



>ref|XP_010057104.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Eucalyptus 
grandis]
 gb|KCW74112.1| hypothetical protein EUGRSUZ_E02751 [Eucalyptus grandis]
Length=521

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 79/128 (62%), Gaps = 8/128 (6%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKT--VGGRGSRWEGKVG  412
            V +E+ + LF  W+ ++ KVY+   E E R +NFK NL+YV E++   GG+    +  VG
Sbjct  48   VSDERAVELFRRWQAQHKKVYKHAGEAERRLENFKRNLRYVMERSRRDGGK----QHGVG  103

Query  413  LNKFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRG  592
            LNKFADL NEEF+ ++ SK+K    +K   +  S + + R  K   SC+AP S+DWR  G
Sbjct  104  LNKFADLSNEEFRQLYLSKVKKSVNQKWRAKRESLMRNKR--KGAESCKAPSSLDWRNYG  161

Query  593  AVTRVKDQ  616
             VT VKDQ
Sbjct  162  IVTGVKDQ  169



>ref|XP_004485897.1| PREDICTED: cysteine proteinase RD21a-like [Cicer arietinum]
Length=492

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 76/125 (61%), Gaps = 12/125 (10%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            E++V+ LF++WK+ + K Y   EE   R ++F+ NLKYV E+    R S    ++GLN+F
Sbjct  40   EDQVVELFQQWKKDHKKFYIHPEEAALRLESFRRNLKYVIERN-SMRNSTLGHRLGLNRF  98

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSC-EAPFSVDWRKRGAVT  601
            AD+ N+EFK  F SK+K P  K+     V          K  SC EA +S+DWRK+GAVT
Sbjct  99   ADMSNDEFKSKFISKVKKPTSKRSNDLYV----------KDESCEEAAYSLDWRKKGAVT  148

Query  602  RVKDQ  616
             VKDQ
Sbjct  149  GVKDQ  153



>ref|XP_009404511.1| PREDICTED: xylem cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=473

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 84/159 (53%), Gaps = 13/159 (8%)
 Frame = +2

Query  146  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  325
             L F  VA VWC   S Y    +I G   G    E+   LFE+W   +GKVY    E   
Sbjct  8    LLCFSAVALVWCRLPSEY----SIVGYEPGPNATERSYELFEQWCRAHGKVYMHPAEKAR  63

Query  326  RFQNFKGNLKYVKEKTVGGRGSRWEG--KVGLNKFADLRNEEFKDVFTSKIKMPFRKKQG  499
            RF+ F  NL+YV ++      S       VGLN+FADL NEEFK  + SKI    RK++ 
Sbjct  64   RFEYFLANLRYVFDRNSRRSSSSSSHGHAVGLNRFADLSNEEFKATYMSKIG---RKRE-  119

Query  500  IQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
               V     G  +K + SC+AP S+DWRK+G VT VKDQ
Sbjct  120  ---VGMSRGGDMEKTRESCDAPASLDWRKKGVVTAVKDQ  155



>ref|NP_001242660.1| uncharacterized protein LOC100807362 precursor [Glycine max]
 gb|ACU18666.1| unknown [Glycine max]
Length=367

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 60/168 (36%), Positives = 81/168 (48%), Gaps = 12/168 (7%)
 Frame = +2

Query  113  MGTKCSLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNG  292
            MGT  SL     +V   V AV                   G+  +E+V+ ++EEW  ++G
Sbjct  1    MGTNRSLMATILIVLFTVLAVSSALDMSIISYDRSHADKSGWKSDEEVMSIYEEWLVKHG  60

Query  293  KVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKI  472
            KVY   EE E+RFQ FK NL +++E     R      KVGLN+F+DL NEE++  +    
Sbjct  61   KVYNAVEEKEKRFQIFKDNLNFIEEHNAVNRTY----KVGLNRFSDLSNEEYRSKYLGTK  116

Query  473  KMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
              P R              R    +V+   P SVDWRK GAV RVK+Q
Sbjct  117  IDPSRM--------MARPSRRYSPRVADNLPESVDWRKEGAVVRVKNQ  156



>ref|NP_001241331.1| uncharacterized protein LOC100811719 precursor [Glycine max]
 gb|ACU23360.1| unknown [Glycine max]
Length=362

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 85/164 (52%), Gaps = 12/164 (7%)
 Frame = +2

Query  128  SLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRD  307
            SLQ      F IV   +    +C       +     F  EE+V +LF+ W++ + + Y +
Sbjct  3    SLQRTKLFPFFIVLVSF----TCSLSLAMSSNQLEQFASEEEVFQLFQAWQKEHKREYGN  58

Query  308  EEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFR  487
            +EE  +RFQ F+ NL+Y+ E     +    + ++GLNKFAD+  EEF   +  +I+MP+ 
Sbjct  59   QEEKAKRFQIFQSNLRYINEMNAKRKSPTTQHRLGLNKFADMSPEEFMKTYLKEIEMPYS  118

Query  488  KKQGIQMVSAVHSGREKKKKVSCE-APFSVDWRKRGAVTRVKDQ  616
              +  + +       +K     C+  P SVDWR +GAVT V+DQ
Sbjct  119  NLESRKKL-------QKGDDADCDNLPHSVDWRDKGAVTEVRDQ  155



>gb|AAP41846.1| cysteine protease [Anthurium andraeanum]
Length=502

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 73/119 (61%), Gaps = 5/119 (4%)
 Frame = +2

Query  263  LFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGK-VGLNKFADLRN  439
            LFE W E++ KVY    E   R+ NF  NL +V+++   GR +   G+ VG+N FADL N
Sbjct  50   LFERWMEKHRKVYAHPGEKARRYANFLSNLAFVRKRNAEGRRAPSSGQGVGMNVFADLSN  109

Query  440  EEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
            EEF++V++S++     +K+  +   A     E +    C+AP S+DWRKRGAVT VK+Q
Sbjct  110  EEFREVYSSRV----LRKKAAEGRGARRRAGEGRVVAGCDAPASLDWRKRGAVTAVKNQ  164



>gb|KHN48002.1| P34 putative thiol protease [Glycine soja]
Length=336

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 74/125 (59%), Gaps = 8/125 (6%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            EE+V +LF+ W++ + + Y ++EE  +RFQ F+ NL+Y+ E     +    + ++GLNKF
Sbjct  12   EEEVFQLFQAWQKEHKREYGNQEEKAKRFQIFQSNLRYINEMNAKSKSPTTQHRLGLNKF  71

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCE-APFSVDWRKRGAVT  601
            AD+  EEF   +  +I+MP+   +  + +       +K     C+  P SVDWR +GAVT
Sbjct  72   ADMSPEEFMKTYLKEIEMPYSNLESRKKL-------QKGDDADCDNLPHSVDWRDKGAVT  124

Query  602  RVKDQ  616
             V+DQ
Sbjct  125  EVRDQ  129



>ref|XP_003636796.1| Cysteine proteinase [Medicago truncatula]
 gb|KEH36607.1| papain family cysteine protease [Medicago truncatula]
Length=475

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 71/125 (57%), Gaps = 27/125 (22%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            EE+V+ LF++WK+ + K Y   EE   R +NFK NLKY+ E+    R S     +GLN+F
Sbjct  44   EEQVVELFQQWKKEHQKFYIHPEEAALRLENFKRNLKYIVERNA-MRNSPVGHHLGLNRF  102

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSC-EAPFSVDWRKRGAVT  601
            AD+ NEEFK+ F SK++                         SC +AP+S+DWRK+G VT
Sbjct  103  ADMSNEEFKNKFISKVE-------------------------SCDDAPYSLDWRKKGVVT  137

Query  602  RVKDQ  616
             VKDQ
Sbjct  138  GVKDQ  142



>ref|XP_003580684.2| PREDICTED: oryzain alpha chain-like [Brachypodium distachyon]
Length=486

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 69/124 (56%), Gaps = 9/124 (7%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            EE+V R++ EW   NG+ Y    E E RF+ F+ NL+YV +            ++GLN+F
Sbjct  65   EEEVRRMYVEWMAENGRTYNAIGEEERRFEVFRDNLRYVDQHNAAADAGLHSFRLGLNRF  124

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++D +      P R+++         SGR +      E P SVDWR++GAV +
Sbjct  125  ADLTNEEYRDTYLGVRTKPVRERR--------LSGRYQAADNE-ELPESVDWREKGAVAK  175

Query  605  VKDQ  616
            VKDQ
Sbjct  176  VKDQ  179



>ref|XP_009613581.1| PREDICTED: low-temperature-induced cysteine proteinase-like isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009613582.1| PREDICTED: low-temperature-induced cysteine proteinase-like isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009613583.1| PREDICTED: low-temperature-induced cysteine proteinase-like isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009613584.1| PREDICTED: low-temperature-induced cysteine proteinase-like isoform 
X2 [Nicotiana tomentosiformis]
Length=434

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 62/97 (64%), Gaps = 5/97 (5%)
 Frame = +2

Query  326  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGIQ  505
            R + F+ N+KY+ EK    R S  +  VGL  FAD+ NEEF+ V TSKIK+PF K++ IQ
Sbjct  2    RLEKFRRNVKYIVEKN-SKRKSDSDHLVGLTNFADMSNEEFRQVHTSKIKIPFDKRKTIQ  60

Query  506  MVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
            M +      +K   V C+AP S DWRK GAVT VK+Q
Sbjct  61   MKNV----EKKPTPVYCDAPPSRDWRKHGAVTEVKNQ  93



>gb|KHN04480.1| Cysteine proteinase RD21a [Glycine soja]
Length=360

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 69/124 (56%), Gaps = 12/124 (10%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +E+V+ ++EEW  ++GKVY   EE E+RFQ FK NL +++E     R      KVGLN+F
Sbjct  38   DEEVMSIYEEWLVKHGKVYNAVEEKEKRFQIFKDNLNFIEEHNAVNRTY----KVGLNRF  93

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            +DL NEE++  +      P R              R    +V+   P SVDWRK GAV R
Sbjct  94   SDLSNEEYRSKYLGTKIDPRRMM--------ARPSRRYSPRVADNLPESVDWRKEGAVVR  145

Query  605  VKDQ  616
            VK+Q
Sbjct  146  VKNQ  149



>gb|AGV54734.1| cysteine proteinase [Phaseolus vulgaris]
Length=385

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 72/125 (58%), Gaps = 11/125 (9%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            EE+VL+LF+ W++ +G+ Y + EE  +RF  F+ NL+Y+ E     R S  + ++GLNKF
Sbjct  60   EEEVLQLFQVWQKEHGREYGNPEEKTKRFHIFQRNLRYINEMNA-KRKSETQHRLGLNKF  118

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCE-APFSVDWRKRGAVT  601
            AD   EEF + +  +I MP              S  +K     CE  P SVDWR++GAVT
Sbjct  119  ADTSPEEFAETYLKEIDMPSNLGS---------SKMQKDDDGDCENLPDSVDWREKGAVT  169

Query  602  RVKDQ  616
             V+DQ
Sbjct  170  EVRDQ  174



>ref|XP_004486273.1| PREDICTED: P34 probable thiol protease-like [Cicer arietinum]
Length=375

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 75/157 (48%), Gaps = 10/157 (6%)
 Frame = +2

Query  146  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  325
            F++F  +    C G+   Y              +E + +LF++W++ +G+VY+D EE  +
Sbjct  13   FIIFTTLCLSSCYGIPTKYSSILGPNLDKLPTQQEAI-QLFQQWRKDHGRVYKDLEEMSK  71

Query  326  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGIQ  505
            +F  F  NLKY+ E T   R S     +GL  F+D    EFK+ +  +I M     +   
Sbjct  72   KFDIFYSNLKYITE-TNAKRKSPHGFLLGLTSFSDWSTNEFKETYLHEIDMSTHMDK---  127

Query  506  MVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
                   G    +   C AP S+DWR +GAVT VK Q
Sbjct  128  -----MKGNGVVRNSECSAPSSLDWRTKGAVTSVKSQ  159



>ref|XP_011097243.1| PREDICTED: cysteine proteinase COT44 [Sesamum indicum]
Length=371

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 70/127 (55%), Gaps = 14/127 (11%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            EE+V  L+E W  ++GK Y    E + RFQ FK NLK+V E   G R      KVGLN+F
Sbjct  40   EEQVKGLYERWLAKHGKAYNGIGEKDRRFQIFKDNLKFVDEHNSGNRTY----KVGLNRF  95

Query  425  ADLRNEEFKDVFT---SKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGA  595
            ADL NEEF+ V+    +  K  F K +      A  +G +       E P SVDWR+RGA
Sbjct  96   ADLTNEEFRSVYLGTRTDAKRRFVKSKNASRRYAFRAGDD-------ELPESVDWRERGA  148

Query  596  VTRVKDQ  616
            V  +K+Q
Sbjct  149  VAPIKNQ  155



>gb|AES64023.2| papain family cysteine protease [Medicago truncatula]
Length=374

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 82/161 (51%), Gaps = 14/161 (9%)
 Frame = +2

Query  146  FLVFLIVAAVWCGGVSCY---YDgfaiagagggfVP-EEKVLRLFEEWKERNGKVYRDEE  313
            FL+F+I   + C   S Y       +I G     +P ++K + +F+ W + +G+VY+D +
Sbjct  9    FLIFIIFTTILCLPSSTYGIPTKYSSIMGPNLDKLPTQDKTIEIFQLWMKEHGRVYKDLD  68

Query  314  EYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKK  493
            E  ++F  F  NLKY+ E T   R S     +GL  F D  +EEF++ +   I MP    
Sbjct  69   EMAKKFDIFISNLKYITE-TNAKRKSSNGFLLGLTNFTDWSSEEFQERYLHNIDMP--TD  125

Query  494  QGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
                 V+ VH         SC AP S+DWR +G V+ +KDQ
Sbjct  126  IDTMKVNDVHLS-------SCSAPSSLDWRSKGVVSDIKDQ  159



>gb|KDP21086.1| hypothetical protein JCGZ_21557 [Jatropha curcas]
Length=151

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 82/159 (52%), Gaps = 25/159 (16%)
 Frame = +2

Query  146  FLVFLI-VAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYE  322
            FLVF++ +  +W     C              + EE +L+  EEW+ ++G+VY+D  E +
Sbjct  10   FLVFVLNILTIWATHTVC------------RPLNEEYMLKRHEEWRAQHGRVYKDTAEKQ  57

Query  323  ERFQNFKGNLKYVKEKTVG-GRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQG  499
            +++  FK NL+ ++    G  RG     K+GLNKFADL +EEF+ +      +P +    
Sbjct  58   KKYLVFKDNLERIESFNNGVDRGY----KLGLNKFADLTDEEFRAMHLGYKSLPSK----  109

Query  500  IQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
               + A    R  + +     P ++DWRK GAVT VKDQ
Sbjct  110  ---LMATSKSRSFRYRNVTSVPTTIDWRKAGAVTLVKDQ  145



>dbj|BAJ92693.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=289

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 67/124 (54%), Gaps = 9/124 (7%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            EE+V R++ EW   +G  Y    E E RF+ F+ NL+Y+ +            ++GLN+F
Sbjct  36   EEEVRRMYAEWMAEHGSTYNAIGEEERRFEAFRDNLRYIDQHNAAADAGVHSFRLGLNRF  95

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++  +      P R+++    +SA +   +       E P SVDWRK+GAV  
Sbjct  96   ADLTNEEYRSTYLGARTKPDRERK----LSARYQAADND-----ELPESVDWRKKGAVGA  146

Query  605  VKDQ  616
            VKDQ
Sbjct  147  VKDQ  150



>ref|NP_001054087.2| Os04g0650000 [Oryza sativa Japonica Group]
 dbj|BAF16001.2| Os04g0650000 [Oryza sativa Japonica Group]
Length=158

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 67/126 (53%), Gaps = 11/126 (9%)
 Frame = +2

Query  242  PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK  421
             EE+  RL+ EWK  +GK Y    E E R+  F+ NL+Y+ E            ++GLN+
Sbjct  32   SEEEARRLYAEWKAEHGKSYNAVGEEERRYAAFRDNLRYIDEHNAAADAGVHSFRLGLNR  91

Query  422  FADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEA-PFSVDWRKRGAV  598
            FADL NEE++D +      P R+++    VS      ++      EA P SVDWR +GAV
Sbjct  92   FADLTNEEYRDTYLGLRNKPRRERK----VS------DRYLAADNEALPESVDWRTKGAV  141

Query  599  TRVKDQ  616
              +KDQ
Sbjct  142  AEIKDQ  147



>ref|XP_010436251.1| PREDICTED: xylem cysteine proteinase 1-like, partial [Camelina 
sativa]
Length=306

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 84/164 (51%), Gaps = 16/164 (10%)
 Frame = +2

Query  128  SLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRD  307
            SL     L+ +  +A+ C  ++  +D   +          EK+L LFE W   + K Y  
Sbjct  3    SLTKFSLLIAISASALLCSALA--HDFSIVGYTPEHLTSTEKLLELFESWMSEHSKAYNS  60

Query  308  EEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPF-  484
             EE   RF+ F+ NL ++ ++      S W   +GLN+FADL +EEFK+ +    K  F 
Sbjct  61   VEEKVHRFEVFRENLMHIDQRN-NEINSYW---LGLNEFADLSHEEFKERYLGLAKPQFS  116

Query  485  RKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
            RK+Q         S   + + ++ + P SVDWRK+GAVT VKDQ
Sbjct  117  RKRQP--------SANFRYRDIT-DLPKSVDWRKKGAVTPVKDQ  151



>gb|AAD54424.1|AF182079_1 thiol protease [Matricaria chamomilla]
Length=501

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 79/129 (61%), Gaps = 11/129 (9%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            +   KV  LF +WKE +GK Y+ EEE   R +NFK ++K+V EK    R S  +  VGLN
Sbjct  41   LSSAKVSDLFGKWKELHGKTYQHEEEENLRLENFKKSVKFVMEKN-SERKSELDHTVGLN  99

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVS---CEAPFSVDWRKR  589
            KFADL NEEFK+++ SK+K    +   ++M      G ++   VS   C+AP S+DWR +
Sbjct  100  KFADLSNEEFKEMYMSKVKG--SRSNELKM-----GGVKRNMSVSSRTCDAPTSLDWRDK  152

Query  590  GAVTRVKDQ  616
            G VT +KDQ
Sbjct  153  GVVTPMKDQ  161



>ref|XP_008779806.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=326

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 77/126 (61%), Gaps = 14/126 (11%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            + +E +LR  E+W  + G+VY+D  E E RFQ F+GN +Y+  +++   G R + K+GLN
Sbjct  15   IADEPMLRRHEQWMAQYGRVYKDAAEKERRFQIFRGNYEYI--ESINRAGDR-KYKLGLN  71

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
            +FAD+ NEEFK       ++ F+      M +   +G  +   +S +AP S+DWR +GAV
Sbjct  72   QFADMTNEEFK-----ASRLGFKP-----MPTESTTGSFQYANLS-DAPDSMDWRTKGAV  120

Query  599  TRVKDQ  616
            T VK+Q
Sbjct  121  TAVKNQ  126



>ref|XP_010109882.1| Oryzain alpha chain [Morus notabilis]
 gb|EXC24835.1| Oryzain alpha chain [Morus notabilis]
Length=487

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 89/158 (56%), Gaps = 16/158 (10%)
 Frame = +2

Query  149  LVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEK-VLRLFEEWKERNGKVYRDEEEYEE  325
            LVFLI A + C   S       + G      P EK  + LF +W E++ KVYR  EE E 
Sbjct  10   LVFLIWAWLTCLSSS-------LLGHEMESFPSEKEAVELFRKWTEKHKKVYRQPEEEER  62

Query  326  RFQNFKGNLKYVKEKT-VGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGI  502
            R +NFK NLKY+ EK     R S+   K+GLN+FAD+ NEEF+ V++SKI    R+    
Sbjct  63   RNENFKRNLKYIYEKNDYWKRRSQNGHKLGLNRFADMSNEEFRKVYSSKIDNKRRR----  118

Query  503  QMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
               + + S   + K  S +AP S+DWR +G VT VKDQ
Sbjct  119  ---NVIPSRSLRGKLGSVDAPLSLDWRTKGVVTGVKDQ  153



>ref|XP_007159458.1| hypothetical protein PHAVU_002G239300g [Phaseolus vulgaris]
 gb|ESW31452.1| hypothetical protein PHAVU_002G239300g [Phaseolus vulgaris]
Length=368

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 73/129 (57%), Gaps = 19/129 (15%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            EE+VL+LF+ W++ +G+ Y + EE  +RF  F+ NL+Y+ E     R S  + ++GLNKF
Sbjct  43   EEEVLQLFQVWQKEHGREYGNPEEKAKRFHIFQRNLRYINEMNA-KRKSGTQHRLGLNKF  101

Query  425  ADLRNEEFKDVFTSKIKMP----FRKKQGIQMVSAVHSGREKKKKVSCE-APFSVDWRKR  589
            AD   EEF + +  +I MP     RK Q             K     CE  P SVDWR++
Sbjct  102  ADTSPEEFAETYLKEIDMPSNLGSRKMQ-------------KDDDDDCENLPDSVDWREK  148

Query  590  GAVTRVKDQ  616
            GAVT V+DQ
Sbjct  149  GAVTEVRDQ  157



>dbj|BAJ85145.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=436

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 67/124 (54%), Gaps = 9/124 (7%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            EE+V R++ EW   +G  Y    E E RF+ F+ NL+Y+ +            ++GLN+F
Sbjct  36   EEEVRRMYAEWMAEHGSTYNAIGEEERRFEAFRDNLRYIDQHNAAADAGVHSFRLGLNRF  95

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++  +      P R+++    +SA +   +       E P SVDWRK+GAV  
Sbjct  96   ADLTNEEYRSTYLGARTKPDRERK----LSARYQAADND-----ELPESVDWRKKGAVGA  146

Query  605  VKDQ  616
            VKDQ
Sbjct  147  VKDQ  150



>emb|CAQ00105.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87864.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96253.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=463

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 67/124 (54%), Gaps = 9/124 (7%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            EE+V R++ EW   +G  Y    E E RF+ F+ NL+Y+ +            ++GLN+F
Sbjct  36   EEEVRRMYAEWMAEHGSTYNAIGEEERRFEAFRDNLRYIDQHNAAADAGVHSFRLGLNRF  95

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++  +      P R+++    +SA +   +       E P SVDWRK+GAV  
Sbjct  96   ADLTNEEYRSTYLGARTKPDRERK----LSARYQAADND-----ELPESVDWRKKGAVGA  146

Query  605  VKDQ  616
            VKDQ
Sbjct  147  VKDQ  150



>ref|NP_001066557.2| Os12g0273800 [Oryza sativa Japonica Group]
 dbj|BAF29576.2| Os12g0273800 [Oryza sativa Japonica Group]
Length=210

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 68/117 (58%), Gaps = 10/117 (9%)
 Frame = +2

Query  269  EEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEF  448
            E W  ++G+VY+D  E   R + FK N+ +++    GG+   W   +G+N+FADL +EEF
Sbjct  45   ERWMAQHGRVYKDAAEKARRLEVFKANVAFIESFNAGGKNRYW---LGVNQFADLTSEEF  101

Query  449  KDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEA-PFSVDWRKRGAVTRVKDQ  616
            K   T+  K       G+++ +       K + VS +A P SVDWR +GAVTR+KDQ
Sbjct  102  KATMTNS-KGFSTPNNGVRVSTGF-----KYENVSADALPASVDWRTKGAVTRIKDQ  152



>ref|XP_010686210.1| PREDICTED: xylem cysteine proteinase 2-like [Beta vulgaris subsp. 
vulgaris]
Length=571

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 76/126 (60%), Gaps = 12/126 (10%)
 Frame = +2

Query  245  EEKVLRLFEEWKE--RNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            E +V+ LF++W+   ++ K Y  ++E  +RF NFK NLKYV EK     G      VGLN
Sbjct  53   ENRVMELFQQWRNNYKHTKSYEYKKEELKRFDNFKRNLKYVFEKNENRAGF----TVGLN  108

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
            +F+DL NEEF+ ++  KIK+    K  +++    H+       + C+AP  +DWR++G V
Sbjct  109  RFSDLSNEEFRKMYLGKIKI----KNPVRLSKRKHT--RMSSLLGCDAPSFLDWREKGVV  162

Query  599  TRVKDQ  616
            T+VKDQ
Sbjct  163  TQVKDQ  168



>ref|XP_008810168.1| PREDICTED: ervatamin-B-like isoform X2 [Phoenix dactylifera]
 ref|XP_008810169.1| PREDICTED: ervatamin-B-like isoform X2 [Phoenix dactylifera]
Length=336

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 82/157 (52%), Gaps = 26/157 (17%)
 Frame = +2

Query  146  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  325
            F + L+V  VW  G +               + +E +    E+W  +NG+VY D  E E 
Sbjct  6    FELALMVLGVWVSGAT------------ARGIADEPMRTKHEQWMAQNGRVYTDAAEKER  53

Query  326  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGIQ  505
            RFQ F+ N +Y+  K+V   G R + K+GLN+FADL N EFK       ++ F+      
Sbjct  54   RFQIFRDNYEYI--KSVNRAGDR-KYKLGLNQFADLTNGEFK-----ASRLAFKP-----  100

Query  506  MVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
            M +A  +G  +   ++ + P S+DWR RGAVT VK+Q
Sbjct  101  MPTASTTGSFQYANLT-DVPNSMDWRTRGAVTPVKNQ  136



>gb|KEH30224.1| papain family cysteine protease [Medicago truncatula]
Length=364

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 83/160 (52%), Gaps = 13/160 (8%)
 Frame = +2

Query  146  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVP-EEKVLRLFEEWKERNGKVYRD-EEEY  319
             L FLI+ ++ C   +   +    +         +E+V  LF+ WK+ +G+ Y + EEE 
Sbjct  10   ILSFLILISITCLSFALSSEYSISSHGKLDKFSSDEEVFELFQMWKKEHGRDYANSEEEN  69

Query  320  EERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQG  499
             +RF+ FK N KY+ E     R S+ + ++ LNKFAD+  EEF   +  KI+M       
Sbjct  70   AKRFEIFKTNFKYINEMN-AKRKSQTQHRLSLNKFADMSPEEFSKTYLPKIEM-------  121

Query  500  IQMVSAVHSGREKKKKVSCE-APFSVDWRKRGAVTRVKDQ  616
               V +     + K    CE  P SVDWR++GAVT V+DQ
Sbjct  122  --QVPSNRDNAKLKDDDDCENLPTSVDWREKGAVTEVRDQ  159



>ref|XP_004499026.1| PREDICTED: cysteine proteinase RD21a-like [Cicer arietinum]
Length=472

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 69/124 (56%), Gaps = 9/124 (7%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            E++VL L+EEW  ++GKVY    E ++RF  FK NLK++ E  V     R    +GL +F
Sbjct  47   EKEVLTLYEEWLVKHGKVYNGLGEKDKRFDIFKDNLKFIDEHNVLNSTYR----LGLTRF  102

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++  F      P RK + +   S  ++ R   K      P SVDWRK GAV  
Sbjct  103  ADLTNEEYRAKFLGTRVDPNRKIRKVNSPSNRYAPRVGDK-----LPESVDWRKEGAVAA  157

Query  605  VKDQ  616
            VKDQ
Sbjct  158  VKDQ  161



>gb|KJB69615.1| hypothetical protein B456_011G034200 [Gossypium raimondii]
Length=342

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/156 (33%), Positives = 79/156 (51%), Gaps = 21/156 (13%)
 Frame = +2

Query  149  LVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEER  328
            L  L V  +W   VS               +PE  +   FE+W    G+VY+D  E ++R
Sbjct  8    LALLFVLGIWAFQVS------------SRSIPEVSMSDKFEQWMASYGRVYQDAFEKDKR  55

Query  329  FQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGIQM  508
            FQ FK N++Y++    G    ++  K+G+N+F DL NEEFK +          K Q   +
Sbjct  56   FQIFKENVEYIESHNAGHTAKKY--KLGVNEFTDLTNEEFKSMRNG------YKMQRSTI  107

Query  509  VSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
            V++  +   + + V+   P S+DWR +GAVT +KDQ
Sbjct  108  VASSKTSSFRYENVTA-VPSSMDWRSKGAVTNIKDQ  142



>gb|ABI30276.1| VXH-C [Vasconcellea x heilbornii]
Length=282

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 80/156 (51%), Gaps = 12/156 (8%)
 Frame = +2

Query  149  LVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEER  328
            L+F+    +   G+S + D   +  +       EK +RLFE W  ++ KVY+  EE   R
Sbjct  10   LIFVATCLIVRAGLS-FADFSIVGYSQDDLTSIEKSIRLFESWMLKHDKVYKSMEEKINR  68

Query  329  FQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGIQM  508
            F+ FK NL Y+ E T     S W   +GLN+FADL ++EFK  +   I   +       +
Sbjct  69   FEIFKDNLMYIDE-TNKKNNSYW---LGLNEFADLTHDEFKKKYVGSIPEDY------TI  118

Query  509  VSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
            +     G    K V  + P SVDWR++GAVT VKDQ
Sbjct  119  IEQSDDGEFPYKHV-VDYPESVDWRQKGAVTPVKDQ  153



>ref|XP_008810167.1| PREDICTED: ervatamin-B-like isoform X1 [Phoenix dactylifera]
Length=362

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 82/157 (52%), Gaps = 26/157 (17%)
 Frame = +2

Query  146  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  325
            F + L+V  VW  G +               + +E +    E+W  +NG+VY D  E E 
Sbjct  32   FELALMVLGVWVSGATA------------RGIADEPMRTKHEQWMAQNGRVYTDAAEKER  79

Query  326  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGIQ  505
            RFQ F+ N +Y+  K+V   G R + K+GLN+FADL N EFK       ++ F+      
Sbjct  80   RFQIFRDNYEYI--KSVNRAGDR-KYKLGLNQFADLTNGEFK-----ASRLAFKP-----  126

Query  506  MVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
            M +A  +G  +   ++ + P S+DWR RGAVT VK+Q
Sbjct  127  MPTASTTGSFQYANLT-DVPNSMDWRTRGAVTPVKNQ  162



>gb|AAQ55450.1| 34 kDa maturing seed vacuolar thiol protease precursor [Glycine 
max]
Length=165

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 74/125 (59%), Gaps = 9/125 (7%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +++V  LF+ WK  +G+VY + EE  +R + FK NL Y+++     R S    ++GLNKF
Sbjct  37   QKQVSSLFQLWKSEHGRVYHNHEEEAKRLEIFKNNLNYIRDMN-ANRKSPHSHRLGLNKF  95

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCE-APFSVDWRKRGAVT  601
            AD+  +EF   +   ++ P    Q I+M +     + KK++ SC+  P S DWRK+G +T
Sbjct  96   ADITPQEFSKKY---LQAPKDVSQQIKMANK----KMKKEQYSCDHPPASWDWRKKGVIT  148

Query  602  RVKDQ  616
            +VK Q
Sbjct  149  QVKYQ  153



>ref|XP_004504420.1| PREDICTED: P34 probable thiol protease-like [Cicer arietinum]
Length=364

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 67/123 (54%), Gaps = 10/123 (8%)
 Frame = +2

Query  248  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA  427
            E V  LF+ WK+ +G+ Y ++EE E RF+ FK NL+Y+ E     R S  + ++GLNKF 
Sbjct  47   EDVFELFQMWKKEHGREYGNKEEMENRFEIFKSNLRYINEMN-AKRNSPLQHRLGLNKFG  105

Query  428  DLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRV  607
            D+  EEF   + S+I+M           +      +         P S+DWRK+GAVT V
Sbjct  106  DMSPEEFSKTYLSEIQM---------RSNWDDRKLKDDDDDCDNLPASIDWRKKGAVTEV  156

Query  608  KDQ  616
            +DQ
Sbjct  157  RDQ  159



>ref|XP_006434711.1| hypothetical protein CICLE_v100010541mg, partial [Citrus clementina]
 gb|ESR47951.1| hypothetical protein CICLE_v100010541mg, partial [Citrus clementina]
Length=160

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 85/170 (50%), Gaps = 15/170 (9%)
 Frame = +2

Query  113  MGTKCSLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNG  292
            MG   S     FL+FL   +         YD    + +      +E V+ +FE W  ++G
Sbjct  1    MGLFRSPTMAMFLLFLFTVSSALDMSIVSYDKTHESKSSSWRTDDE-VMGMFEAWFVKHG  59

Query  293  KVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKI  472
            K Y    E E+RF+ FK NL+++ E     R      KVGLN+FADL NEE++ ++   +
Sbjct  60   KAYNALGEKEKRFEIFKDNLRFIDEHNSENRTY----KVGLNRFADLTNEEYRSMY---L  112

Query  473  KMPFRKKQGIQMVSAVHSGREKK--KKVSCEAPFSVDWRKRGAVTRVKDQ  616
               F  K+     +++ S R  +   +V    P SVDWRK+GAV  VKDQ
Sbjct  113  GARFGAKR-----TSLKSKRSDRYLPRVGEALPDSVDWRKKGAVAEVKDQ  157



>gb|KJB69616.1| hypothetical protein B456_011G034300 [Gossypium raimondii]
Length=341

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 76/158 (48%), Gaps = 24/158 (15%)
 Frame = +2

Query  146  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  325
            +L  L +  +W    S               +PE  +   FE+W    G+VY+D  E ++
Sbjct  7    YLALLFILGIWVSQAS------------SRSIPEVSMSDRFEQWMASYGRVYQDPSEKDK  54

Query  326  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGIQ  505
            RFQ FK N++Y++    G    ++  K+G+N+F DL NEEFK +         R    +Q
Sbjct  55   RFQIFKENVEYIESHNAGHTAKKY--KLGVNEFTDLTNEEFKSM---------RNGYKMQ  103

Query  506  MVSAVHSGREKKKKVSCEA-PFSVDWRKRGAVTRVKDQ  616
              +   S +   +  +  A P S+DWR +G VT +KDQ
Sbjct  104  RSTIASSSKTSFRYENVTAVPSSMDWRSKGVVTNIKDQ  141



>ref|XP_011088223.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Sesamum 
indicum]
Length=468

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 71/124 (57%), Gaps = 10/124 (8%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            E +V+ L+E W  ++GK Y    E E+RF+ FK NLK++ E     R      K+GLN+F
Sbjct  43   ENEVMALYESWLAKHGKAYNAIGEKEKRFEIFKDNLKFIDEHNSADRSY----KLGLNRF  98

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++ +F S      R  +  ++++   S R   K    E P SVDWRK+GAV  
Sbjct  99   ADLTNEEYRMLFVSG-----RVDRKTKLINRRASDRYAFKAGE-ELPQSVDWRKKGAVAP  152

Query  605  VKDQ  616
            VKDQ
Sbjct  153  VKDQ  156



>gb|AJA74414.1| cysteine protease [Cicer arietinum]
Length=495

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 69/124 (56%), Gaps = 9/124 (7%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            E++VL L+EEW  ++GKVY    E ++RF  FK NLK++ E  V     R    +GL +F
Sbjct  47   EKEVLTLYEEWLVKHGKVYNGLGEKDKRFDIFKDNLKFIDEHNVLNSTYR----LGLTRF  102

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++  F      P RK + +   S  ++ R   K      P SVDWRK GAV  
Sbjct  103  ADLTNEEYRAKFLGTRVDPNRKIRKVNSPSNRYAPRVGDK-----LPESVDWRKEGAVAA  157

Query  605  VKDQ  616
            VKDQ
Sbjct  158  VKDQ  161



>ref|XP_010274468.1| PREDICTED: xylem cysteine proteinase 2-like isoform X4 [Nelumbo 
nucifera]
Length=240

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 75/126 (60%), Gaps = 11/126 (9%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            V +E +  LF+ WK ++ KVY   EE E+RF+ F+ NL YV +     + S  +  +GLN
Sbjct  42   VSQEGLALLFKRWKAKHEKVYTSSEEKEKRFKIFQSNLAYVIDWNSKRKPS--DHTMGLN  99

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
            +F+D+  +EF +++ S ++      + I  V+A++     + K++C  P SVDWR+ G V
Sbjct  100  QFSDMSFDEFSEIYLSNME----PAESISEVTAIN-----RVKLTCSHPSSVDWRENGVV  150

Query  599  TRVKDQ  616
            T VK+Q
Sbjct  151  TPVKNQ  156



>ref|XP_010091715.1| hypothetical protein L484_001478 [Morus notabilis]
 gb|EXB44999.1| hypothetical protein L484_001478 [Morus notabilis]
Length=353

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/165 (33%), Positives = 77/165 (47%), Gaps = 33/165 (20%)
 Frame = +2

Query  146  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLR-LFEEWKERNGKVYRDEEEYE  322
            FL   +V  +W     C               PEE  LR   E+W  R+G+ Y+D  E E
Sbjct  11   FLALNLVLGLWASQAEC------------RKPPEEASLRESHEQWMARHGRTYKDNAEKE  58

Query  323  ERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGI  502
            +R + +K NL+YVK+    G  +    K+ LN+FADL NEEF           + +  G+
Sbjct  59   QRLKIYKENLEYVKKFNSEGNQTF---KLSLNRFADLTNEEFD----------YTRNGGL  105

Query  503  QMVSAVHSGREKKKKV-------SCEAPFSVDWRKRGAVTRVKDQ  616
             + S     R     +       S  AP S+DWR++GAVT V+DQ
Sbjct  106  MVSSLSRPSRVNNSSIYDQTLFSSGGAPSSIDWRQKGAVTNVRDQ  150



>ref|XP_002525124.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37251.1| cysteine protease, putative [Ricinus communis]
Length=342

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 74/134 (55%), Gaps = 29/134 (22%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            + E  ++   E+W  ++GKVY+D+EE   RFQ FK N+++++     G  S     +G+N
Sbjct  30   LHESTMVERHEKWMAKHGKVYKDDEEKLRRFQIFKNNVEFIESSNAAGNNSY---MLGIN  86

Query  419  KFADLRNEEFKDVF--------TSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSV  574
            +FADL NEEF+  +         S+I  PF+ +     V+A+              P+S+
Sbjct  87   RFADLTNEEFRASWNGYKRPLDASRIVTPFKYEN----VTAL--------------PYSM  128

Query  575  DWRKRGAVTRVKDQ  616
            DWR++GAVT +KDQ
Sbjct  129  DWRRKGAVTSIKDQ  142



>gb|KDP41692.1| hypothetical protein JCGZ_16099 [Jatropha curcas]
Length=466

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 67/124 (54%), Gaps = 11/124 (9%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +++V+ ++EEW E+NGK Y    E E RFQ FK NL+++ E     R      KV LN+F
Sbjct  44   DDEVMAIYEEWLEKNGKAYNALGEKERRFQIFKDNLRFIDEHNSENRAY----KVALNRF  99

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            AD+ NEE++ ++          + G++      S      +V    P SVDWRK GAV  
Sbjct  100  ADISNEEYRSLY-------LGAQAGVRRNKLRKSSDRYTPRVGESLPDSVDWRKEGAVAE  152

Query  605  VKDQ  616
            VKDQ
Sbjct  153  VKDQ  156



>ref|XP_010028191.1| PREDICTED: cysteine proteinase COT44-like [Eucalyptus grandis]
 gb|KCW54882.1| hypothetical protein EUGRSUZ_I00844 [Eucalyptus grandis]
Length=370

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 69/124 (56%), Gaps = 7/124 (6%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +E+V+ ++E W  ++GK Y    E E RF+ F+ NL++V E T   R       +G+N+F
Sbjct  31   DEEVMGMYELWLAKHGKAYNGLGERERRFEIFRDNLRFVDEHTALNRSY----ALGMNRF  86

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++ ++      P R+    +  S  ++ R     +    P +VDWR +GAV +
Sbjct  87   ADLTNEEYRAIYLGTRSDPMRRVAKARRASDRYASRPCDDSM---LPAAVDWRTKGAVNK  143

Query  605  VKDQ  616
            VKDQ
Sbjct  144  VKDQ  147



>sp|P25776.2|ORYA_ORYSJ RecName: Full=Oryzain alpha chain; Flags: Precursor [Oryza sativa 
Japonica Group]
 gb|ABB30151.1| oryzain alpha [Oryza sativa Japonica Group]
Length=458

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 66/124 (53%), Gaps = 9/124 (7%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            EE+  RL+ EWK  +GK Y    E E R+  F+ NL+Y+ E            ++GLN+F
Sbjct  33   EEEARRLYAEWKAEHGKSYNAVGEEERRYAAFRDNLRYIDEHNAAADAGVHSFRLGLNRF  92

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++D +      P R+++    VS  +   + +       P SVDWR +GAV  
Sbjct  93   ADLTNEEYRDTYLGLRNKPRRERK----VSDRYLAADNEA-----LPESVDWRTKGAVAE  143

Query  605  VKDQ  616
            +KDQ
Sbjct  144  IKDQ  147



>ref|XP_010274467.1| PREDICTED: P34 probable thiol protease-like isoform X3 [Nelumbo 
nucifera]
Length=281

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 75/126 (60%), Gaps = 11/126 (9%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            V +E +  LF+ WK ++ KVY   EE E+RF+ F+ NL YV +     + S  +  +GLN
Sbjct  42   VSQEGLALLFKRWKAKHEKVYTSSEEKEKRFKIFQSNLAYVIDWNSKRKPS--DHTMGLN  99

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
            +F+D+  +EF +++ S ++      + I  V+A++     + K++C  P SVDWR+ G V
Sbjct  100  QFSDMSFDEFSEIYLSNME----PAESISEVTAIN-----RVKLTCSHPSSVDWRENGVV  150

Query  599  TRVKDQ  616
            T VK+Q
Sbjct  151  TPVKNQ  156



>emb|CAE04498.2| OSJNBb0059K02.8 [Oryza sativa Japonica Group]
Length=458

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 66/124 (53%), Gaps = 9/124 (7%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            EE+  RL+ EWK  +GK Y    E E R+  F+ NL+Y+ E            ++GLN+F
Sbjct  33   EEEARRLYAEWKAEHGKSYNAVGEEERRYAAFRDNLRYIDEHNAAADAGVHSFRLGLNRF  92

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++D +      P R+++    VS  +   + +       P SVDWR +GAV  
Sbjct  93   ADLTNEEYRDTYLGLRNKPRRERK----VSDRYLAADNEA-----LPESVDWRTKGAVAE  143

Query  605  VKDQ  616
            +KDQ
Sbjct  144  IKDQ  147



>gb|EEE61807.1| hypothetical protein OsJ_16426 [Oryza sativa Japonica Group]
Length=459

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 66/124 (53%), Gaps = 9/124 (7%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            EE+  RL+ EWK  +GK Y    E E R+  F+ NL+Y+ E            ++GLN+F
Sbjct  34   EEEARRLYAEWKAEHGKSYNAVGEEERRYAAFRDNLRYIDEHNAAADAGVHSFRLGLNRF  93

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++D +      P R+++    VS  +   + +       P SVDWR +GAV  
Sbjct  94   ADLTNEEYRDTYLGLRNKPRRERK----VSDRYLAADNEA-----LPESVDWRTKGAVAE  144

Query  605  VKDQ  616
            +KDQ
Sbjct  145  IKDQ  148



>gb|EPS62067.1| cysteine proteinase, partial [Genlisea aurea]
Length=309

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 67/125 (54%), Gaps = 14/125 (11%)
 Frame = +2

Query  242  PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK  421
            PE++   +FE W  ++ K Y D ++   RF+ FK NLKYV+E+   G       K+GLN+
Sbjct  2    PEDETKSMFESWAAKHKKSYADSDQKARRFEIFKDNLKYVEERNAAGDRKY---KLGLNR  58

Query  422  FADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVT  601
            F+DL NEE++  F    + P R      +  A  +G           P +VDWR RGAVT
Sbjct  59   FSDLTNEEYRTGFLG--RKPNRSPGTKSVGFATGNG---------SVPAAVDWRTRGAVT  107

Query  602  RVKDQ  616
             VKDQ
Sbjct  108  PVKDQ  112



>ref|XP_010274464.1| PREDICTED: zingipain-2-like [Nelumbo nucifera]
Length=372

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 71/126 (56%), Gaps = 12/126 (10%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            V +E +  LFE W E++ KVY   EE E+RF+ F+ NL YV +     + S  + +VGLN
Sbjct  41   VSQEGLALLFERWIEKHEKVYTSSEEKEKRFKIFQSNLAYVIDWNSKRKPS--DHRVGLN  98

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
            +F+D+  +EF +++ SK+ +             +   R +   ++C  P SVDWR +G V
Sbjct  99   QFSDMSFDEFSEIYLSKLNLE----------EDILEARAETVNLTCSYPSSVDWRNKGVV  148

Query  599  TRVKDQ  616
            T +K+Q
Sbjct  149  TPIKNQ  154



>dbj|BAA14402.1| oryzain alpha precursor [Oryza sativa Japonica Group]
Length=458

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 66/124 (53%), Gaps = 9/124 (7%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            EE+  RL+ EWK  +GK Y    E E R+  F+ NL+Y+ E            ++GLN+F
Sbjct  33   EEEARRLYAEWKAEHGKSYNAVGEEERRYAAFRDNLRYIDEHNAAADAGVHSFRLGLNRF  92

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++D +      P R+++    VS  +   + +       P SVDWR +GAV  
Sbjct  93   ADLTNEEYRDTYLGLRNKPRRERK----VSDRYLAADNEA-----LPESVDWRTKGAVAE  143

Query  605  VKDQ  616
            +KDQ
Sbjct  144  IKDQ  147



>ref|XP_006849993.1| hypothetical protein AMTR_s00022p00166050 [Amborella trichopoda]
 gb|ERN11574.1| hypothetical protein AMTR_s00022p00166050 [Amborella trichopoda]
Length=350

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 73/124 (59%), Gaps = 14/124 (11%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +E ++ LF+ W  ++GKVYRD EE   RF+ FK N+K++ E     + S W   +GLN+F
Sbjct  40   DEGLISLFQSWASKHGKVYRDFEEKLRRFETFKDNIKHIDETNRKNK-SYW---LGLNEF  95

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            AD+ +EEFK+ +   +K  F ++ G         G   + +     P SVDWRK+GAVT 
Sbjct  96   ADMSHEEFKEKYLG-VKPIFPRRNG---------GENFRYRDVENIPKSVDWRKKGAVTA  145

Query  605  VKDQ  616
            VK+Q
Sbjct  146  VKNQ  149



>ref|NP_001147086.1| thiol protease SEN102 precursor [Zea mays]
 gb|ACG25394.1| thiol protease SEN102 precursor [Zea mays]
Length=356

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 67/123 (54%), Gaps = 5/123 (4%)
 Frame = +2

Query  254  VLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADL  433
            +L  F+ W+    + Y   EE+++RF  +  N++++K       GS +E  +G N+F DL
Sbjct  34   LLERFKAWQAEYNRTYATPEEFQQRFMIYSENVRFIKTMNQLSTGSSYE--LGENQFTDL  91

Query  434  RNEEFKDVFTSKI--KMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRV  607
              EEFKD +  K+  + P  +  G  + +   +G         EAP SVDWR +GAVTRV
Sbjct  92   TEEEFKDTYLMKLDEQPPAAEAMGPTVGTMSTAGMSNGNNTG-EAPNSVDWRTKGAVTRV  150

Query  608  KDQ  616
            KDQ
Sbjct  151  KDQ  153



>ref|XP_004291075.1| PREDICTED: cysteine proteinase RD21a [Fragaria vesca subsp. vesca]
Length=469

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 66/122 (54%), Gaps = 11/122 (9%)
 Frame = +2

Query  251  KVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFAD  430
            +V+ L+E W   +GK Y    E E+RFQ FK NLK++ E            K+GLN+FAD
Sbjct  48   EVMSLYERWLAEHGKAYNGLGEKEKRFQIFKDNLKFIDEHNA----LNLSYKLGLNRFAD  103

Query  431  LRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVK  610
            L N+E++  F         K + +  +S   S R    +V  + P SVDWRK GAVT VK
Sbjct  104  LSNDEYRSTFLGT------KPRAMNRLSKTKSDR-YAPRVGDQLPDSVDWRKEGAVTAVK  156

Query  611  DQ  616
            DQ
Sbjct  157  DQ  158



>ref|XP_010274466.1| PREDICTED: zingipain-2-like isoform X2 [Nelumbo nucifera]
Length=321

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 75/126 (60%), Gaps = 11/126 (9%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            V +E +  LF+ WK ++ KVY   EE E+RF+ F+ NL YV +     + S  +  +GLN
Sbjct  42   VSQEGLALLFKRWKAKHEKVYTSSEEKEKRFKIFQSNLAYVIDWNSKRKPS--DHTMGLN  99

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
            +F+D+  +EF +++ S ++      + I  V+A++     + K++C  P SVDWR+ G V
Sbjct  100  QFSDMSFDEFSEIYLSNME----PAESISEVTAIN-----RVKLTCSHPSSVDWRENGVV  150

Query  599  TRVKDQ  616
            T VK+Q
Sbjct  151  TPVKNQ  156



>ref|XP_004977049.1| PREDICTED: oryzain alpha chain-like [Setaria italica]
Length=463

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 67/124 (54%), Gaps = 9/124 (7%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            EE+  R++ EW   +G+ Y    E E R+Q FK NL+Y+              ++GLN+F
Sbjct  36   EEETRRMYAEWMATHGRTYNAIGEEERRYQVFKDNLRYIDAHNAAADAGVHSFRLGLNRF  95

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL  EE++D +   +  P R+++    +SA +   E +     E P SVDWR +GAV  
Sbjct  96   ADLTVEEYRDTYLGVMTKPQRERK----LSARYLTGENE-----ELPESVDWRAKGAVAE  146

Query  605  VKDQ  616
            VKDQ
Sbjct  147  VKDQ  150



>ref|XP_008796668.1| PREDICTED: oryzain alpha chain-like [Phoenix dactylifera]
Length=473

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 70/124 (56%), Gaps = 5/124 (4%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            EE+V RL++ WK R+ + Y   +E E RF+ F+ NL+++ +         +  ++GL +F
Sbjct  45   EEEVRRLYQAWKARHSRSYNALDEDERRFEIFRDNLRFIDQHNAAADAGEYSFRLGLTRF  104

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++  +        R+++     SA  S R + +  S E P S+DWR +GAV  
Sbjct  105  ADLTNEEYRSTYLGVRTAGSRRRRS----SAAGSHRYQFRS-SDELPDSIDWRDKGAVAE  159

Query  605  VKDQ  616
            VKDQ
Sbjct  160  VKDQ  163



>gb|EEC78138.1| hypothetical protein OsI_17694 [Oryza sativa Indica Group]
Length=458

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 66/124 (53%), Gaps = 9/124 (7%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            EE+  RL+ EWK  +GK Y    E E R+  F+ NL+Y+ E            ++GLN+F
Sbjct  33   EEEARRLYAEWKAEHGKNYNAVGEEERRYAAFRDNLRYIDEHNAAADAGVHSFRLGLNRF  92

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++D +      P R+++    VS  +   + +       P SVDWR +GAV  
Sbjct  93   ADLTNEEYRDTYLGLRNKPRRERK----VSDRYLAADNEA-----LPESVDWRTKGAVAE  143

Query  605  VKDQ  616
            +KDQ
Sbjct  144  IKDQ  147



>ref|XP_008779585.1| PREDICTED: zingipain-2-like [Phoenix dactylifera]
Length=326

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 75/152 (49%), Gaps = 26/152 (17%)
 Frame = +2

Query  161  IVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNF  340
            +V  VW  G + +             + +E + R  E+W  + G+VY D  E E RFQ F
Sbjct  1    MVLGVWVSGATAH------------GIADEPMSRRHEQWMVQYGRVYMDAAEKERRFQIF  48

Query  341  KGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAV  520
            + N +Y+  ++V   G R + K+GLN+FAD+ N EFK        MP   K G    + +
Sbjct  49   RDNYEYI--ESVNRAGDR-KYKLGLNQFADMTNGEFKASHLGFKPMPMESKTGSFQYANL  105

Query  521  HSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
                        +AP S+DWR RGAVT VK+Q
Sbjct  106  -----------TDAPHSMDWRTRGAVTAVKNQ  126



>gb|EAY97106.1| hypothetical protein OsI_19029 [Oryza sativa Indica Group]
Length=350

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 68/117 (58%), Gaps = 10/117 (9%)
 Frame = +2

Query  269  EEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEF  448
            E W  ++G+VY+D  E   R + FK N+ +++    GG+   W   +G+N+FADL +EEF
Sbjct  45   ERWMAQHGRVYKDAAEKARRLEVFKANVAFIESFNAGGKNRYW---LGVNQFADLTSEEF  101

Query  449  KDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEA-PFSVDWRKRGAVTRVKDQ  616
            K   T+  K       G+++ +       K + VS +A P SVDWR +GAVTR+KDQ
Sbjct  102  KATMTNS-KGFSTPNNGVRVSTGF-----KYENVSADALPASVDWRTKGAVTRIKDQ  152



>gb|ABA97421.1| Vignain precursor, putative [Oryza sativa Japonica Group]
 gb|EEE62878.1| hypothetical protein OsJ_17681 [Oryza sativa Japonica Group]
Length=350

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 68/117 (58%), Gaps = 10/117 (9%)
 Frame = +2

Query  269  EEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEF  448
            E W  ++G+VY+D  E   R + FK N+ +++    GG+   W   +G+N+FADL +EEF
Sbjct  45   ERWMAQHGRVYKDAAEKARRLEVFKANVAFIESFNAGGKNRYW---LGVNQFADLTSEEF  101

Query  449  KDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEA-PFSVDWRKRGAVTRVKDQ  616
            K   T+  K       G+++ +       K + VS +A P SVDWR +GAVTR+KDQ
Sbjct  102  KATMTNS-KGFSTPNNGVRVSTGF-----KYENVSADALPASVDWRTKGAVTRIKDQ  152



>emb|CAJ86180.1| H0212B02.7 [Oryza sativa Indica Group]
Length=470

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 66/124 (53%), Gaps = 9/124 (7%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            EE+  RL+ EWK  +GK Y    E E R+  F+ NL+Y+ E            ++GLN+F
Sbjct  33   EEEARRLYAEWKAEHGKNYNAVGEEERRYAAFRDNLRYIDEHNAAADAGVHSFRLGLNRF  92

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++D +      P R+++    VS  +   + +       P SVDWR +GAV  
Sbjct  93   ADLTNEEYRDTYLGLRNKPRRERK----VSDRYLAADNEA-----LPESVDWRTKGAVAE  143

Query  605  VKDQ  616
            +KDQ
Sbjct  144  IKDQ  147



>gb|AFW85695.1| thiol protease SEN102 [Zea mays]
Length=382

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 66/122 (54%), Gaps = 3/122 (2%)
 Frame = +2

Query  254  VLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADL  433
            +L  F+ W+    + Y   EE+++RF  +  N++++K       GS +E  +G N+F DL
Sbjct  60   LLERFKAWQAEYNRTYATPEEFQQRFMIYSENVRFIKTMNQLSTGSSYE--LGENQFTDL  117

Query  434  RNEEFKDVFTSKI-KMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVK  610
              EEFKD +  K+ + P   +     V  + +        + EAP SVDWR +GAVTRVK
Sbjct  118  TEEEFKDTYLMKLDEQPPAAEAMPPTVGTMSTAGMSNGNNTGEAPNSVDWRTKGAVTRVK  177

Query  611  DQ  616
            DQ
Sbjct  178  DQ  179



>ref|XP_010274465.1| PREDICTED: zingipain-2-like isoform X1 [Nelumbo nucifera]
Length=364

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 75/126 (60%), Gaps = 11/126 (9%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            V +E +  LF+ WK ++ KVY   EE E+RF+ F+ NL YV +     + S  +  +GLN
Sbjct  42   VSQEGLALLFKRWKAKHEKVYTSSEEKEKRFKIFQSNLAYVIDWNSKRKPS--DHTMGLN  99

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
            +F+D+  +EF +++ S ++      + I  V+A++     + K++C  P SVDWR+ G V
Sbjct  100  QFSDMSFDEFSEIYLSNME----PAESISEVTAIN-----RVKLTCSHPSSVDWRENGVV  150

Query  599  TRVKDQ  616
            T VK+Q
Sbjct  151  TPVKNQ  156



>ref|XP_003593772.1| Cysteine proteinase [Medicago truncatula]
Length=339

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 67/124 (54%), Gaps = 10/124 (8%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            ++K + +F+ W + +G+VY+D +E  ++F  F  NLKY+ E T   R S     +GL  F
Sbjct  11   QDKTIEIFQLWMKEHGRVYKDLDEMAKKFDIFISNLKYITE-TNAKRKSSNGFLLGLTNF  69

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
             D  +EEF++ +   I MP         V+ VH         SC AP S+DWR +G V+ 
Sbjct  70   TDWSSEEFQERYLHNIDMP--TDIDTMKVNDVHLS-------SCSAPSSLDWRSKGVVSD  120

Query  605  VKDQ  616
            +KDQ
Sbjct  121  IKDQ  124



>dbj|BAH11164.1| cysteine protease [Hordeum vulgare]
Length=462

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 66/124 (53%), Gaps = 9/124 (7%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            EE+V R++ EW   +   Y    E E RF+ F+ NL+Y+ +            ++GLN+F
Sbjct  35   EEEVRRMYAEWMAEHHSTYNPIGEEERRFEAFRNNLRYIDQHNAAADAGVHSFRLGLNRF  94

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++  +      P R+++    +SA +   +       E P SVDWRK+GAV  
Sbjct  95   ADLTNEEYRSTYLGARTKPDRERK----LSARYQAADND-----ELPESVDWRKKGAVGA  145

Query  605  VKDQ  616
            VKDQ
Sbjct  146  VKDQ  149



>ref|XP_011074404.1| PREDICTED: low-temperature-induced cysteine proteinase [Sesamum 
indicum]
Length=469

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 71/125 (57%), Gaps = 12/125 (10%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEK-TVGGRGSRWEGKVGLNK  421
             ++V+ ++E W  ++GK Y    E E RF+ FK NL+Y+ E+  +GGR      K+GLN+
Sbjct  46   HDEVMSMYESWLMKHGKSYNALGEKERRFEIFKDNLRYIDEQNALGGRTY----KLGLNR  101

Query  422  FADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVT  601
            FADL NEE++  F         +  G + +++  S R    KV    P S+DWR +GAV 
Sbjct  102  FADLTNEEYRKTFLGA------RPDGKRRLTSTKSDR-YAPKVGESLPDSIDWRAKGAVA  154

Query  602  RVKDQ  616
             VKDQ
Sbjct  155  PVKDQ  159



>ref|XP_009384829.1| PREDICTED: xylem cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=349

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 53/156 (34%), Positives = 78/156 (50%), Gaps = 21/156 (13%)
 Frame = +2

Query  152  VFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEERF  331
            +FL+      GG S       +  +       +K++ LF+ W  R+ K Y + EE   RF
Sbjct  15   MFLVTCTALPGGFSI------VGYSEEDLTSHDKLIELFDSWMSRHSKSYANFEEKLRRF  68

Query  332  QNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTS-KIKMPFRKKQGIQM  508
            + FK NLK++ E     R S W   +GLN FAD+ ++EFK  +      MP R+      
Sbjct  69   EVFKDNLKHIDETNRQKR-SYW---LGLNAFADMTHDEFKATYLGVSTSMPRRRD-----  119

Query  509  VSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
                 SG   + + + + P SVDWRK+GAVT VK+Q
Sbjct  120  -----SGSSFRYENAVDLPKSVDWRKKGAVTHVKNQ  150



>ref|XP_010248205.1| PREDICTED: zingipain-2-like [Nelumbo nucifera]
Length=353

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 71/126 (56%), Gaps = 11/126 (9%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            V +E +  LFE W E++GK Y   EE + RF+ F+  L Y+ +     RG   +  +GL 
Sbjct  40   VSDEGIALLFERWMEKHGKAYASLEEKDRRFKIFQSKLAYIIDWN-SKRGPS-DHILGLT  97

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
            +F+D+  EEF +++ SK+          Q++S    G EK+ K SC  P + DWR +GAV
Sbjct  98   QFSDMSFEEFSEIYLSKMNT-------TQLMSV--EGIEKRVKGSCTPPSTFDWRTQGAV  148

Query  599  TRVKDQ  616
            T VK+Q
Sbjct  149  TGVKNQ  154



>ref|XP_010028205.1| PREDICTED: cysteine proteinase COT44-like [Eucalyptus grandis]
 gb|KCW54899.1| hypothetical protein EUGRSUZ_I00879 [Eucalyptus grandis]
Length=364

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 66/124 (53%), Gaps = 9/124 (7%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +E+V+ ++E W  ++GK Y    E E RF+ F+ NL++V E     R       +G+N+F
Sbjct  27   DEEVMGMYELWLAKHGKAYNGLGERERRFEIFRDNLRFVDEHNALNRSY----TLGMNRF  82

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++ V+      P R+       S  ++ R          P +VDWR RGAV +
Sbjct  83   ADLTNEEYRAVYLGTRSDPVRRVAKAARASGRYAPRPDDM-----LPAAVDWRTRGAVNK  137

Query  605  VKDQ  616
            VKDQ
Sbjct  138  VKDQ  141



>ref|XP_009398671.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=473

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 67/124 (54%), Gaps = 6/124 (5%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            E+++ R++E W  R+G+ Y    E E RF+ FK NL +V          R   ++GLN+F
Sbjct  45   EDEMRRIYEGWLARHGRAYNALGEKEARFEVFKDNLHFVDGHNAAADAGRQRFRLGLNRF  104

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEEF+ ++         K +G+   S V + R + +      P SVDWR +GAV  
Sbjct  105  ADLTNEEFRALYLGA------KGRGVARRSRVAADRYRYEGAGDVLPDSVDWRAKGAVAA  158

Query  605  VKDQ  616
            VK+Q
Sbjct  159  VKNQ  162



>ref|XP_010446933.1| PREDICTED: xylem cysteine proteinase 1 [Camelina sativa]
Length=350

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 83/165 (50%), Gaps = 16/165 (10%)
 Frame = +2

Query  125  CSLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYR  304
             SL     LV +  +A+ C  ++   D   +          EK+L LFE W   + K Y+
Sbjct  2    ASLTKFSLLVAISASALLCSALA--RDFSIVGYTPEHLTSTEKLLELFESWMSEHSKAYK  59

Query  305  DEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPF  484
              EE   RF+ F+ NL ++ ++      S W   +GLN+FADL +EEFK  +    K  F
Sbjct  60   SVEEKVHRFEVFRENLMHIDQRN-NEINSYW---LGLNEFADLSHEEFKGKYLGLAKPQF  115

Query  485  -RKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
             RK+Q         S   + + ++ + P SVDWRK+GAVT VKDQ
Sbjct  116  SRKRQ--------PSANFRYRDIT-DLPKSVDWRKKGAVTPVKDQ  151



>gb|KEH36581.1| papain family cysteine protease [Medicago truncatula]
Length=361

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 80/168 (48%), Gaps = 14/168 (8%)
 Frame = +2

Query  128  SLQGCGFLVFLIVAAVWCGGVSCY---YDgfaiagagggfVP-EEKVLRLFEEWKERNGK  295
            SL    FL+ +I     C   S Y       +I G     +P + K + LF+ W + +G+
Sbjct  2    SLTSNPFLLIIIFTIFLCLSSSTYGIPTKYSSILGPKLDKLPTQNKTIELFQIWMKDHGR  61

Query  296  VYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEG-KVGLNKFADLRNEEFKDVFTSKI  472
            VY+D EE  ++F  F  NLKY+ E   G R S   G  +GL  FAD   +EFK+    K+
Sbjct  62   VYKDLEEKAKKFDIFVSNLKYITESN-GNRKSSPHGFLLGLTNFADWSPQEFKERMLHKL  120

Query  473  KMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
             M         M++      +        AP S+DWR +GAVT VKDQ
Sbjct  121  DM--------SMINDTMKLNDIASSSCNAAPSSLDWRLKGAVTNVKDQ  160



>ref|XP_010437483.1| PREDICTED: xylem cysteine proteinase 1-like isoform X1 [Camelina 
sativa]
 ref|XP_010437484.1| PREDICTED: xylem cysteine proteinase 1-like isoform X2 [Camelina 
sativa]
Length=350

 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 79/164 (48%), Gaps = 14/164 (9%)
 Frame = +2

Query  125  CSLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYR  304
             SL     LV +  +A+ C  ++   D   +          EK+L LFE W   + K Y+
Sbjct  2    ASLTKFSLLVAISASALLCSALA--RDFSIVGYTPEHLTSTEKLLELFESWMSEHSKAYK  59

Query  305  DEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPF  484
              EE   RF+ F+ NL ++ ++      S W   +GLN+FADL +EEFK  +    K  F
Sbjct  60   SVEEKVHRFEVFRENLMHIDQRN-NEINSYW---LGLNEFADLSHEEFKGRYLGLAKPQF  115

Query  485  RKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
             +K+              + +   + P SVDWRK+GAVT VKDQ
Sbjct  116  SRKR--------QPSTNFRYRDITDLPKSVDWRKKGAVTPVKDQ  151



>ref|XP_004171356.1| PREDICTED: cysteine proteinase RD21a-like, partial [Cucumis sativus]
Length=168

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 70/125 (56%), Gaps = 11/125 (9%)
 Frame = +2

Query  242  PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK  421
            P+E+V  L+E W   +GK Y    E E RF+ FK NL+++ E     R SR   KVGL +
Sbjct  54   PDEEVAALYESWLVHHGKAYNAIGEKERRFEIFKDNLRFIDEHN---RESRTY-KVGLTR  109

Query  422  FADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVT  601
            FADL NEE++  F   +   F +K     +SA  SGR     +  + P  VDWRK+GAV 
Sbjct  110  FADLTNEEYRARF---LGGRFSRK---PRLSAAKSGR-YAAALGDDLPDDVDWRKKGAVA  162

Query  602  RVKDQ  616
             VKDQ
Sbjct  163  TVKDQ  167



>ref|XP_008453002.1| PREDICTED: xylem cysteine proteinase 2 [Cucumis melo]
Length=347

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 70/123 (57%), Gaps = 14/123 (11%)
 Frame = +2

Query  248  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA  427
            +K++ LFEEW   +GK+Y   EE   RF+ FK NLK++ E T     S W   +GLN+FA
Sbjct  39   DKLIELFEEWISNHGKIYETIEEKWHRFEVFKDNLKHIDE-TNKKVSSYW---LGLNEFA  94

Query  428  DLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRV  607
            DL ++EFK+++        R +Q            E+      + P SVDWRK+GAVTRV
Sbjct  95   DLTHQEFKNMYLGLKVESSRTRQ----------SPEEFTYKDVDLPKSVDWRKKGAVTRV  144

Query  608  KDQ  616
            K+Q
Sbjct  145  KNQ  147



>ref|XP_010928804.1| PREDICTED: xylem cysteine proteinase 1-like [Elaeis guineensis]
Length=347

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 71/125 (57%), Gaps = 15/125 (12%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
             ++++ LFE W  ++ KVY+  EE   RF+ FK NLK++ E T   + S W   +GLN+F
Sbjct  38   HDRLIELFESWMSKHSKVYKSFEEKLRRFEVFKDNLKHIDE-TNKKKSSYW---LGLNEF  93

Query  425  ADLRNEEFKDVFTS-KIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVT  601
            ADL +EEFK  +   +  +P R+                + + S + P SVDWRK+GAVT
Sbjct  94   ADLSHEEFKATYLGLRTALPERRDASSNF----------RYEDSTDLPKSVDWRKKGAVT  143

Query  602  RVKDQ  616
             VK+Q
Sbjct  144  HVKNQ  148



>ref|XP_004168497.1| PREDICTED: xylem cysteine proteinase 1-like [Cucumis sativus]
 gb|KGN55535.1| hypothetical protein Csa_4G664420 [Cucumis sativus]
Length=348

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 71/123 (58%), Gaps = 13/123 (11%)
 Frame = +2

Query  248  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA  427
            ++++ LFEEW   +GK+Y   EE   RF+ FK NLK++ E T     S W   +G+N+FA
Sbjct  39   DRLIELFEEWISNHGKIYETIEEKWHRFEVFKDNLKHIDE-TNKKVTSYW---LGVNEFA  94

Query  428  DLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRV  607
            DL ++EFK+++        R +Q         S  E   K   + P SVDWRK+GAVTRV
Sbjct  95   DLTHQEFKNMYLGLKVESSRTRQ---------SPEEFTYKDVVDLPKSVDWRKKGAVTRV  145

Query  608  KDQ  616
            K+Q
Sbjct  146  KNQ  148



>dbj|BAD29958.1| cysteine protease [Daucus carota]
Length=496

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 73/126 (58%), Gaps = 14/126 (11%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKT-VGGRGSRWEGKVGLNK  421
            +++   LFE W   +GK Y    E E+RFQ FK NL+Y+ E+  V  RG     K+GLNK
Sbjct  38   DDEATTLFESWLVTHGKSYNALGEEEKRFQIFKNNLRYIDEQNLVEDRGF----KLGLNK  93

Query  422  FADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEA-PFSVDWRKRGAV  598
            FADL NEE++  +T       RKK     VSA  SGR     +S E+ P SVDWR+ GAV
Sbjct  94   FADLTNEEYRSKYTGIKSKDLRKK-----VSA-KSGR--YATLSGESLPESVDWRESGAV  145

Query  599  TRVKDQ  616
              VKDQ
Sbjct  146  ATVKDQ  151



>ref|XP_002519955.1| cysteine protease, putative [Ricinus communis]
 gb|EEF42559.1| cysteine protease, putative [Ricinus communis]
Length=321

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 65/126 (52%), Gaps = 28/126 (22%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            + E+ ++   E+W  R+G+ Y+D EE E RFQ FK NL+Y+       + S    ++GLN
Sbjct  30   INEDALVEKHEQWMARHGRTYQDSEEKERRFQIFKSNLEYIDNFN---KASNQTYQLGLN  86

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
             FADL +EE+   +T++ KMP                         E P S+DWR  GAV
Sbjct  87   NFADLSHEEYVATYTAR-KMPV------------------------EVPESIDWRDHGAV  121

Query  599  TRVKDQ  616
            T +K+Q
Sbjct  122  TPIKNQ  127



>ref|XP_004145553.1| PREDICTED: xylem cysteine proteinase 1-like [Cucumis sativus]
Length=351

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 71/123 (58%), Gaps = 13/123 (11%)
 Frame = +2

Query  248  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA  427
            ++++ LFEEW   +GK+Y   EE   RF+ FK NLK++ E T     S W   +G+N+FA
Sbjct  42   DRLIELFEEWISNHGKIYETIEEKWHRFEVFKDNLKHIDE-TNKKVTSYW---LGVNEFA  97

Query  428  DLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRV  607
            DL ++EFK+++        R +Q         S  E   K   + P SVDWRK+GAVTRV
Sbjct  98   DLTHQEFKNMYLGLKVESSRTRQ---------SPEEFTYKDVVDLPKSVDWRKKGAVTRV  148

Query  608  KDQ  616
            K+Q
Sbjct  149  KNQ  151



>dbj|BAC75927.1| cysteine protease-5 [Helianthus annuus]
Length=365

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 72/126 (57%), Gaps = 10/126 (8%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +E+V   +E W  R+GK Y    E E RF+ F  NLK++ E  + G  S    KVGLN+F
Sbjct  29   DEEVRNTYELWLARHGKTYNALGEKESRFRIFADNLKFIDEHNLSGNRSY---KVGLNQF  85

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQM--VSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
            ADL NEE++ ++      P+R+   +Q   +S  ++ +E +       P  VDWR+RGAV
Sbjct  86   ADLTNEEYRSMYLGTKVDPYRRIAKMQRGEISRRYAVQENEM-----FPAKVDWRERGAV  140

Query  599  TRVKDQ  616
            + VK+Q
Sbjct  141  SPVKNQ  146



>dbj|BAA25899.1| Bd 30K [Glycine max]
 gb|ABC56139.1| 34 kDa maturing seed protein [Glycine max]
 gb|ACG59282.1| major allergen Gly m Bd 30K [Glycine max]
 gb|ACM89583.1| maturing seed protein [Glycine max]
 gb|ACO55749.1| Gly m Bd 30K allergen [Glycine max]
 gb|ADW08728.1| P34 allergen [Glycine max]
 gb|ADW08729.1| P34 allergen [Glycine max]
 gb|ADW08730.1| P34 allergen [Glycine max]
 gb|ADW08731.1| P34 allergen [Glycine max]
 gb|KHN47996.1| P34 putative thiol protease [Glycine soja]
Length=379

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 74/127 (58%), Gaps = 9/127 (7%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
              +++V  LF+ WK  +G+VY + EE  +R + FK NL Y+++     R S    ++GLN
Sbjct  35   TTQKQVSSLFQLWKSEHGRVYHNHEEEAKRLEIFKNNLNYIRDMNA-NRKSPHSHRLGLN  93

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCE-APFSVDWRKRGA  595
            KFAD+  +EF   +   ++ P    Q I+M +     + KK++ SC+  P S DWRK+G 
Sbjct  94   KFADITPQEFSKKY---LQAPKDVSQQIKMANK----KMKKEQYSCDHPPASWDWRKKGV  146

Query  596  VTRVKDQ  616
            +T+VK Q
Sbjct  147  ITQVKYQ  153



>ref|XP_002869093.1| hypothetical protein ARALYDRAFT_491113 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45352.1| hypothetical protein ARALYDRAFT_491113 [Arabidopsis lyrata subsp. 
lyrata]
Length=355

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 83/164 (51%), Gaps = 16/164 (10%)
 Frame = +2

Query  128  SLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRD  307
            SL     LV +  +A+ C  ++   D   +          EK+L LFE W   + KVY+ 
Sbjct  7    SLTKFSLLVAISASALLCSALA--RDFSIVGYTPEQLTSTEKLLELFESWMSEHSKVYKS  64

Query  308  EEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPF-  484
             EE   RF+ F+ NL ++ ++      S W   +GLN+FADL +EEFK  +    K  F 
Sbjct  65   VEEKVHRFEVFRENLMHIDQRN-NEINSYW---LGLNEFADLTHEEFKGRYLGLAKPQFS  120

Query  485  RKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
            RK+Q         S   + + ++ + P SVDWRK+GAV  VKDQ
Sbjct  121  RKRQ--------PSANFRYRDIT-DLPKSVDWRKKGAVAPVKDQ  155



>ref|XP_002965654.1| hypothetical protein SELMODRAFT_230713 [Selaginella moellendorffii]
 gb|EFJ33074.1| hypothetical protein SELMODRAFT_230713 [Selaginella moellendorffii]
Length=345

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 67/125 (54%), Gaps = 19/125 (15%)
 Frame = +2

Query  248  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA  427
            + + +++++W + +GK Y    EY++RFQ FK N+ Y+         S     +GLNKFA
Sbjct  32   DPLWQVYQKWIQEHGKAYNSAHEYKKRFQIFKENVNYINSHNARRNNSH---SLGLNKFA  88

Query  428  DLRNEEFKDVFTSKIK--MPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVT  601
            DL N EF+ ++  +++   PF +   I +V+              +   SVDWRK+G VT
Sbjct  89   DLTNSEFRGLYVGRLQRPAPFHEVGDIALVA--------------DTATSVDWRKKGGVT  134

Query  602  RVKDQ  616
             +KDQ
Sbjct  135  EIKDQ  139



>ref|XP_006284015.1| hypothetical protein CARUB_v10005136mg [Capsella rubella]
 gb|EOA16913.1| hypothetical protein CARUB_v10005136mg [Capsella rubella]
Length=354

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 82/164 (50%), Gaps = 16/164 (10%)
 Frame = +2

Query  128  SLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRD  307
            SL     LV +  +A+ C  ++   D   +          E +L LFE W   + K Y+ 
Sbjct  7    SLTKFSLLVAISASALLCSALA--RDFSIVGYTPEHLTSTENLLELFEAWMSEHSKAYKS  64

Query  308  EEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPF-  484
             EE   RF+ F+ NL ++ ++      S W   +GLN+FADL +EEFK  +    K  F 
Sbjct  65   VEEKVHRFEVFRENLMHIDQRN-NEISSYW---LGLNEFADLSHEEFKGKYLGLAKPQFS  120

Query  485  RKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
            RK+Q         S   + + +S + P SVDWRK+GAVT VKDQ
Sbjct  121  RKRQ--------PSANFRYRDIS-DLPKSVDWRKKGAVTPVKDQ  155



>dbj|BAF02546.1| triticain alpha [Triticum aestivum]
 gb|AFK80346.1| cysteine endopeptidase EP alpha [Secale cereale x Triticum turgidum 
subsp. durum]
Length=461

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 68/124 (55%), Gaps = 9/124 (7%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            EE+V R++ EW   + + Y    E E RF+ F+ NL+Y+ +            ++GLN+F
Sbjct  34   EEEVRRMYAEWMSEHRRTYNAIGEEERRFEVFRDNLRYIDQHNAAADAGLHSFRLGLNRF  93

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++  +      P R+++    +SA +   + +     E P +VDWRK+GAV  
Sbjct  94   ADLTNEEYRSTYLGARTKPDRERK----LSARYQADDNE-----ELPETVDWRKKGAVAA  144

Query  605  VKDQ  616
            +KDQ
Sbjct  145  IKDQ  148



>gb|EMS56635.1| Oryzain alpha chain [Triticum urartu]
Length=483

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 68/124 (55%), Gaps = 9/124 (7%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            EE+V R++ EW   + + Y    E E RF+ F+ NL+Y+ +            ++GLN+F
Sbjct  34   EEEVRRMYAEWMSEHRRTYNAIGEEERRFEVFRDNLRYIDQHNAAADAGLHSFRLGLNRF  93

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++  +      P R+++    +SA +   + +     E P +VDWRK+GAV  
Sbjct  94   ADLTNEEYRSTYLGARTKPDRERK----LSARYQADDNE-----ELPETVDWRKKGAVAA  144

Query  605  VKDQ  616
            +KDQ
Sbjct  145  IKDQ  148



>gb|KDO85216.1| hypothetical protein CISIN_1g0186492mg, partial [Citrus sinensis]
Length=281

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 72/124 (58%), Gaps = 14/124 (11%)
 Frame = +2

Query  248  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA  427
            +K++ LFE W  +  KVY   +E  ERF+ FK NL+++ E     + + W   +GLN+FA
Sbjct  42   DKLIDLFESWMSKFEKVYESLDEKLERFEIFKDNLRHIDETNRKIK-NYW---LGLNEFA  97

Query  428  DLRNEEFKDVFTS-KIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            DLR+EEFK++F   K  +  RK Q         S  +   K   + P SVDWRK+GAVT 
Sbjct  98   DLRHEEFKEMFLGLKPDLARRKDQ---------SHEDFSYKDVVDLPKSVDWRKKGAVTH  148

Query  605  VKDQ  616
            VK+Q
Sbjct  149  VKNQ  152



>emb|CAA53377.1| cysteine protease [Vicia sativa]
Length=368

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 68/126 (54%), Gaps = 15/126 (12%)
 Frame = +2

Query  248  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA  427
            ++V+ ++EEW  ++ KVY    E ++RFQ FK NL ++ E         +   VGLNKFA
Sbjct  33   DEVMTMYEEWLVKHQKVYNGLREKDQRFQIFKDNLNFIDEH----NAQNYTYIVGLNKFA  88

Query  428  DLRNEEFKDVFT---SKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
            D+ NEE++D++    S IK    K +      A +SG           P  VDWR +GA+
Sbjct  89   DMTNEEYRDMYLGTRSDIKRRIMKNKITGHRYAYNSGD--------RLPVHVDWRLKGAI  140

Query  599  TRVKDQ  616
            T +KDQ
Sbjct  141  THIKDQ  146



>emb|CDP01294.1| unnamed protein product [Coffea canephora]
Length=465

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 71/124 (57%), Gaps = 10/124 (8%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +E+V+ L+EEW  ++GK Y    E ++RF+ FK NL+Y+ E+      SR   ++GLN+F
Sbjct  40   DEEVMALYEEWLVKHGKSYNGLGEKDKRFEIFKDNLRYIDEQN--SLPSRTY-QLGLNRF  96

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++  +      P R+        A  S    + KV    P S+DWR++GAV  
Sbjct  97   ADLSNEEYRSTYLGTRPDPKRRL-------AKTSSDRYRPKVGDSLPNSIDWREKGAVLP  149

Query  605  VKDQ  616
            VKDQ
Sbjct  150  VKDQ  153



>gb|EMT10408.1| Oryzain alpha chain [Aegilops tauschii]
Length=463

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 68/124 (55%), Gaps = 9/124 (7%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            EE+V R++ EW   + + Y    E E RF+ F+ NL+Y+ +            ++GLN+F
Sbjct  36   EEEVRRMYAEWMSEHRRTYNAIGEEERRFEVFRDNLRYIDQHNAAADAGLHSFRLGLNRF  95

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++  +      P R+++    +SA +   + +     E P +VDWRK+GAV  
Sbjct  96   ADLTNEEYRSTYLGARTKPDRERK----LSARYQADDNE-----ELPETVDWRKKGAVAA  146

Query  605  VKDQ  616
            +KDQ
Sbjct  147  IKDQ  150



>ref|NP_001047923.1| Os02g0715000 [Oryza sativa Japonica Group]
 dbj|BAD09165.1| putative cysteine proteinase [Oryza sativa Japonica Group]
 dbj|BAF09837.1| Os02g0715000 [Oryza sativa Japonica Group]
 dbj|BAG96580.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87483.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57683.1| hypothetical protein OsJ_08138 [Oryza sativa Japonica Group]
Length=366

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 81/157 (52%), Gaps = 12/157 (8%)
 Frame = +2

Query  149  LVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEER  328
            ++FL++  V C   + ++D   +  +        K++ LF  W  ++ K+Y   +E  +R
Sbjct  16   MLFLLLGFVACSATASHHDPSVVGYSQEDLALPNKLVGLFTSWSVKHSKIYASPKEKVKR  75

Query  329  FQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTS-KIKMPFRKKQGIQ  505
            ++ FK NL+++ E T    GS W   +GLN FAD+ +EEFK  +   K  +  R  Q   
Sbjct  76   YEIFKRNLRHIVE-TNRRNGSYW---LGLNHFADIAHEEFKASYLGLKPGLARRDAQ---  128

Query  506  MVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
                 H     +   +   P++VDWRK+GAVT VK+Q
Sbjct  129  ----PHGSTTFRYANAVNLPWAVDWRKKGAVTPVKNQ  161



>ref|XP_008782844.1| PREDICTED: xylem cysteine proteinase 1-like [Phoenix dactylifera]
Length=347

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 70/125 (56%), Gaps = 15/125 (12%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
             +K++ LFE W  ++ KVY+  EE   RF+ FK NLK++ E T   R S W   +GLN+F
Sbjct  39   HDKLIELFESWMSKHSKVYKSFEEKLRRFEVFKDNLKHIDE-TNKKRSSYW---LGLNEF  94

Query  425  ADLRNEEFKDVFTS-KIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVT  601
            ADL + EFK  +      +P ++  G             + + S + P SVDWRK+GAVT
Sbjct  95   ADLSHGEFKATYLGLTTDLPEKRDAGSNF----------RYEDSTDLPKSVDWRKKGAVT  144

Query  602  RVKDQ  616
             VK+Q
Sbjct  145  PVKNQ  149



>emb|CAQ00115.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=190

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 68/124 (55%), Gaps = 8/124 (6%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +++V+ L++ W  ++GK Y    E E+RF+ FK NL +V E       +    K+GLNKF
Sbjct  42   DDEVMGLYKSWVIQHGKAYNGIGEEEKRFEIFKDNLMFVDEHNSNNNTTY---KLGLNKF  98

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL N+E++  F      P R+     M S + S R   +      P SV+WR  GAV+R
Sbjct  99   ADLTNQEYRAKFLGTRTDPRRR----LMKSKIPSSRNAHRAAD-NLPDSVNWRDHGAVSR  153

Query  605  VKDQ  616
            VKDQ
Sbjct  154  VKDQ  157



>dbj|BAD16614.1| cysteine proteinase [Dianthus caryophyllus]
Length=459

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 71/129 (55%), Gaps = 17/129 (13%)
 Frame = +2

Query  242  PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK  421
            P++++  L+E W  ++GK Y    E + RF  FK NL++V E+           K+GLN+
Sbjct  35   PDDEIASLYETWLVKHGKNYNGLGEKQLRFNIFKDNLRFVDER----NSENLSFKLGLNR  90

Query  422  FADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEA----PFSVDWRKR  589
            FADL NEE++ V+     +  R +     V+   SGR K  + +  A    P SVDWRK+
Sbjct  91   FADLTNEEYRSVY-----LGTRPRS----VAVARSGRSKSDRYAFRAGDTLPESVDWRKK  141

Query  590  GAVTRVKDQ  616
            GAV  +KDQ
Sbjct  142  GAVAGIKDQ  150



>ref|XP_006647791.1| PREDICTED: xylem cysteine proteinase 1-like [Oryza brachyantha]
Length=369

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 84/156 (54%), Gaps = 8/156 (5%)
 Frame = +2

Query  149  LVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEER  328
            ++FL +  V C   + ++D   +  +        K++ LF  W  ++ K+Y   +E  +R
Sbjct  17   MLFLFLCFVACVATASHHDPSVVGYSQEDLALPNKLVDLFTSWSVKHRKIYGSPKEKVKR  76

Query  329  FQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGIQM  508
            ++ FK NLK++ E T    GS W   +GLN+FAD+ +EEFK  +   +K    ++     
Sbjct  77   YEIFKQNLKHIVE-TNRRNGSYW---LGLNQFADIAHEEFKSSYLG-LKSRLARRDAQPH  131

Query  509  VSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
             SA  + R +    +   P++VDWRK+GAVT VK+Q
Sbjct  132  ASASTTFRYEN---AINLPWAVDWRKKGAVTPVKNQ  164



>gb|KHG05637.1| Cysteinease RD21a -like protein [Gossypium arboreum]
Length=457

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 69/124 (56%), Gaps = 12/124 (10%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +++V+ ++EEW  ++GK Y    E E R Q FK NL+++ E       S    KVGLN+F
Sbjct  44   DDEVMAMYEEWLVKHGKTYNGLGEKERRLQIFKDNLRFIDEHNADESHSF---KVGLNRF  100

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++ ++   IK P RK        A   G+        + P SVDWR++GAV  
Sbjct  101  ADLTNEEYRAIYLG-IKKPNRKVSKASDRYAPLLGQ--------KLPDSVDWREKGAVAE  151

Query  605  VKDQ  616
            VKDQ
Sbjct  152  VKDQ  155



>gb|KHN47997.1| P34 putative thiol protease [Glycine soja]
Length=380

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 74/125 (59%), Gaps = 9/125 (7%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +++V  LF+ WK  +G+VY + EE  +R + FK NL Y+++     R S    ++GLNKF
Sbjct  37   QKQVSSLFQLWKSEHGRVYHNHEEEAKRLEIFKNNLNYIRDMN-ANRKSPHSHRLGLNKF  95

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCE-APFSVDWRKRGAVT  601
            AD+  +EF   +   ++ P    Q I+M +     + KK++ SC+  P S DWR++G +T
Sbjct  96   ADITPQEFSKKY---LQAPKDVSQQIKMANK----KMKKEQHSCDHPPASWDWREKGVIT  148

Query  602  RVKDQ  616
            +VK Q
Sbjct  149  QVKYQ  153



>gb|EAY87283.1| hypothetical protein OsI_08685 [Oryza sativa Indica Group]
Length=357

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 81/157 (52%), Gaps = 12/157 (8%)
 Frame = +2

Query  149  LVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEER  328
            ++FL++  V C   + ++D   +  +        K++ LF  W  ++ K+Y   +E  +R
Sbjct  7    MLFLLLGFVACSATASHHDPSVVGYSQEDLALPNKLVGLFTSWSVKHSKIYASPKEKVKR  66

Query  329  FQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTS-KIKMPFRKKQGIQ  505
            ++ FK NL+++ E T    GS W   +GLN FAD+ +EEFK  +   K  +  R  Q   
Sbjct  67   YEIFKRNLRHIVE-TNRRNGSYW---LGLNHFADIAHEEFKASYLGLKPGLARRDAQ---  119

Query  506  MVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
                 H     +   +   P++VDWRK+GAVT VK+Q
Sbjct  120  ----PHGSTTFRYANAVNLPWAVDWRKKGAVTPVKNQ  152



>ref|XP_006473845.1| PREDICTED: xylem cysteine proteinase 2-like [Citrus sinensis]
Length=352

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 72/124 (58%), Gaps = 14/124 (11%)
 Frame = +2

Query  248  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA  427
            +K++ LFE W  +  KVY   EE  ERF+ FK NL+++ E     + + W   +GLN+FA
Sbjct  42   DKLIDLFESWMSKFEKVYESLEEKLERFEIFKDNLRHIDETNRKIK-NYW---LGLNEFA  97

Query  428  DLRNEEFKDVFTS-KIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            DLR+EEFK++F   K  +  RK Q         S  +   K   + P SVDWRK+GAVT 
Sbjct  98   DLRHEEFKEMFLGLKPDLARRKDQ---------SHEDFSYKDVVDLPKSVDWRKKGAVTH  148

Query  605  VKDQ  616
            VK+Q
Sbjct  149  VKNQ  152



>ref|XP_010919166.1| PREDICTED: oryzain alpha chain-like [Elaeis guineensis]
Length=221

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 64/124 (52%), Gaps = 7/124 (6%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            EE++  L+E W  ++G+ Y   EE E RF+ FK N++++              ++GLN+F
Sbjct  98   EEQMRLLYEGWLAKHGRTYNALEEKERRFEIFKDNVRFIDAHNAAADSGHHSFRLGLNRF  157

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            AD+ NEE++ V+          +   Q   A       +  V  E P S+DWR +GAVT 
Sbjct  158  ADITNEEYRAVYLG-------TRPAGQRRRARFGSDRYRYNVGEELPESIDWRDKGAVTA  210

Query  605  VKDQ  616
            VKDQ
Sbjct  211  VKDQ  214



>gb|EYU34557.1| hypothetical protein MIMGU_mgv1a007408mg [Erythranthe guttata]
Length=408

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 67/124 (54%), Gaps = 9/124 (7%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +E+V  L+E W  ++GK Y    E + RF  FK NLK+V +   G R      +VGLNKF
Sbjct  38   DEQVKGLYESWLAKHGKAYNGIGEKDRRFDIFKDNLKFVDDHNSGNRTY----EVGLNKF  93

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++  +      P R+      V + +  R    +     P SVDWR+RGAV+ 
Sbjct  94   ADLTNEEYRSTYLGTRSDPTRR-----FVKSKNPSRRYALRSGEMLPESVDWRERGAVSP  148

Query  605  VKDQ  616
            +K+Q
Sbjct  149  IKNQ  152



>gb|ABG33750.1| cysteine protease [Hevea brasiliensis]
Length=457

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 71/124 (57%), Gaps = 11/124 (9%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +++V+ ++E+W  ++GK Y    E E RF+ FK NL+++ E     R  R    VGLN+F
Sbjct  35   DDEVMAIYEDWLVKHGKAYNSLGEKERRFEVFKDNLRFIDEHNSENRTYR----VGLNRF  90

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++ ++   +    R K  ++ +S  ++ R     V    P SVDWRK GAV  
Sbjct  91   ADLTNEEYRSMYLGALSGIRRNK--LRKISDRYTPR-----VGDSLPDSVDWRKEGAVVG  143

Query  605  VKDQ  616
            VKDQ
Sbjct  144  VKDQ  147



>ref|XP_009796444.1| PREDICTED: xylem cysteine proteinase 1-like [Nicotiana sylvestris]
Length=355

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 89/168 (53%), Gaps = 22/168 (13%)
 Frame = +2

Query  128  SLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRD  307
            S+     LV   ++ + C   S   D   +  +       +K++ LFE W +++GK+Y+ 
Sbjct  5    SISKLSLLVLFSISLLAC--TSFARDHSIVGYSSDDLTCIDKLINLFEHWMDKHGKIYKS  62

Query  308  EEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFR  487
             EE   RF+ FK NLK++ E T     + W   +GLN+FADL ++EFK ++         
Sbjct  63   IEEKLHRFEIFKDNLKHIDE-TNKIVSNYW---LGLNEFADLSHDEFKKMYL--------  110

Query  488  KKQGIQMVSAVHSGREKKKKVSC-----EAPFSVDWRKRGAVTRVKDQ  616
               G+++ + + + REK ++        + P SVDWRK+GAVT VK+Q
Sbjct  111  ---GLKVDNELLNKREKSQQEFAYRDFVDLPKSVDWRKKGAVTPVKNQ  155



>ref|XP_001783545.1| predicted protein [Physcomitrella patens]
 gb|EDQ51634.1| predicted protein [Physcomitrella patens]
Length=461

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 64/125 (51%), Gaps = 17/125 (14%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            E  +L  F  W  ++GK Y D E+   RF  +K NL Y++        S     +GL KF
Sbjct  47   ENLLLEQFAAWAHKHGKAYHDAEQCLHRFAVWKDNLAYIRHSETNRTYS-----LGLTKF  101

Query  425  ADLRNEEFKDVFT-SKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVT  601
            ADL NEEF+ ++T ++I    R K+           R   +    EAP SVDWRK GAVT
Sbjct  102  ADLTNEEFRRMYTGTRIDRSRRAKR-----------RTGFRYADSEAPESVDWRKNGAVT  150

Query  602  RVKDQ  616
             VKDQ
Sbjct  151  SVKDQ  155



>ref|XP_008659257.1| PREDICTED: ervatamin-B-like [Zea mays]
 gb|AFW85700.1| hypothetical protein ZEAMMB73_033873 [Zea mays]
Length=359

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 66/122 (54%), Gaps = 3/122 (2%)
 Frame = +2

Query  254  VLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADL  433
            +L  F+ W+    + Y   EE+++RF  +  NL+++K       GS +E  +G N+F DL
Sbjct  36   LLERFKAWQAEYNRTYATPEEFQQRFMVYSENLRFIKTMNQLSTGSSYE--LGENQFTDL  93

Query  434  RNEEFKDVFTSKI-KMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVK  610
              EEFKD +  K+ + P   +    +V  + +        + EAP SVDWR +GAVT VK
Sbjct  94   TEEEFKDTYLMKLDEQPPAAEAMPPIVGTMSTAGMSNGDNTGEAPNSVDWRTKGAVTPVK  153

Query  611  DQ  616
            +Q
Sbjct  154  NQ  155



>ref|XP_002273243.2| PREDICTED: xylem cysteine proteinase 1 [Vitis vinifera]
Length=351

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 70/124 (56%), Gaps = 15/124 (12%)
 Frame = +2

Query  248  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA  427
            +K+  LFE W  ++GK YR  EE   RF+ F+ NLK++ E T     S W   +GLN+FA
Sbjct  42   DKLTDLFESWMSKHGKSYRSFEEKLHRFEVFQDNLKHIDE-TNKKVSSYW---LGLNEFA  97

Query  428  DLRNEEFKDVFTS-KIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            DL +EEFK  +   KI++P R+           S  E   K   + P SVDWRK+GAV  
Sbjct  98   DLSHEEFKRKYLGLKIELPKRRD----------SPEEFSYKDVADLPKSVDWRKKGAVAH  147

Query  605  VKDQ  616
            VK+Q
Sbjct  148  VKNQ  151



>ref|XP_007135981.1| hypothetical protein PHAVU_009G008200g [Phaseolus vulgaris]
 gb|ESW07975.1| hypothetical protein PHAVU_009G008200g [Phaseolus vulgaris]
Length=349

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 87/159 (55%), Gaps = 22/159 (14%)
 Frame = +2

Query  155  FLIVAAVWCGGVSCYY--DgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEER  328
             L++A  +C  +S  +  D   +  +       +K++ LFE W  R+GK+Y   EE   R
Sbjct  8    LLVLACSFCIFLSLAFGRDFSIVGYSSEDLKSMDKLIELFESWMSRHGKIYEGIEEKLLR  67

Query  329  FQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGIQM  508
            F+ FK NLK++ E+      + W   +GLN+FADL ++EFK+ +   +K+ + ++     
Sbjct  68   FEIFKDNLKHIDERN-NVISNYW---LGLNEFADLSHQEFKNKYLG-LKVDYSRR-----  117

Query  509  VSAVHSGREKKKKVS---CEAPFSVDWRKRGAVTRVKDQ  616
                   RE  ++ S    E P SVDWRK+GAVT+VK+Q
Sbjct  118  -------RESPEEFSYKDIELPKSVDWRKKGAVTQVKNQ  149



>ref|XP_008660699.1| PREDICTED: ervatamin-B-like [Zea mays]
 gb|AFW85699.1| hypothetical protein ZEAMMB73_033873 [Zea mays]
Length=361

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 66/122 (54%), Gaps = 3/122 (2%)
 Frame = +2

Query  254  VLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADL  433
            +L  F+ W+    + Y   EE+++RF  +  NL+++K       GS +E  +G N+F DL
Sbjct  36   LLERFKAWQAEYNRTYATPEEFQQRFMVYSENLRFIKTMNQLSTGSSYE--LGENQFTDL  93

Query  434  RNEEFKDVFTSKI-KMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVK  610
              EEFKD +  K+ + P   +    +V  + +        + EAP SVDWR +GAVT VK
Sbjct  94   TEEEFKDTYLMKLDEQPPAAEAMPPIVGTMSTAGMSNGDNTGEAPNSVDWRTKGAVTPVK  153

Query  611  DQ  616
            +Q
Sbjct  154  NQ  155



>emb|CDP18154.1| unnamed protein product [Coffea canephora]
Length=352

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 69/123 (56%), Gaps = 12/123 (10%)
 Frame = +2

Query  248  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA  427
            +K++ LFE W +++GK+Y   EE   RF+ FK NLK++ E+      + W   +GLN+FA
Sbjct  42   DKLINLFESWIQKHGKIYESIEEKLHRFEIFKDNLKHIDERN-KDIANYW---LGLNEFA  97

Query  428  DLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRV  607
            DL +EEFK ++         K+Q          G E       + P SVDWRK+GAVT V
Sbjct  98   DLSHEEFKKMYLGLNGELATKRQS--------PGEEFTYGNVMDIPKSVDWRKKGAVTPV  149

Query  608  KDQ  616
            K+Q
Sbjct  150  KNQ  152



>ref|XP_002305073.2| hypothetical protein POPTR_0004s05540g [Populus trichocarpa]
 gb|EEE85584.2| hypothetical protein POPTR_0004s05540g [Populus trichocarpa]
Length=340

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 85/157 (54%), Gaps = 25/157 (16%)
 Frame = +2

Query  146  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  325
            FL FL++ A W   ++C                +E +L+  EEW  ++G+VY D +E E+
Sbjct  11   FLPFLLILAAWATKIAC-----------RPLDEQEYMLKRHEEWMAQHGRVYGDMKEKEK  59

Query  326  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGIQ  505
            R+  FK N++ ++       GS    K+G+NKFADL NEEF+ ++         K+Q  +
Sbjct  60   RYLIFKENIERIEAFN---NGSDRGYKLGVNKFADLTNEEFRAMYHG------YKRQSSK  110

Query  506  MVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
            ++S+      + + +S + P S+DWR  GAVT VKDQ
Sbjct  111  LMSSSF----RYENLS-DIPTSMDWRNDGAVTPVKDQ  142



>ref|XP_009359945.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Pyrus 
x bretschneideri]
Length=474

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 72/125 (58%), Gaps = 10/125 (8%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +++V+ ++E W   +GK Y    E E RFQ FK NL+Y+ E+           K+GLN+F
Sbjct  49   DDEVMSIYEGWLAEHGKAYNALGEKERRFQIFKDNLRYIDEQ----NSKNLSYKLGLNRF  104

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREK-KKKVSCEAPFSVDWRKRGAVT  601
            ADL NEE+++ +     +  + +  ++ VS  ++  ++   +V    P SVDWRK GAV+
Sbjct  105  ADLSNEEYRNTY-----LGAKTRAQMKRVSNRNTKSDRYAPRVGDSLPDSVDWRKEGAVS  159

Query  602  RVKDQ  616
             VKDQ
Sbjct  160  PVKDQ  164



>emb|CDX69132.1| BnaC01g03210D [Brassica napus]
Length=380

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 83/167 (50%), Gaps = 16/167 (10%)
 Frame = +2

Query  119  TKCSLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKV  298
            T  SL     LV +  +A+ C  ++   D   I          + +L LFE W   + K 
Sbjct  29   TPSSLAKLSLLVAISASALLCSALA--RDFSIIGYTPEQLSSTDNLLELFESWMSEHSKA  86

Query  299  YRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKM  478
            Y+  EE   RF+ F+ NL ++ ++        W   +GLN+FADL +EEFK  +    K 
Sbjct  87   YQSVEEKVHRFEVFRDNLMHIDQRN-NEISEYW---LGLNEFADLTHEEFKRKYLGLAKP  142

Query  479  PF-RKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
             F RK+Q         SG  + + V+ + P SVDWRK+GAVT VK+Q
Sbjct  143  QFSRKRQP--------SGNFRYRDVT-DLPKSVDWRKKGAVTPVKNQ  180



>ref|XP_006849990.1| hypothetical protein AMTR_s00022p00165270 [Amborella trichopoda]
 gb|ERN11571.1| hypothetical protein AMTR_s00022p00165270 [Amborella trichopoda]
Length=347

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 73/124 (59%), Gaps = 14/124 (11%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +E ++ LF+ W  ++GKVYRD EE   RF+ FK N+K++ E     + S W   +GLN+F
Sbjct  39   DEGLISLFQSWASKHGKVYRDFEEKLRRFEIFKDNIKWIDETNRENK-SYW---LGLNEF  94

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            AD+ +EEFK+ +   +K  F K+ G         G+  + K     P S+DWRK+GAV  
Sbjct  95   ADMSHEEFKEKYLG-VKPIFPKRNG---------GQNFRYKDVENIPKSMDWRKKGAVIG  144

Query  605  VKDQ  616
            VK+Q
Sbjct  145  VKNQ  148



>ref|XP_008393776.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Malus 
domestica]
Length=475

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 72/125 (58%), Gaps = 10/125 (8%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +++V+ ++E W   +GK Y    E E RFQ FK NL+Y+ E+           K+GLN+F
Sbjct  50   DDEVMSIYEGWLXEHGKAYNALGEKERRFQIFKDNLRYIDEQ----NSKNLSYKLGLNRF  105

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREK-KKKVSCEAPFSVDWRKRGAVT  601
            ADL NEE+++ +     +  + +  ++ VS  ++  ++   +V    P SVDWRK GAV+
Sbjct  106  ADLSNEEYRNTY-----LGAKTRAQMKRVSNRNTKSDRYAPRVGDSLPDSVDWRKEGAVS  160

Query  602  RVKDQ  616
             VKDQ
Sbjct  161  PVKDQ  165



>ref|XP_006307431.1| hypothetical protein CARUB_v10009056mg [Capsella rubella]
 gb|EOA40329.1| hypothetical protein CARUB_v10009056mg [Capsella rubella]
Length=467

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 67/123 (54%), Gaps = 12/123 (10%)
 Frame = +2

Query  248  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA  427
            + +  LF++W +R+GK Y  E E + RFQ F+ N  +V +  +    +     + LN FA
Sbjct  28   DDISELFDDWCQRHGKTYASEAEKQHRFQIFRDNHDFVTQHNLITNATY---SLSLNAFA  84

Query  428  DLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRV  607
            DL + EFK   TS++ +       +   S + + + K    S + P S+DWRK+GAVT V
Sbjct  85   DLNHSEFK---TSRLGL------SVSAPSVIMASKGKSLGGSVKVPDSLDWRKKGAVTNV  135

Query  608  KDQ  616
            KDQ
Sbjct  136  KDQ  138



>ref|XP_009599970.1| PREDICTED: xylem cysteine proteinase 1-like [Nicotiana tomentosiformis]
Length=355

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 89/168 (53%), Gaps = 22/168 (13%)
 Frame = +2

Query  128  SLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRD  307
            S+     LV   ++ + C   S   D   +  +       +K++ LFE W +++GK+Y+ 
Sbjct  5    SISKLSLLVLFSISLLAC--TSFARDHSIVGYSSDDLTCIDKLINLFEHWMDKHGKIYKS  62

Query  308  EEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFR  487
             EE   RF+ FK NLK++ E T     + W   +GLN+FADL ++EFK ++         
Sbjct  63   IEEKLRRFEIFKDNLKHIDE-TNKIVSNYW---LGLNEFADLSHDEFKKMYL--------  110

Query  488  KKQGIQMVSAVHSGREKKKKVSC-----EAPFSVDWRKRGAVTRVKDQ  616
               G+++ + + + REK ++        + P SVDWRK+GAVT VK+Q
Sbjct  111  ---GLKVDNELLNKREKSQQEFAYRDFVDLPKSVDWRKKGAVTPVKNQ  155



>ref|XP_007042494.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
 gb|EOX98325.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
Length=579

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 76/129 (59%), Gaps = 17/129 (13%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKE-KTVGGRGSRWEGKVGLNK  421
            E ++ R++E W  ++GK Y    E E+RF+ FK NLK+++E  +V G       KVGLN+
Sbjct  153  ETQIRRMYETWLVKHGKAYNGLGEKEKRFEIFKDNLKFIEEHNSVNG-----TYKVGLNR  207

Query  422  FADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKK----KVSCEAPFSVDWRKR  589
            FADL NEE+K ++          +   + VS   +G+EK +    +V  + P SVDWR++
Sbjct  208  FADLTNEEYKAMY-------LGARLDGKTVSHRLAGKEKSQRYVFRVGDKLPESVDWREK  260

Query  590  GAVTRVKDQ  616
            GAV  VKDQ
Sbjct  261  GAVVAVKDQ  269



>ref|XP_006492717.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
 gb|KDO63019.1| hypothetical protein CISIN_1g018968mg [Citrus sinensis]
Length=348

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 72/124 (58%), Gaps = 9/124 (7%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            E+ V+ + E+W  ++G+ Y+DE E E RF+ FK NL+Y+++    G  +    K+G N+F
Sbjct  40   EQSVVEMHEKWMAQHGRSYKDELEKEMRFKIFKENLEYIEKANKEGNRTY---KLGTNRF  96

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            +DL N+EF+ ++T   KMP    +     S   S  + +     + P S+DWR + AVT 
Sbjct  97   SDLTNDEFRALYTG-YKMPSPSHR-----STTSSTFKYQNLSMTDVPTSLDWRDKKAVTP  150

Query  605  VKDQ  616
            +KDQ
Sbjct  151  IKDQ  154



>ref|XP_004136967.1| PREDICTED: cysteine proteinase RD21a-like [Cucumis sativus]
 gb|KGN43904.1| Cysteine protease [Cucumis sativus]
Length=479

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 70/125 (56%), Gaps = 11/125 (9%)
 Frame = +2

Query  242  PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK  421
            P+E+V  L+E W   +GK Y    E E RF+ FK NL+++ E     R SR   KVGL +
Sbjct  54   PDEEVAALYESWLVHHGKAYNAIGEKERRFEIFKDNLRFIDEHN---RESRTY-KVGLTR  109

Query  422  FADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVT  601
            FADL NEE++  F   +   F +K     +SA  SGR     +  + P  VDWRK+GAV 
Sbjct  110  FADLTNEEYRARF---LGGRFSRK---PRLSAAKSGR-YAAALGDDLPDDVDWRKKGAVA  162

Query  602  RVKDQ  616
             VKDQ
Sbjct  163  TVKDQ  167



>dbj|BAC75923.1| cysteine protease-1 [Helianthus annuus]
Length=461

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 70/124 (56%), Gaps = 10/124 (8%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +++V  L+E W  ++GK Y    E + RFQ FK NL+++ E   G        K+GLNKF
Sbjct  45   DDEVNALYESWLVKHGKTYNALGEKDRRFQIFKDNLRFIDEHNSGDHTY----KLGLNKF  100

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++  +T  IK    KK+  +M S  ++ R          P  VDWR++GAVT 
Sbjct  101  ADLTNEEYRMTYTG-IKTIDDKKKLSKMKSDRYAYRSGDS-----LPEYVDWREQGAVTD  154

Query  605  VKDQ  616
            VKDQ
Sbjct  155  VKDQ  158



>ref|XP_006599887.1| PREDICTED: P34 probable thiol protease-like [Glycine max]
Length=338

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 66/124 (53%), Gaps = 12/124 (10%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +++ ++LF+ W++ +G VY+D +E  +RF+ F  NL Y+ E     R S     +GLN F
Sbjct  27   QDETIQLFQLWRKEHGLVYKDLKEMAKRFEIFLSNLNYIIEFN-AKRSSPSGYLLGLNNF  85

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            AD    EF++++   + MP                +     +SC AP S+DWR + AVT 
Sbjct  86   ADWSPSEFQEIYLHSLDMPTDSAP-----------KLNGPLLSCIAPASLDWRNKVAVTA  134

Query  605  VKDQ  616
            +K+Q
Sbjct  135  IKNQ  138



>ref|XP_010276986.1| PREDICTED: ervatamin-B-like [Nelumbo nucifera]
Length=360

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 67/124 (54%), Gaps = 12/124 (10%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            EE V  +FE W E++GKVY   EE + RF+ F+ NL Y+       + S  +  +GLN+F
Sbjct  46   EEGVALIFERWTEKHGKVYTSTEEKDRRFKIFQSNLAYIINWN--SKRSPTDHTMGLNQF  103

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            +D+  EEF +V  S +      +  ++ +S       K  K +C  P S DWR +G VT 
Sbjct  104  SDMSFEEFSNVRLSSVN---PTESLLETIS-------KGVKTTCTHPSSFDWRSQGVVTP  153

Query  605  VKDQ  616
            VK+Q
Sbjct  154  VKNQ  157



>gb|KHN41568.1| P34 putative thiol protease [Glycine soja]
Length=356

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 66/124 (53%), Gaps = 12/124 (10%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +++ ++LF+ W++ +G VY+D +E  +RF+ F  NL Y+ E     R S     +GLN F
Sbjct  45   QDETIQLFQLWRKEHGLVYKDLKEMAKRFEFFLSNLNYIIEFN-AKRSSPSGYLLGLNNF  103

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            AD    EF++++   + MP                +     +SC AP S+DWR + AVT 
Sbjct  104  ADWSPSEFQEIYLHSLDMPTDSAP-----------KLNGPLLSCIAPSSLDWRNKVAVTA  152

Query  605  VKDQ  616
            +K+Q
Sbjct  153  IKNQ  156



>ref|XP_008796470.1| PREDICTED: oryzain alpha chain-like [Phoenix dactylifera]
Length=466

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 66/124 (53%), Gaps = 5/124 (4%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            EE+V  L++ WK R  + Y   +E E RF+ F+ NL+Y+ +         +  ++GL +F
Sbjct  37   EEEVRGLYQAWKARRARSYNALDEDERRFEIFRDNLRYIDQHNAAADAGEYSFRLGLTRF  96

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++  +        R+ +     S V S R + +    + P S+DWR +GAV  
Sbjct  97   ADLTNEEYRSTYLGVRTAGSRRSRN----STVDSNRYRFRSGD-DLPDSIDWRDKGAVAE  151

Query  605  VKDQ  616
            VKDQ
Sbjct  152  VKDQ  155



>ref|XP_010932205.1| PREDICTED: oryzain alpha chain-like [Elaeis guineensis]
 gb|ABR19828.1| cysteine proteinase [Elaeis guineensis]
Length=469

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 71/124 (57%), Gaps = 5/124 (4%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +++V RL++ WK ++ + Y   +E E+R + F+ NL+++ +        ++  ++GL +F
Sbjct  40   DDEVHRLYQAWKAQHARSYNALDEDEQRLEIFRDNLRFIDQHNAAANAGKYSFRLGLTRF  99

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++  +        R+++     S V S R + +  S + P S+DWR +GAV  
Sbjct  100  ADLTNEEYRSTYLGVRTAGSRRRRN----STVGSNRYRFRS-SDDLPDSIDWRDKGAVVD  154

Query  605  VKDQ  616
            VKDQ
Sbjct  155  VKDQ  158



>ref|XP_003527269.1| PREDICTED: xylem cysteine proteinase 2-like [Glycine max]
Length=350

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 77/128 (60%), Gaps = 24/128 (19%)
 Frame = +2

Query  248  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKE--KTVGGRGSRWEGKVGLNK  421
            +K++ LFE W  R+GK+Y+  EE   RF+ FK NLK++ E  K V    + W   +GLN+
Sbjct  42   DKLIELFESWISRHGKIYQSIEEKLHRFEIFKDNLKHIDERNKVV---SNYW---LGLNE  95

Query  422  FADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVS---CEAPFSVDWRKRG  592
            FADL ++EFK+ +   +K+ + ++            RE  ++ +    E P SVDWRK+G
Sbjct  96   FADLSHQEFKNKYLG-LKVDYSRR------------RESPEEFTYKDVELPKSVDWRKKG  142

Query  593  AVTRVKDQ  616
            AVT+VK+Q
Sbjct  143  AVTQVKNQ  150



>dbj|BAD29959.1| cysteine protease [Daucus carota]
Length=361

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 78/165 (47%), Gaps = 24/165 (15%)
 Frame = +2

Query  128  SLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRD  307
            S     F  F+I A +  G  +C         A    +PE  +    E+W  + G+VY+D
Sbjct  19   STTNMAFKHFMIAALILLGAWAC--------QATSRTLPEASMFERHEQWMIQYGRVYKD  70

Query  308  EEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFR  487
            E E   RFQ F  N+K+++E    GR S    K+ +N+FAD  NEEF+            
Sbjct  71   EAEKSVRFQIFMDNVKFIEEFNKDGRQSY---KLAVNEFADQTNEEFQ-----------A  116

Query  488  KKQGIQMVSAVHSGREK--KKKVSCEAPFSVDWRKRGAVTRVKDQ  616
             + G +M  +    +    + +     P S+DWRK+GAVT VKDQ
Sbjct  117  SRNGYKMAVSSRPSQTTLFRYENVTAVPSSMDWRKKGAVTPVKDQ  161



>ref|XP_003563708.2| PREDICTED: ervatamin-B-like [Brachypodium distachyon]
Length=365

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 77/160 (48%), Gaps = 16/160 (10%)
 Frame = +2

Query  146  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLR-LFEEWKERNGKVYRDEEEYE  322
              +FL++       VSC      +A        ++K +R  +E+W    G+ Y+D  E  
Sbjct  17   LAIFLVI-------VSCSTHYLMVAAGEVSTAGDDKAMRERYEKWMAEQGRTYKDSTEKA  69

Query  323  ERFQNFKGNLKYVKEKTVG-GRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQG  499
             RF+ FK N  ++       G G +   K+  NKFADL  +EF++++ +  ++ +R    
Sbjct  70   RRFEVFKSNAHFIDSHNAATGPGGKSRPKLTTNKFADLTEDEFRNIYVTGHRVNYRP---  126

Query  500  IQMVSAVHSGREKKKKVSC-EAPFSVDWRKRGAVTRVKDQ  616
                S V     K   VS  + P S+DWR RGAVT VKDQ
Sbjct  127  ---TSLVTDTVFKFGAVSLSDVPPSIDWRARGAVTSVKDQ  163



>ref|XP_006435429.1| hypothetical protein CICLE_v10001665mg [Citrus clementina]
 gb|ESR48669.1| hypothetical protein CICLE_v10001665mg [Citrus clementina]
Length=352

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 72/124 (58%), Gaps = 14/124 (11%)
 Frame = +2

Query  248  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA  427
            +K++ LFE W  +  KVY   +E  ERF+ FK NL+++ E     + + W   +GLN+FA
Sbjct  42   DKLIDLFESWMSKFEKVYESLDEKLERFEIFKDNLRHIDETNRKIK-NYW---LGLNEFA  97

Query  428  DLRNEEFKDVFTS-KIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            DLR+EEFK++F   K  +  RK Q         S  +   K   + P SVDWRK+GAVT 
Sbjct  98   DLRHEEFKEMFLGLKPDLARRKDQ---------SHEDFSYKDVVDLPKSVDWRKKGAVTH  148

Query  605  VKDQ  616
            VK+Q
Sbjct  149  VKNQ  152



>ref|XP_002283263.1| PREDICTED: cysteine proteinase COT44 [Vitis vinifera]
Length=374

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 69/127 (54%), Gaps = 15/127 (12%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            EE+V+ +++ W  ++GK Y    E E+RF+ FK NLK++ E     R      KVGLN+F
Sbjct  39   EEEVMGMYQWWMAKHGKAYNGLGEKEKRFEIFKDNLKFIDEHNAQNRTY----KVGLNRF  94

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVS---AVHSGREKKKKVSCEAPFSVDWRKRGA  595
            ADL NEE++ ++      P R+   ++  S   AV  G           P SVDWR+ GA
Sbjct  95   ADLTNEEYRAIYLGTRSDPKRRFAKLKNASPRYAVMPGE--------VLPESVDWRETGA  146

Query  596  VTRVKDQ  616
            V  VKDQ
Sbjct  147  VNPVKDQ  153



>gb|KJB14609.1| hypothetical protein B456_002G133800 [Gossypium raimondii]
Length=477

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 71/124 (57%), Gaps = 12/124 (10%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +++V+ ++EEW  ++GK Y    E E RFQ FK NL+++ E       S    KVGLN+F
Sbjct  44   DDEVMAMYEEWLVKHGKTYNGLGEKERRFQIFKDNLRFIDEHNADESQSF---KVGLNRF  100

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++ ++   IK   RK   +   S  ++    +K      P SVDWR++GAV  
Sbjct  101  ADLTNEEYRAIYLG-IKKANRK---VSKASDRYAALLGEK-----LPDSVDWREKGAVAE  151

Query  605  VKDQ  616
            VKDQ
Sbjct  152  VKDQ  155



>ref|XP_006857795.1| hypothetical protein AMTR_s00061p00215070 [Amborella trichopoda]
 gb|ERN19262.1| hypothetical protein AMTR_s00061p00215070 [Amborella trichopoda]
Length=342

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 67/126 (53%), Gaps = 15/126 (12%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
             P   ++R FE+W   +G+ Y D +E E+RFQ F+ NLK++      GR      K+  N
Sbjct  35   TPSSLLVR-FEQWMALHGRQYMDAQEKEQRFQIFQENLKFIDSVNAEGR----PYKLTAN  89

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
            KFADL N+EF+       +M F+  +      A  +        +  AP S+DWRK+GAV
Sbjct  90   KFADLTNDEFR-----VTRMGFKGHE-----CAARASDAPFMYANVSAPTSMDWRKKGAV  139

Query  599  TRVKDQ  616
            T VKDQ
Sbjct  140  TPVKDQ  145



>ref|XP_011100156.1| PREDICTED: xylem cysteine proteinase 2-like [Sesamum indicum]
Length=352

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 75/127 (59%), Gaps = 20/127 (16%)
 Frame = +2

Query  248  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKE--KTVGGRGSRWEGKVGLNK  421
            +K++ LFE W +R+GK Y+  E+   RF+ FK NLK++ E  K V    + W   +GLN+
Sbjct  42   DKLINLFESWIDRHGKKYKSLEDKLHRFEIFKDNLKHIDERNKVV---SNYW---LGLNE  95

Query  422  FADLRNEEFKDVFTS--KIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGA  595
            FAD+ +EEFK ++      ++P R +          S +E K +     P SVDWRK+GA
Sbjct  96   FADMSHEEFKKMYLGLKADQLPNRNQ----------SPQEFKYRDFENLPKSVDWRKKGA  145

Query  596  VTRVKDQ  616
            VTRVK+Q
Sbjct  146  VTRVKNQ  152



>gb|KDO63024.1| hypothetical protein CISIN_1g018958mg [Citrus sinensis]
Length=281

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 72/124 (58%), Gaps = 9/124 (7%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            E+ V+ + E+W  ++G+ Y+DE E E R + FK NL+Y+++    G  +    K+G N+F
Sbjct  40   EQSVVEIHEKWMAQHGRSYKDELEKEMRLKIFKENLEYIEKANKEGNRTY---KLGTNQF  96

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            +DL N+EF+ ++T   KMP    +     S   S  + +     + P S+DWR +GAVT 
Sbjct  97   SDLTNDEFRALYTG-YKMPSPSHR-----STTSSTFKYQNLSMTDVPTSLDWRDKGAVTP  150

Query  605  VKDQ  616
            +K+Q
Sbjct  151  IKNQ  154



>gb|KJB14610.1| hypothetical protein B456_002G133800 [Gossypium raimondii]
Length=457

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 71/124 (57%), Gaps = 12/124 (10%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +++V+ ++EEW  ++GK Y    E E RFQ FK NL+++ E       S    KVGLN+F
Sbjct  44   DDEVMAMYEEWLVKHGKTYNGLGEKERRFQIFKDNLRFIDEHNADESQSF---KVGLNRF  100

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++ ++   IK   RK   +   S  ++    +K      P SVDWR++GAV  
Sbjct  101  ADLTNEEYRAIYLG-IKKANRK---VSKASDRYAALLGEK-----LPDSVDWREKGAVAE  151

Query  605  VKDQ  616
            VKDQ
Sbjct  152  VKDQ  155



>gb|KCW66364.1| hypothetical protein EUGRSUZ_F00184 [Eucalyptus grandis]
Length=470

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 66/124 (53%), Gaps = 10/124 (8%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            + +V+ L+E W  ++GK Y    E E RF  FK NL+++ E   G R       +GLN+F
Sbjct  46   DAEVMALYESWLVKHGKAYNALGEKERRFDIFKDNLRFIDEHNSGNRTY----TLGLNRF  101

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++  +         +    + ++   S R  + ++  + P SVDWRK GAV  
Sbjct  102  ADLTNEEYRSTYLGT------RPDASRRLTKSRSSRRYEPRLGEQLPESVDWRKEGAVVG  155

Query  605  VKDQ  616
            VKDQ
Sbjct  156  VKDQ  159



>ref|XP_010059895.1| PREDICTED: low-temperature-induced cysteine proteinase [Eucalyptus 
grandis]
 gb|KCW66363.1| hypothetical protein EUGRSUZ_F00184 [Eucalyptus grandis]
Length=470

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 66/124 (53%), Gaps = 10/124 (8%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            + +V+ L+E W  ++GK Y    E E RF  FK NL+++ E   G R       +GLN+F
Sbjct  46   DAEVMALYESWLVKHGKAYNALGEKERRFDIFKDNLRFIDEHNSGNRTY----TLGLNRF  101

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++  +         +    + ++   S R  + ++  + P SVDWRK GAV  
Sbjct  102  ADLTNEEYRSTYLGT------RPDASRRLTKSRSSRRYEPRLGEQLPESVDWRKEGAVVG  155

Query  605  VKDQ  616
            VKDQ
Sbjct  156  VKDQ  159



>ref|XP_004500831.1| PREDICTED: xylem cysteine proteinase 2-like [Cicer arietinum]
Length=353

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 71/123 (58%), Gaps = 12/123 (10%)
 Frame = +2

Query  248  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA  427
            +K++ LFE W  R+GK+Y   EE   RF+ FK NLK++ E+      + W   +GLN+FA
Sbjct  43   DKLIELFESWMSRHGKIYETIEEKLLRFEVFKDNLKHIDERN-KIVSNYW---LGLNEFA  98

Query  428  DLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRV  607
            DL ++EFK+ +   +K+ F K+          S  E       + P SVDWRK+GAVT V
Sbjct  99   DLSHQEFKNKYLG-LKVDFSKR-------TESSQEEDFTYRDVDLPKSVDWRKKGAVTAV  150

Query  608  KDQ  616
            K+Q
Sbjct  151  KNQ  153



>gb|KHN33772.1| Xylem cysteine proteinase 2 [Glycine soja]
Length=310

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 76/128 (59%), Gaps = 24/128 (19%)
 Frame = +2

Query  248  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKE--KTVGGRGSRWEGKVGLNK  421
            +K++ LFE W  R+GK+Y+  EE   RF  FK NLK++ E  K V    + W   +GLN+
Sbjct  2    DKLIELFESWMSRHGKIYQSIEEKLHRFDIFKDNLKHIDERNKVV---SNYW---LGLNE  55

Query  422  FADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVS---CEAPFSVDWRKRG  592
            FADL ++EFK+ +   +K+ + ++            RE  ++ +    E P SVDWRK+G
Sbjct  56   FADLSHQEFKNKYLG-LKVDYSRR------------RESPEEFTYKDFELPKSVDWRKKG  102

Query  593  AVTRVKDQ  616
            AVT+VK+Q
Sbjct  103  AVTQVKNQ  110



>ref|XP_010061721.1| PREDICTED: low-temperature-induced cysteine proteinase [Eucalyptus 
grandis]
 gb|KCW68707.1| hypothetical protein EUGRSUZ_F02310 [Eucalyptus grandis]
Length=478

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 69/127 (54%), Gaps = 19/127 (15%)
 Frame = +2

Query  251  KVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFAD  430
            +V+ ++E W  ++GK Y    E E+RFQ FK NL+++ +   GG  +     VGLN+FAD
Sbjct  55   EVMAVYESWLAKHGKAYNALGEKEKRFQVFKDNLRFIDDHNAGGDRTY---TVGLNQFAD  111

Query  431  LRNEEFKDVFTSKIKMPFRKKQGIQMV-SAVHSGREKKKKVSCEA----PFSVDWRKRGA  595
            L NEE++ ++            G +M  S    GR +  + +  A    P SVDWRK GA
Sbjct  112  LTNEEYRSMYL-----------GARMDRSGRRLGRARSDRYAVAAGEELPASVDWRKEGA  160

Query  596  VTRVKDQ  616
            V  VKDQ
Sbjct  161  VVDVKDQ  167



>gb|KCW68708.1| hypothetical protein EUGRSUZ_F02310 [Eucalyptus grandis]
Length=478

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 69/127 (54%), Gaps = 19/127 (15%)
 Frame = +2

Query  251  KVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFAD  430
            +V+ ++E W  ++GK Y    E E+RFQ FK NL+++ +   GG  +     VGLN+FAD
Sbjct  55   EVMAVYESWLAKHGKAYNALGEKEKRFQVFKDNLRFIDDHNAGGDRTY---TVGLNQFAD  111

Query  431  LRNEEFKDVFTSKIKMPFRKKQGIQMV-SAVHSGREKKKKVSCEA----PFSVDWRKRGA  595
            L NEE++ ++            G +M  S    GR +  + +  A    P SVDWRK GA
Sbjct  112  LTNEEYRSMYL-----------GARMDRSGRRLGRARSDRYAVAAGEELPASVDWRKEGA  160

Query  596  VTRVKDQ  616
            V  VKDQ
Sbjct  161  VVDVKDQ  167



>ref|XP_009102734.1| PREDICTED: xylem cysteine proteinase 1 [Brassica rapa]
Length=356

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 83/167 (50%), Gaps = 16/167 (10%)
 Frame = +2

Query  119  TKCSLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKV  298
            T  SL     LV +  +A+ C  ++   D   I          + +L LFE W   + K 
Sbjct  5    TPSSLAKLSLLVAISASALLCSALA--RDFSIIGYTPEHLSSTDNLLELFESWISEHSKA  62

Query  299  YRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKM  478
            Y+  EE   RF+ F+ NL ++ ++         E  +GLN+FADL +EEFK  +    K 
Sbjct  63   YQSVEEKVHRFEVFRDNLMHIDQR----NNEISEYWLGLNEFADLTHEEFKRKYLGLAKP  118

Query  479  PF-RKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
             F RK+Q         SG  + + V+ + P SVDWRK+GAVT VK+Q
Sbjct  119  QFSRKRQ--------PSGNFRYRDVT-DLPKSVDWRKKGAVTPVKNQ  156



>ref|XP_003522988.1| PREDICTED: xylem cysteine proteinase 2-like [Glycine max]
Length=349

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 76/128 (59%), Gaps = 24/128 (19%)
 Frame = +2

Query  248  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKE--KTVGGRGSRWEGKVGLNK  421
            +K++ LFE W  R+GK+Y+  EE   RF  FK NLK++ E  K V    + W   +GLN+
Sbjct  41   DKLIELFESWMSRHGKIYQSIEEKLHRFDIFKDNLKHIDERNKVV---SNYW---LGLNE  94

Query  422  FADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVS---CEAPFSVDWRKRG  592
            FADL ++EFK+ +   +K+ + ++            RE  ++ +    E P SVDWRK+G
Sbjct  95   FADLSHQEFKNKYLG-LKVDYSRR------------RESPEEFTYKDFELPKSVDWRKKG  141

Query  593  AVTRVKDQ  616
            AVT+VK+Q
Sbjct  142  AVTQVKNQ  149



>ref|XP_004506025.1| PREDICTED: vignain-like [Cicer arietinum]
Length=342

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 67/124 (54%), Gaps = 13/124 (10%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +  +L  +E+W  +NGKVY+  +E   R+Q FK N+++++    GG       K+G+N+F
Sbjct  32   DASLLERYEQWMTQNGKVYKGSQEKALRYQIFKENVQFIEAFNKGGNKPY---KLGINQF  88

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEEFK           R K    M S +      K +     P ++DWR++GAVT 
Sbjct  89   ADLTNEEFKT----------RNKFKGHMCSTITRTPTFKYEHVTSVPAALDWRQKGAVTP  138

Query  605  VKDQ  616
            +KDQ
Sbjct  139  IKDQ  142



>ref|XP_002522572.1| cysteine protease, putative [Ricinus communis]
 gb|EEF39872.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 69/128 (54%), Gaps = 11/128 (9%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            + E+ V    E+W  R+G+ Y+D+EE E RF  FK NLK+++        +    K+GLN
Sbjct  29   IDEDAVAEKHEQWMARHGRTYQDDEEKERRFHIFKKNLKHIENFNNAFNRTY---KLGLN  85

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEA--PFSVDWRKRG  592
             FADL +EEF   +T   KMP      +   + + +   +   V  EA  P S+DWR RG
Sbjct  86   HFADLTDEEFLATYTG-YKMP-----KVLPTANITTKTTQSSDVLYEANVPESIDWRTRG  139

Query  593  AVTRVKDQ  616
             VT VK+Q
Sbjct  140  VVTPVKNQ  147



>ref|XP_007136708.1| hypothetical protein PHAVU_009G067300g [Phaseolus vulgaris]
 gb|ESW08702.1| hypothetical protein PHAVU_009G067300g [Phaseolus vulgaris]
Length=373

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 68/124 (55%), Gaps = 12/124 (10%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +E+V  ++EEW  ++GKV       E+RFQ FK NLK++ +     R      KVGLN+F
Sbjct  46   DEEVRSIYEEWLVKHGKVPSTLALKEKRFQIFKDNLKFIDDHNAENRTY----KVGLNRF  101

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL N+E++  +      P R       ++A  S R    +V    P SVDWRK GAV R
Sbjct  102  ADLSNDEYRSKYLRTKINPLR-------MTAKPSNR-YAPRVDDILPESVDWRKEGAVVR  153

Query  605  VKDQ  616
            VKDQ
Sbjct  154  VKDQ  157



>gb|KJB48623.1| hypothetical protein B456_008G078300 [Gossypium raimondii]
Length=240

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 68/124 (55%), Gaps = 8/124 (6%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +++V+ L++ W  ++GK Y    E E+RF+ FK NL+++ E       +    K+GLNKF
Sbjct  39   DDEVMGLYKSWVIQHGKAYNGIGEEEKRFEIFKDNLRFIDEHNSNNNTTY---KLGLNKF  95

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL N+E++  F      P R+     M S V S R    +     P SVDWR  GAV+ 
Sbjct  96   ADLTNQEYRAKFLGTRTDPRRR----LMKSKVPSSR-YAHRAGDNLPDSVDWRDHGAVSP  150

Query  605  VKDQ  616
            VKDQ
Sbjct  151  VKDQ  154



>emb|CAN61026.1| hypothetical protein VITISV_001146 [Vitis vinifera]
Length=469

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 67/124 (54%), Gaps = 11/124 (9%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +E V+ ++E W  ++GK Y    E E RFQ FK NL+++ E     R      KVGLN+F
Sbjct  46   DEDVMAVYEAWLAKHGKSYNALGEKERRFQIFKDNLRFIDEHNAENRTY----KVGLNRF  101

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++ ++        R+      +S  ++ R     V    P SVDWRK+GAV  
Sbjct  102  ADLTNEEYRSMYLGTRTAAKRRSS--NKISDRYAFR-----VGDSLPESVDWRKKGAVVE  154

Query  605  VKDQ  616
            VKDQ
Sbjct  155  VKDQ  158



>ref|XP_002510170.1| cysteine protease, putative [Ricinus communis]
 gb|EEF52357.1| cysteine protease, putative [Ricinus communis]
Length=469

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 67/127 (53%), Gaps = 14/127 (11%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEE---EYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGL  415
            +++V+ ++EEW  +NGK + +     E E RFQ FK NL+++ E     R      KVGL
Sbjct  44   DDEVMAIYEEWLVKNGKAHSNNNALGEKERRFQVFKDNLRFIDEHNSENRSY----KVGL  99

Query  416  NKFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGA  595
            N+FADL NEE++ ++          + G +      S      +V    P SVDWRK GA
Sbjct  100  NRFADLTNEEYRSMY-------LGARSGAKRNRLSRSSNRYLPRVGDSLPDSVDWRKEGA  152

Query  596  VTRVKDQ  616
            V  VKDQ
Sbjct  153  VAEVKDQ  159



>gb|KDO63025.1| hypothetical protein CISIN_1g018958mg [Citrus sinensis]
Length=348

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 72/124 (58%), Gaps = 9/124 (7%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            E+ V+ + E+W  ++G+ Y+DE E E R + FK NL+Y+++    G  +    K+G N+F
Sbjct  40   EQSVVEIHEKWMAQHGRSYKDELEKEMRLKIFKENLEYIEKANKEGNRTY---KLGTNQF  96

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            +DL N+EF+ ++T   KMP    +     S   S  + +     + P S+DWR +GAVT 
Sbjct  97   SDLTNDEFRALYTG-YKMPSPSHR-----STTSSTFKYQNLSMTDVPTSLDWRDKGAVTP  150

Query  605  VKDQ  616
            +K+Q
Sbjct  151  IKNQ  154



>ref|XP_002284973.1| PREDICTED: low-temperature-induced cysteine proteinase [Vitis 
vinifera]
Length=467

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 67/124 (54%), Gaps = 11/124 (9%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +E V+ ++E W  ++GK Y    E E RFQ FK NL+++ E     R      KVGLN+F
Sbjct  44   DEDVMAVYEAWLAKHGKSYNALGEKERRFQIFKDNLRFIDEHNAENRTY----KVGLNRF  99

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++ ++        R+      +S  ++ R     V    P SVDWRK+GAV  
Sbjct  100  ADLTNEEYRSMYLGTRTAAKRRSS--NKISDRYAFR-----VGDSLPESVDWRKKGAVVE  152

Query  605  VKDQ  616
            VKDQ
Sbjct  153  VKDQ  156



>ref|XP_006362435.1| PREDICTED: fruit bromelain-like [Solanum tuberosum]
Length=344

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 67/124 (54%), Gaps = 9/124 (7%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            E  +L   E+W   +G+VY+D+ E E RF+ FK N+++++     G   R+  K+ +NK+
Sbjct  33   ELSMLERHEKWMAHHGRVYKDDIEKEHRFKTFKENVEFIESFNQNGT-LRY--KLAINKY  89

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL  EEF   F         +++ I   ++       K     E PFS+DWRK G+VT 
Sbjct  90   ADLTTEEFTASFMGLDTSLLSQQESIATTTSF------KYDSVTEVPFSMDWRKSGSVTE  143

Query  605  VKDQ  616
            +KDQ
Sbjct  144  IKDQ  147



>ref|XP_010274447.1| PREDICTED: ervatamin-B-like [Nelumbo nucifera]
Length=357

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 68/126 (54%), Gaps = 11/126 (9%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            + EE +  LFE W E++GKVY + E+ + RF+ F+ NL +V +       S  +   GLN
Sbjct  42   ISEEGLALLFERWMEKHGKVYNNLEDKQRRFKIFQSNLAHVIDWNSKRNPS--DHIAGLN  99

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
            +F+DL  EEF   + SK+  P ++         V     ++   +C  P S DWR +GAV
Sbjct  100  QFSDLSFEEFSQNYLSKMD-PHQEN--------VFEASAERLNATCPHPLSWDWRYKGAV  150

Query  599  TRVKDQ  616
            T VK+Q
Sbjct  151  TPVKNQ  156



>gb|KEH31479.1| papain family cysteine protease [Medicago truncatula]
Length=359

 Score = 75.5 bits (184),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 65/123 (53%), Gaps = 8/123 (7%)
 Frame = +2

Query  248  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA  427
            E+V+ ++EEW  ++ KVY    E ++RF+ FK NL ++ E         +  KVGLNKFA
Sbjct  29   EEVMTMYEEWLVKHHKVYNGLGEKDQRFEIFKDNLGFIDEH----NAQNYTYKVGLNKFA  84

Query  428  DLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRV  607
            D+ NEE+++++        R    I++     +G           P  VDWR +GAV  +
Sbjct  85   DMTNEEYRNMYLGTKNDAKRNVMKIKIT----TGHRYAFNSGDRLPVHVDWRSKGAVAHI  140

Query  608  KDQ  616
            KDQ
Sbjct  141  KDQ  143



>gb|AAP32193.1| cysteine protease 14 [Trifolium repens]
Length=351

 Score = 75.5 bits (184),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 72/124 (58%), Gaps = 14/124 (11%)
 Frame = +2

Query  248  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA  427
            +K++ LFE W  R+GK+Y   EE   RF+ FK NLK++ E+      + W   +GLN+FA
Sbjct  41   DKLIELFESWMSRHGKIYETIEEKLLRFEVFKDNLKHIDERN-KIVSNYW---LGLNEFA  96

Query  428  DLRNEEFKDVFTS-KIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            DL ++EFK+ +   K+ +  R++          S  E+      + P SVDWRK+GAVT 
Sbjct  97   DLSHQEFKNKYLGLKVNLSQRRES---------SNEEEFTYRDVDLPKSVDWRKKGAVTP  147

Query  605  VKDQ  616
            VK+Q
Sbjct  148  VKNQ  151



>ref|XP_007017153.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
 gb|EOY14378.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
Length=466

 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 70/126 (56%), Gaps = 16/126 (13%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +++V+ ++EEW  ++GK Y    E E RF+ FK NL+++ E       S    KVGLN+F
Sbjct  44   DDEVMAMYEEWLVKHGKAYNGLGEKERRFEIFKDNLRFIDEHNADDSHSF---KVGLNRF  100

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSC--EAPFSVDWRKRGAV  598
            ADL NEE++ ++    K P RK           S R  +   S   E P S+DWR++GAV
Sbjct  101  ADLTNEEYRAMYLGT-KKPERKV----------SKRSDRYAPSLGEELPDSIDWREKGAV  149

Query  599  TRVKDQ  616
              VKDQ
Sbjct  150  AAVKDQ  155



>ref|XP_006422409.1| hypothetical protein CICLE_v10028739mg [Citrus clementina]
 ref|XP_006486581.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
 gb|ESR35649.1| hypothetical protein CICLE_v10028739mg [Citrus clementina]
 gb|KDO68383.1| hypothetical protein CISIN_1g018781mg [Citrus sinensis]
Length=350

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 74/124 (60%), Gaps = 15/124 (12%)
 Frame = +2

Query  248  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA  427
            +K++ LFE W  ++GK Y+  EE   RF+ FK NLK++ ++      S W   +GLN+FA
Sbjct  42   DKLIELFESWMSKHGKTYKCIEEKLHRFEIFKENLKHIDQRN-KEVTSYW---LGLNEFA  97

Query  428  DLRNEEFKDVFTS-KIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            D+ +EEFK+ +   K + P R++      SA  S R+ K       P SVDWRK+GAVT 
Sbjct  98   DMSHEEFKNKYLGLKPQFPTRRQP-----SAEFSYRDVKA-----LPKSVDWRKKGAVTP  147

Query  605  VKDQ  616
            VK+Q
Sbjct  148  VKNQ  151



>gb|KJB43804.1| hypothetical protein B456_007G216900 [Gossypium raimondii]
Length=277

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 69/124 (56%), Gaps = 9/124 (7%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +++V+ L++ W  ++GK Y    E E RF  FK NLK++ +     + + +  K+GLNKF
Sbjct  32   DDEVMSLYQAWLVKHGKQYNGIGEEENRFDIFKDNLKFIDQHN--SKNTTY--KLGLNKF  87

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL N+E++ +F      P R+     ++ + +  +    +     P SVDWR  GAVT 
Sbjct  88   ADLTNQEYRSMFLGTKSDPKRR-----VMKSKNPSQRYASRAGDSLPESVDWRDHGAVTP  142

Query  605  VKDQ  616
            VKDQ
Sbjct  143  VKDQ  146



>ref|XP_010274449.1| PREDICTED: zingipain-2-like [Nelumbo nucifera]
Length=358

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 70/126 (56%), Gaps = 11/126 (9%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
            + EE+V  LFE W +++GKVY + EE   RF+ F+ NL  V +       S  +   GLN
Sbjct  45   ISEEEVALLFERWMDKHGKVYNNLEEKRRRFKIFQSNLAKVIDWNSKRNPS--DHSAGLN  102

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAV  598
            +F+DL  EEF++   SK+ +    ++ +   +A      K+   +C  P S DWR +GAV
Sbjct  103  QFSDLSFEEFREKHLSKMDL---HQENLLETNA------KRLNSTCTHPLSWDWRYKGAV  153

Query  599  TRVKDQ  616
            T VK+Q
Sbjct  154  TPVKNQ  159



>ref|XP_007132822.1| hypothetical protein PHAVU_011G127400g [Phaseolus vulgaris]
 gb|ESW04816.1| hypothetical protein PHAVU_011G127400g [Phaseolus vulgaris]
Length=341

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 77/156 (49%), Gaps = 23/156 (15%)
 Frame = +2

Query  149  LVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEER  328
            LV  +V  +W    +CY             +PE       E+W  + GKVY+D  E E+R
Sbjct  10   LVLFLVFTLW----TCY--------VMSRRLPEASSSERHEKWMTQYGKVYKDASEREKR  57

Query  329  FQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGIQM  508
            FQ FK N+++++     G        + +NKFADL +EEFK + T+      RK++ +  
Sbjct  58   FQIFKNNVQFIESFNAAGDKPF---NLSINKFADLHSEEFKALLTNGQ----RKERRVWR  110

Query  509  VSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
                    +   K+    P +VDWRKRGAVT +KDQ
Sbjct  111  ARETSFRYDSITKI----PATVDWRKRGAVTSIKDQ  142



>gb|KJB48626.1| hypothetical protein B456_008G078300 [Gossypium raimondii]
Length=286

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 68/124 (55%), Gaps = 8/124 (6%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +++V+ L++ W  ++GK Y    E E+RF+ FK NL+++ E       +    K+GLNKF
Sbjct  39   DDEVMGLYKSWVIQHGKAYNGIGEEEKRFEIFKDNLRFIDEHNSNNNTTY---KLGLNKF  95

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL N+E++  F      P R+     M S V S R    +     P SVDWR  GAV+ 
Sbjct  96   ADLTNQEYRAKFLGTRTDPRRR----LMKSKVPSSR-YAHRAGDNLPDSVDWRDHGAVSP  150

Query  605  VKDQ  616
            VKDQ
Sbjct  151  VKDQ  154



>gb|AAK48495.1|AF259983_1 putative cysteine protease [Ipomoea batatas]
Length=462

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 69/125 (55%), Gaps = 10/125 (8%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRD-EEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK  421
            +E+V+ L+E W   +GK Y     E ++RF+ FK NL+Y+ E+    RG R   K+GLN+
Sbjct  42   DEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQN--SRGDR-SYKLGLNR  98

Query  422  FADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVT  601
            FADL NEE++  +         K    + ++   S R    K     P S+DWR++GAV 
Sbjct  99   FADLTNEEYRSTYLGA------KTDARRRIAKTKSDRRYAPKAGGSLPDSIDWREKGAVA  152

Query  602  RVKDQ  616
             VKDQ
Sbjct  153  EVKDQ  157



>gb|AFW76903.1| hypothetical protein ZEAMMB73_202256 [Zea mays]
Length=151

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 66/117 (56%), Gaps = 13/117 (11%)
 Frame = +2

Query  269  EEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEF  448
            E+W  +  +VY+D  E   RF+ FK N+K+++    GG    W   +G+N+FADL N+EF
Sbjct  38   EQWMAQYSRVYKDAAEKARRFEVFKANVKFIESFNTGGNRKFW---LGINQFADLTNDEF  94

Query  449  KDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEA-PFSVDWRKRGAVTRVKDQ  616
            +   T+K   P   K        V +G  + + VS +A P ++DWR  GAVT +KDQ
Sbjct  95   RTTKTNKGFKPSLDK--------VSTGF-RYENVSVDAIPATIDWRTNGAVTPIKDQ  142



>ref|XP_010091714.1| Fruit bromelain [Morus notabilis]
 gb|EXB44998.1| Fruit bromelain [Morus notabilis]
Length=621

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 81/164 (49%), Gaps = 26/164 (16%)
 Frame = +2

Query  128  SLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRD  307
            +L+G    + L+V  +W     C              + E  +    E+W  R+G+VY+D
Sbjct  4    TLEGTTIFLALLVLGIWASQADC-----------RRPLDEASIRAKHEQWMARHGRVYKD  52

Query  308  EEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFR  487
              E EER + FK N++YVK        +    K+ +N+FADL N+EF            R
Sbjct  53   NAEKEERLKIFKENMEYVKNFNSQKNQTF---KLSINRFADLTNKEF-----------IR  98

Query  488  KKQGIQMVSAVHSGRE-KKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
             + G ++VS     +    + +S +AP S+DWR++GAVT VK+Q
Sbjct  99   YRTGGKLVSRPPGVQSLAYEALSGDAPSSIDWRQKGAVTSVKEQ  142



>dbj|BAC75926.1| cysteine protease-4 [Helianthus annuus]
Length=352

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 83/158 (53%), Gaps = 18/158 (11%)
 Frame = +2

Query  146  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  325
            FLVF+ V A  C  ++  +     A      +   KV+ LFE W  ++ K+Y   +E   
Sbjct  13   FLVFVSVLA--CSALANEFSILGYAPEDLTSI--HKVIHLFESWLAKHSKIYESLDEKLH  68

Query  326  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTS-KIKMPFRKKQGI  502
            RF+ F  NLK++ + T     + W   +GLN+FADL +EEFK+ F   K ++P RK + I
Sbjct  69   RFEIFMDNLKHI-DDTNKKVSNYW---LGLNEFADLTHEEFKNKFLGLKGELPERKDESI  124

Query  503  QMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
            +         E   +   + P SVDWRK+GAV  VK+Q
Sbjct  125  E---------EFSYRDFVDLPKSVDWRKKGAVAPVKNQ  153



>ref|XP_007018686.1| Xylem cysteine peptidase 1 [Theobroma cacao]
 gb|EOY15911.1| Xylem cysteine peptidase 1 [Theobroma cacao]
Length=355

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 79/158 (50%), Gaps = 14/158 (9%)
 Frame = +2

Query  146  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  325
            FLV   +    C  ++  +D   +  +       +K++ LFE W  ++ KVY   EE   
Sbjct  10   FLVSFSLCLFACSALA--HDFSILGYSPDDLTSTDKLIDLFESWMSKHKKVYDSIEEKLH  67

Query  326  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGIQ  505
            RF  FK NL ++ E T     + W   +GLN+FADL +EEFK       KM    K  + 
Sbjct  68   RFDIFKDNLMHIDE-TNKKISNYW---LGLNEFADLSHEEFK-------KMYLGLKVDLS  116

Query  506  MVSA-VHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
             +S    S  E   +   + P SVDWRK+GAVTRVK+Q
Sbjct  117  RISGRSESDEEFTYREVMDLPKSVDWRKKGAVTRVKNQ  154



>ref|XP_002305072.2| hypothetical protein POPTR_0004s05520g [Populus trichocarpa]
 gb|EEE85583.2| hypothetical protein POPTR_0004s05520g [Populus trichocarpa]
Length=340

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 85/157 (54%), Gaps = 25/157 (16%)
 Frame = +2

Query  146  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  325
            F+ FL++ A W   ++C                +E +L+  EEW  ++G+VY D +E E+
Sbjct  11   FVPFLLILAAWATKIAC-----------RPLDEQEYMLKRHEEWMAQHGRVYGDMKEKEK  59

Query  326  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGIQ  505
            R+  FK N++ ++       GS    K+G+NKFADL NEEF+ ++         K+Q  +
Sbjct  60   RYLIFKENIERIEAFN---NGSDRGYKLGVNKFADLTNEEFRAMYHG------YKRQSSK  110

Query  506  MVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
            ++S+      + + +S + P S+DWR  GAVT VKDQ
Sbjct  111  LMSSSF----RYENLS-DIPTSMDWRNDGAVTPVKDQ  142



>ref|XP_010094652.1| Cysteine proteinase RD21a [Morus notabilis]
 gb|EXB56503.1| Cysteine proteinase RD21a [Morus notabilis]
Length=463

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 70/124 (56%), Gaps = 15/124 (12%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +++V+ ++E W  ++GKVY    E E+RFQ FK NL+++ E     R      K+GLN+F
Sbjct  44   DDEVMAIYEAWLVKHGKVYNALGEKEKRFQIFKDNLRFIDEHNAQDR----PYKLGLNRF  99

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++  +         K +G + VS  ++ R     V  + P  VDWRK GAV  
Sbjct  100  ADLTNEEYRSTYLGT------KIRGQKKVSQRYAPR-----VGDDLPSFVDWRKEGAVVG  148

Query  605  VKDQ  616
            VKDQ
Sbjct  149  VKDQ  152



>ref|XP_011000919.1| PREDICTED: cysteine proteinase RD21a-like [Populus euphratica]
Length=488

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 69/124 (56%), Gaps = 9/124 (7%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            E + LRL+E W   +GK Y    E E RF+ FK NLK+V +    G  S    K+GLNKF
Sbjct  53   EAETLRLYEMWLVEHGKAYNALGEKERRFEIFKDNLKFVDQHNSVGNPSY---KLGLNKF  109

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++  +    +M  +++    ++    S R   K    + P SVDWR++GAV  
Sbjct  110  ADLSNEEYRAAYLG-TRMDGKRR----LLGGPKSARYLFKDGD-DLPESVDWREKGAVAP  163

Query  605  VKDQ  616
            VKDQ
Sbjct  164  VKDQ  167



>ref|XP_011074065.1| PREDICTED: xylem cysteine proteinase 2-like [Sesamum indicum]
Length=354

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 75/125 (60%), Gaps = 16/125 (13%)
 Frame = +2

Query  248  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA  427
            +K++ LFE W +++GK Y+  EE   RF+ FK NLK++ E+      + W   +GLN+FA
Sbjct  44   DKLINLFESWIDKHGKKYKSLEEKLHRFEIFKDNLKHIDERNKVAS-NYW---LGLNEFA  99

Query  428  DLRNEEFKDVFTS--KIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVT  601
            D+ ++EFK+++      ++P R +          S +E K +     P SVDWRK+GAVT
Sbjct  100  DMSHDEFKNMYLGLKTDQLPKRDE----------SRQEFKYRDVESLPKSVDWRKKGAVT  149

Query  602  RVKDQ  616
            RVK+Q
Sbjct  150  RVKNQ  154



>sp|P00784.1|PAPA1_CARPA RecName: Full=Papain; AltName: Full=Papaya proteinase I; Short=PPI; 
AltName: Allergen=Car p 1; Flags: Precursor [Carica papaya]
 gb|AAB02650.1| papain precursor [Carica papaya]
 gb|AAA72774.1| papain [synthetic construct]
 prf||1303270A papain
Length=345

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 68/123 (55%), Gaps = 12/123 (10%)
 Frame = +2

Query  248  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA  427
            E++++LFE W  ++ K+Y++ +E   RF+ FK NLKY+ E T     S W   +GLN FA
Sbjct  42   ERLIQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDE-TNKKNNSYW---LGLNVFA  97

Query  428  DLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRV  607
            D+ N+EFK+ +T  I   +   +         S  E         P  VDWR++GAVT V
Sbjct  98   DMSNDEFKEKYTGSIAGNYTTTE--------LSYEEVLNDGDVNIPEYVDWRQKGAVTPV  149

Query  608  KDQ  616
            K+Q
Sbjct  150  KNQ  152



>gb|ABQ10200.1| cysteine protease Cp2 [Actinidia deliciosa]
Length=376

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 67/127 (53%), Gaps = 15/127 (12%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +E+V+ ++ EW  ++GK Y    E E RF+ FK NLK+V E     R      KVGLN+F
Sbjct  40   DEEVMGIYAEWLAKHGKAYNGIGERERRFEIFKDNLKFVDEHNSENRSY----KVGLNRF  95

Query  425  ADLRNEEFKDVFT---SKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGA  595
            ADL NEE++ +F    +  K  F K +      AV          S   P SVDWR+ GA
Sbjct  96   ADLTNEEYRSMFLGTKTDSKRRFMKSKSASRRYAVQD--------SDMLPESVDWRESGA  147

Query  596  VTRVKDQ  616
            V  +KDQ
Sbjct  148  VAPIKDQ  154



>ref|XP_002446222.1| hypothetical protein SORBIDRAFT_06g005410 [Sorghum bicolor]
 gb|EES10550.1| hypothetical protein SORBIDRAFT_06g005410 [Sorghum bicolor]
Length=340

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 82/159 (52%), Gaps = 23/159 (14%)
 Frame = +2

Query  143  GFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYE  322
            G ++ ++  A++CG      D             +  ++   E+W  +  +VY+D  E  
Sbjct  6    GSILAILGLALFCGAALAARDLND----------DSAMVARHEQWMAQYNRVYKDATEKA  55

Query  323  ERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGI  502
            +RF+ FK N+K+++    GG    W   +G+N+FADL N+EF+   T+K   P   K   
Sbjct  56   QRFEVFKANVKFIESFNAGGNRKFW---LGVNQFADLTNDEFRATKTNKGFKPSPVK---  109

Query  503  QMVSAVHSGREKKKKVSCEA-PFSVDWRKRGAVTRVKDQ  616
                 V +G  + + VS +A P S+DWR +GAVT +KDQ
Sbjct  110  -----VPTGF-RYENVSVDALPASIDWRTKGAVTPIKDQ  142



>emb|CDX75496.1| BnaA01g02060D [Brassica napus]
Length=356

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 83/166 (50%), Gaps = 14/166 (8%)
 Frame = +2

Query  119  TKCSLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKV  298
            T  SL     LV +  +A+ C  ++   D   I          + +L+LFE W   + K 
Sbjct  5    TPSSLAKLSLLVAISASALICSALA--RDFSIIGYTPEHLSSTDNLLKLFESWMSEHSKA  62

Query  299  YRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKM  478
            Y+  EE   RF+ F+ NL ++ ++         E  +GLN+FADL +EEFK  +    K 
Sbjct  63   YQSVEEKVHRFEVFRDNLMHIDQR----NNEISEYWLGLNEFADLTHEEFKRKYLGLAKP  118

Query  479  PFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
             F +++         SG  + + V+ + P SVDWRK+GAVT VK+Q
Sbjct  119  QFSRER-------RPSGNFRYRDVT-DLPKSVDWRKKGAVTPVKNQ  156



>ref|NP_001238219.1| P34 probable thiol protease precursor [Glycine max]
 gb|AAB09252.1| 34 kDa maturing seed vacuolar thiol protease precursor [Glycine 
max]
Length=379

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
              +++V  LF+ WK  +G+VY + EE  +R + FK N  Y+++     R S    ++GLN
Sbjct  35   TTQKQVSSLFQLWKSEHGRVYHNHEEEAKRLEIFKNNSNYIRDMNA-NRKSPHSHRLGLN  93

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCE-APFSVDWRKRGA  595
            KFAD+  +EF   +   ++ P    Q I+M +     + KK++ SC+  P S DWRK+G 
Sbjct  94   KFADITPQEFSKKY---LQAPKDVSQQIKMANK----KMKKEQYSCDHPPASWDWRKKGV  146

Query  596  VTRVKDQ  616
            +T+VK Q
Sbjct  147  ITQVKYQ  153



>emb|CAE54307.1| cysteine proteinase [Gossypium hirsutum]
Length=372

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 70/124 (56%), Gaps = 8/124 (6%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +++V+ L++ W  ++GK Y    E E+RF+ FK NL+++ E       +    K+GLNKF
Sbjct  39   DDEVMGLYKSWVIQHGKAYNGIGEEEKRFEIFKDNLRFIDEHNSNNNTTY---KLGLNKF  95

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL N+E++  F      P R+    ++ S+ ++ R          P SV+WR  GAV+R
Sbjct  96   ADLTNQEYRAKFLGTRTDPRRRLMKSKIPSSRYAHRAGDN-----LPDSVNWRDHGAVSR  150

Query  605  VKDQ  616
            VKDQ
Sbjct  151  VKDQ  154



>ref|XP_010501397.1| PREDICTED: zingipain-2-like, partial [Camelina sativa]
Length=416

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 65/124 (52%), Gaps = 11/124 (9%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
             + +  LF++W +R+GK Y  EEE + R Q FK N  +V +  +    +     + LN F
Sbjct  3    SDDISELFDDWCQRHGKTYGSEEERQHRVQIFKDNHDFVTKHNLIANATY---SLSLNAF  59

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL + EFK   TS++ +         +V A   G+     V  + P SVDWRK GAVT 
Sbjct  60   ADLTHTEFK---TSRLGLSVSAP---SLVMASSKGKSLGGTV--KVPDSVDWRKNGAVTN  111

Query  605  VKDQ  616
            VKDQ
Sbjct  112  VKDQ  115



>ref|XP_008799257.1| PREDICTED: xylem cysteine proteinase 1-like [Phoenix dactylifera]
Length=351

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 72/123 (59%), Gaps = 11/123 (9%)
 Frame = +2

Query  251  KVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFAD  430
            +++ LFE W  ++ K Y D EE   RF+ FK NLK++ E T   R S W   +GLN+FAD
Sbjct  40   RLIDLFETWMAKHSKSYADLEEKLRRFEIFKDNLKHIDE-TNKERSSYW---LGLNEFAD  95

Query  431  LRNEEFKDVFTS-KIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRV  607
            + +EEFK+ +   K  +P ++       +A  S +    +     P SVDWRK+GAVT+V
Sbjct  96   MSHEEFKEKYLGLKPHLPSKRD------AASKSSKPFVYENLMLLPKSVDWRKKGAVTQV  149

Query  608  KDQ  616
            K+Q
Sbjct  150  KNQ  152



>sp|P22895.1|P34_SOYBN RecName: Full=P34 probable thiol protease; Flags: Precursor [Glycine 
max]
Length=379

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
 Frame = +2

Query  239  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  418
              +++V  LF+ WK  +G+VY + EE  +R + FK N  Y+++     R S    ++GLN
Sbjct  35   TTQKQVSSLFQLWKSEHGRVYHNHEEEAKRLEIFKNNSNYIRDMNA-NRKSPHSHRLGLN  93

Query  419  KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCE-APFSVDWRKRGA  595
            KFAD+  +EF   +   ++ P    Q I+M +     + KK++ SC+  P S DWRK+G 
Sbjct  94   KFADITPQEFSKKY---LQAPKDVSQQIKMANK----KMKKEQYSCDHPPASWDWRKKGV  146

Query  596  VTRVKDQ  616
            +T+VK Q
Sbjct  147  ITQVKYQ  153



>gb|EPS65491.1| hypothetical protein M569_09284 [Genlisea aurea]
Length=339

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 72/123 (59%), Gaps = 11/123 (9%)
 Frame = +2

Query  248  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA  427
            +K++ LFE W +++ + Y   EE  +RF+ F+ NLK+++E+      + W   +GLNKFA
Sbjct  24   DKLVNLFESWIQKHTRKYETIEEKLQRFEVFRDNLKHIEERN-KAISNYW---LGLNKFA  79

Query  428  DLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRV  607
            D+ ++EFK       KM    K G  +     S +E K +     P SVDWRK+GAVTRV
Sbjct  80   DMTHDEFK-------KMYLGLKSGPLLHLKNGSPQEFKYRDLQVIPKSVDWRKKGAVTRV  132

Query  608  KDQ  616
            KDQ
Sbjct  133  KDQ  135



>gb|AAX84673.1| cysteine protease CP1 [Manihot esculenta]
Length=467

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 66/124 (53%), Gaps = 11/124 (9%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +++V+ ++EEW  + GKVY    E E+RFQ FK NL+++ E     R      K+GLN F
Sbjct  45   DDEVMAIYEEWLVKQGKVYNALGEREKRFQVFKDNLRFIDEHNSENRTY----KLGLNGF  100

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++  +          + G++      +      +V    P SVDWRK GAV  
Sbjct  101  ADLTNEEYRSTY-------LGARGGMKRNRLRKTSDRYAPRVGESLPDSVDWRKEGAVAE  153

Query  605  VKDQ  616
            VKDQ
Sbjct  154  VKDQ  157



>ref|XP_006857794.1| hypothetical protein AMTR_s00061p00214890 [Amborella trichopoda]
 gb|ERN19261.1| hypothetical protein AMTR_s00061p00214890 [Amborella trichopoda]
Length=342

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 63/117 (54%), Gaps = 14/117 (12%)
 Frame = +2

Query  266  FEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEE  445
            FE+W   +G++Y+D +E E+R Q F+ NLK++      GR      K+  NKFADL N+E
Sbjct  43   FEQWMALHGRLYKDAQEKEQRSQIFEENLKFIDSVNAEGRLY----KLSTNKFADLTNDE  98

Query  446  FKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
            FK      + M F+  +      A           +  AP S+DWRK+GAVT VKDQ
Sbjct  99   FK-----AMHMGFKGHE-----CATRESDAPFMYANVSAPASMDWRKKGAVTPVKDQ  145



>emb|CAA46863.1| thiolprotease [Pisum sativum]
Length=464

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 67/123 (54%), Gaps = 9/123 (7%)
 Frame = +2

Query  248  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA  427
            ++VL ++EEW  ++GK Y    E E+RF+ FK NL ++ E            ++GLN+FA
Sbjct  41   DQVLTMYEEWLVKHGKNYNALGEKEKRFEIFKDNLGFIDEH----NSKNLSFRLGLNRFA  96

Query  428  DLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRV  607
            DL NEE++  F      P R+ + +   +  ++ R   K      P SVDWRK GAV  V
Sbjct  97   DLTNEEYRTRFLGTRINPNRRNRKVNSQTNRYATRVGDK-----LPESVDWRKEGAVVGV  151

Query  608  KDQ  616
            KDQ
Sbjct  152  KDQ  154



>gb|KJB48624.1| hypothetical protein B456_008G078300 [Gossypium raimondii]
Length=314

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 68/124 (55%), Gaps = 8/124 (6%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +++V+ L++ W  ++GK Y    E E+RF+ FK NL+++ E       +    K+GLNKF
Sbjct  39   DDEVMGLYKSWVIQHGKAYNGIGEEEKRFEIFKDNLRFIDEHNSNNNTTY---KLGLNKF  95

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL N+E++  F      P R+     M S V S R    +     P SVDWR  GAV+ 
Sbjct  96   ADLTNQEYRAKFLGTRTDPRRR----LMKSKVPSSR-YAHRAGDNLPDSVDWRDHGAVSP  150

Query  605  VKDQ  616
            VKDQ
Sbjct  151  VKDQ  154



>ref|XP_006857797.1| hypothetical protein AMTR_s00061p00215400 [Amborella trichopoda]
 gb|ERN19264.1| hypothetical protein AMTR_s00061p00215400 [Amborella trichopoda]
Length=347

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 63/119 (53%), Gaps = 18/119 (15%)
 Frame = +2

Query  266  FEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEE  445
            FE+W   +G+ Y D +E E+R Q F+ NLK++     GGR      K+  NKFADL N+E
Sbjct  45   FEQWMALHGRQYMDAQEKEQRSQIFEENLKFIDSVNAGGRPY----KLSANKFADLTNDE  100

Query  446  FKDVFTS--KIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
            F+ +       + P R      M + V             AP S+DWRK+GAVT+VKDQ
Sbjct  101  FRAMHMGFKGHECPTRASDAPFMYANV------------SAPASMDWRKKGAVTQVKDQ  147



>ref|XP_008659254.1| PREDICTED: ervatamin-B-like [Zea mays]
Length=359

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 65/122 (53%), Gaps = 3/122 (2%)
 Frame = +2

Query  254  VLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADL  433
            +L  F+ W+    + Y   EE+++RF  +  N++++K       GS +E  +G N+F DL
Sbjct  36   LLERFKAWQAEYNRTYTTPEEFQQRFMVYSENVRFIKTMNQLSTGSSYE--LGENQFTDL  93

Query  434  RNEEFKDVFTSKI-KMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVK  610
              EEFKD +  K+ + P   +     V  + +        + EAP SVDWR +GAVT VK
Sbjct  94   TEEEFKDTYLMKLDEQPPAAEAMPPTVGTMSTAGMSNGDNTGEAPNSVDWRTKGAVTPVK  153

Query  611  DQ  616
            +Q
Sbjct  154  NQ  155



>ref|XP_002313136.2| hypothetical protein POPTR_0009s10090g [Populus trichocarpa]
 gb|EEE87091.2| hypothetical protein POPTR_0009s10090g [Populus trichocarpa]
Length=477

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 69/124 (56%), Gaps = 9/124 (7%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            E + LRL+E W  + GK Y    E E RF+ FK NLK+V +    G  S    K+GLNKF
Sbjct  42   EAETLRLYEMWLVKYGKAYNALGEKERRFEIFKDNLKFVDQHNSVGNPSY---KLGLNKF  98

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++  +    +M  +++    ++    S R   K    + P SVDWR++GAV  
Sbjct  99   ADLSNEEYRAAYLGT-RMDGKRR----LLGGPKSARYLFKDGD-DLPESVDWREKGAVAP  152

Query  605  VKDQ  616
            VKDQ
Sbjct  153  VKDQ  156



>ref|XP_010270819.1| PREDICTED: cysteine proteinase RD21a-like [Nelumbo nucifera]
Length=474

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 68/128 (53%), Gaps = 19/128 (15%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +++V  L+E W   +GK Y    E E RF+ FK NL+++ E   G R      KVGLN+F
Sbjct  49   DQEVRGLYESWLVTHGKAYNALGEKERRFEIFKDNLRFIDEHNSGNRTY----KVGLNRF  104

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEA----PFSVDWRKRG  592
            ADL N+E++ ++      P R+           + R K  + + +A    P SVDWR +G
Sbjct  105  ADLTNDEYRAMYLGTKLNPNRR-----------ASRPKSNRYAFQAGDALPDSVDWRDKG  153

Query  593  AVTRVKDQ  616
            AV  VKDQ
Sbjct  154  AVVAVKDQ  161



>ref|NP_974687.1| xylem cysteine proteinase 1 [Arabidopsis thaliana]
 gb|AEE86502.1| xylem cysteine proteinase 1 [Arabidopsis thaliana]
Length=288

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 81/164 (49%), Gaps = 16/164 (10%)
 Frame = +2

Query  128  SLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRD  307
            SL     LV +  +A+ C   +   D   +          +K+L LFE W   + K Y+ 
Sbjct  7    SLSKFSLLVAISASALLCCAFA--RDFSIVGYTPEHLTNTDKLLELFESWMSEHSKAYKS  64

Query  308  EEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPF-  484
             EE   RF+ F+ NL ++ ++      S W   +GLN+FADL +EEFK  +    K  F 
Sbjct  65   VEEKVHRFEVFRENLMHIDQRN-NEINSYW---LGLNEFADLTHEEFKGRYLGLAKPQFS  120

Query  485  RKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
            RK+Q         S   + + ++ + P SVDWRK+GAV  VKDQ
Sbjct  121  RKRQP--------SANFRYRDIT-DLPKSVDWRKKGAVAPVKDQ  155



>ref|XP_006445658.1| hypothetical protein CICLE_v10015798mg [Citrus clementina]
 gb|ESR58898.1| hypothetical protein CICLE_v10015798mg [Citrus clementina]
Length=348

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 72/124 (58%), Gaps = 9/124 (7%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            E+ V+ + E+W  ++G+ Y+DE E E R + FK NL+Y+++    G  +    K+G N+F
Sbjct  40   EQSVVEIHEKWMAQHGRRYKDELEKEMRLKIFKENLEYIEKANKEGNRTY---KLGTNQF  96

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            +DL N+EF+ ++T   KMP    +     S   S  + +     + P S+DWR +GAVT 
Sbjct  97   SDLTNDEFRALYTG-YKMPSPSHR-----STTSSTFKYQNLSMTDVPTSLDWRDKGAVTP  150

Query  605  VKDQ  616
            +K+Q
Sbjct  151  IKNQ  154



>gb|KJB48622.1| hypothetical protein B456_008G078300 [Gossypium raimondii]
Length=372

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 68/124 (55%), Gaps = 8/124 (6%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +++V+ L++ W  ++GK Y    E E+RF+ FK NL+++ E       +    K+GLNKF
Sbjct  39   DDEVMGLYKSWVIQHGKAYNGIGEEEKRFEIFKDNLRFIDEHNSNNNTTY---KLGLNKF  95

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL N+E++  F      P R+     M S V S R    +     P SVDWR  GAV+ 
Sbjct  96   ADLTNQEYRAKFLGTRTDPRRR----LMKSKVPSSR-YAHRAGDNLPDSVDWRDHGAVSP  150

Query  605  VKDQ  616
            VKDQ
Sbjct  151  VKDQ  154



>dbj|BAE80740.1| cysteine proteinase [Platycodon grandiflorus]
Length=462

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 67/124 (54%), Gaps = 12/124 (10%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +++V+ ++E W  ++GK Y    E E+RFQ FK NL+++ E       S    KVGLN+F
Sbjct  43   DDEVMAMYESWLVKHGKSYNALGEKEKRFQIFKDNLRFIDEHNAEENLSY---KVGLNRF  99

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL NEE++  +      P         +S V S R    +V    P SVDWR +GAV  
Sbjct  100  ADLTNEEYRSTYLGAKSKP--------KLSKVKSDR-YAPRVGDSLPESVDWRAKGAVAP  150

Query  605  VKDQ  616
            +KDQ
Sbjct  151  IKDQ  154



>gb|KJB48625.1| hypothetical protein B456_008G078300 [Gossypium raimondii]
Length=372

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 68/124 (55%), Gaps = 8/124 (6%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +++V+ L++ W  ++GK Y    E E+RF+ FK NL+++ E       +    K+GLNKF
Sbjct  39   DDEVMGLYKSWVIQHGKAYNGIGEEEKRFEIFKDNLRFIDEHNSNNNTTY---KLGLNKF  95

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL N+E++  F      P R+     M S V S R    +     P SVDWR  GAV+ 
Sbjct  96   ADLTNQEYRAKFLGTRTDPRRR----LMKSKVPSSR-YAHRAGDNLPDSVDWRDHGAVSP  150

Query  605  VKDQ  616
            VKDQ
Sbjct  151  VKDQ  154



>tpg|DAA35682.1| TPA: cysteine proteinase Mir3 [Zea mays]
Length=468

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 65/124 (52%), Gaps = 9/124 (7%)
 Frame = +2

Query  245  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  424
            +E+  R++ EW   +G+ Y    E E R+Q F+ NL+Y+              ++GLN+F
Sbjct  39   DEEARRMYAEWMAAHGRTYNAVGEEERRYQVFRDNLRYIDAHNAAADAGVHSFRLGLNRF  98

Query  425  ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTR  604
            ADL N+E++  +      P R++   ++ +  H+   +      + P SVDWR +GAV  
Sbjct  99   ADLTNDEYRATYLGARTRPQRER---KLGARYHAADNE------DLPESVDWRAKGAVAE  149

Query  605  VKDQ  616
            VKDQ
Sbjct  150  VKDQ  153



>ref|XP_007025398.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOY28020.1| Senescence-associated gene 12 [Theobroma cacao]
Length=338

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 76/164 (46%), Gaps = 41/164 (25%)
 Frame = +2

Query  149  LVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEER  328
            L  L +  +W    S               VPE  +   FE+W    G+VY+D  E E+R
Sbjct  8    LALLFIVGIWACQAS------------SRSVPEVSMSDRFEQWLASCGRVYQDASEKEKR  55

Query  329  FQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDV--------FTSKIKMPF  484
             Q FK N++Y++        +  + K+G+N+F DL NEEFK +         TS  K  F
Sbjct  56   LQIFKENVEYIESHNA---DTSKKYKLGVNEFTDLTNEEFKAMRNGYKLRPSTSSKKSSF  112

Query  485  RKKQGIQMVSAVHSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ  616
            R +     V+AV              P S+DWRK+GAVT +KDQ
Sbjct  113  RYEN----VAAV--------------PSSMDWRKKGAVTNIKDQ  138



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090