BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS020F02

Length=627
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011078363.1|  PREDICTED: probable ADP-ribosylation factor ...    273   3e-83   Sesamum indicum [beniseed]
ref|XP_004251595.1|  PREDICTED: probable ADP-ribosylation factor ...    264   4e-80   Solanum lycopersicum
ref|XP_009776200.1|  PREDICTED: probable ADP-ribosylation factor ...    263   6e-80   Nicotiana sylvestris
ref|XP_009776199.1|  PREDICTED: probable ADP-ribosylation factor ...    263   6e-80   Nicotiana sylvestris
ref|XP_009627509.1|  PREDICTED: probable ADP-ribosylation factor ...    261   3e-79   Nicotiana tomentosiformis
ref|XP_009627508.1|  PREDICTED: probable ADP-ribosylation factor ...    261   4e-79   Nicotiana tomentosiformis
ref|XP_006353447.1|  PREDICTED: probable ADP-ribosylation factor ...    261   8e-79   Solanum tuberosum [potatoes]
emb|CDP03358.1|  unnamed protein product                                257   3e-77   Coffea canephora [robusta coffee]
gb|EPS61339.1|  hypothetical protein M569_13457                         248   6e-77   Genlisea aurea
gb|KJB27129.1|  hypothetical protein B456_004G279500                    251   3e-76   Gossypium raimondii
ref|XP_010047752.1|  PREDICTED: probable ADP-ribosylation factor ...    253   1e-75   Eucalyptus grandis [rose gum]
ref|XP_010047751.1|  PREDICTED: probable ADP-ribosylation factor ...    253   1e-75   Eucalyptus grandis [rose gum]
ref|XP_008352294.1|  PREDICTED: probable ADP-ribosylation factor ...    248   6e-75   
ref|XP_008242599.1|  PREDICTED: probable ADP-ribosylation factor ...    250   2e-74   Prunus mume [ume]
ref|XP_008343980.1|  PREDICTED: probable ADP-ribosylation factor ...    248   4e-74   
gb|KJB54159.1|  hypothetical protein B456_009G023500                    246   5e-74   Gossypium raimondii
ref|XP_007203783.1|  hypothetical protein PRUPE_ppa001945mg             248   6e-74   Prunus persica
ref|XP_007013231.1|  NSP-interacting GTPase, putative isoform 1         249   6e-74   
ref|XP_007013233.1|  NSP-interacting GTPase, putative isoform 3         248   7e-74   
ref|XP_007013232.1|  NSP-interacting GTPase, putative isoform 2         248   9e-74   
ref|XP_009352480.1|  PREDICTED: probable ADP-ribosylation factor ...    247   1e-73   Pyrus x bretschneideri [bai li]
ref|XP_009336872.1|  PREDICTED: probable ADP-ribosylation factor ...    247   2e-73   Pyrus x bretschneideri [bai li]
ref|XP_010254182.1|  PREDICTED: probable ADP-ribosylation factor ...    247   3e-73   Nelumbo nucifera [Indian lotus]
ref|XP_010088856.1|  putative ADP-ribosylation factor GTPase-acti...    247   4e-73   
gb|KJB27131.1|  hypothetical protein B456_004G279500                    246   4e-73   Gossypium raimondii
gb|KHN21549.1|  Arf-GAP domain and FG repeat-containing protein 1       245   4e-73   Glycine soja [wild soybean]
gb|KJB27127.1|  hypothetical protein B456_004G279500                    246   5e-73   Gossypium raimondii
gb|KJB27126.1|  hypothetical protein B456_004G279500                    246   5e-73   Gossypium raimondii
gb|KJB27130.1|  hypothetical protein B456_004G279500                    246   5e-73   Gossypium raimondii
ref|XP_010934816.1|  PREDICTED: probable ADP-ribosylation factor ...    243   6e-73   
gb|KHG08531.1|  hypothetical protein F383_13599                         245   7e-73   Gossypium arboreum [tree cotton]
ref|XP_010249829.1|  PREDICTED: probable ADP-ribosylation factor ...    246   7e-73   Nelumbo nucifera [Indian lotus]
ref|XP_010656352.1|  PREDICTED: actin cytoskeleton-regulatory com...    246   7e-73   Vitis vinifera
ref|XP_002281316.2|  PREDICTED: probable ADP-ribosylation factor ...    246   7e-73   Vitis vinifera
ref|XP_004167945.1|  PREDICTED: uncharacterized LOC101209764            245   8e-73   
ref|XP_006580462.1|  PREDICTED: probable ADP-ribosylation factor ...    244   9e-73   Glycine max [soybeans]
ref|XP_010249832.1|  PREDICTED: probable ADP-ribosylation factor ...    245   1e-72   Nelumbo nucifera [Indian lotus]
ref|XP_008242637.1|  PREDICTED: probable ADP-ribosylation factor ...    245   1e-72   
gb|KJB27128.1|  hypothetical protein B456_004G279500                    243   1e-72   Gossypium raimondii
ref|XP_009415353.1|  PREDICTED: probable ADP-ribosylation factor ...    242   2e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011458060.1|  PREDICTED: probable ADP-ribosylation factor ...    244   2e-72   Fragaria vesca subsp. vesca
ref|XP_008458192.1|  PREDICTED: probable ADP-ribosylation factor ...    243   3e-72   Cucumis melo [Oriental melon]
ref|XP_004287082.1|  PREDICTED: probable ADP-ribosylation factor ...    243   4e-72   Fragaria vesca subsp. vesca
ref|XP_004512853.1|  PREDICTED: probable ADP-ribosylation factor ...    241   2e-71   Cicer arietinum [garbanzo]
ref|XP_004512854.1|  PREDICTED: probable ADP-ribosylation factor ...    241   2e-71   Cicer arietinum [garbanzo]
gb|KHG17023.1|  hypothetical protein F383_09821                         242   2e-71   Gossypium arboreum [tree cotton]
gb|KJB64872.1|  hypothetical protein B456_010G069100                    241   3e-71   Gossypium raimondii
ref|XP_004139426.1|  PREDICTED: uncharacterized protein LOC101209764    239   3e-71   
ref|XP_009415351.1|  PREDICTED: probable ADP-ribosylation factor ...    239   4e-71   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO54160.1|  hypothetical protein CISIN_1g004435mg                   239   5e-71   Citrus sinensis [apfelsine]
gb|KJB54155.1|  hypothetical protein B456_009G023500                    241   5e-71   Gossypium raimondii
gb|KJB54158.1|  hypothetical protein B456_009G023500                    241   5e-71   Gossypium raimondii
gb|KJB54156.1|  hypothetical protein B456_009G023500                    240   6e-71   Gossypium raimondii
gb|KDP32306.1|  hypothetical protein JCGZ_13231                         240   8e-71   Jatropha curcas
ref|XP_010933331.1|  PREDICTED: probable ADP-ribosylation factor ...    238   1e-70   
ref|XP_010931848.1|  PREDICTED: probable ADP-ribosylation factor ...    238   1e-70   Elaeis guineensis
ref|XP_006844366.1|  hypothetical protein AMTR_s00142p00058560          240   1e-70   
ref|XP_010934106.1|  PREDICTED: probable ADP-ribosylation factor ...    238   3e-70   Elaeis guineensis
ref|XP_008804233.1|  PREDICTED: probable ADP-ribosylation factor ...    236   8e-70   Phoenix dactylifera
ref|XP_008804232.1|  PREDICTED: probable ADP-ribosylation factor ...    236   9e-70   Phoenix dactylifera
ref|XP_010915040.1|  PREDICTED: probable ADP-ribosylation factor ...    236   1e-69   Elaeis guineensis
ref|XP_006584844.1|  PREDICTED: probable ADP-ribosylation factor ...    236   2e-69   Glycine max [soybeans]
ref|XP_007160353.1|  hypothetical protein PHAVU_002G314500g             235   3e-69   Phaseolus vulgaris [French bean]
gb|KDO54162.1|  hypothetical protein CISIN_1g004435mg                   233   1e-68   Citrus sinensis [apfelsine]
ref|XP_006475717.1|  PREDICTED: probable ADP-ribosylation factor ...    234   1e-68   
ref|XP_009412408.1|  PREDICTED: probable ADP-ribosylation factor ...    231   1e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002324405.1|  Rev interacting-like family protein                233   2e-68   
gb|KDO54161.1|  hypothetical protein CISIN_1g004435mg                   233   2e-68   Citrus sinensis [apfelsine]
ref|XP_006583397.1|  PREDICTED: probable ADP-ribosylation factor ...    230   2e-68   Glycine max [soybeans]
ref|XP_011043437.1|  PREDICTED: probable ADP-ribosylation factor ...    234   2e-68   Populus euphratica
ref|XP_006475714.1|  PREDICTED: probable ADP-ribosylation factor ...    234   2e-68   
gb|KDO54156.1|  hypothetical protein CISIN_1g004435mg                   234   2e-68   Citrus sinensis [apfelsine]
gb|KDO54159.1|  hypothetical protein CISIN_1g004435mg                   234   2e-68   Citrus sinensis [apfelsine]
ref|XP_006475716.1|  PREDICTED: probable ADP-ribosylation factor ...    234   2e-68   
ref|XP_008793443.1|  PREDICTED: probable ADP-ribosylation factor ...    232   3e-68   Phoenix dactylifera
ref|XP_007160352.1|  hypothetical protein PHAVU_002G314400g             232   6e-68   Phaseolus vulgaris [French bean]
dbj|BAD25003.1|  human Rev interacting-like protein-like                229   6e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007160351.1|  hypothetical protein PHAVU_002G314400g             231   6e-68   Phaseolus vulgaris [French bean]
ref|XP_010654693.1|  PREDICTED: probable ADP-ribosylation factor ...    231   2e-67   
ref|XP_010688167.1|  PREDICTED: probable ADP-ribosylation factor ...    231   2e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010654688.1|  PREDICTED: probable ADP-ribosylation factor ...    231   2e-67   Vitis vinifera
emb|CBI36171.3|  unnamed protein product                                231   2e-67   Vitis vinifera
ref|XP_009408824.1|  PREDICTED: probable ADP-ribosylation factor ...    229   4e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006647062.1|  PREDICTED: probable ADP-ribosylation factor ...    229   9e-67   Oryza brachyantha
ref|XP_010532839.1|  PREDICTED: probable ADP-ribosylation factor ...    227   2e-66   Tarenaya hassleriana [spider flower]
gb|AFW71361.1|  putative ARF GTPase-activating domain family protein    222   4e-66   
ref|XP_003620547.1|  Arf-GAP domain and FG repeats-containing pro...    226   5e-66   
ref|XP_008808989.1|  PREDICTED: probable ADP-ribosylation factor ...    225   9e-66   Phoenix dactylifera
ref|XP_003620495.1|  Arf-GAP domain and FG repeats-containing pro...    226   1e-65   
ref|XP_006583393.1|  PREDICTED: probable ADP-ribosylation factor ...    225   2e-65   Glycine max [soybeans]
ref|XP_006583396.1|  PREDICTED: probable ADP-ribosylation factor ...    225   2e-65   
ref|XP_006587513.1|  PREDICTED: probable ADP-ribosylation factor ...    222   2e-65   Glycine max [soybeans]
ref|XP_003571599.1|  PREDICTED: probable ADP-ribosylation factor ...    225   2e-65   
ref|XP_002863138.1|  hypothetical protein ARALYDRAFT_358984             222   4e-65   Arabidopsis lyrata subsp. lyrata
gb|EEC72722.1|  hypothetical protein OsI_06328                          224   9e-65   Oryza sativa Indica Group [Indian rice]
ref|XP_003630818.1|  hypothetical protein MTR_8g103750                  223   1e-64   Medicago truncatula
ref|XP_009121281.1|  PREDICTED: probable ADP-ribosylation factor ...    213   2e-64   Brassica rapa
emb|CBI20945.3|  unnamed protein product                                213   2e-64   Vitis vinifera
gb|EMT18497.1|  Putative ADP-ribosylation factor GTPase-activatin...    222   2e-64   
ref|XP_006286186.1|  hypothetical protein CARUB_v10007750mg             221   2e-64   Capsella rubella
emb|CDY01122.1|  BnaA04g06970D                                          221   2e-64   
ref|XP_010450221.1|  PREDICTED: probable ADP-ribosylation factor ...    220   3e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010440592.1|  PREDICTED: probable ADP-ribosylation factor ...    220   3e-64   Camelina sativa [gold-of-pleasure]
ref|NP_001046262.1|  Os02g0208900                                       222   3e-64   
ref|XP_004951486.1|  PREDICTED: probable ADP-ribosylation factor ...    222   4e-64   Setaria italica
ref|NP_193071.2|  NSP (nuclear shuttle protein)-interacting GTPase      220   4e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008808979.1|  PREDICTED: probable ADP-ribosylation factor ...    221   4e-64   Phoenix dactylifera
ref|NP_001146420.1|  uncharacterized protein LOC100280000               221   8e-64   Zea mays [maize]
gb|AFW66088.1|  putative ARF GTPase-activating domain family prot...    220   9e-64   
ref|XP_010435278.1|  PREDICTED: probable ADP-ribosylation factor ...    218   1e-63   Camelina sativa [gold-of-pleasure]
ref|XP_006414927.1|  hypothetical protein EUTSA_v10024713mg             218   2e-63   Eutrema salsugineum [saltwater cress]
gb|ACG43047.1|  GTP-ase activating protein for Arf containing pro...    219   2e-63   Zea mays [maize]
emb|CDY47324.1|  BnaCnng14610D                                          218   2e-63   Brassica napus [oilseed rape]
ref|XP_004512958.1|  PREDICTED: probable ADP-ribosylation factor ...    219   2e-63   
ref|XP_004512959.1|  PREDICTED: probable ADP-ribosylation factor ...    219   3e-63   Cicer arietinum [garbanzo]
ref|XP_004512957.1|  PREDICTED: probable ADP-ribosylation factor ...    219   3e-63   Cicer arietinum [garbanzo]
gb|AGT17187.1|  Arf GTPase activating protein                           219   4e-63   Saccharum hybrid cultivar R570
ref|XP_008681297.1|  PREDICTED: uncharacterized protein LOC100216...    218   6e-63   
ref|XP_009139640.1|  PREDICTED: probable ADP-ribosylation factor ...    216   9e-63   Brassica rapa
ref|XP_009139636.1|  PREDICTED: probable ADP-ribosylation factor ...    216   9e-63   Brassica rapa
ref|XP_009139639.1|  PREDICTED: probable ADP-ribosylation factor ...    216   1e-62   Brassica rapa
ref|XP_006587509.1|  PREDICTED: probable ADP-ribosylation factor ...    217   1e-62   Glycine max [soybeans]
ref|XP_006587510.1|  PREDICTED: probable ADP-ribosylation factor ...    217   1e-62   Glycine max [soybeans]
ref|XP_006450579.1|  hypothetical protein CICLE_v10010498mg             218   1e-62   
ref|XP_006476221.1|  PREDICTED: probable ADP-ribosylation factor ...    218   2e-62   Citrus sinensis [apfelsine]
ref|XP_002324829.2|  hypothetical protein POPTR_0018s01020g             217   5e-62   
ref|XP_010051219.1|  PREDICTED: probable ADP-ribosylation factor ...    213   8e-62   
ref|XP_006829864.1|  hypothetical protein AMTR_s00119p00132020          214   1e-61   
gb|KCW89405.1|  hypothetical protein EUGRSUZ_A01700                     213   2e-61   Eucalyptus grandis [rose gum]
ref|XP_007024065.1|  Uncharacterized protein TCM_028636                 214   2e-61   
ref|XP_009402905.1|  PREDICTED: probable ADP-ribosylation factor ...    213   3e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008219908.1|  PREDICTED: probable ADP-ribosylation factor ...    214   4e-61   Prunus mume [ume]
ref|XP_011459144.1|  PREDICTED: uncharacterized protein LOC105349887    215   4e-61   Fragaria vesca subsp. vesca
gb|EMS60759.1|  putative ADP-ribosylation factor GTPase-activatin...    213   5e-61   Triticum urartu
ref|XP_006654703.1|  PREDICTED: uncharacterized protein LOC102721646    212   5e-61   Oryza brachyantha
gb|KGN60132.1|  hypothetical protein Csa_3G879500                       213   6e-61   Cucumis sativus [cucumbers]
ref|XP_009592974.1|  PREDICTED: probable ADP-ribosylation factor ...    212   8e-61   Nicotiana tomentosiformis
ref|XP_009592977.1|  PREDICTED: probable ADP-ribosylation factor ...    211   8e-61   Nicotiana tomentosiformis
gb|EEC79586.1|  hypothetical protein OsI_20764                          209   1e-60   Oryza sativa Indica Group [Indian rice]
gb|EEE64486.1|  hypothetical protein OsJ_19336                          209   1e-60   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011026537.1|  PREDICTED: probable ADP-ribosylation factor ...    211   3e-60   Populus euphratica
ref|XP_010648572.1|  PREDICTED: probable ADP-ribosylation factor ...    211   4e-60   
ref|XP_009762670.1|  PREDICTED: probable ADP-ribosylation factor ...    209   5e-60   Nicotiana sylvestris
ref|XP_011026535.1|  PREDICTED: probable ADP-ribosylation factor ...    211   6e-60   Populus euphratica
ref|XP_011026534.1|  PREDICTED: probable ADP-ribosylation factor ...    211   6e-60   Populus euphratica
ref|XP_008466359.1|  PREDICTED: probable ADP-ribosylation factor ...    210   6e-60   Cucumis melo [Oriental melon]
gb|EYU35659.1|  hypothetical protein MIMGU_mgv1a004826mg                205   2e-59   Erythranthe guttata [common monkey flower]
gb|EYU35658.1|  hypothetical protein MIMGU_mgv1a004826mg                205   2e-59   Erythranthe guttata [common monkey flower]
ref|XP_007227166.1|  hypothetical protein PRUPE_ppa024658mg             209   2e-59   
gb|KDO79652.1|  hypothetical protein CISIN_1g045661mg                   208   3e-59   Citrus sinensis [apfelsine]
ref|XP_004498622.1|  PREDICTED: probable ADP-ribosylation factor ...    207   6e-59   Cicer arietinum [garbanzo]
ref|XP_008378286.1|  PREDICTED: probable ADP-ribosylation factor ...    203   6e-59   
gb|KDO46629.1|  hypothetical protein CISIN_1g005051mg                   206   1e-58   Citrus sinensis [apfelsine]
ref|XP_006437268.1|  hypothetical protein CICLE_v10030836mg             207   1e-58   Citrus clementina [clementine]
gb|KDO46632.1|  hypothetical protein CISIN_1g005051mg                   206   2e-58   Citrus sinensis [apfelsine]
gb|KDO46634.1|  hypothetical protein CISIN_1g005051mg                   206   2e-58   Citrus sinensis [apfelsine]
gb|KDO46633.1|  hypothetical protein CISIN_1g005051mg                   206   2e-58   Citrus sinensis [apfelsine]
gb|KDO46635.1|  hypothetical protein CISIN_1g005051mg                   206   2e-58   Citrus sinensis [apfelsine]
ref|XP_006484788.1|  PREDICTED: probable ADP-ribosylation factor ...    206   2e-58   Citrus sinensis [apfelsine]
ref|XP_006484787.1|  PREDICTED: probable ADP-ribosylation factor ...    206   2e-58   Citrus sinensis [apfelsine]
gb|KDO46630.1|  hypothetical protein CISIN_1g005051mg                   206   2e-58   Citrus sinensis [apfelsine]
gb|KDO46631.1|  hypothetical protein CISIN_1g005051mg                   206   2e-58   Citrus sinensis [apfelsine]
gb|KDO46636.1|  hypothetical protein CISIN_1g005051mg                   204   4e-58   Citrus sinensis [apfelsine]
gb|KDO46637.1|  hypothetical protein CISIN_1g005051mg                   204   4e-58   Citrus sinensis [apfelsine]
gb|KDO46638.1|  hypothetical protein CISIN_1g005051mg                   204   4e-58   Citrus sinensis [apfelsine]
ref|XP_009377378.1|  PREDICTED: probable ADP-ribosylation factor ...    205   5e-58   Pyrus x bretschneideri [bai li]
ref|XP_008357498.1|  PREDICTED: probable ADP-ribosylation factor ...    205   6e-58   
ref|XP_010653158.1|  PREDICTED: probable ADP-ribosylation factor ...    204   7e-58   Vitis vinifera
ref|NP_001141785.2|  uncharacterized protein LOC100273921               199   8e-58   Zea mays [maize]
gb|AFW71360.1|  putative ARF GTPase-activating domain family protein    204   1e-57   
ref|XP_002440136.1|  hypothetical protein SORBIDRAFT_09g026670          199   1e-57   
ref|XP_011081866.1|  PREDICTED: probable ADP-ribosylation factor ...    204   1e-57   
emb|CDP18429.1|  unnamed protein product                                204   1e-57   Coffea canephora [robusta coffee]
ref|XP_007029909.1|  GTPase activating protein, putative isoform 2      201   4e-57   
gb|KDP39625.1|  hypothetical protein JCGZ_02645                         202   4e-57   Jatropha curcas
gb|EYU33121.1|  hypothetical protein MIMGU_mgv1a020516mg                194   7e-57   Erythranthe guttata [common monkey flower]
ref|XP_007013726.1|  ArfGap/RecO-like zinc finger domain-containi...    202   7e-57   
ref|XP_009796556.1|  PREDICTED: probable ADP-ribosylation factor ...    201   1e-56   Nicotiana sylvestris
ref|XP_007029910.1|  ARF GAP-like zinc finger-containing protein ...    200   2e-56   
ref|XP_009796569.1|  PREDICTED: probable ADP-ribosylation factor ...    200   2e-56   Nicotiana sylvestris
ref|XP_009796563.1|  PREDICTED: probable ADP-ribosylation factor ...    201   2e-56   Nicotiana sylvestris
ref|XP_007029908.1|  ARF GAP-like zinc finger-containing protein ...    200   3e-56   
ref|XP_002309583.2|  hypothetical protein POPTR_0006s26230g             201   3e-56   
ref|XP_006412447.1|  hypothetical protein EUTSA_v10024655mg             199   3e-56   
ref|XP_006364751.1|  PREDICTED: probable ADP-ribosylation factor ...    200   4e-56   Solanum tuberosum [potatoes]
gb|EYU21903.1|  hypothetical protein MIMGU_mgv1a024605mg                195   4e-56   Erythranthe guttata [common monkey flower]
ref|NP_001056151.1|  Os05g0534800                                       197   4e-56   
ref|XP_002319204.1|  ARF GAP-like zinc finger-containing protein ...    199   4e-56   
ref|XP_006375928.1|  hypothetical protein POPTR_0013s06460g             199   5e-56   
emb|CDY68904.1|  BnaCnng61010D                                          196   6e-56   Brassica napus [oilseed rape]
ref|XP_008647576.1|  PREDICTED: uncharacterized protein LOC100273...    198   6e-56   
ref|XP_008443183.1|  PREDICTED: probable ADP-ribosylation factor ...    199   8e-56   Cucumis melo [Oriental melon]
gb|KCW47808.1|  hypothetical protein EUGRSUZ_K015481                    199   8e-56   Eucalyptus grandis [rose gum]
ref|XP_010036277.1|  PREDICTED: probable ADP-ribosylation factor ...    199   9e-56   Eucalyptus grandis [rose gum]
ref|XP_010245794.1|  PREDICTED: probable ADP-ribosylation factor ...    199   1e-55   Nelumbo nucifera [Indian lotus]
emb|CDY65431.1|  BnaA08g29820D                                          197   1e-55   Brassica napus [oilseed rape]
ref|XP_010036278.1|  PREDICTED: probable ADP-ribosylation factor ...    199   1e-55   Eucalyptus grandis [rose gum]
ref|XP_010670775.1|  PREDICTED: uncharacterized protein LOC104887747    199   1e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010245793.1|  PREDICTED: probable ADP-ribosylation factor ...    198   1e-55   Nelumbo nucifera [Indian lotus]
ref|XP_010245795.1|  PREDICTED: probable ADP-ribosylation factor ...    198   1e-55   Nelumbo nucifera [Indian lotus]
ref|XP_004249094.1|  PREDICTED: probable ADP-ribosylation factor ...    198   1e-55   Solanum lycopersicum
gb|KHG17664.1|  hypothetical protein F383_06879                         198   2e-55   Gossypium arboreum [tree cotton]
ref|XP_009107693.1|  PREDICTED: probable ADP-ribosylation factor ...    196   2e-55   Brassica rapa
ref|XP_009107694.1|  PREDICTED: probable ADP-ribosylation factor ...    196   2e-55   Brassica rapa
ref|XP_011070020.1|  PREDICTED: probable ADP-ribosylation factor ...    197   2e-55   Sesamum indicum [beniseed]
ref|XP_011047055.1|  PREDICTED: probable ADP-ribosylation factor ...    197   2e-55   Populus euphratica
gb|KHN35582.1|  Putative ADP-ribosylation factor GTPase-activatin...    198   3e-55   Glycine soja [wild soybean]
gb|KJB46060.1|  hypothetical protein B456_007G346500                    197   3e-55   Gossypium raimondii
ref|XP_004287205.1|  PREDICTED: probable ADP-ribosylation factor ...    197   3e-55   Fragaria vesca subsp. vesca
ref|XP_011019715.1|  PREDICTED: probable ADP-ribosylation factor ...    197   3e-55   Populus euphratica
ref|XP_003525726.1|  PREDICTED: probable ADP-ribosylation factor ...    197   4e-55   Glycine max [soybeans]
ref|XP_008240628.1|  PREDICTED: probable ADP-ribosylation factor ...    197   4e-55   Prunus mume [ume]
ref|XP_007202210.1|  hypothetical protein PRUPE_ppa002501mg             197   4e-55   
ref|XP_007151505.1|  hypothetical protein PHAVU_004G052500g             197   4e-55   Phaseolus vulgaris [French bean]
ref|XP_009389148.1|  PREDICTED: probable ADP-ribosylation factor ...    196   4e-55   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX75265.1|  BnaA01g04370D                                          196   5e-55   
ref|XP_011019714.1|  PREDICTED: uncharacterized protein LOC105122...    197   5e-55   Populus euphratica
ref|XP_004136610.1|  PREDICTED: probable ADP-ribosylation factor ...    196   6e-55   Cucumis sativus [cucumbers]
ref|XP_009125724.1|  PREDICTED: probable ADP-ribosylation factor ...    195   7e-55   Brassica rapa
ref|XP_003555100.1|  PREDICTED: probable ADP-ribosylation factor ...    196   8e-55   Glycine max [soybeans]
ref|XP_002530953.1|  HIV-1 rev binding protein, hrbl, putative          196   8e-55   Ricinus communis
ref|XP_009389146.1|  PREDICTED: probable ADP-ribosylation factor ...    196   9e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009389147.1|  PREDICTED: probable ADP-ribosylation factor ...    196   9e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008394005.1|  PREDICTED: probable ADP-ribosylation factor ...    196   1e-54   
ref|NP_001049974.1|  Os03g0323500                                       194   1e-54   
emb|CDP18503.1|  unnamed protein product                                195   2e-54   Coffea canephora [robusta coffee]
ref|XP_009416362.1|  PREDICTED: probable ADP-ribosylation factor ...    194   2e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010550492.1|  PREDICTED: probable ADP-ribosylation factor ...    194   3e-54   Tarenaya hassleriana [spider flower]
ref|XP_006306972.1|  hypothetical protein CARUB_v10008548mg             194   3e-54   Capsella rubella
ref|XP_011019713.1|  PREDICTED: uncharacterized protein LOC105122...    195   3e-54   Populus euphratica
ref|XP_011019709.1|  PREDICTED: uncharacterized protein LOC105122...    195   3e-54   Populus euphratica
ref|XP_006285581.1|  hypothetical protein CARUB_v10007026mg             194   3e-54   
ref|XP_010922919.1|  PREDICTED: probable ADP-ribosylation factor ...    193   4e-54   Elaeis guineensis
ref|XP_009389149.1|  PREDICTED: probable ADP-ribosylation factor ...    194   4e-54   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN05268.1|  Putative ADP-ribosylation factor GTPase-activatin...    194   4e-54   Glycine soja [wild soybean]
ref|XP_006417658.1|  hypothetical protein EUTSA_v10007026mg             194   4e-54   Eutrema salsugineum [saltwater cress]
ref|XP_006417659.1|  hypothetical protein EUTSA_v10007026mg             194   4e-54   Eutrema salsugineum [saltwater cress]
ref|XP_010922918.1|  PREDICTED: probable ADP-ribosylation factor ...    193   4e-54   
gb|EAY87827.1|  hypothetical protein OsI_09246                          193   4e-54   Oryza sativa Indica Group [Indian rice]
ref|XP_010922917.1|  PREDICTED: probable ADP-ribosylation factor ...    193   5e-54   Elaeis guineensis
ref|XP_006417657.1|  hypothetical protein EUTSA_v10007026mg             193   5e-54   Eutrema salsugineum [saltwater cress]
ref|XP_010553783.1|  PREDICTED: probable ADP-ribosylation factor ...    193   7e-54   Tarenaya hassleriana [spider flower]
ref|XP_010458119.1|  PREDICTED: probable ADP-ribosylation factor ...    192   7e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010475678.1|  PREDICTED: probable ADP-ribosylation factor ...    192   7e-54   Camelina sativa [gold-of-pleasure]
ref|XP_003521869.1|  PREDICTED: probable ADP-ribosylation factor ...    192   1e-53   Glycine max [soybeans]
ref|NP_001031002.1|  putative ADP-ribosylation factor GTPase-acti...    192   1e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306973.1|  hypothetical protein CARUB_v10008548mg             192   2e-53   
gb|EMT02442.1|  Putative ADP-ribosylation factor GTPase-activatin...    195   2e-53   
ref|XP_008394008.1|  PREDICTED: probable ADP-ribosylation factor ...    192   3e-53   
ref|XP_004489644.1|  PREDICTED: probable ADP-ribosylation factor ...    191   3e-53   Cicer arietinum [garbanzo]
ref|XP_009353045.1|  PREDICTED: probable ADP-ribosylation factor ...    192   3e-53   Pyrus x bretschneideri [bai li]
emb|CDY43691.1|  BnaC08g46980D                                          191   3e-53   Brassica napus [oilseed rape]
ref|XP_010489254.1|  PREDICTED: probable ADP-ribosylation factor ...    191   3e-53   
gb|KJB44412.1|  hypothetical protein B456_007G251300                    191   3e-53   Gossypium raimondii
gb|KJB44411.1|  hypothetical protein B456_007G251300                    191   3e-53   Gossypium raimondii
ref|XP_010489263.1|  PREDICTED: probable ADP-ribosylation factor ...    191   3e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010931482.1|  PREDICTED: probable ADP-ribosylation factor ...    191   3e-53   
gb|EMS66657.1|  putative ADP-ribosylation factor GTPase-activatin...    194   4e-53   Triticum urartu
emb|CDM84685.1|  unnamed protein product                                191   5e-53   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010458114.1|  PREDICTED: probable ADP-ribosylation factor ...    191   5e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010665813.1|  PREDICTED: probable ADP-ribosylation factor ...    190   6e-53   
ref|XP_010436288.1|  PREDICTED: probable ADP-ribosylation factor ...    191   6e-53   Camelina sativa [gold-of-pleasure]
ref|XP_002516603.1|  conserved hypothetical protein                     191   6e-53   Ricinus communis
ref|XP_006356657.1|  PREDICTED: probable ADP-ribosylation factor ...    190   9e-53   Solanum tuberosum [potatoes]
ref|XP_010550477.1|  PREDICTED: probable ADP-ribosylation factor ...    189   1e-52   Tarenaya hassleriana [spider flower]
gb|ABF95689.1|  GTPase activating protein, putative, expressed          189   1e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008807338.1|  PREDICTED: probable ADP-ribosylation factor ...    189   2e-52   Phoenix dactylifera
gb|EMS45868.1|  putative ADP-ribosylation factor GTPase-activatin...    188   2e-52   Triticum urartu
dbj|BAK07055.1|  predicted protein                                      189   2e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010437881.1|  PREDICTED: probable ADP-ribosylation factor ...    189   2e-52   Camelina sativa [gold-of-pleasure]
ref|XP_008391730.1|  PREDICTED: probable ADP-ribosylation factor ...    189   2e-52   
ref|XP_008806240.1|  PREDICTED: probable ADP-ribosylation factor ...    189   2e-52   Phoenix dactylifera
ref|XP_010931480.1|  PREDICTED: probable ADP-ribosylation factor ...    189   2e-52   Elaeis guineensis
gb|KJB64565.1|  hypothetical protein B456_010G054100                    189   3e-52   Gossypium raimondii
ref|NP_194989.2|  ArfGap/RecO-like zinc finger domain-containing ...    188   3e-52   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172344.2|  putative ADP-ribosylation factor GTPase-activat...    188   3e-52   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001119100.1|  ArfGap/RecO-like zinc finger domain-containi...    188   3e-52   Arabidopsis thaliana [mouse-ear cress]
gb|EAY76254.1|  hypothetical protein OsI_04189                          189   3e-52   Oryza sativa Indica Group [Indian rice]
ref|NP_850941.1|  putative ADP-ribosylation factor GTPase-activat...    188   3e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008806244.1|  PREDICTED: probable ADP-ribosylation factor ...    188   3e-52   
ref|XP_010232480.1|  PREDICTED: LOW QUALITY PROTEIN: probable ADP...    192   3e-52   
ref|NP_001184942.1|  putative ADP-ribosylation factor GTPase-acti...    188   4e-52   
gb|KHG04223.1|  hypothetical protein F383_29715                         188   4e-52   
ref|XP_006644891.1|  PREDICTED: probable ADP-ribosylation factor ...    189   5e-52   
ref|XP_010447361.1|  PREDICTED: probable ADP-ribosylation factor ...    188   6e-52   
gb|EPS64232.1|  hypothetical protein M569_10549                         177   6e-52   
gb|EMT09716.1|  Putative ADP-ribosylation factor GTPase-activatin...    187   7e-52   
ref|NP_001044602.1|  Os01g0813900                                       188   7e-52   
ref|XP_011079156.1|  PREDICTED: probable ADP-ribosylation factor ...    187   8e-52   
gb|KFK43179.1|  hypothetical protein AALP_AA1G090300                    187   1e-51   
gb|KFK43178.1|  hypothetical protein AALP_AA1G090300                    187   1e-51   
ref|XP_002869259.1|  hypothetical protein ARALYDRAFT_491451             186   2e-51   
ref|XP_001758951.1|  predicted protein                                  186   3e-51   
ref|XP_002889709.1|  hypothetical protein ARALYDRAFT_470937             186   3e-51   
ref|XP_010325273.1|  PREDICTED: probable ADP-ribosylation factor ...    186   3e-51   
ref|XP_010904972.1|  PREDICTED: probable ADP-ribosylation factor ...    185   6e-51   
ref|XP_002456523.1|  hypothetical protein SORBIDRAFT_03g037790          186   6e-51   
ref|XP_002467938.1|  hypothetical protein SORBIDRAFT_01g036780          184   1e-50   
ref|XP_011079155.1|  PREDICTED: probable ADP-ribosylation factor ...    184   2e-50   
ref|XP_008655211.1|  PREDICTED: probable ADP-ribosylation factor ...    183   3e-50   
ref|XP_004984533.1|  PREDICTED: probable ADP-ribosylation factor ...    183   3e-50   
ref|XP_009408383.1|  PREDICTED: probable ADP-ribosylation factor ...    183   4e-50   
ref|XP_008672718.1|  PREDICTED: uncharacterized protein LOC100279...    183   4e-50   
ref|NP_001146152.1|  uncharacterized protein LOC100279721               183   5e-50   
ref|XP_009408380.1|  PREDICTED: probable ADP-ribosylation factor ...    182   6e-50   
ref|XP_009408382.1|  PREDICTED: probable ADP-ribosylation factor ...    182   6e-50   
ref|XP_004984536.1|  PREDICTED: probable ADP-ribosylation factor ...    182   7e-50   
ref|XP_004984535.1|  PREDICTED: probable ADP-ribosylation factor ...    182   7e-50   
ref|XP_004984534.1|  PREDICTED: probable ADP-ribosylation factor ...    182   9e-50   
gb|KJB64566.1|  hypothetical protein B456_010G054100                    182   1e-49   
ref|XP_002965858.1|  hypothetical protein SELMODRAFT_439307             177   2e-49   
ref|XP_004970331.1|  PREDICTED: probable ADP-ribosylation factor ...    181   4e-49   
ref|XP_009148122.1|  PREDICTED: probable ADP-ribosylation factor ...    178   2e-48   
emb|CDX93544.1|  BnaA06g05040D                                          176   1e-47   
ref|XP_001770050.1|  predicted protein                                  176   1e-47   
ref|XP_006604074.1|  PREDICTED: probable ADP-ribosylation factor ...    176   2e-47   
gb|KEH25528.1|  ARF GTPase activator                                    176   2e-47   
gb|KEH25527.1|  ARF GTPase activator                                    175   2e-47   
emb|CDX95040.1|  BnaC05g06310D                                          174   3e-47   
ref|XP_006451098.1|  hypothetical protein CICLE_v100075541mg            172   4e-46   
ref|XP_006451097.1|  hypothetical protein CICLE_v100075541mg            171   5e-46   
gb|AAF99759.1|AC003981_9  F22O13.16                                     162   8e-46   
ref|XP_008338196.1|  PREDICTED: probable ADP-ribosylation factor ...    160   1e-45   
emb|CAB40770.1|  putative protein                                       169   1e-45   
ref|XP_001780627.1|  predicted protein                                  158   2e-44   
ref|XP_001773485.1|  predicted protein                                  163   4e-43   
ref|XP_007161269.1|  hypothetical protein PHAVU_001G056000g             158   2e-41   
ref|XP_008378285.1|  PREDICTED: probable ADP-ribosylation factor ...    152   8e-40   
ref|XP_010109048.1|  putative ADP-ribosylation factor GTPase-acti...    150   2e-38   
gb|KHN07943.1|  Putative ADP-ribosylation factor GTPase-activatin...    149   2e-38   
gb|KJB35086.1|  hypothetical protein B456_006G099700                    134   2e-36   
ref|XP_008671905.1|  PREDICTED: stromal membrane-associated prote...    138   4e-36   
ref|XP_001756461.1|  predicted protein                                  142   1e-35   
ref|XP_010458115.1|  PREDICTED: probable ADP-ribosylation factor ...    142   2e-35   
gb|KJB64567.1|  hypothetical protein B456_010G054100                    140   6e-35   
ref|XP_006651333.1|  PREDICTED: probable ADP-ribosylation factor ...    137   6e-34   
gb|EPS66065.1|  hypothetical protein M569_08710                         125   4e-33   
dbj|BAN38789.1|  hypothetical protein, conserved                        128   1e-31   
gb|EMS16233.1|  stromal membrane-associated protein                     129   2e-31   
ref|XP_008856972.1|  Arf GTPase activating protein                      128   2e-31   
gb|EMD46676.1|  stromal membrane-associated protein, putative           129   2e-31   
ref|XP_653473.2|  hypothetical protein                                  128   2e-31   
gb|EYU24927.1|  hypothetical protein MIMGU_mgv1a020162mg                120   3e-31   
ref|XP_008869860.1|  hypothetical protein H310_06530                    129   4e-31   
ref|XP_002142389.1|  hypothetical protein                               124   4e-31   
ref|XP_009836817.1|  hypothetical protein H257_11538                    128   6e-31   
ref|XP_001741933.1|  stromal membrane-associated protein                126   8e-31   
ref|XP_004258804.1|  stromal membrane-associated protein, putative      125   2e-30   
ref|XP_009630243.1|  PREDICTED: probable ADP-ribosylation factor ...    127   6e-30   
ref|XP_008612823.1|  hypothetical protein SDRG_08707                    124   1e-29   
gb|KDO29191.1|  hypothetical protein SPRG_05433                         123   3e-29   
ref|XP_006587511.1|  PREDICTED: probable ADP-ribosylation factor ...    123   1e-28   
ref|XP_005846627.1|  hypothetical protein CHLNCDRAFT_135266             117   1e-28   
ref|XP_008909968.1|  hypothetical protein, variant 7                    121   3e-28   
gb|ETI40188.1|  hypothetical protein, variant 7                         121   3e-28   
ref|XP_008909961.1|  hypothetical protein PPTG_14423                    121   5e-28   
ref|XP_008909962.1|  hypothetical protein, variant 1                    121   6e-28   
ref|XP_008909966.1|  hypothetical protein, variant 5                    120   6e-28   
gb|ETI40181.1|  hypothetical protein F443_14354                         121   7e-28   
gb|ETI40182.1|  hypothetical protein, variant 1                         120   7e-28   
emb|CBN78382.1|  conserved unknown protein                              116   8e-28   
gb|ETI40186.1|  hypothetical protein, variant 5                         120   8e-28   
ref|XP_004356450.1|  Arf GTPase activating protein                      117   2e-27   
gb|EST48603.1|  Arf GTP activating protein                              117   3e-27   
ref|XP_008378287.1|  PREDICTED: probable ADP-ribosylation factor ...    117   3e-27   
ref|XP_004359305.1|  Arf GTPase activating protein                      116   1e-26   
gb|KFH73264.1|  hypothetical protein MVEG_00482                         117   2e-26   
ref|XP_010458116.1|  PREDICTED: probable ADP-ribosylation factor ...    117   2e-26   
ref|XP_006596715.1|  PREDICTED: mucin-5AC-like                          113   2e-25   
gb|EFA83789.1|  Arf GTPase activating protein                           114   4e-25   
ref|XP_002777823.1|  Stromal membrane-associated protein, putative      111   4e-25   
ref|XP_005792468.1|  hypothetical protein EMIHUDRAFT_631919             112   8e-25   
ref|XP_009515253.1|  hypothetical protein PHYSODRAFT_258326             111   1e-24   
gb|EPS68472.1|  hypothetical protein M569_06293                         111   2e-24   
ref|XP_002598708.1|  hypothetical protein BRAFLDRAFT_127749             107   3e-24   
emb|CBK23744.2|  unnamed protein product                                108   4e-24   
pdb|2OLM|A  Chain A, Arfgap Domain Of Hiv-1 Rev Binding Protein         102   2e-23   
ref|XP_003055304.1|  predicted protein                                  108   2e-23   
ref|XP_011481110.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    107   2e-23   
ref|XP_006601619.1|  PREDICTED: flocculation protein FLO11-like         108   3e-23   
ref|XP_011481111.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    107   4e-23   
ref|XP_001691264.1|  potential GTPase activation protein                108   4e-23   
gb|KEH21362.1|  ARF GTPase activator                                    106   7e-23   
gb|KHN20701.1|  hypothetical protein glysoja_019018                     106   8e-23   
ref|XP_004258023.1|  hypothetical protein EIN_151890                    107   1e-22   
ref|XP_009044309.1|  hypothetical protein LOTGIDRAFT_184772             103   1e-22   
ref|XP_001637303.1|  predicted protein                                  100   1e-22   
dbj|GAM19371.1|  hypothetical protein SAMD00019534_025460               105   1e-22   
ref|XP_005993090.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    103   2e-22   
emb|CDS14185.1|  hypothetical protein LRAMOSA06355                      103   2e-22   
ref|XP_002515586.1|  HIV-1 rev binding protein, hrbl, putative          101   2e-22   
emb|CBK24903.2|  unnamed protein product                                103   2e-22   
emb|CDQ72685.1|  unnamed protein product                                104   3e-22   
gb|KHN42171.1|  Putative ADP-ribosylation factor GTPase-activatin...    104   3e-22   
emb|CBK20691.2|  unnamed protein product                                103   3e-22   
gb|KIZ01335.1|  putative ADP-ribosylation factor GTPase-activatin...    105   3e-22   
ref|XP_004561511.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    104   4e-22   
ref|XP_005993089.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    103   4e-22   
ref|XP_007420509.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   4e-22   
ref|XP_008386976.1|  PREDICTED: probable ADP-ribosylation factor ...    104   6e-22   
ref|XP_005993088.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    103   6e-22   
ref|XP_005993087.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    103   6e-22   
ref|XP_005474545.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   6e-22   
ref|XP_005993086.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    103   6e-22   
ref|XP_005993084.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    103   6e-22   
ref|XP_005993083.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    103   6e-22   
ref|XP_005993085.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    103   7e-22   
ref|XP_007573680.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   7e-22   
ref|XP_008337464.1|  PREDICTED: probable ADP-ribosylation factor ...    103   8e-22   
ref|XP_007573676.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   8e-22   
ref|XP_007420507.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   8e-22   
ref|XP_002424611.1|  protein AGE2, putative                             101   8e-22   
ref|XP_008164124.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   8e-22   
ref|XP_006799959.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   9e-22   
ref|XP_007573678.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   9e-22   
ref|XP_007573677.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   1e-21   
ref|XP_005474544.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   1e-21   
ref|XP_006799958.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   1e-21   
ref|XP_005474543.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   1e-21   
ref|XP_008104455.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   1e-21   
ref|XP_005944743.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   1e-21   
ref|XP_008292752.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   1e-21   
ref|XP_008824080.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   1e-21   
ref|XP_006799957.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   1e-21   
ref|XP_008164123.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   1e-21   
ref|XP_007573675.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   1e-21   
ref|XP_005803412.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   1e-21   
ref|XP_005147104.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
ref|XP_010566610.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
ref|XP_647109.1|  Arf GTPase activating protein                         102   2e-21   
ref|XP_005282647.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
ref|XP_005527102.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
ref|XP_002198461.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
ref|XP_006637956.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
ref|XP_007420506.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
ref|XP_011481114.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_006258384.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
ref|XP_004417232.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
gb|ETE68403.1|  Arf-GAP domain and FG repeats-containing protein 1      102   2e-21   
ref|XP_003474662.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_006258383.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
ref|XP_008164120.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
ref|XP_007573673.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
ref|XP_005147103.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
ref|XP_008306632.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
ref|XP_007573679.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
ref|XP_006990412.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_007420510.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
ref|XP_005147102.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
gb|KEH25529.1|  ARF GTPase activator                                    102   2e-21   
ref|XP_006496502.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_008104454.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_002198433.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
ref|XP_006496501.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_011481113.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_005474542.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
ref|XP_006258382.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
ref|XP_006496500.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_004033344.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_008824079.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_005944742.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_005527100.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
ref|XP_004385880.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_005282646.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
ref|XP_005474541.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
ref|XP_005474540.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
ref|XP_007467989.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_005360087.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_004868057.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|NP_001128661.1|  arf-GAP domain and FG repeat-containing prot...    101   2e-21   
ref|XP_005282645.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
ref|XP_006799956.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_006496499.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_004427706.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_010566609.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_006861971.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_010566608.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_008909963.1|  hypothetical protein, variant 2                    102   2e-21   
ref|XP_005527101.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_008292750.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
ref|XP_008997884.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_008104451.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_008292751.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
ref|XP_006496503.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_005147101.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
ref|XP_003218307.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_003908078.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_005474539.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
ref|XP_008909965.1|  hypothetical protein, variant 4                    102   2e-21   
ref|XP_008997885.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_008306631.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
ref|XP_004176493.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
ref|XP_005360086.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_007964695.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_004576811.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_008104450.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_007573672.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    102   2e-21   
ref|XP_003784935.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_007964694.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   2e-21   
ref|XP_008164118.1|  PREDICTED: arf-GAP domain and FG repeat-cont...    101   3e-21   



>ref|XP_011078363.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Sesamum indicum]
Length=699

 Score =   273 bits (697),  Expect = 3e-83, Method: Composition-based stats.
 Identities = 131/151 (87%), Positives = 136/151 (90%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNERIIR LLKLP+NRRCINCNSLGPQYVC NFSTF+CTTCSGIHREFTHR
Sbjct  1    MANRLKEDEKNERIIRNLLKLPENRRCINCNSLGPQYVCTNFSTFVCTTCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFT QEVSALQGGGNASA+EIYLKE DPQRNSLPDGSN+ERLRDFIKHVYVDR
Sbjct  61   VKSVSMAKFTPQEVSALQGGGNASAREIYLKEWDPQRNSLPDGSNIERLRDFIKHVYVDR  120

Query  502  RYTGERGFP---RGK-GETEDLNGNRRVDTY  582
            RYTGER      R K GE ED NGNRR+DTY
Sbjct  121  RYTGERNLEKPLRAKMGEAEDFNGNRRIDTY  151



>ref|XP_004251595.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Solanum lycopersicum]
 ref|XP_010313725.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Solanum lycopersicum]
Length=691

 Score =   264 bits (675),  Expect = 4e-80, Method: Composition-based stats.
 Identities = 127/151 (84%), Positives = 136/151 (90%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR +EDEKNER IR LLKLPDNRRCINCNSLGPQYVC NF TF+CTTCSG+HREFTHR
Sbjct  1    MANR-REDEKNERTIRNLLKLPDNRRCINCNSLGPQYVCTNFWTFVCTTCSGLHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEVSALQGGGNASAKEIYLK+ DPQRNSLPDGSNVERLRDFI+HVYVDR
Sbjct  60   VKSVSMAKFTSQEVSALQGGGNASAKEIYLKDWDPQRNSLPDGSNVERLRDFIRHVYVDR  119

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RY+GER F   PRGK  E E++N NR+ DTY
Sbjct  120  RYSGERSFEKPPRGKMAEAENMNENRKTDTY  150



>ref|XP_009776200.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Nicotiana sylvestris]
Length=693

 Score =   263 bits (673),  Expect = 6e-80, Method: Composition-based stats.
 Identities = 129/151 (85%), Positives = 135/151 (89%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNERIIR LLKLPDNRRC+NCNSLGPQYVC NF TF+CTTCSGIHREFTHR
Sbjct  1    MANR-KEDEKNERIIRNLLKLPDNRRCMNCNSLGPQYVCTNFWTFVCTTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEVSALQGGGNASAK IYLK+ D QRNSLPDGSNVERLRDFIKHVYVDR
Sbjct  60   VKSVSMAKFTSQEVSALQGGGNASAKVIYLKDWDTQRNSLPDGSNVERLRDFIKHVYVDR  119

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RYTGER F   PRGK  E E+L+ NR+ DTY
Sbjct  120  RYTGERSFEKPPRGKMAEAENLSENRKTDTY  150



>ref|XP_009776199.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Nicotiana sylvestris]
Length=694

 Score =   263 bits (673),  Expect = 6e-80, Method: Composition-based stats.
 Identities = 129/151 (85%), Positives = 135/151 (89%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNERIIR LLKLPDNRRC+NCNSLGPQYVC NF TF+CTTCSGIHREFTHR
Sbjct  1    MANR-KEDEKNERIIRNLLKLPDNRRCMNCNSLGPQYVCTNFWTFVCTTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEVSALQGGGNASAK IYLK+ D QRNSLPDGSNVERLRDFIKHVYVDR
Sbjct  60   VKSVSMAKFTSQEVSALQGGGNASAKVIYLKDWDTQRNSLPDGSNVERLRDFIKHVYVDR  119

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RYTGER F   PRGK  E E+L+ NR+ DTY
Sbjct  120  RYTGERSFEKPPRGKMAEAENLSENRKTDTY  150



>ref|XP_009627509.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Nicotiana tomentosiformis]
Length=694

 Score =   261 bits (668),  Expect = 3e-79, Method: Composition-based stats.
 Identities = 128/151 (85%), Positives = 134/151 (89%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNERIIR LLKLPDNRRC+NCNSLGPQYVC NF TF+CTTCSGIHREFTHR
Sbjct  1    MANR-KEDEKNERIIRNLLKLPDNRRCMNCNSLGPQYVCTNFWTFVCTTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEVSALQGGGNASAK IYLK+ D QRNSLPDGSNVERLRDFIKHVYVDR
Sbjct  60   VKSVSMAKFTSQEVSALQGGGNASAKVIYLKDWDTQRNSLPDGSNVERLRDFIKHVYVDR  119

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RYTGER     PRGK  E E+L+ NR+ DTY
Sbjct  120  RYTGERSLEKPPRGKMAEAENLSENRKTDTY  150



>ref|XP_009627508.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Nicotiana tomentosiformis]
Length=695

 Score =   261 bits (668),  Expect = 4e-79, Method: Composition-based stats.
 Identities = 128/151 (85%), Positives = 134/151 (89%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNERIIR LLKLPDNRRC+NCNSLGPQYVC NF TF+CTTCSGIHREFTHR
Sbjct  1    MANR-KEDEKNERIIRNLLKLPDNRRCMNCNSLGPQYVCTNFWTFVCTTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEVSALQGGGNASAK IYLK+ D QRNSLPDGSNVERLRDFIKHVYVDR
Sbjct  60   VKSVSMAKFTSQEVSALQGGGNASAKVIYLKDWDTQRNSLPDGSNVERLRDFIKHVYVDR  119

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RYTGER     PRGK  E E+L+ NR+ DTY
Sbjct  120  RYTGERSLEKPPRGKMAEAENLSENRKTDTY  150



>ref|XP_006353447.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like [Solanum tuberosum]
Length=695

 Score =   261 bits (666),  Expect = 8e-79, Method: Composition-based stats.
 Identities = 127/151 (84%), Positives = 134/151 (89%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M NR +EDEKNER IR LLKLPDNRRCINCNSLGPQYVC NF TF+CTTCSG+HREFTHR
Sbjct  1    MTNR-REDEKNERTIRNLLKLPDNRRCINCNSLGPQYVCTNFWTFVCTTCSGLHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEVSALQGGGNASAKEIYLK+ DPQRNSLPDGSNVERLRDFIKHVYVDR
Sbjct  60   VKSVSMAKFTSQEVSALQGGGNASAKEIYLKDWDPQRNSLPDGSNVERLRDFIKHVYVDR  119

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RY+GER     PRGK  E E+LN NR+ DTY
Sbjct  120  RYSGERSIEKPPRGKMAEAENLNENRKTDTY  150



>emb|CDP03358.1| unnamed protein product [Coffea canephora]
Length=714

 Score =   257 bits (656),  Expect = 3e-77, Method: Composition-based stats.
 Identities = 125/151 (83%), Positives = 136/151 (90%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M++R KEDEKNERIIR LLKLPDNRRCINCNSLGPQYVC+NF TF+CT CSGIHREFTHR
Sbjct  1    MSSR-KEDEKNERIIRNLLKLPDNRRCINCNSLGPQYVCVNFWTFVCTNCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGS-NVERLRDFIKHVYVD  498
            VKS+SMAKFTSQEVSALQGGGNASAKEIYLKE DPQR SLPDGS NVERLRDFIKHVYV+
Sbjct  60   VKSISMAKFTSQEVSALQGGGNASAKEIYLKEWDPQRQSLPDGSNNVERLRDFIKHVYVE  119

Query  499  RRYTGERGF---PRGKGETEDLNGNRRVDTY  582
            RRY+GER F   PR KGE+ED   NRR+D++
Sbjct  120  RRYSGERIFEKPPRVKGESEDSQENRRIDSF  150



>gb|EPS61339.1| hypothetical protein M569_13457, partial [Genlisea aurea]
Length=380

 Score =   248 bits (632),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 128/154 (83%), Gaps = 11/154 (7%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNE+IIR LLKLP+NRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR
Sbjct  1    MANRVKEDEKNEKIIRNLLKLPENRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFT  E+SALQGGGNASA+EIYLKE DPQRNSL DGSN+ERLRDFIKHVYVDR
Sbjct  61   VKSVSMAKFTPLEISALQGGGNASAREIYLKEWDPQRNSLLDGSNIERLRDFIKHVYVDR  120

Query  502  RYTGER-----------GFPRGKGETEDLNGNRR  570
            R+TGE+            F   +GET    G+ R
Sbjct  121  RFTGEKTTGKPPRNFLLAFTNPQGETNTYQGSSR  154



>gb|KJB27129.1| hypothetical protein B456_004G279500 [Gossypium raimondii]
Length=595

 Score =   251 bits (642),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 131/151 (87%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDE+NERIIRGLLK P+NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFTHR
Sbjct  1    MASRVKEDERNERIIRGLLKQPENRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV+ALQ GGN  A+EIY+KE DPQRNS PD SNVERLRDFIKHVY DR
Sbjct  61   VKSVSMAKFTSQEVTALQEGGNQRAREIYMKEWDPQRNSGPDSSNVERLRDFIKHVYEDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RY+GER +   PRGK G+ ED+ G+RR D Y
Sbjct  121  RYSGERNYDKPPRGKMGDKEDVYGSRRADGY  151



>ref|XP_010047752.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Eucalyptus grandis]
Length=725

 Score =   253 bits (645),  Expect = 1e-75, Method: Composition-based stats.
 Identities = 119/151 (79%), Positives = 130/151 (86%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNERIIRGLLKLP+N+RCINCNSLGPQYVC +F TF+CTTCSGIHREFTHR
Sbjct  1    MANRIKEDEKNERIIRGLLKLPENKRCINCNSLGPQYVCTSFCTFVCTTCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFTSQEVSALQGGGN  AKEIYLKE DPQRNSLPD SNV+RLRDFIKHVYVD+
Sbjct  61   VKSISMAKFTSQEVSALQGGGNQRAKEIYLKEWDPQRNSLPDCSNVDRLRDFIKHVYVDK  120

Query  502  RYTGERGF---PRGKGETED-LNGNRRVDTY  582
            RY+G+R F   PR K + ED  +G  R   Y
Sbjct  121  RYSGDRSFDRPPRAKSDREDSYHGGSRSPPY  151



>ref|XP_010047751.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Eucalyptus grandis]
 gb|KCW79713.1| hypothetical protein EUGRSUZ_C01068 [Eucalyptus grandis]
Length=733

 Score =   253 bits (645),  Expect = 1e-75, Method: Composition-based stats.
 Identities = 119/151 (79%), Positives = 130/151 (86%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNERIIRGLLKLP+N+RCINCNSLGPQYVC +F TF+CTTCSGIHREFTHR
Sbjct  1    MANRIKEDEKNERIIRGLLKLPENKRCINCNSLGPQYVCTSFCTFVCTTCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFTSQEVSALQGGGN  AKEIYLKE DPQRNSLPD SNV+RLRDFIKHVYVD+
Sbjct  61   VKSISMAKFTSQEVSALQGGGNQRAKEIYLKEWDPQRNSLPDCSNVDRLRDFIKHVYVDK  120

Query  502  RYTGERGF---PRGKGETED-LNGNRRVDTY  582
            RY+G+R F   PR K + ED  +G  R   Y
Sbjct  121  RYSGDRSFDRPPRAKSDREDSYHGGSRSPPY  151



>ref|XP_008352294.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Malus domestica]
Length=609

 Score =   248 bits (634),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 130/151 (86%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KE+EKNERIIRGLLKLP+NRRCINCNSLGPQYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MASR-KEEEKNERIIRGLLKLPENRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV+ALQ GGN  AKEIY KELD QRNS PD SNVERLRDFIKHVYVDR
Sbjct  60   VKSVSMAKFTSQEVNALQEGGNQRAKEIYHKELDXQRNSFPDSSNVERLRDFIKHVYVDR  119

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RYTGER     P+GK GE ED   NRRVD+Y
Sbjct  120  RYTGERNLDKPPKGKMGEKEDSYDNRRVDSY  150



>ref|XP_008242599.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Prunus mume]
Length=738

 Score =   250 bits (638),  Expect = 2e-74, Method: Composition-based stats.
 Identities = 123/151 (81%), Positives = 129/151 (85%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDEKNERIIR LLKLP+NRRCINCNSLGPQYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MASRVKEDEKNERIIRSLLKLPENRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV+ALQ GGN  AKEIY KELDPQRNS PD SNVERLRDFIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVNALQEGGNQRAKEIYHKELDPQRNSFPDSSNVERLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RYTGER     PR K GE ED   NRR+D+Y
Sbjct  121  RYTGERNLDKPPRAKMGEKEDSYENRRLDSY  151



>ref|XP_008343980.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Malus domestica]
Length=663

 Score =   248 bits (632),  Expect = 4e-74, Method: Composition-based stats.
 Identities = 126/151 (83%), Positives = 131/151 (87%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDEKNERIIRGLLKLP+NRRCINCNSLGPQYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MASR-KEDEKNERIIRGLLKLPENRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEVSALQ GGN  AKEIY KELDPQRNS PD SNVERLRDFIKHVYVDR
Sbjct  60   VKSVSMAKFTSQEVSALQEGGNQRAKEIYHKELDPQRNSYPDSSNVERLRDFIKHVYVDR  119

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RYTGER     P+GK GE ED   NRRVD+Y
Sbjct  120  RYTGERNLDKPPKGKMGEKEDSYDNRRVDSY  150



>gb|KJB54159.1| hypothetical protein B456_009G023500 [Gossypium raimondii]
Length=613

 Score =   246 bits (629),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 125/151 (83%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA R KEDEKNERIIRGLLK P+NRRCINCNSLGPQYVC NF TFICTTCSGIHREFTHR
Sbjct  1    MAGRVKEDEKNERIIRGLLKQPENRRCINCNSLGPQYVCTNFWTFICTTCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEVSALQ GGN  AKEIY KE DPQRNSLP  SNVERLRDFIKHVYVD 
Sbjct  61   VKSVSMAKFTSQEVSALQEGGNQRAKEIYFKEWDPQRNSLPKSSNVERLRDFIKHVYVDG  120

Query  502  RYTGERG---FPRGK-GETEDLNGNRRVDTY  582
            RY+G R     P+GK G+ ED   NRR D Y
Sbjct  121  RYSGGRSNDKPPQGKTGDKEDFFENRRTDGY  151



>ref|XP_007203783.1| hypothetical protein PRUPE_ppa001945mg [Prunus persica]
 gb|EMJ04982.1| hypothetical protein PRUPE_ppa001945mg [Prunus persica]
Length=738

 Score =   248 bits (634),  Expect = 6e-74, Method: Composition-based stats.
 Identities = 122/151 (81%), Positives = 129/151 (85%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDEKNERIIR LLKLP+NRRCINCNSLGPQYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MASRVKEDEKNERIIRSLLKLPENRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKF+SQEV+ALQ GGN  AKEIY KELDPQRNS PD SNVERLRDFIKHVYVDR
Sbjct  61   VKSVSMAKFSSQEVNALQEGGNQRAKEIYHKELDPQRNSFPDSSNVERLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RYTGER     PR K GE ED   NRR+D+Y
Sbjct  121  RYTGERNLDKPPRAKMGEKEDSYENRRLDSY  151



>ref|XP_007013231.1| NSP-interacting GTPase, putative isoform 1 [Theobroma cacao]
 ref|XP_007013234.1| NSP-interacting GTPase, putative isoform 1 [Theobroma cacao]
 gb|EOY30850.1| NSP-interacting GTPase, putative isoform 1 [Theobroma cacao]
 gb|EOY30853.1| NSP-interacting GTPase, putative isoform 1 [Theobroma cacao]
Length=752

 Score =   249 bits (635),  Expect = 6e-74, Method: Composition-based stats.
 Identities = 122/151 (81%), Positives = 129/151 (85%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDEKNERIIRGLLK  +NRRCINCNSLGPQYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MASRVKEDEKNERIIRGLLKQQENRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEVSALQ GGN  AKEIY KE DPQRNS+PD SNVERLRDFIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVSALQEGGNQRAKEIYFKEWDPQRNSVPDSSNVERLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RY+GER +   PRGK G+ EDL  NRR D Y
Sbjct  121  RYSGERNYDKPPRGKMGDKEDLYENRRTDGY  151



>ref|XP_007013233.1| NSP-interacting GTPase, putative isoform 3 [Theobroma cacao]
 ref|XP_007013235.1| NSP-interacting GTPase, putative isoform 3 [Theobroma cacao]
 gb|EOY30852.1| NSP-interacting GTPase, putative isoform 3 [Theobroma cacao]
 gb|EOY30854.1| NSP-interacting GTPase, putative isoform 3 [Theobroma cacao]
Length=753

 Score =   248 bits (634),  Expect = 7e-74, Method: Composition-based stats.
 Identities = 122/151 (81%), Positives = 129/151 (85%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDEKNERIIRGLLK  +NRRCINCNSLGPQYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MASRVKEDEKNERIIRGLLKQQENRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEVSALQ GGN  AKEIY KE DPQRNS+PD SNVERLRDFIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVSALQEGGNQRAKEIYFKEWDPQRNSVPDSSNVERLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RY+GER +   PRGK G+ EDL  NRR D Y
Sbjct  121  RYSGERNYDKPPRGKMGDKEDLYENRRTDGY  151



>ref|XP_007013232.1| NSP-interacting GTPase, putative isoform 2 [Theobroma cacao]
 gb|EOY30851.1| NSP-interacting GTPase, putative isoform 2 [Theobroma cacao]
Length=710

 Score =   248 bits (632),  Expect = 9e-74, Method: Composition-based stats.
 Identities = 122/151 (81%), Positives = 129/151 (85%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDEKNERIIRGLLK  +NRRCINCNSLGPQYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MASRVKEDEKNERIIRGLLKQQENRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEVSALQ GGN  AKEIY KE DPQRNS+PD SNVERLRDFIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVSALQEGGNQRAKEIYFKEWDPQRNSVPDSSNVERLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RY+GER +   PRGK G+ EDL  NRR D Y
Sbjct  121  RYSGERNYDKPPRGKMGDKEDLYENRRTDGY  151



>ref|XP_009352480.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Pyrus x bretschneideri]
Length=707

 Score =   247 bits (631),  Expect = 1e-73, Method: Composition-based stats.
 Identities = 124/151 (82%), Positives = 131/151 (87%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KE+EKNERIIRGLLKLP+NRRCINCNSLGPQYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MASR-KEEEKNERIIRGLLKLPENRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV+ALQ GGN  AKEIY KELDPQRNS PD SNVERLRDFIKHVYVDR
Sbjct  60   VKSVSMAKFTSQEVNALQEGGNQRAKEIYHKELDPQRNSFPDSSNVERLRDFIKHVYVDR  119

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RYTGER     P+GK GE ED   NRRVD+Y
Sbjct  120  RYTGERNLDKPPKGKMGEKEDSYDNRRVDSY  150



>ref|XP_009336872.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Pyrus x bretschneideri]
Length=731

 Score =   247 bits (631),  Expect = 2e-73, Method: Composition-based stats.
 Identities = 124/151 (82%), Positives = 131/151 (87%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDEKNERIIRGLLKLP+NRRCINCNSLGPQYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MASR-KEDEKNERIIRGLLKLPENRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV+ALQ GGN  AK+IY KELDPQRNS PD SNVERLRDFIKHVYVDR
Sbjct  60   VKSVSMAKFTSQEVNALQEGGNQRAKDIYHKELDPQRNSYPDSSNVERLRDFIKHVYVDR  119

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RYTGER     P+GK GE ED   NRRVD+Y
Sbjct  120  RYTGERNLDKPPKGKMGEKEDSYDNRRVDSY  150



>ref|XP_010254182.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Nelumbo nucifera]
 ref|XP_010254183.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Nelumbo nucifera]
Length=747

 Score =   247 bits (630),  Expect = 3e-73, Method: Composition-based stats.
 Identities = 118/151 (78%), Positives = 129/151 (85%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R +EDEKNE+IIRGLLKLP NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFTHR
Sbjct  1    MASRMREDEKNEKIIRGLLKLPANRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFTSQEV+ALQGGGN  A+E Y KE DPQR+S PDGSNV+RLRDFIKHVYVDR
Sbjct  61   VKSISMAKFTSQEVAALQGGGNERARETYFKEWDPQRHSAPDGSNVDRLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGKGET-EDLNGNRRVDTY  582
            RYTGER     PR K +  ED   NRR+DTY
Sbjct  121  RYTGERSIDKPPRVKSDDREDSYENRRMDTY  151



>ref|XP_010088856.1| putative ADP-ribosylation factor GTPase-activating protein AGD14 
[Morus notabilis]
 gb|EXB37053.1| putative ADP-ribosylation factor GTPase-activating protein AGD14 
[Morus notabilis]
Length=767

 Score =   247 bits (630),  Expect = 4e-73, Method: Composition-based stats.
 Identities = 119/150 (79%), Positives = 128/150 (85%), Gaps = 4/150 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNERIIRGLLKL +NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFTHR
Sbjct  1    MANRVKEDEKNERIIRGLLKLQENRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFTSQEVSALQ GGN  AKEIYLKE DPQRNS PD SN+ERLRDFIKHVYVDR
Sbjct  61   VKSISMAKFTSQEVSALQEGGNKRAKEIYLKEWDPQRNSFPDSSNIERLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGKGETEDLNGNRRVDTY  582
            R++GE+     PR K   E+L  NRR D+Y
Sbjct  121  RFSGEKNHDKPPRAK-MGEELYENRRTDSY  149



>gb|KJB27131.1| hypothetical protein B456_004G279500 [Gossypium raimondii]
Length=715

 Score =   246 bits (628),  Expect = 4e-73, Method: Composition-based stats.
 Identities = 119/151 (79%), Positives = 131/151 (87%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDE+NERIIRGLLK P+NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFTHR
Sbjct  1    MASRVKEDERNERIIRGLLKQPENRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV+ALQ GGN  A+EIY+KE DPQRNS PD SNVERLRDFIKHVY DR
Sbjct  61   VKSVSMAKFTSQEVTALQEGGNQRAREIYMKEWDPQRNSGPDSSNVERLRDFIKHVYEDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RY+GER +   PRGK G+ ED+ G+RR D Y
Sbjct  121  RYSGERNYDKPPRGKMGDKEDVYGSRRADGY  151



>gb|KHN21549.1| Arf-GAP domain and FG repeat-containing protein 1 [Glycine soja]
Length=697

 Score =   245 bits (626),  Expect = 4e-73, Method: Composition-based stats.
 Identities = 114/150 (76%), Positives = 129/150 (86%), Gaps = 3/150 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDEKNERIIRGLLKL  NRRCINCNSLGPQYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MASRVKEDEKNERIIRGLLKLAPNRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKF++QEVSALQ GGN  AKEIY KE DPQR+SLPD SN++RLRDFIKHVYVDR
Sbjct  61   VKSVSMAKFSAQEVSALQEGGNQRAKEIYFKEWDPQRHSLPDSSNIDRLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGKGETEDLNGNRRVDTY  582
            R++GER +   PR KG+ +D + N+R +TY
Sbjct  121  RFSGERTYDKPPRVKGDKDDFHENKRTETY  150



>gb|KJB27127.1| hypothetical protein B456_004G279500 [Gossypium raimondii]
Length=729

 Score =   246 bits (628),  Expect = 5e-73, Method: Composition-based stats.
 Identities = 119/151 (79%), Positives = 131/151 (87%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDE+NERIIRGLLK P+NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFTHR
Sbjct  1    MASRVKEDERNERIIRGLLKQPENRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV+ALQ GGN  A+EIY+KE DPQRNS PD SNVERLRDFIKHVY DR
Sbjct  61   VKSVSMAKFTSQEVTALQEGGNQRAREIYMKEWDPQRNSGPDSSNVERLRDFIKHVYEDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RY+GER +   PRGK G+ ED+ G+RR D Y
Sbjct  121  RYSGERNYDKPPRGKMGDKEDVYGSRRADGY  151



>gb|KJB27126.1| hypothetical protein B456_004G279500 [Gossypium raimondii]
Length=736

 Score =   246 bits (628),  Expect = 5e-73, Method: Composition-based stats.
 Identities = 119/151 (79%), Positives = 131/151 (87%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDE+NERIIRGLLK P+NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFTHR
Sbjct  1    MASRVKEDERNERIIRGLLKQPENRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV+ALQ GGN  A+EIY+KE DPQRNS PD SNVERLRDFIKHVY DR
Sbjct  61   VKSVSMAKFTSQEVTALQEGGNQRAREIYMKEWDPQRNSGPDSSNVERLRDFIKHVYEDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RY+GER +   PRGK G+ ED+ G+RR D Y
Sbjct  121  RYSGERNYDKPPRGKMGDKEDVYGSRRADGY  151



>gb|KJB27130.1| hypothetical protein B456_004G279500 [Gossypium raimondii]
Length=737

 Score =   246 bits (628),  Expect = 5e-73, Method: Composition-based stats.
 Identities = 119/151 (79%), Positives = 131/151 (87%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDE+NERIIRGLLK P+NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFTHR
Sbjct  1    MASRVKEDERNERIIRGLLKQPENRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV+ALQ GGN  A+EIY+KE DPQRNS PD SNVERLRDFIKHVY DR
Sbjct  61   VKSVSMAKFTSQEVTALQEGGNQRAREIYMKEWDPQRNSGPDSSNVERLRDFIKHVYEDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RY+GER +   PRGK G+ ED+ G+RR D Y
Sbjct  121  RYSGERNYDKPPRGKMGDKEDVYGSRRADGY  151



>ref|XP_010934816.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X4 [Elaeis guineensis]
Length=625

 Score =   243 bits (621),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 124/150 (83%), Gaps = 3/150 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNE+IIRGLLKLP N+RCINCNSLGPQYVC NF TFICT CSG+HREFTHR
Sbjct  1    MANRMKEDEKNEKIIRGLLKLPANKRCINCNSLGPQYVCTNFWTFICTNCSGLHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFT QEV ALQ GGN  AKEIY KE DPQR+ +PD SN ++LRDFIKHVYVDR
Sbjct  61   VKSISMAKFTPQEVRALQEGGNERAKEIYFKEWDPQRHYVPDSSNPDKLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGKGETEDLNGNRRVDTY  582
            RYTGER     P+ KG+ ED   NRR D+Y
Sbjct  121  RYTGERSIDRPPKVKGDREDTYENRREDSY  150



>gb|KHG08531.1| hypothetical protein F383_13599 [Gossypium arboreum]
Length=693

 Score =   245 bits (625),  Expect = 7e-73, Method: Composition-based stats.
 Identities = 119/151 (79%), Positives = 130/151 (86%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDE+NERIIRGLLK P+NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFTHR
Sbjct  1    MASRVKEDERNERIIRGLLKQPENRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV+ALQ GGN  A+EIY+KE DPQRNS PD SNVERLRDFIKHVY DR
Sbjct  61   VKSVSMAKFTSQEVTALQEGGNQRAREIYMKEWDPQRNSGPDSSNVERLRDFIKHVYEDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RY+GER +   PRGK G+ ED+  NRR D Y
Sbjct  121  RYSGERNYDKPPRGKMGDKEDVYENRRADGY  151



>ref|XP_010249829.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Nelumbo nucifera]
 ref|XP_010249830.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Nelumbo nucifera]
 ref|XP_010249831.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Nelumbo nucifera]
Length=758

 Score =   246 bits (628),  Expect = 7e-73, Method: Composition-based stats.
 Identities = 120/150 (80%), Positives = 127/150 (85%), Gaps = 4/150 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNERIIRGLLKLP+NRRCINCNSLGPQYVC +F TF+CTTCSGIHREFTHR
Sbjct  1    MANRVKEDEKNERIIRGLLKLPENRRCINCNSLGPQYVCTSFWTFVCTTCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEVSALQ GGN  AKEIY KE DPQR S+PD SNV+RLRDFIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVSALQAGGNQRAKEIYFKEWDPQRQSIPDSSNVDRLRDFIKHVYVDR  120

Query  502  RYTGERGFPRGK----GETEDLNGNRRVDT  579
            RYTGE    + +    GE ED   NRRVDT
Sbjct  121  RYTGEPSIDKSRRVKSGEREDSYENRRVDT  150



>ref|XP_010656352.1| PREDICTED: actin cytoskeleton-regulatory complex protein pan1 
isoform X2 [Vitis vinifera]
Length=758

 Score =   246 bits (628),  Expect = 7e-73, Method: Composition-based stats.
 Identities = 118/151 (78%), Positives = 128/151 (85%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNERIIRGLLKLP+NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFTHR
Sbjct  1    MANRMKEDEKNERIIRGLLKLPENRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEVS+LQ GGN   KE Y KE DPQR+S PD SN+ERLRDFIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVSSLQRGGNERVKEFYFKEWDPQRHSFPDSSNIERLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RY+GER F   PR K G+ E+   NR++D Y
Sbjct  121  RYSGERSFDKPPRVKMGDKEEPYENRKMDNY  151



>ref|XP_002281316.2| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Vitis vinifera]
 emb|CBI28100.3| unnamed protein product [Vitis vinifera]
Length=759

 Score =   246 bits (628),  Expect = 7e-73, Method: Composition-based stats.
 Identities = 118/151 (78%), Positives = 128/151 (85%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNERIIRGLLKLP+NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFTHR
Sbjct  1    MANRMKEDEKNERIIRGLLKLPENRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEVS+LQ GGN   KE Y KE DPQR+S PD SN+ERLRDFIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVSSLQRGGNERVKEFYFKEWDPQRHSFPDSSNIERLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RY+GER F   PR K G+ E+   NR++D Y
Sbjct  121  RYSGERSFDKPPRVKMGDKEEPYENRKMDNY  151



>ref|XP_004167945.1| PREDICTED: uncharacterized LOC101209764 [Cucumis sativus]
 gb|KGN60631.1| hypothetical protein Csa_2G005280 [Cucumis sativus]
Length=711

 Score =   245 bits (625),  Expect = 8e-73, Method: Composition-based stats.
 Identities = 121/151 (80%), Positives = 128/151 (85%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNERIIRGLLKL +NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFTHR
Sbjct  1    MANRVKEDEKNERIIRGLLKLQENRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFTSQEVSALQ GGN  AKEIY KELDPQR+S PD SNV RLRDFIKHVYVDR
Sbjct  61   VKSISMAKFTSQEVSALQEGGNQRAKEIYFKELDPQRHSFPDSSNVMRLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RY+G++ F   PR K GE ED    RR DTY
Sbjct  121  RYSGDKNFDRPPRVKSGEKEDTYETRRADTY  151



>ref|XP_006580462.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like [Glycine max]
Length=697

 Score =   244 bits (624),  Expect = 9e-73, Method: Composition-based stats.
 Identities = 114/150 (76%), Positives = 129/150 (86%), Gaps = 3/150 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDEKNERIIRGLLKL  NRRCINCNSLGPQYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MASRVKEDEKNERIIRGLLKLTPNRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKF++QEVSALQ GGN  AKEIY KE DPQR+SLPD SN++RLRDFIKHVYVDR
Sbjct  61   VKSVSMAKFSAQEVSALQEGGNQRAKEIYFKEWDPQRHSLPDSSNIDRLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGKGETEDLNGNRRVDTY  582
            R++GER +   PR KG+ +D + N+R +TY
Sbjct  121  RFSGERTYDKPPRVKGDKDDFHENKRTETY  150



>ref|XP_010249832.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Nelumbo nucifera]
Length=712

 Score =   245 bits (625),  Expect = 1e-72, Method: Composition-based stats.
 Identities = 120/150 (80%), Positives = 127/150 (85%), Gaps = 4/150 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNERIIRGLLKLP+NRRCINCNSLGPQYVC +F TF+CTTCSGIHREFTHR
Sbjct  1    MANRVKEDEKNERIIRGLLKLPENRRCINCNSLGPQYVCTSFWTFVCTTCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEVSALQ GGN  AKEIY KE DPQR S+PD SNV+RLRDFIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVSALQAGGNQRAKEIYFKEWDPQRQSIPDSSNVDRLRDFIKHVYVDR  120

Query  502  RYTGERGFPRGK----GETEDLNGNRRVDT  579
            RYTGE    + +    GE ED   NRRVDT
Sbjct  121  RYTGEPSIDKSRRVKSGEREDSYENRRVDT  150



>ref|XP_008242637.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Prunus mume]
Length=710

 Score =   245 bits (625),  Expect = 1e-72, Method: Composition-based stats.
 Identities = 122/151 (81%), Positives = 128/151 (85%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDEKNERIIR LLKLP+NRRCINCNSLGPQYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MASRVKEDEKNERIIRSLLKLPENRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV+ALQ GGN  AK IY KELDPQRNS PD SNVERLRDFIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVNALQEGGNQRAKGIYHKELDPQRNSFPDSSNVERLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RYTGER     PR K GE ED   NRR+D+Y
Sbjct  121  RYTGERNLDKPPRAKMGEKEDSYENRRLDSY  151



>gb|KJB27128.1| hypothetical protein B456_004G279500 [Gossypium raimondii]
Length=648

 Score =   243 bits (620),  Expect = 1e-72, Method: Composition-based stats.
 Identities = 119/151 (79%), Positives = 131/151 (87%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDE+NERIIRGLLK P+NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFTHR
Sbjct  1    MASRVKEDERNERIIRGLLKQPENRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV+ALQ GGN  A+EIY+KE DPQRNS PD SNVERLRDFIKHVY DR
Sbjct  61   VKSVSMAKFTSQEVTALQEGGNQRAREIYMKEWDPQRNSGPDSSNVERLRDFIKHVYEDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RY+GER +   PRGK G+ ED+ G+RR D Y
Sbjct  121  RYSGERNYDKPPRGKMGDKEDVYGSRRADGY  151



>ref|XP_009415353.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Musa acuminata subsp. malaccensis]
Length=598

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 122/145 (84%), Gaps = 3/145 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R +EDEKNERIIRGLLKLP NRRCINCNSLGPQYVC NF TFICT CSGIHREFTHR
Sbjct  1    MASRVREDEKNERIIRGLLKLPANRRCINCNSLGPQYVCTNFWTFICTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFTSQEVSALQ GGN  AKEIY KE DPQ +S PD SN++RLR+FIKHVYVDR
Sbjct  61   VKSISMAKFTSQEVSALQEGGNERAKEIYFKEWDPQHHSFPDNSNIDRLREFIKHVYVDR  120

Query  502  RYTGERGF---PRGKGETEDLNGNR  567
            RY GER F   PR KG+ ED   NR
Sbjct  121  RYAGERSFDRPPRVKGDIEDSYLNR  145



>ref|XP_011458060.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Fragaria vesca subsp. vesca]
 ref|XP_011458085.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Fragaria vesca subsp. vesca]
Length=726

 Score =   244 bits (623),  Expect = 2e-72, Method: Composition-based stats.
 Identities = 122/151 (81%), Positives = 129/151 (85%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDEKNERIIRGLLKLP+NRRCINCNSLGPQYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MASR-KEDEKNERIIRGLLKLPENRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV +LQ GGN  AKEIY KELDPQRNS PD SNVERLRDFIKHVYVDR
Sbjct  60   VKSVSMAKFTSQEVKSLQEGGNQRAKEIYQKELDPQRNSFPDSSNVERLRDFIKHVYVDR  119

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RYTGER     PR K G+ ED   NRR+D+Y
Sbjct  120  RYTGERNIDKPPRLKTGDKEDSYENRRLDSY  150



>ref|XP_008458192.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Cucumis melo]
 ref|XP_008458200.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Cucumis melo]
Length=712

 Score =   243 bits (621),  Expect = 3e-72, Method: Composition-based stats.
 Identities = 120/151 (79%), Positives = 128/151 (85%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNERIIRGLLKL +NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFTHR
Sbjct  1    MANRVKEDEKNERIIRGLLKLQENRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFTSQEVSALQ GGN  AKEIY KELDPQR+S PD SNV RLRDFIKHVYVDR
Sbjct  61   VKSISMAKFTSQEVSALQEGGNQRAKEIYFKELDPQRHSFPDSSNVMRLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RY+G++ F   PR K GE ED    R+ DTY
Sbjct  121  RYSGDKNFDRPPRVKSGEKEDTYEIRKADTY  151



>ref|XP_004287082.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Fragaria vesca subsp. vesca]
Length=701

 Score =   243 bits (620),  Expect = 4e-72, Method: Composition-based stats.
 Identities = 122/151 (81%), Positives = 129/151 (85%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDEKNERIIRGLLKLP+NRRCINCNSLGPQYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MASR-KEDEKNERIIRGLLKLPENRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV +LQ GGN  AKEIY KELDPQRNS PD SNVERLRDFIKHVYVDR
Sbjct  60   VKSVSMAKFTSQEVKSLQEGGNQRAKEIYQKELDPQRNSFPDSSNVERLRDFIKHVYVDR  119

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RYTGER     PR K G+ ED   NRR+D+Y
Sbjct  120  RYTGERNIDKPPRLKTGDKEDSYENRRLDSY  150



>ref|XP_004512853.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X1 [Cicer arietinum]
Length=687

 Score =   241 bits (615),  Expect = 2e-71, Method: Composition-based stats.
 Identities = 114/150 (76%), Positives = 127/150 (85%), Gaps = 3/150 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KEDEKNERIIRGLLKL  NRRCINCNSLGPQYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MTSRLKEDEKNERIIRGLLKLTPNRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFT+QEVSALQ GGN  AKEI+ KE DPQ +SLPD SNV+RLRDF+KHVYVDR
Sbjct  61   VKSISMAKFTAQEVSALQEGGNQRAKEIFFKEWDPQSHSLPDSSNVDRLRDFLKHVYVDR  120

Query  502  RYTGERGF---PRGKGETEDLNGNRRVDTY  582
            R+TGER     PR KG+ +DL+ NRRV+ Y
Sbjct  121  RFTGERSIDKPPRVKGDKDDLSENRRVEAY  150



>ref|XP_004512854.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X2 [Cicer arietinum]
Length=686

 Score =   241 bits (615),  Expect = 2e-71, Method: Composition-based stats.
 Identities = 114/150 (76%), Positives = 127/150 (85%), Gaps = 3/150 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KEDEKNERIIRGLLKL  NRRCINCNSLGPQYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MTSRLKEDEKNERIIRGLLKLTPNRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFT+QEVSALQ GGN  AKEI+ KE DPQ +SLPD SNV+RLRDF+KHVYVDR
Sbjct  61   VKSISMAKFTAQEVSALQEGGNQRAKEIFFKEWDPQSHSLPDSSNVDRLRDFLKHVYVDR  120

Query  502  RYTGERGF---PRGKGETEDLNGNRRVDTY  582
            R+TGER     PR KG+ +DL+ NRRV+ Y
Sbjct  121  RFTGERSIDKPPRVKGDKDDLSENRRVEAY  150



>gb|KHG17023.1| hypothetical protein F383_09821 [Gossypium arboreum]
Length=774

 Score =   242 bits (618),  Expect = 2e-71, Method: Composition-based stats.
 Identities = 119/151 (79%), Positives = 127/151 (84%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDEKNERIIR LLK  +NRRCINCNSLGPQYVC +F TF+CTTCSGIHREFTHR
Sbjct  1    MASRLKEDEKNERIIRALLKQSENRRCINCNSLGPQYVCTSFWTFVCTTCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEVSALQ GGN  AKEIY KE DPQRNS+PD SNVERLRDFIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVSALQEGGNQRAKEIYFKEWDPQRNSVPDRSNVERLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RY+G R +   PRGK G+ ED   NRR D Y
Sbjct  121  RYSGGRNYDKPPRGKMGDKEDFYENRRTDGY  151



>gb|KJB64872.1| hypothetical protein B456_010G069100 [Gossypium raimondii]
 gb|KJB64873.1| hypothetical protein B456_010G069100 [Gossypium raimondii]
 gb|KJB64874.1| hypothetical protein B456_010G069100 [Gossypium raimondii]
Length=740

 Score =   241 bits (616),  Expect = 3e-71, Method: Composition-based stats.
 Identities = 118/151 (78%), Positives = 126/151 (83%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDEKNERIIR LLK P+NRRCINCNSLGPQYVC +F TF+C TCSGIHREFTHR
Sbjct  1    MASRLKEDEKNERIIRALLKQPENRRCINCNSLGPQYVCTSFWTFVCITCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEVSALQ GGN  AKEIY KE DPQ NS+PD SNVERLRDFIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVSALQEGGNQRAKEIYFKEWDPQSNSVPDSSNVERLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RY+G R +   PRGK G+ ED   NRR D Y
Sbjct  121  RYSGGRNYDKPPRGKMGDKEDFYENRRTDGY  151



>ref|XP_004139426.1| PREDICTED: uncharacterized protein LOC101209764 [Cucumis sativus]
Length=630

 Score =   239 bits (610),  Expect = 3e-71, Method: Composition-based stats.
 Identities = 121/155 (78%), Positives = 128/155 (83%), Gaps = 8/155 (5%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNERIIRGLLKL +NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFTHR
Sbjct  1    MANRVKEDEKNERIIRGLLKLQENRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDG----SNVERLRDFIKHV  489
            VKS+SMAKFTSQEVSALQ GGN  AKEIY KELDPQR+S PD     SNV RLRDFIKHV
Sbjct  61   VKSISMAKFTSQEVSALQEGGNQRAKEIYFKELDPQRHSFPDSSFLYSNVMRLRDFIKHV  120

Query  490  YVDRRYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            YVDRRY+G++ F   PR K GE ED    RR DTY
Sbjct  121  YVDRRYSGDKNFDRPPRVKSGEKEDTYETRRADTY  155



>ref|XP_009415351.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009415352.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Musa acuminata subsp. malaccensis]
Length=638

 Score =   239 bits (610),  Expect = 4e-71, Method: Composition-based stats.
 Identities = 114/145 (79%), Positives = 122/145 (84%), Gaps = 3/145 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R +EDEKNERIIRGLLKLP NRRCINCNSLGPQYVC NF TFICT CSGIHREFTHR
Sbjct  1    MASRVREDEKNERIIRGLLKLPANRRCINCNSLGPQYVCTNFWTFICTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFTSQEVSALQ GGN  AKEIY KE DPQ +S PD SN++RLR+FIKHVYVDR
Sbjct  61   VKSISMAKFTSQEVSALQEGGNERAKEIYFKEWDPQHHSFPDNSNIDRLREFIKHVYVDR  120

Query  502  RYTGERGF---PRGKGETEDLNGNR  567
            RY GER F   PR KG+ ED   NR
Sbjct  121  RYAGERSFDRPPRVKGDIEDSYLNR  145



>gb|KDO54160.1| hypothetical protein CISIN_1g004435mg [Citrus sinensis]
Length=677

 Score =   239 bits (611),  Expect = 5e-71, Method: Composition-based stats.
 Identities = 119/151 (79%), Positives = 124/151 (82%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNERIIRGLLKL DNRRCINCNSLG QYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MANRLKEDEKNERIIRGLLKLQDNRRCINCNSLGTQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV ALQ GGN  AKE+ LKE DPQR S PD SNVERLR+FIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVKALQEGGNQRAKEVLLKEWDPQRQSFPDSSNVERLRNFIKHVYVDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RYTGER +   PR K G+ ED    RR DTY
Sbjct  121  RYTGERNYDKPPRVKMGDKEDSYDIRR-DTY  150



>gb|KJB54155.1| hypothetical protein B456_009G023500 [Gossypium raimondii]
 gb|KJB54157.1| hypothetical protein B456_009G023500 [Gossypium raimondii]
 gb|KJB54160.1| hypothetical protein B456_009G023500 [Gossypium raimondii]
Length=741

 Score =   241 bits (614),  Expect = 5e-71, Method: Composition-based stats.
 Identities = 121/151 (80%), Positives = 125/151 (83%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA R KEDEKNERIIRGLLK P+NRRCINCNSLGPQYVC NF TFICTTCSGIHREFTHR
Sbjct  1    MAGRVKEDEKNERIIRGLLKQPENRRCINCNSLGPQYVCTNFWTFICTTCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEVSALQ GGN  AKEIY KE DPQRNSLP  SNVERLRDFIKHVYVD 
Sbjct  61   VKSVSMAKFTSQEVSALQEGGNQRAKEIYFKEWDPQRNSLPKSSNVERLRDFIKHVYVDG  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RY+G R     P+GK G+ ED   NRR D Y
Sbjct  121  RYSGGRSNDKPPQGKTGDKEDFFENRRTDGY  151



>gb|KJB54158.1| hypothetical protein B456_009G023500 [Gossypium raimondii]
Length=742

 Score =   241 bits (614),  Expect = 5e-71, Method: Composition-based stats.
 Identities = 121/151 (80%), Positives = 125/151 (83%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA R KEDEKNERIIRGLLK P+NRRCINCNSLGPQYVC NF TFICTTCSGIHREFTHR
Sbjct  1    MAGRVKEDEKNERIIRGLLKQPENRRCINCNSLGPQYVCTNFWTFICTTCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEVSALQ GGN  AKEIY KE DPQRNSLP  SNVERLRDFIKHVYVD 
Sbjct  61   VKSVSMAKFTSQEVSALQEGGNQRAKEIYFKEWDPQRNSLPKSSNVERLRDFIKHVYVDG  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RY+G R     P+GK G+ ED   NRR D Y
Sbjct  121  RYSGGRSNDKPPQGKTGDKEDFFENRRTDGY  151



>gb|KJB54156.1| hypothetical protein B456_009G023500 [Gossypium raimondii]
Length=713

 Score =   240 bits (612),  Expect = 6e-71, Method: Composition-based stats.
 Identities = 121/151 (80%), Positives = 125/151 (83%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA R KEDEKNERIIRGLLK P+NRRCINCNSLGPQYVC NF TFICTTCSGIHREFTHR
Sbjct  1    MAGRVKEDEKNERIIRGLLKQPENRRCINCNSLGPQYVCTNFWTFICTTCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEVSALQ GGN  AKEIY KE DPQRNSLP  SNVERLRDFIKHVYVD 
Sbjct  61   VKSVSMAKFTSQEVSALQEGGNQRAKEIYFKEWDPQRNSLPKSSNVERLRDFIKHVYVDG  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RY+G R     P+GK G+ ED   NRR D Y
Sbjct  121  RYSGGRSNDKPPQGKTGDKEDFFENRRTDGY  151



>gb|KDP32306.1| hypothetical protein JCGZ_13231 [Jatropha curcas]
Length=717

 Score =   240 bits (612),  Expect = 8e-71, Method: Composition-based stats.
 Identities = 115/141 (82%), Positives = 123/141 (87%), Gaps = 4/141 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDEKNERIIRGLLKLP+NRRCINCN LGPQYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MASRVKEDEKNERIIRGLLKLPENRRCINCNCLGPQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV+ALQGGGN  A++IYLKE DPQR S PDGSNVERLRDFIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVAALQGGGNQRARDIYLKEWDPQRQSAPDGSNVERLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGK-GETED  552
            RYTGER +   P  K G+ ED
Sbjct  121  RYTGERNYGKPPSAKLGDKED  141



>ref|XP_010933331.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Elaeis guineensis]
Length=665

 Score =   238 bits (608),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 113/150 (75%), Positives = 124/150 (83%), Gaps = 3/150 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNE+IIRGLLKLP N+RCINCNSLGPQYVC NF TFICT CSG+HREFTHR
Sbjct  1    MANRMKEDEKNEKIIRGLLKLPANKRCINCNSLGPQYVCTNFWTFICTNCSGLHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFT QEV ALQ GGN  AKEIY KE DPQR+ +PD SN ++LRDFIKHVYVDR
Sbjct  61   VKSISMAKFTPQEVRALQEGGNERAKEIYFKEWDPQRHYVPDSSNPDKLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGKGETEDLNGNRRVDTY  582
            RYTGER     P+ KG+ ED   NRR D+Y
Sbjct  121  RYTGERSIDRPPKVKGDREDTYENRREDSY  150



>ref|XP_010931848.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Elaeis guineensis]
 ref|XP_010932605.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Elaeis guineensis]
Length=666

 Score =   238 bits (608),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 113/150 (75%), Positives = 124/150 (83%), Gaps = 3/150 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNE+IIRGLLKLP N+RCINCNSLGPQYVC NF TFICT CSG+HREFTHR
Sbjct  1    MANRMKEDEKNEKIIRGLLKLPANKRCINCNSLGPQYVCTNFWTFICTNCSGLHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFT QEV ALQ GGN  AKEIY KE DPQR+ +PD SN ++LRDFIKHVYVDR
Sbjct  61   VKSISMAKFTPQEVRALQEGGNERAKEIYFKEWDPQRHYVPDSSNPDKLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGKGETEDLNGNRRVDTY  582
            RYTGER     P+ KG+ ED   NRR D+Y
Sbjct  121  RYTGERSIDRPPKVKGDREDTYENRREDSY  150



>ref|XP_006844366.1| hypothetical protein AMTR_s00142p00058560 [Amborella trichopoda]
 gb|ERN06041.1| hypothetical protein AMTR_s00142p00058560 [Amborella trichopoda]
Length=782

 Score =   240 bits (613),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 119/155 (77%), Positives = 129/155 (83%), Gaps = 5/155 (3%)
 Frame = +1

Query  130  IGVQMANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHRE  309
            IGV MANR KEDEKNE+IIRGLLKLP NRRCINCNSLGPQYVC NF TF+CT CSGIHRE
Sbjct  9    IGV-MANRMKEDEKNEKIIRGLLKLPANRRCINCNSLGPQYVCTNFWTFVCTACSGIHRE  67

Query  310  FTHRVKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHV  489
            FTHRVKSVSMAKFTSQEV+ALQGGGN  AKE Y KE D  R++LPD SNVERLRDFI+H 
Sbjct  68   FTHRVKSVSMAKFTSQEVTALQGGGNERAKEFYFKEWDAHRHTLPDSSNVERLRDFIRHA  127

Query  490  YVDRRYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            YV+RRYTGERG    P+G+  + ED   NRR DTY
Sbjct  128  YVERRYTGERGTDKPPKGRMNDQEDAYENRRTDTY  162



>ref|XP_010934106.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X3 [Elaeis guineensis]
Length=664

 Score =   238 bits (606),  Expect = 3e-70, Method: Composition-based stats.
 Identities = 113/148 (76%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNE+IIRGLLKLP N+RCINCNSLGPQYVC NF TFICT CSG+HREFTHR
Sbjct  1    MANRMKEDEKNEKIIRGLLKLPANKRCINCNSLGPQYVCTNFWTFICTNCSGLHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFT QEV ALQ GGN  AKEIY KE DPQR+ +PD SN ++LRDFIKHVYVDR
Sbjct  61   VKSISMAKFTPQEVRALQEGGNERAKEIYFKEWDPQRHYVPDSSNPDKLRDFIKHVYVDR  120

Query  502  RYTGERGFPR-GKGETEDLNGNRRVDTY  582
            RYTGER   R  KG+ ED   NRR D+Y
Sbjct  121  RYTGERSIDRPPKGDREDTYENRREDSY  148



>ref|XP_008804233.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Phoenix dactylifera]
Length=662

 Score =   236 bits (602),  Expect = 8e-70, Method: Composition-based stats.
 Identities = 113/150 (75%), Positives = 123/150 (82%), Gaps = 3/150 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNE+IIRGLLKLP NRRCINCNSLGPQYVC NF TFICT CSG+ REFTHR
Sbjct  1    MANRMKEDEKNEKIIRGLLKLPANRRCINCNSLGPQYVCTNFWTFICTNCSGLXREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFT QEV ALQ GGN  AKEIY KE DPQR+ +PD SN+++LRDFIKHVYVDR
Sbjct  61   VKSISMAKFTPQEVRALQEGGNERAKEIYFKEWDPQRHYVPDSSNLDKLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGKGETEDLNGNRRVDTY  582
            RYTGER     P  KG+ ED   NRR D+Y
Sbjct  121  RYTGERSINRPPNVKGDREDTYENRREDSY  150



>ref|XP_008804232.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Phoenix dactylifera]
Length=663

 Score =   236 bits (602),  Expect = 9e-70, Method: Composition-based stats.
 Identities = 113/150 (75%), Positives = 123/150 (82%), Gaps = 3/150 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNE+IIRGLLKLP NRRCINCNSLGPQYVC NF TFICT CSG+ REFTHR
Sbjct  1    MANRMKEDEKNEKIIRGLLKLPANRRCINCNSLGPQYVCTNFWTFICTNCSGLXREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFT QEV ALQ GGN  AKEIY KE DPQR+ +PD SN+++LRDFIKHVYVDR
Sbjct  61   VKSISMAKFTPQEVRALQEGGNERAKEIYFKEWDPQRHYVPDSSNLDKLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGKGETEDLNGNRRVDTY  582
            RYTGER     P  KG+ ED   NRR D+Y
Sbjct  121  RYTGERSINRPPNVKGDREDTYENRREDSY  150



>ref|XP_010915040.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Elaeis guineensis]
Length=711

 Score =   236 bits (603),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 110/150 (73%), Positives = 125/150 (83%), Gaps = 3/150 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNE+IIRGLLKLP NRRCINCN+LGPQYVC NF TFICT CSG+HREFTHR
Sbjct  1    MANRMKEDEKNEKIIRGLLKLPANRRCINCNNLGPQYVCTNFWTFICTNCSGVHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFTSQEV+ALQ  GN  A+ +Y KE DP R+S PD SN++RLRDFIKHVYVDR
Sbjct  61   VKSISMAKFTSQEVNALQEAGNEHARGVYFKEWDPHRHSFPDSSNIDRLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGKGETEDLNGNRRVDTY  582
            R+TGER     PR KG  ED N NR++++Y
Sbjct  121  RFTGERNVDKPPRTKGVREDYNENRKMESY  150



>ref|XP_006584844.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like [Glycine max]
 gb|KHN16595.1| Putative ADP-ribosylation factor GTPase-activating protein AGD14 
[Glycine soja]
Length=696

 Score =   236 bits (601),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 112/150 (75%), Positives = 127/150 (85%), Gaps = 3/150 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDEKNERIIRGLLKL  NRRCINCNSLGPQYVC NF TF+C  CSGIHREFTHR
Sbjct  1    MASRLKEDEKNERIIRGLLKLTPNRRCINCNSLGPQYVCSNFWTFVCINCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKF++QEVSALQ GGN  A+EIYLKE DPQR+SLPD SNV++LRDFIK+VYVDR
Sbjct  61   VKSVSMAKFSAQEVSALQEGGNQRAQEIYLKEWDPQRHSLPDSSNVDKLRDFIKNVYVDR  120

Query  502  RYTGERGF---PRGKGETEDLNGNRRVDTY  582
            R++GER +   PR KG+ +D + N R  TY
Sbjct  121  RFSGERTYDKPPRVKGDKDDFHENMRTKTY  150



>ref|XP_007160353.1| hypothetical protein PHAVU_002G314500g [Phaseolus vulgaris]
 gb|ESW32347.1| hypothetical protein PHAVU_002G314500g [Phaseolus vulgaris]
Length=692

 Score =   235 bits (599),  Expect = 3e-69, Method: Composition-based stats.
 Identities = 111/150 (74%), Positives = 124/150 (83%), Gaps = 3/150 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDEKNERIIRGLLKL  NRRCINCNS+GPQYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MASRLKEDEKNERIIRGLLKLAPNRRCINCNSMGPQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFT+QEV +LQ GGN  AKEIY KE DPQ +SLPD S+V RLRDFIKHVYVDR
Sbjct  61   VKSISMAKFTAQEVGSLQEGGNQRAKEIYFKEWDPQHHSLPDSSHVGRLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGKGETEDLNGNRRVDTY  582
            R++GER     PR KG+ +D   N+R DTY
Sbjct  121  RFSGERTNDKPPRVKGDKDDFYENKRTDTY  150



>gb|KDO54162.1| hypothetical protein CISIN_1g004435mg [Citrus sinensis]
Length=698

 Score =   233 bits (595),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 119/151 (79%), Positives = 124/151 (82%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNERIIRGLLKL DNRRCINCNSLG QYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MANRLKEDEKNERIIRGLLKLQDNRRCINCNSLGTQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV ALQ GGN  AKE+ LKE DPQR S PD SNVERLR+FIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVKALQEGGNQRAKEVLLKEWDPQRQSFPDSSNVERLRNFIKHVYVDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RYTGER +   PR K G+ ED    RR DTY
Sbjct  121  RYTGERNYDKPPRVKMGDKEDSYDIRR-DTY  150



>ref|XP_006475717.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X4 [Citrus sinensis]
Length=711

 Score =   234 bits (596),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 119/151 (79%), Positives = 124/151 (82%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNERIIRGLLKL DNRRCINCNSLG QYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MANRLKEDEKNERIIRGLLKLQDNRRCINCNSLGTQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV ALQ GGN  AKE+ LKE DPQR S PD SNVERLR+FIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVKALQEGGNQRAKEVLLKEWDPQRQSFPDSSNVERLRNFIKHVYVDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RYTGER +   PR K G+ ED    RR DTY
Sbjct  121  RYTGERNYDKPPRVKMGDKEDSYDIRR-DTY  150



>ref|XP_009412408.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Musa acuminata subsp. malaccensis]
Length=596

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 122/150 (81%), Gaps = 3/150 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA   KEDEKNE+IIRGLLKLP NRRCINCNSLGPQYVCINF TFIC  CSGIHREFTHR
Sbjct  1    MARPEKEDEKNEKIIRGLLKLPANRRCINCNSLGPQYVCINFWTFICINCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFTSQEVSALQ GGN  AKEIY KE DPQ +SLPD SN++RLR+FIK+VYVD 
Sbjct  61   VKSISMAKFTSQEVSALQEGGNERAKEIYFKEWDPQHHSLPDNSNIDRLREFIKNVYVDG  120

Query  502  RYTGERGFPRG---KGETEDLNGNRRVDTY  582
            RYTGER F R    K   ED    R+VD++
Sbjct  121  RYTGERSFDRPQMVKVNAEDSYDKRKVDSF  150



>ref|XP_002324405.1| Rev interacting-like family protein [Populus trichocarpa]
 gb|EEF02970.1| Rev interacting-like family protein [Populus trichocarpa]
Length=649

 Score =   233 bits (593),  Expect = 2e-68, Method: Composition-based stats.
 Identities = 112/147 (76%), Positives = 122/147 (83%), Gaps = 4/147 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNERIIRGLLK  +NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFTHR
Sbjct  1    MANRLKEDEKNERIIRGLLKHTENRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV+ALQ GGN  A++IY KE D QR S PD SNVERLRDFIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVAALQEGGNKRARDIYFKEWDSQRQSAPDSSNVERLRDFIKHVYVDR  120

Query  502  RYTGERGFPRGKGETEDLNGNRRVDTY  582
            RYTGER +    G+  + + NR+ D Y
Sbjct  121  RYTGERNY----GKPPNFSENRKTDAY  143



>gb|KDO54161.1| hypothetical protein CISIN_1g004435mg [Citrus sinensis]
Length=711

 Score =   233 bits (595),  Expect = 2e-68, Method: Composition-based stats.
 Identities = 119/151 (79%), Positives = 124/151 (82%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNERIIRGLLKL DNRRCINCNSLG QYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MANRLKEDEKNERIIRGLLKLQDNRRCINCNSLGTQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV ALQ GGN  AKE+ LKE DPQR S PD SNVERLR+FIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVKALQEGGNQRAKEVLLKEWDPQRQSFPDSSNVERLRNFIKHVYVDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RYTGER +   PR K G+ ED    RR DTY
Sbjct  121  RYTGERNYDKPPRVKMGDKEDSYDIRR-DTY  150



>ref|XP_006583397.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X5 [Glycine max]
Length=546

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 122/152 (80%), Gaps = 5/152 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDEKNER+IRGLLKL  NRRCINCNSLGPQYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MASRMKEDEKNERVIRGLLKLQHNRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEVSALQ GGN  AKEIY KE D QR+S PD SNV+RLRDFIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVSALQEGGNQRAKEIYFKEWDAQRHSFPDSSNVDRLRDFIKHVYVDR  120

Query  502  RYTGERG---FPRGK-GETEDL-NGNRRVDTY  582
            R+TG++     PR K G+ +D   G  R   Y
Sbjct  121  RFTGDKTNDKPPRAKPGDKDDFYQGGSRSPPY  152



>ref|XP_011043437.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Populus euphratica]
 ref|XP_011043438.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Populus euphratica]
 ref|XP_011043439.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Populus euphratica]
Length=739

 Score =   234 bits (596),  Expect = 2e-68, Method: Composition-based stats.
 Identities = 114/151 (75%), Positives = 124/151 (82%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNERIIRGLLK  +NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFTHR
Sbjct  1    MANRLKEDEKNERIIRGLLKHTENRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV+ALQ GGN  A++IY KE D QR S PD SNVERLRDFIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVAALQEGGNKRARDIYFKEWDSQRQSPPDSSNVERLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGKGET-EDLNGNRRVDTY  582
            RYTGER +   P  K +  ED + +R+ D Y
Sbjct  121  RYTGERNYGKPPSMKMDNKEDFSEHRKTDAY  151



>ref|XP_006475714.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X1 [Citrus sinensis]
 ref|XP_006475715.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X2 [Citrus sinensis]
Length=753

 Score =   234 bits (597),  Expect = 2e-68, Method: Composition-based stats.
 Identities = 119/151 (79%), Positives = 124/151 (82%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNERIIRGLLKL DNRRCINCNSLG QYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MANRLKEDEKNERIIRGLLKLQDNRRCINCNSLGTQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV ALQ GGN  AKE+ LKE DPQR S PD SNVERLR+FIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVKALQEGGNQRAKEVLLKEWDPQRQSFPDSSNVERLRNFIKHVYVDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RYTGER +   PR K G+ ED    RR DTY
Sbjct  121  RYTGERNYDKPPRVKMGDKEDSYDIRR-DTY  150



>gb|KDO54156.1| hypothetical protein CISIN_1g004435mg [Citrus sinensis]
 gb|KDO54157.1| hypothetical protein CISIN_1g004435mg [Citrus sinensis]
 gb|KDO54158.1| hypothetical protein CISIN_1g004435mg [Citrus sinensis]
Length=753

 Score =   234 bits (597),  Expect = 2e-68, Method: Composition-based stats.
 Identities = 119/151 (79%), Positives = 124/151 (82%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNERIIRGLLKL DNRRCINCNSLG QYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MANRLKEDEKNERIIRGLLKLQDNRRCINCNSLGTQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV ALQ GGN  AKE+ LKE DPQR S PD SNVERLR+FIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVKALQEGGNQRAKEVLLKEWDPQRQSFPDSSNVERLRNFIKHVYVDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RYTGER +   PR K G+ ED    RR DTY
Sbjct  121  RYTGERNYDKPPRVKMGDKEDSYDIRR-DTY  150



>gb|KDO54159.1| hypothetical protein CISIN_1g004435mg [Citrus sinensis]
Length=743

 Score =   234 bits (596),  Expect = 2e-68, Method: Composition-based stats.
 Identities = 119/151 (79%), Positives = 124/151 (82%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNERIIRGLLKL DNRRCINCNSLG QYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MANRLKEDEKNERIIRGLLKLQDNRRCINCNSLGTQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV ALQ GGN  AKE+ LKE DPQR S PD SNVERLR+FIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVKALQEGGNQRAKEVLLKEWDPQRQSFPDSSNVERLRNFIKHVYVDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RYTGER +   PR K G+ ED    RR DTY
Sbjct  121  RYTGERNYDKPPRVKMGDKEDSYDIRR-DTY  150



>ref|XP_006475716.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X3 [Citrus sinensis]
Length=743

 Score =   234 bits (596),  Expect = 2e-68, Method: Composition-based stats.
 Identities = 119/151 (79%), Positives = 124/151 (82%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNERIIRGLLKL DNRRCINCNSLG QYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MANRLKEDEKNERIIRGLLKLQDNRRCINCNSLGTQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV ALQ GGN  AKE+ LKE DPQR S PD SNVERLR+FIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVKALQEGGNQRAKEVLLKEWDPQRQSFPDSSNVERLRNFIKHVYVDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RYTGER +   PR K G+ ED    RR DTY
Sbjct  121  RYTGERNYDKPPRVKMGDKEDSYDIRR-DTY  150



>ref|XP_008793443.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Phoenix dactylifera]
Length=667

 Score =   232 bits (591),  Expect = 3e-68, Method: Composition-based stats.
 Identities = 111/150 (74%), Positives = 124/150 (83%), Gaps = 3/150 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNE+IIRGLLKLP NRRCINCN+LGPQYVC NF TFICT CSG+HREFTHR
Sbjct  1    MANRMKEDEKNEKIIRGLLKLPANRRCINCNNLGPQYVCTNFWTFICTNCSGVHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEVSALQ GGN  A+ IY KE DP R+S  D SN++RLR+FIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVSALQEGGNEHARGIYFKEWDPHRHSFADSSNIDRLRNFIKHVYVDR  120

Query  502  RYTGERGF---PRGKGETEDLNGNRRVDTY  582
            R+T ER     PR KG  ED N NR++++Y
Sbjct  121  RFTAERNVDRPPRMKGVREDYNENRKMESY  150



>ref|XP_007160352.1| hypothetical protein PHAVU_002G314400g [Phaseolus vulgaris]
 gb|ESW32346.1| hypothetical protein PHAVU_002G314400g [Phaseolus vulgaris]
Length=701

 Score =   232 bits (591),  Expect = 6e-68, Method: Composition-based stats.
 Identities = 111/150 (74%), Positives = 122/150 (81%), Gaps = 3/150 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDEKNERIIRGLLKL  NRRCINCNSLGPQYVC NF TF+C  CSGIHREFTHR
Sbjct  1    MASRLKEDEKNERIIRGLLKLTPNRRCINCNSLGPQYVCTNFWTFVCINCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFT+ EVSALQ GGN  AKEIY KE DPQ +SLPD S VE+LRDFIKHVYVDR
Sbjct  61   VKSISMAKFTALEVSALQEGGNQRAKEIYFKEWDPQLHSLPDSSLVEKLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGKGETEDLNGNRRVDTY  582
            R++GER     PR KG  +D   N+R +TY
Sbjct  121  RFSGERTNDKPPRAKGVKDDFYENKRTETY  150



>dbj|BAD25003.1| human Rev interacting-like protein-like [Oryza sativa Japonica 
Group]
 dbj|BAD25012.1| human Rev interacting-like protein-like [Oryza sativa Japonica 
Group]
Length=544

 Score =   229 bits (583),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 121/148 (82%), Gaps = 3/148 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDE+NERIIRGLLKLP N+RCINCN+LGPQYVC NF TFICT CSG HREFTHR
Sbjct  1    MASRLKEDERNERIIRGLLKLPANKRCINCNNLGPQYVCTNFWTFICTNCSGAHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
             KSVSMAKFT+QEVSALQ GGN  A+EI+ KE D  RNS PD SN ++LR+FIKHVYV+R
Sbjct  61   AKSVSMAKFTAQEVSALQEGGNERAREIFFKEWDAHRNSFPDSSNADKLRNFIKHVYVER  120

Query  502  RYTGERGF---PRGKGETEDLNGNRRVD  576
            RYTGER     PRGK + ++ + NRR D
Sbjct  121  RYTGERSADRPPRGKDDKDEYSENRRSD  148



>ref|XP_007160351.1| hypothetical protein PHAVU_002G314400g [Phaseolus vulgaris]
 gb|ESW32345.1| hypothetical protein PHAVU_002G314400g [Phaseolus vulgaris]
Length=670

 Score =   231 bits (589),  Expect = 6e-68, Method: Composition-based stats.
 Identities = 111/150 (74%), Positives = 122/150 (81%), Gaps = 3/150 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDEKNERIIRGLLKL  NRRCINCNSLGPQYVC NF TF+C  CSGIHREFTHR
Sbjct  1    MASRLKEDEKNERIIRGLLKLTPNRRCINCNSLGPQYVCTNFWTFVCINCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFT+ EVSALQ GGN  AKEIY KE DPQ +SLPD S VE+LRDFIKHVYVDR
Sbjct  61   VKSISMAKFTALEVSALQEGGNQRAKEIYFKEWDPQLHSLPDSSLVEKLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGKGETEDLNGNRRVDTY  582
            R++GER     PR KG  +D   N+R +TY
Sbjct  121  RFSGERTNDKPPRAKGVKDDFYENKRTETY  150



>ref|XP_010654693.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Vitis vinifera]
 ref|XP_010654694.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X3 [Vitis vinifera]
Length=717

 Score =   231 bits (588),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 109/130 (84%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNE+IIRGLLKLP NRRCINCN LGPQYVC NF TF+CTTCSGIHREFTHR
Sbjct  1    MANRMKEDEKNEKIIRGLLKLPGNRRCINCNGLGPQYVCTNFWTFVCTTCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV++LQ GGN  AKEIYLK+ D QRNS PD SNV+RLRDFIKHVY DR
Sbjct  61   VKSVSMAKFTSQEVTSLQNGGNERAKEIYLKDWDQQRNSFPDSSNVDRLRDFIKHVYEDR  120

Query  502  RYTGERGFPR  531
            RYTGERG  R
Sbjct  121  RYTGERGSDR  130



>ref|XP_010688167.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Beta vulgaris subsp. vulgaris]
Length=712

 Score =   231 bits (588),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 108/151 (72%), Positives = 126/151 (83%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KED++NE++IRGLLKLP NRRC+NCN+LGPQYVC  FSTFICTTC GIHREFTHR
Sbjct  1    MASRLKEDDRNEKVIRGLLKLPGNRRCMNCNTLGPQYVCTTFSTFICTTCGGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFT QE+++LQ GGN  AKEI+ K+ D QR + PD SNV++LRDFIKHVYVDR
Sbjct  61   VKSVSMAKFTPQEIASLQAGGNERAKEIHFKDWDSQRQTAPDSSNVDKLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            RY+GERG    PRGK G+ E+ N NRR D Y
Sbjct  121  RYSGERGSDRPPRGKLGDKEEPNENRRSDAY  151



>ref|XP_010654688.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Vitis vinifera]
 ref|XP_010654689.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Vitis vinifera]
 ref|XP_010654690.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Vitis vinifera]
 ref|XP_010654691.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Vitis vinifera]
 ref|XP_010654692.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Vitis vinifera]
Length=736

 Score =   231 bits (589),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 109/130 (84%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNE+IIRGLLKLP NRRCINCN LGPQYVC NF TF+CTTCSGIHREFTHR
Sbjct  1    MANRMKEDEKNEKIIRGLLKLPGNRRCINCNGLGPQYVCTNFWTFVCTTCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV++LQ GGN  AKEIYLK+ D QRNS PD SNV+RLRDFIKHVY DR
Sbjct  61   VKSVSMAKFTSQEVTSLQNGGNERAKEIYLKDWDQQRNSFPDSSNVDRLRDFIKHVYEDR  120

Query  502  RYTGERGFPR  531
            RYTGERG  R
Sbjct  121  RYTGERGSDR  130



>emb|CBI36171.3| unnamed protein product [Vitis vinifera]
Length=734

 Score =   231 bits (588),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 109/130 (84%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNE+IIRGLLKLP NRRCINCN LGPQYVC NF TF+CTTCSGIHREFTHR
Sbjct  1    MANRMKEDEKNEKIIRGLLKLPGNRRCINCNGLGPQYVCTNFWTFVCTTCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV++LQ GGN  AKEIYLK+ D QRNS PD SNV+RLRDFIKHVY DR
Sbjct  61   VKSVSMAKFTSQEVTSLQNGGNERAKEIYLKDWDQQRNSFPDSSNVDRLRDFIKHVYEDR  120

Query  502  RYTGERGFPR  531
            RYTGERG  R
Sbjct  121  RYTGERGSDR  130



>ref|XP_009408824.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Musa acuminata subsp. malaccensis]
 ref|XP_009408825.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Musa acuminata subsp. malaccensis]
Length=672

 Score =   229 bits (584),  Expect = 4e-67, Method: Composition-based stats.
 Identities = 110/150 (73%), Positives = 124/150 (83%), Gaps = 3/150 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNE+IIRGLLKLP NRRCINCN+LGPQYVC NF TFICT CSGIHREFTHR
Sbjct  1    MANRVKEDEKNEKIIRGLLKLPANRRCINCNNLGPQYVCTNFWTFICTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFTSQEV+ALQ GGN  A+EIY K+ DPQR+S PD SN++RLRDFIKHVYVD+
Sbjct  61   VKSISMAKFTSQEVTALQEGGNERAREIYFKDWDPQRHSFPDSSNIDRLRDFIKHVYVDQ  120

Query  502  RYTGERGFPRG---KGETEDLNGNRRVDTY  582
            RY+G R   R    KG+ +  N NRR + Y
Sbjct  121  RYSGGRHGDRPQMLKGDKDVYNENRRAEPY  150



>ref|XP_006647062.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like [Oryza brachyantha]
Length=717

 Score =   229 bits (583),  Expect = 9e-67, Method: Composition-based stats.
 Identities = 108/148 (73%), Positives = 125/148 (84%), Gaps = 3/148 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDE+NERIIRGLLKLP N+RCINCN+LGPQYVC NF TF+CT CSG HREFTHR
Sbjct  1    MASRLKEDERNERIIRGLLKLPANKRCINCNNLGPQYVCTNFWTFVCTNCSGAHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFT+QEVSALQ GGN  A+EI+ KE DPQRNS PD SN ++LR+FIKHVYV+R
Sbjct  61   VKSVSMAKFTAQEVSALQEGGNERAREIFFKEWDPQRNSYPDSSNADKLRNFIKHVYVER  120

Query  502  RYTGERGF---PRGKGETEDLNGNRRVD  576
            RYTGER     PRGK + ++++ NRR D
Sbjct  121  RYTGERSADRPPRGKDDKDEISENRRSD  148



>ref|XP_010532839.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Tarenaya hassleriana]
Length=669

 Score =   227 bits (578),  Expect = 2e-66, Method: Composition-based stats.
 Identities = 109/146 (75%), Positives = 121/146 (83%), Gaps = 4/146 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDEKNER+IRGLLKLP+N+RCINCNSLGPQYVC  F TF+CT CSGIHREFTHR
Sbjct  1    MASRLKEDEKNERVIRGLLKLPENKRCINCNSLGPQYVCTTFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV ALQ GGN  AKEIY K  D QR SLPDGSNVERLRDFI+HVYV++
Sbjct  61   VKSVSMAKFTSQEVGALQEGGNQRAKEIYFKGFDLQRQSLPDGSNVERLRDFIRHVYVNK  120

Query  502  RYTGERGF---PRGK-GETEDLNGNR  567
            RY GE+     PRG+ G+  D +G R
Sbjct  121  RYMGEKNDDKPPRGQMGDKNDFHGTR  146



>gb|AFW71361.1| putative ARF GTPase-activating domain family protein [Zea mays]
Length=467

 Score =   222 bits (565),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 121/148 (82%), Gaps = 3/148 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDE++E+I+RGLLKLP N+RCINCN+LGPQY C NF TF+CT CSG HREFTHR
Sbjct  1    MASRVKEDERHEKILRGLLKLPANKRCINCNNLGPQYACTNFWTFVCTNCSGAHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFT+QEV+ALQ GGN  A+E++ KE DPQRN  PD SN ++LR+FIKHVYV+R
Sbjct  61   VKSVSMAKFTAQEVTALQEGGNERAREVFFKEWDPQRNGYPDSSNADKLRNFIKHVYVER  120

Query  502  RYTGERGF---PRGKGETEDLNGNRRVD  576
            RYTGER     PR K + ++ + NRR D
Sbjct  121  RYTGERSTDKPPRAKDDKDEYSENRRSD  148



>ref|XP_003620547.1| Arf-GAP domain and FG repeats-containing protein [Medicago truncatula]
 gb|AES76765.1| ARF GTPase activator [Medicago truncatula]
Length=658

 Score =   226 bits (575),  Expect = 5e-66, Method: Composition-based stats.
 Identities = 112/151 (74%), Positives = 121/151 (80%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M  RFKEDE+NER IR LLKL  NRRCINCNSLGPQYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MGTRFKEDERNERAIRTLLKLEPNRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV+ALQ GGN  AKEIY KE D QRNS PD SNV RLR+FIKHVY DR
Sbjct  61   VKSVSMAKFTSQEVTALQEGGNQRAKEIYFKEWDAQRNSFPDSSNVNRLREFIKHVYEDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            R+TG+R     PRGK G+ +D   NRRV+ Y
Sbjct  121  RFTGDRTSDKPPRGKAGDKDDSYENRRVEAY  151



>ref|XP_008808989.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Phoenix dactylifera]
Length=662

 Score =   225 bits (574),  Expect = 9e-66, Method: Composition-based stats.
 Identities = 104/147 (71%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDEKNE+IIRGLLKLP NRRCINCNSLGPQYVC NF TFICT CSG+HREFTHR
Sbjct  1    MASRMKEDEKNEKIIRGLLKLPANRRCINCNSLGPQYVCTNFWTFICTNCSGLHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFT QE+ ALQ GGN   KE Y KE DPQR+ +PD SN+++LRDF+KHVYVDR
Sbjct  61   VKSISMAKFTLQEIRALQEGGNERTKEFYFKEWDPQRHCVPDSSNLDKLRDFVKHVYVDR  120

Query  502  RYTGERGFPRGKGETEDLNGNRRVDTY  582
            RYTGER   R   +  D   N++ D+Y
Sbjct  121  RYTGERSINRPPKDRGDSYENKKEDSY  147



>ref|XP_003620495.1| Arf-GAP domain and FG repeats-containing protein [Medicago truncatula]
Length=698

 Score =   226 bits (575),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 112/151 (74%), Positives = 121/151 (80%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M  RFKEDE+NER IR LLKL  NRRCINCNSLGPQYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MGTRFKEDERNERAIRTLLKLEPNRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV+ALQ GGN  AKEIY KE D QRNS PD SNV RLR+FIKHVY DR
Sbjct  61   VKSVSMAKFTSQEVTALQEGGNQRAKEIYFKEWDAQRNSFPDSSNVNRLREFIKHVYEDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            R+TG+R     PRGK G+ +D   NRRV+ Y
Sbjct  121  RFTGDRTSDKPPRGKAGDKDDSYENRRVEAY  151



>ref|XP_006583393.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X1 [Glycine max]
 ref|XP_006583394.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X2 [Glycine max]
 ref|XP_006583395.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X3 [Glycine max]
Length=681

 Score =   225 bits (573),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 112/152 (74%), Positives = 122/152 (80%), Gaps = 5/152 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDEKNER+IRGLLKL  NRRCINCNSLGPQYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MASRMKEDEKNERVIRGLLKLQHNRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEVSALQ GGN  AKEIY KE D QR+S PD SNV+RLRDFIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVSALQEGGNQRAKEIYFKEWDAQRHSFPDSSNVDRLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGK-GETEDL-NGNRRVDTY  582
            R+TG++     PR K G+ +D   G  R   Y
Sbjct  121  RFTGDKTNDKPPRAKPGDKDDFYQGGSRSPPY  152



>ref|XP_006583396.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X4 [Glycine max]
Length=680

 Score =   225 bits (573),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 112/152 (74%), Positives = 122/152 (80%), Gaps = 5/152 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDEKNER+IRGLLKL  NRRCINCNSLGPQYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MASRMKEDEKNERVIRGLLKLQHNRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEVSALQ GGN  AKEIY KE D QR+S PD SNV+RLRDFIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVSALQEGGNQRAKEIYFKEWDAQRHSFPDSSNVDRLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGK-GETEDL-NGNRRVDTY  582
            R+TG++     PR K G+ +D   G  R   Y
Sbjct  121  RFTGDKTNDKPPRAKPGDKDDFYQGGSRSPPY  152



>ref|XP_006587513.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X5 [Glycine max]
Length=545

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+  KEDEKNER+IRGLLKL  NRRC+NCNSLGPQYVCINF TF+CT CSGIHREFTHR
Sbjct  1    MASPMKEDEKNERVIRGLLKLQHNRRCVNCNSLGPQYVCINFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEVSALQ GGN  AKEIY KE D  R+S PD SNV+RLR+FIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVSALQEGGNQRAKEIYFKEWDALRHSFPDSSNVDRLRNFIKHVYVDR  120

Query  502  RYTGER  519
            R+TG++
Sbjct  121  RFTGDK  126



>ref|XP_003571599.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Brachypodium distachyon]
 ref|XP_010234027.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Brachypodium distachyon]
Length=704

 Score =   225 bits (573),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 107/148 (72%), Positives = 124/148 (84%), Gaps = 3/148 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDE+NER+IRGLLKLP N+RCINCN+LGPQYVC NF TF+CT CSG HREFTHR
Sbjct  1    MASRVKEDERNERVIRGLLKLPANKRCINCNNLGPQYVCTNFWTFVCTNCSGAHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFT+QEVSALQGGGN  A+EI+ KE D QR S PD SNV++LR+FIKHVYV+R
Sbjct  61   VKSVSMAKFTAQEVSALQGGGNERAREIFFKEWDSQRGSYPDSSNVDKLRNFIKHVYVER  120

Query  502  RYTGERGF---PRGKGETEDLNGNRRVD  576
            RYTGER     PRGK + ++ + NRR D
Sbjct  121  RYTGERSSDRPPRGKDDKDEPSENRRSD  148



>ref|XP_002863138.1| hypothetical protein ARALYDRAFT_358984 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39397.1| hypothetical protein ARALYDRAFT_358984 [Arabidopsis lyrata subsp. 
lyrata]
Length=601

 Score =   222 bits (566),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNE+IIR LLKLP+N+RCINCNSLGPQYVC  F TF+CT CSGIHREFTHR
Sbjct  1    MANRVKEDEKNEKIIRSLLKLPENKRCINCNSLGPQYVCTTFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFTSQEV+AL+ GGN  AKEIY K LD QR S+PDGSNVERLRDFI+HVYV++
Sbjct  61   VKSISMAKFTSQEVTALKEGGNKHAKEIYFKGLDQQRQSVPDGSNVERLRDFIRHVYVNK  120

Query  502  RYTGER  519
            RY+ E+
Sbjct  121  RYSNEK  126



>gb|EEC72722.1| hypothetical protein OsI_06328 [Oryza sativa Indica Group]
Length=722

 Score =   224 bits (570),  Expect = 9e-65, Method: Composition-based stats.
 Identities = 107/148 (72%), Positives = 122/148 (82%), Gaps = 3/148 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDE+NERIIRGLLKLP N+RCINCN+LGPQYVC NF TFICT CSG HREFTHR
Sbjct  1    MASRLKEDERNERIIRGLLKLPANKRCINCNNLGPQYVCTNFWTFICTNCSGAHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFT+QEVSALQ GGN  A+EI+ KE D  RNS PD SN ++LR+FIKHVYV+R
Sbjct  61   VKSVSMAKFTAQEVSALQEGGNERAREIFFKEWDAHRNSFPDSSNADKLRNFIKHVYVER  120

Query  502  RYTGERGF---PRGKGETEDLNGNRRVD  576
            RYTGER     PRGK + ++ + NRR D
Sbjct  121  RYTGERSADRPPRGKDDKDEYSENRRSD  148



>ref|XP_003630818.1| hypothetical protein MTR_8g103750 [Medicago truncatula]
 gb|AET05294.1| ARF GTPase activator [Medicago truncatula]
Length=688

 Score =   223 bits (567),  Expect = 1e-64, Method: Composition-based stats.
 Identities = 104/150 (69%), Positives = 122/150 (81%), Gaps = 3/150 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KED+KNER IRGLLKL  NRRCINCNS+GPQYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MTSRLKEDQKNERTIRGLLKLTPNRRCINCNSMGPQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFT+QEVSALQ GGN  AKEI+ KE D Q +SLPD  NV+RLRDFIK VYVDR
Sbjct  61   VKSISMAKFTAQEVSALQEGGNQRAKEIFFKEWDAQTHSLPDSGNVDRLRDFIKRVYVDR  120

Query  502  RYTGERGF---PRGKGETEDLNGNRRVDTY  582
            R+TG+R +   PR KG+ +D    R++++Y
Sbjct  121  RFTGDRSYDKPPRVKGDKDDSYDTRKMESY  150



>ref|XP_009121281.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Brassica rapa]
Length=303

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +1

Query  157  KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHRVKSVS  336
            KEDEKNERIIR LLKLPDN+RCINCNSLGPQYVC  F TF+CT CSGIHREFTHRVKS+S
Sbjct  7    KEDEKNERIIRSLLKLPDNKRCINCNSLGPQYVCTTFWTFVCTNCSGIHREFTHRVKSIS  66

Query  337  MAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDRRYTGE  516
            MAKFTSQEVSAL+ GGN  AK+IY K LD QR S PDGSNVERLRDFI+ VYV++RYT +
Sbjct  67   MAKFTSQEVSALKEGGNQHAKDIYFKGLDQQRQSAPDGSNVERLRDFIRQVYVNKRYTND  126

Query  517  RGFPRG  534
               PRG
Sbjct  127  DKPPRG  132



>emb|CBI20945.3| unnamed protein product [Vitis vinifera]
Length=296

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M N+ KE+EK ER IRGLLKL +NRRCINCNSLGPQYVC  F TF+CT CSGIHREFTHR
Sbjct  1    MGNKVKEEEKIERTIRGLLKLAENRRCINCNSLGPQYVCTTFLTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            +KSVSMAKFT++EV+ALQ GGN  A+EIYLK+ DPQR+SLPD SN+ +LR+FIKHVYVDR
Sbjct  61   IKSVSMAKFTTEEVTALQAGGNERAREIYLKDWDPQRHSLPDSSNLHKLREFIKHVYVDR  120

Query  502  RYTGER  519
            +YTGER
Sbjct  121  KYTGER  126



>gb|EMT18497.1| Putative ADP-ribosylation factor GTPase-activating protein AGD14 
[Aegilops tauschii]
Length=707

 Score =   222 bits (566),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 105/148 (71%), Positives = 123/148 (83%), Gaps = 3/148 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDEKNER+IRGLLKLP N+RCINCN+LGPQYVC NF TF+CT CSG HREFTHR
Sbjct  1    MASRVKEDEKNERVIRGLLKLPANKRCINCNNLGPQYVCTNFWTFVCTNCSGAHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFT+QEV+ALQGGGN  A+EI+ KE D QRN  PD SN ++LR+FIKH+YV+R
Sbjct  61   VKSVSMAKFTAQEVTALQGGGNERAREIFFKEWDSQRNPYPDSSNTDKLRNFIKHIYVER  120

Query  502  RYTGERGF---PRGKGETEDLNGNRRVD  576
            RYTGER     PRGK + ++ + NRR D
Sbjct  121  RYTGERSSDRPPRGKDDKDEHSENRRSD  148



>ref|XP_006286186.1| hypothetical protein CARUB_v10007750mg [Capsella rubella]
 gb|EOA19084.1| hypothetical protein CARUB_v10007750mg [Capsella rubella]
Length=627

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDEKNERIIR LLKLP+N+RCINCNSLGPQYVC  F TF+CT CSGIHREFTHR
Sbjct  1    MASRVKEDEKNERIIRSLLKLPENKRCINCNSLGPQYVCTTFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV++L+ GGN  AK+IY K LD QR S+PDGSNVERLRDFI+HVYV++
Sbjct  61   VKSVSMAKFTSQEVTSLKEGGNQHAKDIYFKGLDQQRQSVPDGSNVERLRDFIRHVYVNK  120

Query  502  RYTGER  519
            RYT E+
Sbjct  121  RYTNEK  126



>emb|CDY01122.1| BnaA04g06970D [Brassica napus]
Length=611

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA   KEDEKNERIIR LLKLP N+RCINCNSLGPQYVC  F TF+CT CSGIHREFTHR
Sbjct  1    MAGGVKEDEKNERIIRSLLKLPHNKRCINCNSLGPQYVCTTFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFTSQEVSAL+ GGN  AK+IY K LDPQR S PDGSNVERLRDFI+ VYV++
Sbjct  61   VKSISMAKFTSQEVSALKEGGNQHAKDIYFKGLDPQRQSAPDGSNVERLRDFIRQVYVNK  120

Query  502  RYTGERGFPRGK  537
            RYT +   PRG 
Sbjct  121  RYTNDDKPPRGP  132



>ref|XP_010450221.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
 ref|XP_010450222.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
Length=602

 Score =   220 bits (561),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNE+IIR LLKL +N+RCINCNSLGPQYVC  F TF+CT CSGIHREFTHR
Sbjct  1    MANRVKEDEKNEKIIRSLLKLAENKRCINCNSLGPQYVCTTFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFTSQEV+AL+ GGN  AKEIY K LD QR S+PDGSNVERLRDFI+HVYV++
Sbjct  61   VKSISMAKFTSQEVTALKEGGNQHAKEIYFKGLDQQRQSVPDGSNVERLRDFIRHVYVNK  120

Query  502  RYTGER  519
            RYT E+
Sbjct  121  RYTNEK  126



>ref|XP_010440592.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
 ref|XP_010440593.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
 ref|XP_010440594.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
 ref|XP_010440595.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
 ref|XP_010440597.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
 ref|XP_010440598.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
Length=602

 Score =   220 bits (561),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNE+IIR LLKL +N+RCINCNSLGPQYVC  F TF+CT CSGIHREFTHR
Sbjct  1    MANRVKEDEKNEKIIRSLLKLAENKRCINCNSLGPQYVCTTFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFTSQEV+AL+ GGN  AKEIY K LD QR S+PDGSNVERLRDFI+HVYV++
Sbjct  61   VKSISMAKFTSQEVTALKEGGNQHAKEIYFKGLDQQRQSVPDGSNVERLRDFIRHVYVNK  120

Query  502  RYTGER  519
            RYT E+
Sbjct  121  RYTNEK  126



>ref|NP_001046262.1| Os02g0208900 [Oryza sativa Japonica Group]
 dbj|BAD25002.1| ZIGA2 protein-like [Oryza sativa Japonica Group]
 dbj|BAD25011.1| ZIGA2 protein-like [Oryza sativa Japonica Group]
 dbj|BAF08176.1| Os02g0208900 [Oryza sativa Japonica Group]
 dbj|BAH00355.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56541.1| hypothetical protein OsJ_05850 [Oryza sativa Japonica Group]
Length=728

 Score =   222 bits (566),  Expect = 3e-64, Method: Composition-based stats.
 Identities = 106/148 (72%), Positives = 121/148 (82%), Gaps = 3/148 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDE+NERIIRGLLKLP N+RCINCN+LGPQYVC NF TFICT CSG HREFTHR
Sbjct  1    MASRLKEDERNERIIRGLLKLPANKRCINCNNLGPQYVCTNFWTFICTNCSGAHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
             KSVSMAKFT+QEVSALQ GGN  A+EI+ KE D  RNS PD SN ++LR+FIKHVYV+R
Sbjct  61   AKSVSMAKFTAQEVSALQEGGNERAREIFFKEWDAHRNSFPDSSNADKLRNFIKHVYVER  120

Query  502  RYTGERGF---PRGKGETEDLNGNRRVD  576
            RYTGER     PRGK + ++ + NRR D
Sbjct  121  RYTGERSADRPPRGKDDKDEYSENRRSD  148



>ref|XP_004951486.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like [Setaria italica]
Length=717

 Score =   222 bits (565),  Expect = 4e-64, Method: Composition-based stats.
 Identities = 103/148 (70%), Positives = 122/148 (82%), Gaps = 3/148 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDE++ERIIRGLLKLP N+RCINCN+LGPQYVC NF TFICT CSG HREFTHR
Sbjct  1    MASRVKEDERHERIIRGLLKLPANKRCINCNNLGPQYVCTNFWTFICTNCSGAHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFT+QEV+ALQ GGN  A+E++ KE DPQRN  PD SN ++LR+FIKH YV+R
Sbjct  61   VKSVSMAKFTAQEVTALQEGGNERAREVFFKEWDPQRNGYPDSSNADKLRNFIKHAYVER  120

Query  502  RYTGERGF---PRGKGETEDLNGNRRVD  576
            R+TGER     PRGK + ++ + NRR D
Sbjct  121  RFTGERSADRPPRGKDDKDEYSENRRSD  148



>ref|NP_193071.2| NSP (nuclear shuttle protein)-interacting GTPase [Arabidopsis 
thaliana]
 ref|NP_849540.1| NSP (nuclear shuttle protein)-interacting GTPase [Arabidopsis 
thaliana]
 gb|AAL32583.1| putative protein [Arabidopsis thaliana]
 gb|AAP37738.1| At4g13350 [Arabidopsis thaliana]
 gb|AEE83268.1| NSP (nuclear shuttle protein)-interacting GTPase [Arabidopsis 
thaliana]
 gb|AEE83269.1| NSP (nuclear shuttle protein)-interacting GTPase [Arabidopsis 
thaliana]
Length=602

 Score =   220 bits (560),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA R KEDEKNE+IIR LLKLP+N+RCINCNSLGPQYVC  F TF+CT CSGIHREFTHR
Sbjct  1    MAGRVKEDEKNEKIIRSLLKLPENKRCINCNSLGPQYVCTTFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFTSQEV+AL+ GGN  AK+IY K LD QR S+PDGSNVERLRDFI+HVYV++
Sbjct  61   VKSISMAKFTSQEVTALKEGGNQHAKDIYFKGLDQQRQSVPDGSNVERLRDFIRHVYVNK  120

Query  502  RYTGER  519
            RYT E+
Sbjct  121  RYTNEK  126



>ref|XP_008808979.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Phoenix dactylifera]
Length=664

 Score =   221 bits (562),  Expect = 4e-64, Method: Composition-based stats.
 Identities = 104/149 (70%), Positives = 119/149 (80%), Gaps = 2/149 (1%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDEKNE+IIRGLLKLP NRRCINCNSLGPQYVC NF TFICT CSG+HREFTHR
Sbjct  1    MASRMKEDEKNEKIIRGLLKLPANRRCINCNSLGPQYVCTNFWTFICTNCSGLHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFT QE+ ALQ GGN   KE Y KE DPQR+ +PD SN+++LRDF+KHVYVDR
Sbjct  61   VKSISMAKFTLQEIRALQEGGNERTKEFYFKEWDPQRHCVPDSSNLDKLRDFVKHVYVDR  120

Query  502  RYTGERGF--PRGKGETEDLNGNRRVDTY  582
            RYTGER    P    +  D   N++ D+Y
Sbjct  121  RYTGERSINRPPKVKDRGDSYENKKEDSY  149



>ref|NP_001146420.1| uncharacterized protein LOC100280000 [Zea mays]
 gb|ACL53929.1| unknown [Zea mays]
Length=692

 Score =   221 bits (562),  Expect = 8e-64, Method: Composition-based stats.
 Identities = 102/148 (69%), Positives = 122/148 (82%), Gaps = 3/148 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDE++E+IIRGLLKLP N+RCINCN+LGPQYVC NF TF+CT CSG HREFTHR
Sbjct  1    MASRIKEDERHEKIIRGLLKLPANKRCINCNNLGPQYVCTNFWTFVCTNCSGSHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFT+QEV+ALQ GGN  A+E++ KE DPQRN  PD SN ++LR+FIKHVYV+R
Sbjct  61   VKSVSMAKFTAQEVAALQEGGNERAREVFFKEWDPQRNGYPDSSNADKLRNFIKHVYVER  120

Query  502  RYTGERGF---PRGKGETEDLNGNRRVD  576
            RYTGER     PR K + ++ + NRR D
Sbjct  121  RYTGERSTDRPPRAKDDKDEYSENRRSD  148



>gb|AFW66088.1| putative ARF GTPase-activating domain family protein isoform 
1 [Zea mays]
 gb|AFW66089.1| putative ARF GTPase-activating domain family protein isoform 
2 [Zea mays]
Length=692

 Score =   220 bits (561),  Expect = 9e-64, Method: Composition-based stats.
 Identities = 102/148 (69%), Positives = 122/148 (82%), Gaps = 3/148 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDE++E+IIRGLLKLP N+RCINCN+LGPQYVC NF TF+CT CSG HREFTHR
Sbjct  1    MASRIKEDERHEKIIRGLLKLPANKRCINCNNLGPQYVCTNFWTFVCTNCSGSHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFT+QEV+ALQ GGN  A+E++ KE DPQRN  PD SN ++LR+FIKHVYV+R
Sbjct  61   VKSVSMAKFTAQEVAALQEGGNERAREVFFKEWDPQRNGYPDSSNADKLRNFIKHVYVER  120

Query  502  RYTGERGF---PRGKGETEDLNGNRRVD  576
            RYTGER     PR K + ++ + NRR D
Sbjct  121  RYTGERSTDRPPRAKDDKDEYSENRRSD  148



>ref|XP_010435278.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
 ref|XP_010435279.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
 ref|XP_010435280.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
 ref|XP_010435281.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
 ref|XP_010435282.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
 ref|XP_010435283.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
Length=602

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MANR KEDEKNE+IIR LLKL +N+RCINCNSLGPQYVC  F TF+CT CSGIHREFTHR
Sbjct  1    MANRVKEDEKNEKIIRSLLKLAENKRCINCNSLGPQYVCTTFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFTSQEV AL+ GGN  AKEIY K LD QR S+PDGSNVERLRDFI+HVYV++
Sbjct  61   VKSISMAKFTSQEVIALKEGGNQHAKEIYFKGLDQQRQSVPDGSNVERLRDFIRHVYVNK  120

Query  502  RYTGER  519
            RYT E+
Sbjct  121  RYTNEK  126



>ref|XP_006414927.1| hypothetical protein EUTSA_v10024713mg [Eutrema salsugineum]
 gb|ESQ56380.1| hypothetical protein EUTSA_v10024713mg [Eutrema salsugineum]
Length=602

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 112/135 (83%), Gaps = 3/135 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA R KEDEKNER IR LLKLPDN+RCINCNSLGPQYVC  F TF+CT CSGIHREFTHR
Sbjct  1    MAGRVKEDEKNERSIRSLLKLPDNKRCINCNSLGPQYVCTTFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFTSQEV+AL+ GGN  AK+IY K LD QR S+PDGSNVERLRDFI+ VYV+R
Sbjct  61   VKSISMAKFTSQEVTALKRGGNQHAKDIYFKGLDQQRQSVPDGSNVERLRDFIRQVYVNR  120

Query  502  RYTGERG---FPRGK  537
            RYT E+     PRG 
Sbjct  121  RYTNEKNDDKPPRGP  135



>gb|ACG43047.1| GTP-ase activating protein for Arf containing protein [Zea mays]
Length=691

 Score =   219 bits (559),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 102/148 (69%), Positives = 122/148 (82%), Gaps = 3/148 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDE++E+IIRGLLKLP N+RCINCN+LGPQYVC NF TF+CT CSG HREFTHR
Sbjct  1    MASRVKEDERHEKIIRGLLKLPANKRCINCNNLGPQYVCTNFWTFVCTNCSGSHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFT+QEV+ALQ GGN  A+E++ KE DPQRN  PD SN ++LR+FIKHVYV+R
Sbjct  61   VKSVSMAKFTAQEVAALQEGGNERAREVFFKEWDPQRNGYPDSSNADKLRNFIKHVYVER  120

Query  502  RYTGERGF---PRGKGETEDLNGNRRVD  576
            RYTGER     PR K + ++ + NRR D
Sbjct  121  RYTGERSTDRPPRAKDDKDEYSENRRSD  148



>emb|CDY47324.1| BnaCnng14610D [Brassica napus]
Length=594

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 111/135 (82%), Gaps = 3/135 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA   KEDEKNERIIR LLKLPDN+RCINCNSLGPQYVC  F TF+CT CSGIHREFTHR
Sbjct  1    MAGGVKEDEKNERIIRSLLKLPDNKRCINCNSLGPQYVCTTFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFTSQEVSAL+ GGN  AK+IY K LD QR S PDGSNVERLRDFI+ VYV++
Sbjct  61   VKSISMAKFTSQEVSALKEGGNQHAKDIYFKGLDQQRQSAPDGSNVERLRDFIRQVYVNK  120

Query  502  RYTGERG---FPRGK  537
            RYT E+     PRG 
Sbjct  121  RYTNEKNDDKPPRGP  135



>ref|XP_004512958.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X2 [Cicer arietinum]
Length=695

 Score =   219 bits (558),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 106/151 (70%), Positives = 121/151 (80%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R +EDEKNER IR LLKL  NRRCINCNS+GPQYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MASRLREDEKNERAIRALLKLQPNRRCINCNSMGPQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV+ALQ GGN  A++IY KE D Q +S PD SNV RLRDFIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVTALQEGGNQLARDIYFKEWDAQHHSFPDSSNVNRLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            R+TG+R     PR K G+ ++   NR+V+ Y
Sbjct  121  RFTGDRNSDKPPRVKAGDKDESYENRKVEAY  151



>ref|XP_004512959.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X3 [Cicer arietinum]
Length=694

 Score =   219 bits (558),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 106/151 (70%), Positives = 121/151 (80%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R +EDEKNER IR LLKL  NRRCINCNS+GPQYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MASRLREDEKNERAIRALLKLQPNRRCINCNSMGPQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV+ALQ GGN  A++IY KE D Q +S PD SNV RLRDFIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVTALQEGGNQLARDIYFKEWDAQHHSFPDSSNVNRLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            R+TG+R     PR K G+ ++   NR+V+ Y
Sbjct  121  RFTGDRNSDKPPRVKAGDKDESYENRKVEAY  151



>ref|XP_004512957.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X1 [Cicer arietinum]
Length=696

 Score =   219 bits (558),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 106/151 (70%), Positives = 121/151 (80%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R +EDEKNER IR LLKL  NRRCINCNS+GPQYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MASRLREDEKNERAIRALLKLQPNRRCINCNSMGPQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV+ALQ GGN  A++IY KE D Q +S PD SNV RLRDFIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVTALQEGGNQLARDIYFKEWDAQHHSFPDSSNVNRLRDFIKHVYVDR  120

Query  502  RYTGERGF---PRGK-GETEDLNGNRRVDTY  582
            R+TG+R     PR K G+ ++   NR+V+ Y
Sbjct  121  RFTGDRNSDKPPRVKAGDKDESYENRKVEAY  151



>gb|AGT17187.1| Arf GTPase activating protein [Saccharum hybrid cultivar R570]
Length=681

 Score =   219 bits (557),  Expect = 4e-63, Method: Composition-based stats.
 Identities = 101/148 (68%), Positives = 122/148 (82%), Gaps = 3/148 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDE++E+IIRGLLKLP N+RCINCN+LGPQYVC NF TF+CT CSG HREFTHR
Sbjct  1    MASRVKEDERHEKIIRGLLKLPANKRCINCNNLGPQYVCTNFWTFVCTNCSGAHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFT+QEV+ALQ GGN  A+E++ KE DPQRN  PD SN ++LR+FIKHVYV+R
Sbjct  61   VKSVSMAKFTAQEVTALQEGGNERAREVFFKEWDPQRNGYPDSSNADKLRNFIKHVYVER  120

Query  502  RYTGERGF---PRGKGETEDLNGNRRVD  576
            RYTGER     P+ K + ++ + NRR D
Sbjct  121  RYTGERSTDRPPKAKDDKDEYSENRRSD  148



>ref|XP_008681297.1| PREDICTED: uncharacterized protein LOC100216932 isoform X1 [Zea 
mays]
Length=708

 Score =   218 bits (556),  Expect = 6e-63, Method: Composition-based stats.
 Identities = 100/148 (68%), Positives = 121/148 (82%), Gaps = 3/148 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDE++E+I+RGLLKLP N+RCINCN+LGPQY C NF TF+CT CSG HREFTHR
Sbjct  1    MASRVKEDERHEKILRGLLKLPANKRCINCNNLGPQYACTNFWTFVCTNCSGAHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFT+QEV+ALQ GGN  A+E++ KE DPQRN  PD SN ++LR+FIKHVYV+R
Sbjct  61   VKSVSMAKFTAQEVTALQEGGNERAREVFFKEWDPQRNGYPDSSNADKLRNFIKHVYVER  120

Query  502  RYTGERGF---PRGKGETEDLNGNRRVD  576
            RYTGER     PR K + ++ + NRR D
Sbjct  121  RYTGERSTDKPPRAKDDKDEYSENRRSD  148



>ref|XP_009139640.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X3 [Brassica rapa]
Length=596

 Score =   216 bits (550),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +1

Query  157  KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHRVKSVS  336
            KEDEKNERIIR LLKLPDN+RCINCNSLGPQYVC  F TF+CT CSGIHREFTHRVKS+S
Sbjct  7    KEDEKNERIIRSLLKLPDNKRCINCNSLGPQYVCTTFWTFVCTNCSGIHREFTHRVKSIS  66

Query  337  MAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDRRYTGE  516
            MAKFTSQEVSAL+ GGN  AK+IY K LD QR S PDGSNVERLRDFI+ VYV++RYT +
Sbjct  67   MAKFTSQEVSALKEGGNQHAKDIYFKGLDQQRQSAPDGSNVERLRDFIRQVYVNKRYTND  126

Query  517  RGFPRGK  537
               PRG 
Sbjct  127  DKPPRGP  133



>ref|XP_009139636.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Brassica rapa]
 ref|XP_009139637.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Brassica rapa]
 ref|XP_009139638.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Brassica rapa]
Length=599

 Score =   216 bits (550),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +1

Query  157  KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHRVKSVS  336
            KEDEKNERIIR LLKLPDN+RCINCNSLGPQYVC  F TF+CT CSGIHREFTHRVKS+S
Sbjct  7    KEDEKNERIIRSLLKLPDNKRCINCNSLGPQYVCTTFWTFVCTNCSGIHREFTHRVKSIS  66

Query  337  MAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDRRYTGE  516
            MAKFTSQEVSAL+ GGN  AK+IY K LD QR S PDGSNVERLRDFI+ VYV++RYT +
Sbjct  67   MAKFTSQEVSALKEGGNQHAKDIYFKGLDQQRQSAPDGSNVERLRDFIRQVYVNKRYTND  126

Query  517  RGFPRGK  537
               PRG 
Sbjct  127  DKPPRGP  133



>ref|XP_009139639.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Brassica rapa]
Length=598

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +1

Query  157  KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHRVKSVS  336
            KEDEKNERIIR LLKLPDN+RCINCNSLGPQYVC  F TF+CT CSGIHREFTHRVKS+S
Sbjct  7    KEDEKNERIIRSLLKLPDNKRCINCNSLGPQYVCTTFWTFVCTNCSGIHREFTHRVKSIS  66

Query  337  MAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDRRYTGE  516
            MAKFTSQEVSAL+ GGN  AK+IY K LD QR S PDGSNVERLRDFI+ VYV++RYT +
Sbjct  67   MAKFTSQEVSALKEGGNQHAKDIYFKGLDQQRQSAPDGSNVERLRDFIRQVYVNKRYTND  126

Query  517  RGFPRGK  537
               PRG 
Sbjct  127  DKPPRGP  133



>ref|XP_006587509.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X1 [Glycine max]
 gb|KHN32007.1| Arf-GAP domain and FG repeat-containing protein 1 [Glycine soja]
Length=680

 Score =   217 bits (553),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 101/126 (80%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+  KEDEKNER+IRGLLKL  NRRC+NCNSLGPQYVCINF TF+CT CSGIHREFTHR
Sbjct  1    MASPMKEDEKNERVIRGLLKLQHNRRCVNCNSLGPQYVCINFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEVSALQ GGN  AKEIY KE D  R+S PD SNV+RLR+FIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVSALQEGGNQRAKEIYFKEWDALRHSFPDSSNVDRLRNFIKHVYVDR  120

Query  502  RYTGER  519
            R+TG++
Sbjct  121  RFTGDK  126



>ref|XP_006587510.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X2 [Glycine max]
Length=679

 Score =   217 bits (553),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 101/126 (80%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+  KEDEKNER+IRGLLKL  NRRC+NCNSLGPQYVCINF TF+CT CSGIHREFTHR
Sbjct  1    MASPMKEDEKNERVIRGLLKLQHNRRCVNCNSLGPQYVCINFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEVSALQ GGN  AKEIY KE D  R+S PD SNV+RLR+FIKHVYVDR
Sbjct  61   VKSVSMAKFTSQEVSALQEGGNQRAKEIYFKEWDALRHSFPDSSNVDRLRNFIKHVYVDR  120

Query  502  RYTGER  519
            R+TG++
Sbjct  121  RFTGDK  126



>ref|XP_006450579.1| hypothetical protein CICLE_v10010498mg, partial [Citrus clementina]
 gb|ESR63819.1| hypothetical protein CICLE_v10010498mg, partial [Citrus clementina]
Length=776

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 120/150 (80%), Gaps = 3/150 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M N+ KEDE+ E IIRGLLKLP+NRRCINCN LGPQYVC  F TF+CT CSG+HREFTHR
Sbjct  1    MGNKIKEDERIEGIIRGLLKLPENRRCINCNCLGPQYVCTTFLTFVCTNCSGVHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKF+++EVSALQ  GN  A++IYLK+ DPQRNS PDGSN+ R+RDFIKHVYVDR
Sbjct  61   VKSISMAKFSAEEVSALQAAGNERARQIYLKDWDPQRNSYPDGSNLNRIRDFIKHVYVDR  120

Query  502  RYTGERG--FPRGK-GETEDLNGNRRVDTY  582
            RY GE+   F R + GE ED   + +V  Y
Sbjct  121  RYAGEKTDKFLRLRLGEKEDSCQSNKVGAY  150



>ref|XP_006476221.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like [Citrus sinensis]
Length=828

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 121/151 (80%), Gaps = 3/151 (2%)
 Frame = +1

Query  139  QMANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTH  318
            +M N+ KEDE+ E IIRGLLKLP+NRRCINCN LGPQYVC  F TF+CT CSG+HREFTH
Sbjct  3    KMGNKIKEDERIEGIIRGLLKLPENRRCINCNCLGPQYVCTTFLTFVCTNCSGVHREFTH  62

Query  319  RVKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVD  498
            RVKS+SMAKF+++EVSALQ  GN  A++IYLK+ DPQRNS PDGSN+ R+RDFIKHVYVD
Sbjct  63   RVKSISMAKFSAEEVSALQAAGNERARQIYLKDWDPQRNSYPDGSNLNRIRDFIKHVYVD  122

Query  499  RRYTGERG--FPRGK-GETEDLNGNRRVDTY  582
            RRY GE+   F R + GE ED   + +V  Y
Sbjct  123  RRYAGEKTDKFLRLRLGEKEDSCQSNKVGAY  153



>ref|XP_002324829.2| hypothetical protein POPTR_0018s01020g [Populus trichocarpa]
 gb|EEF03394.2| hypothetical protein POPTR_0018s01020g [Populus trichocarpa]
Length=783

 Score =   217 bits (552),  Expect = 5e-62, Method: Composition-based stats.
 Identities = 103/151 (68%), Positives = 122/151 (81%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M  + KE+E+ E+IIRGLLKLP+NRRCINCNSLGPQYVC  F TF+CT CSGIHREFTHR
Sbjct  1    MTKKDKEEERIEKIIRGLLKLPENRRCINCNSLGPQYVCTTFFTFVCTGCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKF ++EVSALQ GGN  A++IYLK+ DPQRN LPDGSN+++LRDFIKHVYVDR
Sbjct  61   VKSVSMAKFNAEEVSALQAGGNERARQIYLKDWDPQRNQLPDGSNLQKLRDFIKHVYVDR  120

Query  502  RYTGERGFPRGK----GETEDLNGNRRVDTY  582
            RYTGE+   +       + E+ + NRRV  Y
Sbjct  121  RYTGEKSEEKLSRLRLTDKEESSENRRVVLY  151



>ref|XP_010051219.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Eucalyptus grandis]
Length=559

 Score =   213 bits (542),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA + KEDE+ ERIIRGLLKLP+NRRCINCNSLGPQYVC  F TF+C  C GIHREFTHR
Sbjct  1    MAPKVKEDERLERIIRGLLKLPENRRCINCNSLGPQYVCTTFCTFVCMNCGGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFT +EVSALQ GGN  A++I+LKE DPQR+S PD SN+ +LRDFIKHVYVDR
Sbjct  61   VKSISMAKFTPEEVSALQAGGNERARQIFLKEWDPQRHSHPDSSNLYKLRDFIKHVYVDR  120

Query  502  RYTGERG  522
            +++GER 
Sbjct  121  KFSGERS  127



>ref|XP_006829864.1| hypothetical protein AMTR_s00119p00132020 [Amborella trichopoda]
 gb|ERM97280.1| hypothetical protein AMTR_s00119p00132020 [Amborella trichopoda]
Length=653

 Score =   214 bits (545),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 96/126 (76%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KEDE+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MGSRMKEDERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV ALQ GGN  ++E +LK+ DPQRN++PD SNV ++RDFIKHVYVDR
Sbjct  61   VKSVSMSKFTSQEVEALQRGGNQRSRETFLKDWDPQRNTVPDSSNVNKIRDFIKHVYVDR  120

Query  502  RYTGER  519
            RY G R
Sbjct  121  RYAGLR  126



>gb|KCW89405.1| hypothetical protein EUGRSUZ_A01700 [Eucalyptus grandis]
Length=632

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA + KEDE+ ERIIRGLLKLP+NRRCINCNSLGPQYVC  F TF+C  C GIHREFTHR
Sbjct  1    MAPKVKEDERLERIIRGLLKLPENRRCINCNSLGPQYVCTTFCTFVCMNCGGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFT +EVSALQ GGN  A++I+LKE DPQR+S PD SN+ +LRDFIKHVYVDR
Sbjct  61   VKSISMAKFTPEEVSALQAGGNERARQIFLKEWDPQRHSHPDSSNLYKLRDFIKHVYVDR  120

Query  502  RYTGER  519
            +++GER
Sbjct  121  KFSGER  126



>ref|XP_007024065.1| Uncharacterized protein TCM_028636 [Theobroma cacao]
 gb|EOY26687.1| Uncharacterized protein TCM_028636 [Theobroma cacao]
Length=739

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M  R  EDEKNE+IIRGLLKLP NRRC+NCN LGPQYVC NFSTF+C TC GIHREFTHR
Sbjct  1    MKGRITEDEKNEKIIRGLLKLPANRRCVNCNGLGPQYVCTNFSTFVCATCGGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTS+EV  LQGGGN SAKE+Y KE   +R S+PD S++E LR FIKHVYVDR
Sbjct  61   VKSVSMAKFTSEEVDGLQGGGNESAKEVYFKEWGSRRQSVPDNSDIEGLRKFIKHVYVDR  120

Query  502  RYTGERGFPR  531
            RYTGE+   R
Sbjct  121  RYTGEKSVDR  130



>ref|XP_009402905.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Musa acuminata subsp. malaccensis]
 ref|XP_009402906.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Musa acuminata subsp. malaccensis]
Length=671

 Score =   213 bits (543),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 121/150 (81%), Gaps = 3/150 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MAN  KE++KNE+IIRGLLKLP NRRCINCNSLGPQYVC NF TF+CT CSGIHREFTHR
Sbjct  1    MANLVKEEKKNEKIIRGLLKLPANRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            +KS+SMAKF+SQEV+ALQ GGN  A+E+Y K+ DPQ +S P  SN++RLRDFIK+VYV R
Sbjct  61   IKSISMAKFSSQEVAALQEGGNERARELYFKDWDPQHHSFPHSSNIDRLRDFIKNVYVYR  120

Query  502  RYTGERGFPRG---KGETEDLNGNRRVDTY  582
            RYTGE    R    K + ++ N N++ ++Y
Sbjct  121  RYTGESVGDRPQKMKDKRDNYNENQKAESY  150



>ref|XP_008219908.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Prunus mume]
Length=730

 Score =   214 bits (544),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M NR KEDEK ER IR LLK P N+RCINCNSLGPQYVC  F TF+CT CSG+HREFTHR
Sbjct  1    MGNRLKEDEKIERTIRSLLKHPQNKRCINCNSLGPQYVCTTFLTFVCTNCSGVHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKF ++EVSALQ GGN  A++IY KE DPQ ++ PDGSN+ RLRDFIKHVYVDR
Sbjct  61   VKSVSMAKFNAEEVSALQAGGNERARQIYFKEWDPQYHAYPDGSNLHRLRDFIKHVYVDR  120

Query  502  RYTGER  519
            +YTGER
Sbjct  121  KYTGER  126



>ref|XP_011459144.1| PREDICTED: uncharacterized protein LOC105349887 [Fragaria vesca 
subsp. vesca]
Length=882

 Score =   215 bits (547),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 121/150 (81%), Gaps = 4/150 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M NR +E+EK ERIIR LLKLP+N+RCINCNSLGPQYVC  F TF+CT CSG+HREFTHR
Sbjct  1    MGNRIREEEKIERIIRSLLKLPENKRCINCNSLGPQYVCTTFLTFVCTNCSGVHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFT++EV++LQ GGN  A+++Y KE DPQ +S PD SN+ RLRDFIKHVYVDR
Sbjct  61   VKSVSMAKFTTEEVNSLQAGGNERARQVYFKEFDPQYHSFPDSSNIGRLRDFIKHVYVDR  120

Query  502  RYTGERG---FPRGKGETEDLNGNRRVDTY  582
            +YTGE+G    P+ +  +E+ +  RRV  Y
Sbjct  121  KYTGEKGVQKLPKLR-LSEERDERRRVGAY  149



>gb|EMS60759.1| putative ADP-ribosylation factor GTPase-activating protein AGD14 
[Triticum urartu]
Length=661

 Score =   213 bits (541),  Expect = 5e-61, Method: Composition-based stats.
 Identities = 105/160 (66%), Positives = 122/160 (76%), Gaps = 15/160 (9%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KEDEKNER+IRGLLKLP N+RCINCN+LGPQYVC NF TF+CT CSG HREFTHR
Sbjct  1    MASRVKEDEKNERVIRGLLKLPANKRCINCNNLGPQYVCTNFWTFVCTNCSGAHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGS------------NVER  465
            VKSVSMAKFT+QEV+ALQGGGN  A+EI+ KE D QRN  PD              N ++
Sbjct  61   VKSVSMAKFTAQEVTALQGGGNERAREIFFKEWDSQRNPYPDSGLPFFVHVPGYNFNTDK  120

Query  466  LRDFIKHVYVDRRYTGERGF---PRGKGETEDLNGNRRVD  576
            LR+FIKHVYV+RRYTGER     PRGK + ++ + NRR D
Sbjct  121  LRNFIKHVYVERRYTGERSSDRPPRGKDDKDEHSENRRSD  160



>ref|XP_006654703.1| PREDICTED: uncharacterized protein LOC102721646 [Oryza brachyantha]
Length=610

 Score =   212 bits (539),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 115/149 (77%), Gaps = 3/149 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NER IR LLKLP NRRCINCNSLGPQYVC +FST +C +CSGIHREFTHR
Sbjct  1    MGSRVKEEERNERAIRALLKLPGNRRCINCNSLGPQYVCTSFSTLVCISCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFTSQEVSALQ GGN   KEIYLK  D Q   LPD S+V+RLR FIK VYVDR
Sbjct  61   VKSISMAKFTSQEVSALQEGGNERGKEIYLKHWDFQGQPLPDSSDVDRLRSFIKTVYVDR  120

Query  502  RYTGER---GFPRGKGETEDLNGNRRVDT  579
            RYTG+R     P+ KG  +D   N  VD+
Sbjct  121  RYTGDRIGDDCPQAKGSRDDTYRNSNVDS  149



>gb|KGN60132.1| hypothetical protein Csa_3G879500 [Cucumis sativus]
Length=670

 Score =   213 bits (541),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 118/146 (81%), Gaps = 3/146 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KE+E+ ER IR LLKLP+NRRC+NCNSLGPQYVC  F TF+CT CSG+HREFTHR
Sbjct  1    MASRVKEEERIERTIRNLLKLPENRRCMNCNSLGPQYVCTTFLTFVCTNCSGVHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFT++EV+ALQ  GN  A+EIYLK  DPQR+S P+ SN+ RLR+FIKHVYVDR
Sbjct  61   VKSVSMAKFTAEEVAALQAAGNQRAREIYLKTWDPQRHSYPENSNLHRLRNFIKHVYVDR  120

Query  502  RYTGERG---FPRGKGETEDLNGNRR  570
            +Y+GERG    PR +   +D +  RR
Sbjct  121  KYSGERGVDELPRLRLTEKDSSQERR  146



>ref|XP_009592974.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009592976.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Nicotiana tomentosiformis]
Length=634

 Score =   212 bits (539),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M  R KE+E+ E+IIRGLL+LPDN+RCINCNSLGPQY+C NF TF+CT CSG+HREFTHR
Sbjct  1    MFKRMKEEERIEKIIRGLLRLPDNKRCINCNSLGPQYICTNFWTFVCTRCSGVHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMA+F  +EVSAL+ GGN  AKEIY K  D  RNS PD SN+ RLRDFIKHVYVDR
Sbjct  61   VKSVSMARFNEEEVSALEAGGNERAKEIYFKTWDTYRNSYPDSSNLHRLRDFIKHVYVDR  120

Query  502  RYTGERG  522
            +YTGERG
Sbjct  121  KYTGERG  127



>ref|XP_009592977.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Nicotiana tomentosiformis]
Length=631

 Score =   211 bits (538),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M  R KE+E+ E+IIRGLL+LPDN+RCINCNSLGPQY+C NF TF+CT CSG+HREFTHR
Sbjct  1    MFKRMKEEERIEKIIRGLLRLPDNKRCINCNSLGPQYICTNFWTFVCTRCSGVHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMA+F  +EVSAL+ GGN  AKEIY K  D  RNS PD SN+ RLRDFIKHVYVDR
Sbjct  61   VKSVSMARFNEEEVSALEAGGNERAKEIYFKTWDTYRNSYPDSSNLHRLRDFIKHVYVDR  120

Query  502  RYTGERG  522
            +YTGERG
Sbjct  121  KYTGERG  127



>gb|EEC79586.1| hypothetical protein OsI_20764 [Oryza sativa Indica Group]
Length=537

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 116/149 (78%), Gaps = 3/149 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NER IR LLKLP NRRCINCNSLGPQYVC +FSTF+C +CSGIHREFTHR
Sbjct  1    MGSRVKEEERNERAIRALLKLPGNRRCINCNSLGPQYVCTSFSTFVCVSCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFTSQEVSALQ GGN   KEIYLK  D Q   LPD S+V+RLR+FIK VYVDR
Sbjct  61   VKSISMAKFTSQEVSALQEGGNERGKEIYLKHWDFQGQPLPDISDVDRLRNFIKIVYVDR  120

Query  502  RYTGER---GFPRGKGETEDLNGNRRVDT  579
            R+T ER     P+ KG  +D   N  +D+
Sbjct  121  RFTAERIGNHQPQAKGSRDDTYRNNNIDS  149



>gb|EEE64486.1| hypothetical protein OsJ_19336 [Oryza sativa Japonica Group]
Length=537

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 116/149 (78%), Gaps = 3/149 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NER IR LLKLP NRRCINCNSLGPQYVC +FSTF+C +CSGIHREFTHR
Sbjct  1    MGSRVKEEERNERAIRALLKLPGNRRCINCNSLGPQYVCTSFSTFVCVSCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFTSQEVSALQ GGN   KEIYLK  D Q   LPD S+V+RLR+FIK VYVDR
Sbjct  61   VKSISMAKFTSQEVSALQEGGNERGKEIYLKHWDFQGQPLPDISDVDRLRNFIKIVYVDR  120

Query  502  RYTGER---GFPRGKGETEDLNGNRRVDT  579
            R+T ER     P+ KG  +D   N  +D+
Sbjct  121  RFTAERIGNHQPQAKGSRDDTYRNNNIDS  149



>ref|XP_011026537.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X3 [Populus euphratica]
Length=748

 Score =   211 bits (538),  Expect = 3e-60, Method: Composition-based stats.
 Identities = 95/126 (75%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M  + KE+E+ E+IIRGLLKLP+NRRCINCNSLGPQYVC  F TF+CT+CSGIHREFTHR
Sbjct  1    MTKKDKEEERIEKIIRGLLKLPENRRCINCNSLGPQYVCTTFFTFVCTSCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKF ++EVSALQ GGN  A++IYLK  DPQRN LPDGSN+++LRDFIKHVY+DR
Sbjct  61   VKSVSMAKFNAEEVSALQAGGNERARQIYLKHWDPQRNQLPDGSNLQKLRDFIKHVYMDR  120

Query  502  RYTGER  519
            RY GE+
Sbjct  121  RYNGEK  126



>ref|XP_010648572.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Vitis vinifera]
 ref|XP_010648573.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Vitis vinifera]
Length=719

 Score =   211 bits (537),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 96/126 (76%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M N+ KE+EK ER IRGLLKL +NRRCINCNSLGPQYVC  F TF+CT CSGIHREFTHR
Sbjct  1    MGNKVKEEEKIERTIRGLLKLAENRRCINCNSLGPQYVCTTFLTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            +KSVSMAKFT++EV+ALQ GGN  A+EIYLK+ DPQR+SLPD SN+ +LR+FIKHVYVDR
Sbjct  61   IKSVSMAKFTTEEVTALQAGGNERAREIYLKDWDPQRHSLPDSSNLHKLREFIKHVYVDR  120

Query  502  RYTGER  519
            +YTGER
Sbjct  121  KYTGER  126



>ref|XP_009762670.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Nicotiana sylvestris]
 ref|XP_009762678.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Nicotiana sylvestris]
Length=637

 Score =   209 bits (533),  Expect = 5e-60, Method: Composition-based stats.
 Identities = 95/127 (75%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M  R KE+E+ E+IIRGLL+LPDN+RCINCNSLGPQY+C NF TF+CT CSG+HREFTHR
Sbjct  1    MFKRMKEEERIEKIIRGLLRLPDNKRCINCNSLGPQYICTNFWTFVCTRCSGVHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMA+F+ +EVSAL+ GGN  AKEIY K  DP RNS PD SN+ RLRDFIKHVYVDR
Sbjct  61   VKSVSMARFSEEEVSALESGGNERAKEIYFKTWDPYRNSYPDSSNLHRLRDFIKHVYVDR  120

Query  502  RYTGERG  522
            +YTGERG
Sbjct  121  KYTGERG  127



>ref|XP_011026535.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Populus euphratica]
Length=765

 Score =   211 bits (537),  Expect = 6e-60, Method: Composition-based stats.
 Identities = 95/126 (75%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M  + KE+E+ E+IIRGLLKLP+NRRCINCNSLGPQYVC  F TF+CT+CSGIHREFTHR
Sbjct  1    MTKKDKEEERIEKIIRGLLKLPENRRCINCNSLGPQYVCTTFFTFVCTSCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKF ++EVSALQ GGN  A++IYLK  DPQRN LPDGSN+++LRDFIKHVY+DR
Sbjct  61   VKSVSMAKFNAEEVSALQAGGNERARQIYLKHWDPQRNQLPDGSNLQKLRDFIKHVYMDR  120

Query  502  RYTGER  519
            RY GE+
Sbjct  121  RYNGEK  126



>ref|XP_011026534.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Populus euphratica]
Length=793

 Score =   211 bits (537),  Expect = 6e-60, Method: Composition-based stats.
 Identities = 95/126 (75%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M  + KE+E+ E+IIRGLLKLP+NRRCINCNSLGPQYVC  F TF+CT+CSGIHREFTHR
Sbjct  1    MTKKDKEEERIEKIIRGLLKLPENRRCINCNSLGPQYVCTTFFTFVCTSCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKF ++EVSALQ GGN  A++IYLK  DPQRN LPDGSN+++LRDFIKHVY+DR
Sbjct  61   VKSVSMAKFNAEEVSALQAGGNERARQIYLKHWDPQRNQLPDGSNLQKLRDFIKHVYMDR  120

Query  502  RYTGER  519
            RY GE+
Sbjct  121  RYNGEK  126



>ref|XP_008466359.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD5 [Cucumis melo]
 ref|XP_008466360.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD5 [Cucumis melo]
 ref|XP_008466361.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD5 [Cucumis melo]
Length=673

 Score =   210 bits (534),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 117/146 (80%), Gaps = 3/146 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R KE+E+ ER +R LLKLP+NRRCINCNSLGPQYVC  F TF+CT CSG+HREFTHR
Sbjct  1    MASRVKEEERIERTLRNLLKLPENRRCINCNSLGPQYVCTTFLTFVCTNCSGVHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFT++EV ALQ  GN  A+EIYLK  DPQR+S P+ S++ RLR+FIKHVYVDR
Sbjct  61   VKSVSMAKFTAEEVVALQAAGNQRAREIYLKTWDPQRHSYPENSDLHRLRNFIKHVYVDR  120

Query  502  RYTGERG---FPRGKGETEDLNGNRR  570
            +Y+GERG    PR +   +D +  RR
Sbjct  121  KYSGERGVDELPRLRLTEKDTSQERR  146



>gb|EYU35659.1| hypothetical protein MIMGU_mgv1a004826mg [Erythranthe guttata]
Length=481

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 119/151 (79%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M++  +E+E+NE+I++GLLKLP NRRCINCN+LGPQYVC NF TFIC TCSGIHREFTHR
Sbjct  1    MSSSKREEERNEKIVKGLLKLPPNRRCINCNNLGPQYVCTNFWTFICITCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV +LQ GGN  A+E+YLK  DPQRN LPD SNV+++R+FIK+VYVD+
Sbjct  61   VKSVSMAKFTSQEVDSLQKGGNQRARELYLKAWDPQRNKLPDNSNVDKVREFIKNVYVDK  120

Query  502  RYTGERGFPRGKGETEDLNGN----RRVDTY  582
            +Y+ E    +   + + L  N    RR  +Y
Sbjct  121  KYSVENSSDKPPKDPQSLRTNEDEMRRASSY  151



>gb|EYU35658.1| hypothetical protein MIMGU_mgv1a004826mg [Erythranthe guttata]
Length=508

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 119/151 (79%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M++  +E+E+NE+I++GLLKLP NRRCINCN+LGPQYVC NF TFIC TCSGIHREFTHR
Sbjct  1    MSSSKREEERNEKIVKGLLKLPPNRRCINCNNLGPQYVCTNFWTFICITCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV +LQ GGN  A+E+YLK  DPQRN LPD SNV+++R+FIK+VYVD+
Sbjct  61   VKSVSMAKFTSQEVDSLQKGGNQRARELYLKAWDPQRNKLPDNSNVDKVREFIKNVYVDK  120

Query  502  RYTGERGFPRGKGETEDLNGN----RRVDTY  582
            +Y+ E    +   + + L  N    RR  +Y
Sbjct  121  KYSVENSSDKPPKDPQSLRTNEDEMRRASSY  151



>ref|XP_007227166.1| hypothetical protein PRUPE_ppa024658mg [Prunus persica]
 gb|EMJ28365.1| hypothetical protein PRUPE_ppa024658mg [Prunus persica]
Length=741

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M NR KEDEK ER IR LLK P N+RCINCN LGPQYVC  F TF+CT CSG+HREFTHR
Sbjct  1    MGNRLKEDEKIERTIRTLLKHPQNKRCINCNCLGPQYVCTTFLTFVCTNCSGVHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKF ++EVSALQ GGN  A++IY KE DPQ ++ PDGSN+ RLRDFIKHVYV+R
Sbjct  61   VKSVSMAKFNAEEVSALQAGGNERARQIYFKEWDPQYHAYPDGSNLHRLRDFIKHVYVNR  120

Query  502  RYTGER  519
            +YTGER
Sbjct  121  KYTGER  126



>gb|KDO79652.1| hypothetical protein CISIN_1g045661mg, partial [Citrus sinensis]
Length=719

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 117/150 (78%), Gaps = 7/150 (5%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M N+ KEDE+ E IIRGLLKLP+NRRCINCN LGPQYVC  F TF+CT CSG+HREFTHR
Sbjct  1    MGNKIKEDERIEGIIRGLLKLPENRRCINCNCLGPQYVCTTFLTFVCTNCSGVHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKF+++EVSALQ  GN  A++IYLK+ DPQRNS PDG    R+RDFIKHVYVDR
Sbjct  61   VKSISMAKFSAEEVSALQAAGNERARQIYLKDWDPQRNSYPDG----RIRDFIKHVYVDR  116

Query  502  RYTGERG--FPRGK-GETEDLNGNRRVDTY  582
            RY GE+   F R + GE ED   + +V  Y
Sbjct  117  RYAGEKTDKFLRLRLGEKEDSCQSNKVGAY  146



>ref|XP_004498622.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X1 [Cicer arietinum]
 ref|XP_004498623.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X2 [Cicer arietinum]
Length=694

 Score =   207 bits (527),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +  KE+E+ ERIIRGLLKLP+NRRCINCN+LGPQYVC  FSTF+CT CSGIHREFTHR
Sbjct  1    MGHSKKEEERVERIIRGLLKLPENRRCINCNTLGPQYVCTTFSTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFT +EV+A+Q GGN  AK+IY K  DP  +S PD  N+ RLRDFIKHVYVDR
Sbjct  61   VKSVSMAKFTPEEVTAIQAGGNERAKQIYFKGWDPLCHSYPDSGNMHRLRDFIKHVYVDR  120

Query  502  RYTGER  519
            +YTGER
Sbjct  121  KYTGER  126



>ref|XP_008378286.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Malus domestica]
Length=466

 Score =   203 bits (516),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M    KEDEK+ER IR LLKLP+N+RCINCNSLGPQYVC  F TF+CT CSG+HREFTHR
Sbjct  1    MRKGLKEDEKSERTIRSLLKLPENKRCINCNSLGPQYVCTTFLTFVCTKCSGVHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKF ++EVSALQ GGN  A++IY KE DPQ +S PD  N+  LR FIKHVYVDR
Sbjct  61   VKSVSMAKFNAEEVSALQAGGNERARQIYFKEWDPQYHSYPDAGNLHGLRSFIKHVYVDR  120

Query  502  RYTGER  519
            +YTGER
Sbjct  121  KYTGER  126



>gb|KDO46629.1| hypothetical protein CISIN_1g005051mg [Citrus sinensis]
Length=682

 Score =   206 bits (525),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 100/151 (66%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFTHR
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV ALQ GGN  A+EIYLK+ D QR  LPD SNV ++RDFIK+VYVDR
Sbjct  60   VKSVSMSKFTSQEVEALQNGGNQRAREIYLKDWDFQRQRLPDNSNVNKVRDFIKNVYVDR  119

Query  502  RYTGERGFPRGKGETE----DLNGNRRVDTY  582
            RY G +   +   +T+     L+ +RR  +Y
Sbjct  120  RYAGGKTPDKPPKDTQGLGSHLDESRRASSY  150



>ref|XP_006437268.1| hypothetical protein CICLE_v10030836mg [Citrus clementina]
 gb|ESR50508.1| hypothetical protein CICLE_v10030836mg [Citrus clementina]
Length=714

 Score =   207 bits (526),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 100/151 (66%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFTHR
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV ALQ GGN  A+EIYLK+ D QR  LPD SNV ++RDFIK+VYVDR
Sbjct  60   VKSVSMSKFTSQEVEALQNGGNQRAREIYLKDWDFQRQRLPDNSNVNKVRDFIKNVYVDR  119

Query  502  RYTGERGFPRGKGETE----DLNGNRRVDTY  582
            RY G +   +   +T+     L+ +RR  +Y
Sbjct  120  RYAGGKTCDKPPKDTQGLGSHLDESRRASSY  150



>gb|KDO46632.1| hypothetical protein CISIN_1g005051mg [Citrus sinensis]
Length=713

 Score =   206 bits (525),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 100/151 (66%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFTHR
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV ALQ GGN  A+EIYLK+ D QR  LPD SNV ++RDFIK+VYVDR
Sbjct  60   VKSVSMSKFTSQEVEALQNGGNQRAREIYLKDWDFQRQRLPDNSNVNKVRDFIKNVYVDR  119

Query  502  RYTGERGFPRGKGETE----DLNGNRRVDTY  582
            RY G +   +   +T+     L+ +RR  +Y
Sbjct  120  RYAGGKTPDKPPKDTQGLGSHLDESRRASSY  150



>gb|KDO46634.1| hypothetical protein CISIN_1g005051mg [Citrus sinensis]
Length=714

 Score =   206 bits (525),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 100/151 (66%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFTHR
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV ALQ GGN  A+EIYLK+ D QR  LPD SNV ++RDFIK+VYVDR
Sbjct  60   VKSVSMSKFTSQEVEALQNGGNQRAREIYLKDWDFQRQRLPDNSNVNKVRDFIKNVYVDR  119

Query  502  RYTGERGFPRGKGETE----DLNGNRRVDTY  582
            RY G +   +   +T+     L+ +RR  +Y
Sbjct  120  RYAGGKTPDKPPKDTQGLGSHLDESRRASSY  150



>gb|KDO46633.1| hypothetical protein CISIN_1g005051mg [Citrus sinensis]
Length=715

 Score =   206 bits (525),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 100/151 (66%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFTHR
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV ALQ GGN  A+EIYLK+ D QR  LPD SNV ++RDFIK+VYVDR
Sbjct  60   VKSVSMSKFTSQEVEALQNGGNQRAREIYLKDWDFQRQRLPDNSNVNKVRDFIKNVYVDR  119

Query  502  RYTGERGFPRGKGETE----DLNGNRRVDTY  582
            RY G +   +   +T+     L+ +RR  +Y
Sbjct  120  RYAGGKTPDKPPKDTQGLGSHLDESRRASSY  150



>gb|KDO46635.1| hypothetical protein CISIN_1g005051mg [Citrus sinensis]
Length=716

 Score =   206 bits (525),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 100/151 (66%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFTHR
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV ALQ GGN  A+EIYLK+ D QR  LPD SNV ++RDFIK+VYVDR
Sbjct  60   VKSVSMSKFTSQEVEALQNGGNQRAREIYLKDWDFQRQRLPDNSNVNKVRDFIKNVYVDR  119

Query  502  RYTGERGFPRGKGETE----DLNGNRRVDTY  582
            RY G +   +   +T+     L+ +RR  +Y
Sbjct  120  RYAGGKTPDKPPKDTQGLGSHLDESRRASSY  150



>ref|XP_006484788.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X2 [Citrus sinensis]
Length=713

 Score =   206 bits (524),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 100/151 (66%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFTHR
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV ALQ GGN  A+EIYLK+ D QR  LPD SNV ++RDFIK+VYVDR
Sbjct  60   VKSVSMSKFTSQEVEALQNGGNQRAREIYLKDWDFQRQRLPDNSNVNKVRDFIKNVYVDR  119

Query  502  RYTGERGFPRGKGETE----DLNGNRRVDTY  582
            RY G +   +   +T+     L+ +RR  +Y
Sbjct  120  RYAGGKTPDKPPKDTQGLGSHLDESRRASSY  150



>ref|XP_006484787.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X1 [Citrus sinensis]
Length=715

 Score =   206 bits (524),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 100/151 (66%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFTHR
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV ALQ GGN  A+EIYLK+ D QR  LPD SNV ++RDFIK+VYVDR
Sbjct  60   VKSVSMSKFTSQEVEALQNGGNQRAREIYLKDWDFQRQRLPDNSNVNKVRDFIKNVYVDR  119

Query  502  RYTGERGFPRGKGETE----DLNGNRRVDTY  582
            RY G +   +   +T+     L+ +RR  +Y
Sbjct  120  RYAGGKTPDKPPKDTQGLGSHLDESRRASSY  150



>gb|KDO46630.1| hypothetical protein CISIN_1g005051mg [Citrus sinensis]
Length=687

 Score =   206 bits (523),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 100/151 (66%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFTHR
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV ALQ GGN  A+EIYLK+ D QR  LPD SNV ++RDFIK+VYVDR
Sbjct  60   VKSVSMSKFTSQEVEALQNGGNQRAREIYLKDWDFQRQRLPDNSNVNKVRDFIKNVYVDR  119

Query  502  RYTGERGFPRGKGETE----DLNGNRRVDTY  582
            RY G +   +   +T+     L+ +RR  +Y
Sbjct  120  RYAGGKTPDKPPKDTQGLGSHLDESRRASSY  150



>gb|KDO46631.1| hypothetical protein CISIN_1g005051mg [Citrus sinensis]
Length=690

 Score =   206 bits (523),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 100/151 (66%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFTHR
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV ALQ GGN  A+EIYLK+ D QR  LPD SNV ++RDFIK+VYVDR
Sbjct  60   VKSVSMSKFTSQEVEALQNGGNQRAREIYLKDWDFQRQRLPDNSNVNKVRDFIKNVYVDR  119

Query  502  RYTGERGFPRGKGETE----DLNGNRRVDTY  582
            RY G +   +   +T+     L+ +RR  +Y
Sbjct  120  RYAGGKTPDKPPKDTQGLGSHLDESRRASSY  150



>gb|KDO46636.1| hypothetical protein CISIN_1g005051mg [Citrus sinensis]
Length=645

 Score =   204 bits (520),  Expect = 4e-58, Method: Composition-based stats.
 Identities = 100/151 (66%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFTHR
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV ALQ GGN  A+EIYLK+ D QR  LPD SNV ++RDFIK+VYVDR
Sbjct  60   VKSVSMSKFTSQEVEALQNGGNQRAREIYLKDWDFQRQRLPDNSNVNKVRDFIKNVYVDR  119

Query  502  RYTGERGFPRGKGETE----DLNGNRRVDTY  582
            RY G +   +   +T+     L+ +RR  +Y
Sbjct  120  RYAGGKTPDKPPKDTQGLGSHLDESRRASSY  150



>gb|KDO46637.1| hypothetical protein CISIN_1g005051mg [Citrus sinensis]
Length=647

 Score =   204 bits (520),  Expect = 4e-58, Method: Composition-based stats.
 Identities = 100/151 (66%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFTHR
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV ALQ GGN  A+EIYLK+ D QR  LPD SNV ++RDFIK+VYVDR
Sbjct  60   VKSVSMSKFTSQEVEALQNGGNQRAREIYLKDWDFQRQRLPDNSNVNKVRDFIKNVYVDR  119

Query  502  RYTGERGFPRGKGETE----DLNGNRRVDTY  582
            RY G +   +   +T+     L+ +RR  +Y
Sbjct  120  RYAGGKTPDKPPKDTQGLGSHLDESRRASSY  150



>gb|KDO46638.1| hypothetical protein CISIN_1g005051mg [Citrus sinensis]
Length=648

 Score =   204 bits (520),  Expect = 4e-58, Method: Composition-based stats.
 Identities = 100/151 (66%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFTHR
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV ALQ GGN  A+EIYLK+ D QR  LPD SNV ++RDFIK+VYVDR
Sbjct  60   VKSVSMSKFTSQEVEALQNGGNQRAREIYLKDWDFQRQRLPDNSNVNKVRDFIKNVYVDR  119

Query  502  RYTGERGFPRGKGETE----DLNGNRRVDTY  582
            RY G +   +   +T+     L+ +RR  +Y
Sbjct  120  RYAGGKTPDKPPKDTQGLGSHLDESRRASSY  150



>ref|XP_009377378.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Pyrus x bretschneideri]
Length=706

 Score =   205 bits (521),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M    KEDEK+ER IR LLKLP+N+RCINCNSLGPQYVC  F TF+CT CSG+HREFTHR
Sbjct  1    MRKGLKEDEKSERTIRSLLKLPENKRCINCNSLGPQYVCTTFLTFVCTKCSGVHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKF ++EVSALQ GGN  A++IY KE DPQ +S PD  N+  LR FIKHVYVDR
Sbjct  61   VKSVSMAKFNAEEVSALQAGGNERARQIYFKEWDPQYHSYPDAGNLHGLRSFIKHVYVDR  120

Query  502  RYTGER  519
            +YTGER
Sbjct  121  KYTGER  126



>ref|XP_008357498.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Malus domestica]
Length=702

 Score =   205 bits (521),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M    KEDEK+ER IR LLKLP+N+RCINCNSLGPQYVC  F TF+CT CSG+HREFTHR
Sbjct  1    MRKGLKEDEKSERTIRSLLKLPENKRCINCNSLGPQYVCTTFLTFVCTKCSGVHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKF ++EVSALQ GGN  A++IY KE DPQ +S PD  N+  LR FIKHVYVDR
Sbjct  61   VKSVSMAKFNAEEVSALQAGGNERARQIYFKEWDPQYHSYPDAGNLHGLRSFIKHVYVDR  120

Query  502  RYTGER  519
            +YTGER
Sbjct  121  KYTGER  126



>ref|XP_010653158.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Vitis vinifera]
 emb|CBI31191.3| unnamed protein product [Vitis vinifera]
Length=695

 Score =   204 bits (520),  Expect = 7e-58, Method: Composition-based stats.
 Identities = 100/151 (66%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M++R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFTHR
Sbjct  1    MSSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV ALQ GGN  A+E+YLK+ D QR  LPD SNV+++RDFIK VYVDR
Sbjct  60   VKSVSMAKFTSQEVEALQKGGNQRARELYLKDWDTQRQRLPDISNVDKVRDFIKSVYVDR  119

Query  502  RYTGERGFPRGKGETEDLNG----NRRVDTY  582
            RY   +   +   +T++L       RR  +Y
Sbjct  120  RYAVGKTSDKPPRDTQNLRDRDEETRRASSY  150



>ref|NP_001141785.2| uncharacterized protein LOC100273921 [Zea mays]
 gb|ACF87040.2| unknown [Zea mays]
 gb|AFW78870.1| putative ARF GTPase-activating domain family protein [Zea mays]
Length=433

 Score =   199 bits (507),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 107/126 (85%), Gaps = 1/126 (1%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KEDE+NE+IIRGLLKLP NRRCINCNSLGPQYVC +FSTFICT CSGIHREF+HR
Sbjct  1    MGSRVKEDERNEKIIRGLLKLPGNRRCINCNSLGPQYVCTSFSTFICTNCSGIHREFSHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEVSALQ GGN  AKEIY K  D Q   + D S+V RLR+FIK+VYV+R
Sbjct  61   VKSVSMAKFTSQEVSALQEGGNERAKEIYFKHWDLQGPVI-DSSDVHRLRNFIKNVYVER  119

Query  502  RYTGER  519
            RY+ +R
Sbjct  120  RYSDQR  125



>gb|AFW71360.1| putative ARF GTPase-activating domain family protein [Zea mays]
Length=736

 Score =   204 bits (520),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 100/176 (57%), Positives = 121/176 (69%), Gaps = 31/176 (18%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSL---------------------------  240
            MA+R KEDE++E+I+RGLLKLP N+RCINCN+L                           
Sbjct  1    MASRVKEDERHEKILRGLLKLPANKRCINCNNLVSLSSRVLLLNLPQCSVAMNGAHTAYW  60

Query  241  -GPQYVCINFSTFICTTCSGIHREFTHRVKSVSMAKFTSQEVSALQGGGNASAKEIYLKE  417
             GPQY C NF TF+CT CSG HREFTHRVKSVSMAKFT+QEV+ALQ GGN  A+E++ KE
Sbjct  61   EGPQYACTNFWTFVCTNCSGAHREFTHRVKSVSMAKFTAQEVTALQEGGNERAREVFFKE  120

Query  418  LDPQRNSLPDGSNVERLRDFIKHVYVDRRYTGERGF---PRGKGETEDLNGNRRVD  576
             DPQRN  PD SN ++LR+FIKHVYV+RRYTGER     PR K + ++ + NRR D
Sbjct  121  WDPQRNGYPDSSNADKLRNFIKHVYVERRYTGERSTDKPPRAKDDKDEYSENRRSD  176



>ref|XP_002440136.1| hypothetical protein SORBIDRAFT_09g026670 [Sorghum bicolor]
 gb|EES18566.1| hypothetical protein SORBIDRAFT_09g026670 [Sorghum bicolor]
Length=439

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 117/150 (78%), Gaps = 5/150 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KEDE+NE+IIRGLLKLP NRRCINCNSLGPQYVC +FSTFICT CSGIHREF+HR
Sbjct  1    MGSRVKEDERNEKIIRGLLKLPGNRRCINCNSLGPQYVCTSFSTFICTNCSGIHREFSHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEVSALQ GGN  AK+IY K  D Q   + D S+V RLR+FIK+VYV+ 
Sbjct  61   VKSVSMAKFTSQEVSALQEGGNEHAKKIYFKHWDLQ-GPVIDSSDVHRLRNFIKNVYVEW  119

Query  502  RYTGERG---FPRGKGE-TEDLNGNRRVDT  579
            RY+ +R     P+ K + ++D  GN   D+
Sbjct  120  RYSDQRNGEHLPQAKIQGSQDSYGNSTADS  149



>ref|XP_011081866.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Sesamum indicum]
Length=694

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M  R KE+E+ E IIRGLL+ P+N+RCINCNS GPQYVC  F TF+CT+CSG+HREFTHR
Sbjct  1    MPRRMKEEERIEMIIRGLLRQPENKRCINCNSSGPQYVCTTFWTFVCTSCSGVHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKF  +E++ALQ GGN  A+EIY K  DPQRN+LPD SN++RLR+F+KHVYVDR
Sbjct  61   VKSVSMAKFNEEEITALQAGGNGRAREIYFKAWDPQRNNLPDNSNLQRLREFVKHVYVDR  120

Query  502  RYTGE  516
            +Y GE
Sbjct  121  KYAGE  125



>emb|CDP18429.1| unnamed protein product [Coffea canephora]
Length=674

 Score =   204 bits (518),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 91/126 (72%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            +  + KE+E+ E+IIRGLLKLP+N+RCINCNSLGPQYVC  F TFICT CSG+HREFTHR
Sbjct  2    LKGKVKEEERIEKIIRGLLKLPENKRCINCNSLGPQYVCTTFLTFICTNCSGVHREFTHR  61

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKF+++EV ALQ GGN  A++IYLKE DP RN  PDGSN+ RLRDFIKHVY+DR
Sbjct  62   VKSVSMAKFSAEEVDALQAGGNERARQIYLKEWDPHRNYFPDGSNLHRLRDFIKHVYIDR  121

Query  502  RYTGER  519
            +Y G R
Sbjct  122  KYAGVR  127



>ref|XP_007029909.1| GTPase activating protein, putative isoform 2 [Theobroma cacao]
 gb|EOY10411.1| GTPase activating protein, putative isoform 2 [Theobroma cacao]
Length=609

 Score =   201 bits (512),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFTHR
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV ALQ GGN  A++IYLK+ D QR  LPD SN +++R+FIK+VYVDR
Sbjct  60   VKSVSMSKFTSQEVEALQNGGNQRARDIYLKDWDLQRQRLPDSSNADKIREFIKNVYVDR  119

Query  502  RYTG  513
            +Y G
Sbjct  120  KYVG  123



>gb|KDP39625.1| hypothetical protein JCGZ_02645 [Jatropha curcas]
Length=691

 Score =   202 bits (514),  Expect = 4e-57, Method: Composition-based stats.
 Identities = 94/124 (76%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TFIC TCSGIHREFTHR
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFICMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV ALQ GGN  A+EIYL+E D QR  LPD SNV+++R+FIK VYVD+
Sbjct  60   VKSVSMSKFTSQEVEALQNGGNQRAREIYLREWDQQRQRLPDNSNVDKVREFIKTVYVDK  119

Query  502  RYTG  513
            RY G
Sbjct  120  RYAG  123



>gb|EYU33121.1| hypothetical protein MIMGU_mgv1a020516mg [Erythranthe guttata]
Length=331

 Score =   194 bits (494),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M  R KE+EK E IIR LLK  DNRRCINCNSLGPQYVC  F TF+CT CSG+HREFTHR
Sbjct  1    MPRRVKEEEKIEMIIRDLLKQTDNRRCINCNSLGPQYVCTTFWTFVCTNCSGVHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKF  +E+++LQ GGN  AK+IY K  D QRN  PDGSN+++LR+FIKHVY+DR
Sbjct  61   VKSLSMAKFNEEEITSLQAGGNERAKQIYFKTWDSQRNYYPDGSNLQKLREFIKHVYLDR  120

Query  502  RYTGE  516
            RY GE
Sbjct  121  RYAGE  125



>ref|XP_007013726.1| ArfGap/RecO-like zinc finger domain-containing protein, putative 
[Theobroma cacao]
 gb|EOY31345.1| ArfGap/RecO-like zinc finger domain-containing protein, putative 
[Theobroma cacao]
Length=715

 Score =   202 bits (513),  Expect = 7e-57, Method: Composition-based stats.
 Identities = 91/123 (74%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  151  RFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHRVKS  330
            + KED+K ER IR LLKLP+N+RCINCN LGPQYVC  F TF+CTTCSGIHREFTHRVK 
Sbjct  5    KIKEDDKTERTIRALLKLPENKRCINCNLLGPQYVCTTFWTFVCTTCSGIHREFTHRVKP  64

Query  331  VSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDRRYT  510
            VSMAKF+ +EV+ALQ  GN  A++IY K  DPQRNSLPDGSN+ RLRDFIKHVYV+R+Y 
Sbjct  65   VSMAKFSEEEVNALQAAGNERARQIYFKAWDPQRNSLPDGSNLHRLRDFIKHVYVERKYA  124

Query  511  GER  519
            GER
Sbjct  125  GER  127



>ref|XP_009796556.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Nicotiana sylvestris]
Length=754

 Score =   201 bits (512),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 96/151 (64%), Positives = 120/151 (79%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M++R +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFTHR
Sbjct  1    MSSR-REEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV ALQ GGN  A+EIYL   DPQR  LP+ SNV+++RDFIK+VYV++
Sbjct  60   VKSVSMSKFTSQEVEALQKGGNQRAREIYLTNWDPQRQWLPNNSNVDKVRDFIKNVYVEK  119

Query  502  RYTGERGFPRGKGETEDLNGN----RRVDTY  582
            RY G +   +   +T++L  +    RR  +Y
Sbjct  120  RYAGAQSSDKPPRDTQNLRSHEDEMRRASSY  150



>ref|XP_007029910.1| ARF GAP-like zinc finger-containing protein ZIGA4, putative isoform 
3 [Theobroma cacao]
 gb|EOY10412.1| ARF GAP-like zinc finger-containing protein ZIGA4, putative isoform 
3 [Theobroma cacao]
Length=654

 Score =   200 bits (509),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 95/151 (63%), Positives = 117/151 (77%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFTHR
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV ALQ GGN  A++IYLK+ D QR  LPD SN +++R+FIK+VYVDR
Sbjct  60   VKSVSMSKFTSQEVEALQNGGNQRARDIYLKDWDLQRQRLPDSSNADKIREFIKNVYVDR  119

Query  502  RYTGERGFPRGKGETEDLNGN----RRVDTY  582
            +Y G +   +   + + L  +    RR  +Y
Sbjct  120  KYVGGKTSDKPPRDMQSLRNHEDEIRRASSY  150



>ref|XP_009796569.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X3 [Nicotiana sylvestris]
Length=699

 Score =   200 bits (509),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 96/151 (64%), Positives = 120/151 (79%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M++R +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFTHR
Sbjct  1    MSSR-REEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV ALQ GGN  A+EIYL   DPQR  LP+ SNV+++RDFIK+VYV++
Sbjct  60   VKSVSMSKFTSQEVEALQKGGNQRAREIYLTNWDPQRQWLPNNSNVDKVRDFIKNVYVEK  119

Query  502  RYTGERGFPRGKGETEDLNGN----RRVDTY  582
            RY G +   +   +T++L  +    RR  +Y
Sbjct  120  RYAGAQSSDKPPRDTQNLRSHEDEMRRASSY  150



>ref|XP_009796563.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Nicotiana sylvestris]
Length=740

 Score =   201 bits (510),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 96/151 (64%), Positives = 120/151 (79%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M++R +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFTHR
Sbjct  1    MSSR-REEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV ALQ GGN  A+EIYL   DPQR  LP+ SNV+++RDFIK+VYV++
Sbjct  60   VKSVSMSKFTSQEVEALQKGGNQRAREIYLTNWDPQRQWLPNNSNVDKVRDFIKNVYVEK  119

Query  502  RYTGERGFPRGKGETEDLNGN----RRVDTY  582
            RY G +   +   +T++L  +    RR  +Y
Sbjct  120  RYAGAQSSDKPPRDTQNLRSHEDEMRRASSY  150



>ref|XP_007029908.1| ARF GAP-like zinc finger-containing protein ZIGA4, putative isoform 
1 [Theobroma cacao]
 gb|EOY10410.1| ARF GAP-like zinc finger-containing protein ZIGA4, putative isoform 
1 [Theobroma cacao]
Length=698

 Score =   200 bits (509),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 95/151 (63%), Positives = 117/151 (77%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFTHR
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV ALQ GGN  A++IYLK+ D QR  LPD SN +++R+FIK+VYVDR
Sbjct  60   VKSVSMSKFTSQEVEALQNGGNQRARDIYLKDWDLQRQRLPDSSNADKIREFIKNVYVDR  119

Query  502  RYTGERGFPRGKGETEDLNGN----RRVDTY  582
            +Y G +   +   + + L  +    RR  +Y
Sbjct  120  KYVGGKTSDKPPRDMQSLRNHEDEIRRASSY  150



>ref|XP_002309583.2| hypothetical protein POPTR_0006s26230g [Populus trichocarpa]
 gb|EEE93106.2| hypothetical protein POPTR_0006s26230g [Populus trichocarpa]
Length=815

 Score =   201 bits (511),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 94/146 (64%), Positives = 115/146 (79%), Gaps = 4/146 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M  + KE+E+  +IIRGLLK+P+N RC+NCNSLGPQYVC  F TF+C  CSGIHREFTHR
Sbjct  1    MTKKNKEEERIGKIIRGLLKIPENIRCVNCNSLGPQYVCTTFFTFVCKNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKF ++EVSALQ GGN  A++I+LKE +PQRN LPD SN +++RDFIKHVYVDR
Sbjct  61   VKSISMAKFNAEEVSALQAGGNERARQIFLKEWNPQRNQLPDSSNQQKVRDFIKHVYVDR  120

Query  502  RYTGERG---FPRGK-GETEDLNGNR  567
            RYTGE+     PR +  + ED   NR
Sbjct  121  RYTGEKSHEKLPRLRLNDKEDSGENR  146



>ref|XP_006412447.1| hypothetical protein EUTSA_v10024655mg [Eutrema salsugineum]
 gb|ESQ53900.1| hypothetical protein EUTSA_v10024655mg [Eutrema salsugineum]
Length=640

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KEDE+ E+ IR LLKLP+NRRCINCNSLGPQYVC  F TF+C  CSGIHREFTHR
Sbjct  1    MGSRNKEDERTEKAIRSLLKLPENRRCINCNSLGPQYVCSTFWTFVCINCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFT++EVSAL+ GGN  A++IY KE D QRN+ PDGSN+ +LRDFI+ VYVD+
Sbjct  61   VKSISMAKFTAEEVSALRAGGNERARQIYFKEWDSQRNAYPDGSNIFKLRDFIRSVYVDK  120

Query  502  RYTGE  516
            RY  E
Sbjct  121  RYNSE  125



>ref|XP_006364751.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like [Solanum tuberosum]
Length=748

 Score =   200 bits (509),  Expect = 4e-56, Method: Composition-based stats.
 Identities = 96/151 (64%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M++R +E+E+NE+IIRGLLKLP NR+CINCNSLGPQYVC NF TF+C TCSGIHREFTHR
Sbjct  1    MSSR-REEERNEKIIRGLLKLPPNRKCINCNSLGPQYVCTNFWTFVCMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV ALQ GGN  A+EIYLK  DPQ   LP+ SNV+++R+FIK VYVD+
Sbjct  60   VKSVSMSKFTSQEVEALQQGGNQRAREIYLKSWDPQSQWLPNNSNVDKVREFIKTVYVDK  119

Query  502  RYTGERGFPRGKGETEDLNGN----RRVDTY  582
            +Y G +   R   +T++L  +    RR  +Y
Sbjct  120  KYAGAQSSDRPPRDTQNLRNHDDDMRRASSY  150



>gb|EYU21903.1| hypothetical protein MIMGU_mgv1a024605mg [Erythranthe guttata]
Length=449

 Score =   195 bits (496),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M  R KE+EK E IIR LLK  DNRRCINCNSLGPQYVC  F TF+CT CSG+HREFTHR
Sbjct  1    MPRRVKEEEKIEMIIRDLLKQTDNRRCINCNSLGPQYVCTTFWTFVCTNCSGVHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKF  +E+++LQ GGN  AK+IY K  D QRN  PDGSN+++LR+FIKHVY+DR
Sbjct  61   VKSVSMAKFNEEEITSLQAGGNERAKQIYFKTWDSQRNYSPDGSNLQKLREFIKHVYLDR  120

Query  502  RYTGE  516
            RY GE
Sbjct  121  RYAGE  125



>ref|NP_001056151.1| Os05g0534800 [Oryza sativa Japonica Group]
 gb|AAS75226.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18065.1| Os05g0534800 [Oryza sativa Japonica Group]
Length=550

 Score =   197 bits (502),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 115/162 (71%), Gaps = 16/162 (10%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NER IR LLKLP NRRCINCNSLGPQYVC +FSTF+C +CSGIHREFTHR
Sbjct  1    MGSRVKEEERNERAIRALLKLPGNRRCINCNSLGPQYVCTSFSTFVCVSCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGS-------------NVE  462
            VKS+SMAKFTSQEVSALQ GGN   KEIYLK  D Q   LPD               +V+
Sbjct  61   VKSISMAKFTSQEVSALQEGGNERGKEIYLKHWDFQGQPLPDIRSATKPDDYHRLLIDVD  120

Query  463  RLRDFIKHVYVDRRYTGER---GFPRGKGETEDLNGNRRVDT  579
            RLR+FIK VYVDRR+T ER     P+ KG  +D   N  +D+
Sbjct  121  RLRNFIKIVYVDRRFTAERIGNHQPQAKGSRDDTYRNNNIDS  162



>ref|XP_002319204.1| ARF GAP-like zinc finger-containing protein ZiGA4 [Populus trichocarpa]
 gb|EEE95127.1| ARF GAP-like zinc finger-containing protein ZiGA4 [Populus trichocarpa]
Length=672

 Score =   199 bits (507),  Expect = 4e-56, Method: Composition-based stats.
 Identities = 92/124 (74%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TFICTTCSGIHREFTHR
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFICTTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV ALQ GGN  A+EIYLK+ + QR  LPD S V+++R+FIK VYVD+
Sbjct  60   VKSVSMSKFTSQEVEALQNGGNQRAREIYLKDWNQQRQRLPDNSKVDKVREFIKDVYVDK  119

Query  502  RYTG  513
            +Y G
Sbjct  120  KYAG  123



>ref|XP_006375928.1| hypothetical protein POPTR_0013s06460g [Populus trichocarpa]
 gb|ERP53725.1| hypothetical protein POPTR_0013s06460g [Populus trichocarpa]
Length=677

 Score =   199 bits (506),  Expect = 5e-56, Method: Composition-based stats.
 Identities = 92/124 (74%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TFICTTCSGIHREFTHR
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFICTTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV ALQ GGN  A+EIYLK+ + QR  LPD S V+++R+FIK VYVD+
Sbjct  60   VKSVSMSKFTSQEVEALQNGGNQRAREIYLKDWNQQRQRLPDNSKVDKVREFIKDVYVDK  119

Query  502  RYTG  513
            +Y G
Sbjct  120  KYAG  123



>emb|CDY68904.1| BnaCnng61010D, partial [Brassica napus]
Length=506

 Score =   196 bits (499),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M ++ KEDE+ E+ IR LLKLP+NRRCINCNSLGPQYVC  F TF+C  CSGIHREFTHR
Sbjct  1    MGSKMKEDERTEKAIRSLLKLPENRRCINCNSLGPQYVCSTFWTFVCINCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFT++EVSAL+ GGN  A++IY KE D QR++ PD SN+ +LRDFI+ VYVD+
Sbjct  61   VKSISMAKFTAEEVSALRAGGNERARQIYFKEWDTQRDAYPDASNIFKLRDFIRSVYVDK  120

Query  502  RYTGE  516
            RY+ E
Sbjct  121  RYSSE  125



>ref|XP_008647576.1| PREDICTED: uncharacterized protein LOC100273921 isoform X1 [Zea 
mays]
Length=619

 Score =   198 bits (504),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 107/126 (85%), Gaps = 1/126 (1%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KEDE+NE+IIRGLLKLP NRRCINCNSLGPQYVC +FSTFICT CSGIHREF+HR
Sbjct  1    MGSRVKEDERNEKIIRGLLKLPGNRRCINCNSLGPQYVCTSFSTFICTNCSGIHREFSHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEVSALQ GGN  AKEIY K  D Q   + D S+V RLR+FIK+VYV+R
Sbjct  61   VKSVSMAKFTSQEVSALQEGGNERAKEIYFKHWDLQGPVI-DSSDVHRLRNFIKNVYVER  119

Query  502  RYTGER  519
            RY+ +R
Sbjct  120  RYSDQR  125



>ref|XP_008443183.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Cucumis melo]
 gb|ADN33979.1| GTPase activating protein [Cucumis melo subsp. melo]
Length=674

 Score =   199 bits (505),  Expect = 8e-56, Method: Composition-based stats.
 Identities = 98/151 (65%), Positives = 115/151 (76%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NERIIRGL+KLP NRRCINCN LGPQYVC NF TF+C TCSGIHREFTHR
Sbjct  1    MGSR-KEEERNERIIRGLMKLPPNRRCINCNGLGPQYVCTNFWTFVCMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFT QEV ALQ GGN  A+EIYLK+ D QR  LP  SNVE++R+FIK+VYVDR
Sbjct  60   VKSVSMAKFTFQEVEALQNGGNQRAREIYLKDWDFQRQRLPVNSNVEKIREFIKNVYVDR  119

Query  502  RYTGERGFPRGKGETEDL----NGNRRVDTY  582
            +Y G R   +   + + L    +  RR  +Y
Sbjct  120  KYAGGRTSEKPPRDMQSLRIHEDETRRASSY  150



>gb|KCW47808.1| hypothetical protein EUGRSUZ_K015481 [Eucalyptus grandis]
Length=685

 Score =   199 bits (505),  Expect = 8e-56, Method: Composition-based stats.
 Identities = 94/124 (76%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC  F TFICTTCSGIHREFTHR
Sbjct  1    MGSR-REEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFICTTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV ALQ GGN  A+E+YLK+ D QR  LPD SNV+++R+FIK VYVDR
Sbjct  60   VKSVSMAKFTSQEVEALQNGGNQRAREMYLKDWDSQRQRLPDSSNVDKVREFIKAVYVDR  119

Query  502  RYTG  513
            RY G
Sbjct  120  RYAG  123



>ref|XP_010036277.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Eucalyptus grandis]
 gb|KCW47809.1| hypothetical protein EUGRSUZ_K015481 [Eucalyptus grandis]
Length=704

 Score =   199 bits (505),  Expect = 9e-56, Method: Composition-based stats.
 Identities = 94/124 (76%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC  F TFICTTCSGIHREFTHR
Sbjct  1    MGSR-REEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFICTTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV ALQ GGN  A+E+YLK+ D QR  LPD SNV+++R+FIK VYVDR
Sbjct  60   VKSVSMAKFTSQEVEALQNGGNQRAREMYLKDWDSQRQRLPDSSNVDKVREFIKAVYVDR  119

Query  502  RYTG  513
            RY G
Sbjct  120  RYAG  123



>ref|XP_010245794.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Nelumbo nucifera]
Length=691

 Score =   199 bits (505),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 90/125 (72%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = +1

Query  139  QMANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTH  318
            +M++R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFTH
Sbjct  4    KMSSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCVTCSGIHREFTH  62

Query  319  RVKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVD  498
            RVKSVSMAKFTSQEV ALQ GGN  A+EI+L+E D QR  LPD SNV+++R+FIK+VY++
Sbjct  63   RVKSVSMAKFTSQEVEALQRGGNQRAREIFLREWDLQRQRLPDSSNVDKVREFIKNVYIE  122

Query  499  RRYTG  513
            ++Y G
Sbjct  123  KKYAG  127



>emb|CDY65431.1| BnaA08g29820D [Brassica napus]
Length=577

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 111/140 (79%), Gaps = 4/140 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M    KE+EKNE+IIR LLKL  N+RCINCNSLGPQYVC +FSTF+CT CSGIHREFTHR
Sbjct  1    MGGGVKEEEKNEKIIRSLLKLAHNKRCINCNSLGPQYVCTSFSTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFTSQEVSAL+ GGN  AK+IY + LD    S  DGSNVERLRDFI+ VYV++
Sbjct  61   VKSISMAKFTSQEVSALKEGGNQHAKDIYFRGLDQHMLSASDGSNVERLRDFIRQVYVNK  120

Query  502  RYTGERG---FPRGK-GETE  549
            RYT E+     PRG  G++E
Sbjct  121  RYTNEKNDDKPPRGPMGDSE  140



>ref|XP_010036278.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Eucalyptus grandis]
Length=700

 Score =   199 bits (505),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 92/119 (77%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +1

Query  157  KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHRVKSVS  336
            +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC  F TFICTTCSGIHREFTHRVKSVS
Sbjct  5    REEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFICTTCSGIHREFTHRVKSVS  64

Query  337  MAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDRRYTG  513
            MAKFTSQEV ALQ GGN  A+E+YLK+ D QR  LPD SNV+++R+FIK VYVDRRY G
Sbjct  65   MAKFTSQEVEALQNGGNQRAREMYLKDWDSQRQRLPDSSNVDKVREFIKAVYVDRRYAG  123



>ref|XP_010670775.1| PREDICTED: uncharacterized protein LOC104887747 [Beta vulgaris 
subsp. vulgaris]
Length=830

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M  R KE++K E+IIRGLLKL +NRRCINCNSLGPQYVC NF TF+CT CSG+HREFTHR
Sbjct  1    MMGRSKEEDKIEKIIRGLLKLSENRRCINCNSLGPQYVCTNFWTFVCTNCSGVHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKF+ +EVSALQ GGN  A++ Y K  DPQRN  P+ SN++++RD IKHVYVD+
Sbjct  61   VKSVSMAKFSMEEVSALQAGGNEKARQTYFKTWDPQRNFSPENSNIDKIRDLIKHVYVDK  120

Query  502  RYTGE  516
            +YTGE
Sbjct  121  QYTGE  125



>ref|XP_010245793.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Nelumbo nucifera]
Length=696

 Score =   198 bits (504),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 90/125 (72%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = +1

Query  139  QMANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTH  318
            +M++R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFTH
Sbjct  4    KMSSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCVTCSGIHREFTH  62

Query  319  RVKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVD  498
            RVKSVSMAKFTSQEV ALQ GGN  A+EI+L+E D QR  LPD SNV+++R+FIK+VY++
Sbjct  63   RVKSVSMAKFTSQEVEALQRGGNQRAREIFLREWDLQRQRLPDSSNVDKVREFIKNVYIE  122

Query  499  RRYTG  513
            ++Y G
Sbjct  123  KKYAG  127



>ref|XP_010245795.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X3 [Nelumbo nucifera]
Length=688

 Score =   198 bits (503),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 94/152 (62%), Positives = 120/152 (79%), Gaps = 5/152 (3%)
 Frame = +1

Query  139  QMANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTH  318
            +M++R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFTH
Sbjct  4    KMSSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCVTCSGIHREFTH  62

Query  319  RVKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVD  498
            RVKSVSMAKFTSQEV ALQ GGN  A+EI+L+E D QR  LPD SNV+++R+FIK+VY++
Sbjct  63   RVKSVSMAKFTSQEVEALQRGGNQRAREIFLREWDLQRQRLPDSSNVDKVREFIKNVYIE  122

Query  499  RRYTGERGFPRGKGETEDL----NGNRRVDTY  582
            ++Y G +   +   + + L    +  RR  +Y
Sbjct  123  KKYAGGKTSDKPPRDMQSLRNYEDQTRRASSY  154



>ref|XP_004249094.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Solanum lycopersicum]
Length=741

 Score =   198 bits (504),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 95/151 (63%), Positives = 118/151 (78%), Gaps = 5/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M++R +E+E+NE+IIRGLLKLP NR+CINCNSLGPQYVC NF TF+C TCSGIHREFTHR
Sbjct  1    MSSR-REEERNEKIIRGLLKLPPNRKCINCNSLGPQYVCTNFWTFVCMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV ALQ GGN  A+EIYLK  DPQ   LP+ SNV+++R+FIK VYVD+
Sbjct  60   VKSVSMSKFTSQEVEALQQGGNQRAREIYLKSWDPQSQWLPNNSNVDKVREFIKTVYVDK  119

Query  502  RYTGERGFPRGKGETEDLNGN----RRVDTY  582
            +Y G +   R   + ++L  +    RR  +Y
Sbjct  120  KYAGAQSSDRPPRDIQNLRNHDDDMRRASSY  150



>gb|KHG17664.1| hypothetical protein F383_06879 [Gossypium arboreum]
Length=685

 Score =   198 bits (503),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 91/124 (73%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TFIC TCSGIHREFTHR
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFICMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFT QEV ALQ GGN  A++IYLK+ D QR  LPD SN +++R+FIK+VYVDR
Sbjct  60   VKSVSMSKFTKQEVEALQNGGNQRARDIYLKDWDLQRQRLPDSSNADKIREFIKNVYVDR  119

Query  502  RYTG  513
            +Y G
Sbjct  120  KYAG  123



>ref|XP_009107693.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Brassica rapa]
Length=584

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M    KE+EKNE+IIR LLKL  N+RCINCNSLGPQYVC +FSTF+CT CSGIHREFTHR
Sbjct  1    MGGGVKEEEKNEKIIRSLLKLAHNKRCINCNSLGPQYVCTSFSTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFTSQEVSAL+ GGN  AK+IY + LD    S  DGSNVERLRDFI+ VYV++
Sbjct  61   VKSISMAKFTSQEVSALKEGGNQHAKDIYFRGLDQHMLSASDGSNVERLRDFIRQVYVNK  120

Query  502  RYTGER  519
            RYT E+
Sbjct  121  RYTNEK  126



>ref|XP_009107694.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Brassica rapa]
Length=583

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M    KE+EKNE+IIR LLKL  N+RCINCNSLGPQYVC +FSTF+CT CSGIHREFTHR
Sbjct  1    MGGGVKEEEKNEKIIRSLLKLAHNKRCINCNSLGPQYVCTSFSTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFTSQEVSAL+ GGN  AK+IY + LD    S  DGSNVERLRDFI+ VYV++
Sbjct  61   VKSISMAKFTSQEVSALKEGGNQHAKDIYFRGLDQHMLSASDGSNVERLRDFIRQVYVNK  120

Query  502  RYTGER  519
            RYT E+
Sbjct  121  RYTNEK  126



>ref|XP_011070020.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Sesamum indicum]
 ref|XP_011070021.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Sesamum indicum]
Length=695

 Score =   197 bits (502),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 92/146 (63%), Positives = 116/146 (79%), Gaps = 4/146 (3%)
 Frame = +1

Query  157  KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHRVKSVS  336
            +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFTHRVKSVS
Sbjct  5    REEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFTHRVKSVS  64

Query  337  MAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDRRYTGE  516
            MAKFT QEV ALQ GGN  A+E++LK  D QRN LPD SNV+++R+FIK+VYVD++Y+ +
Sbjct  65   MAKFTFQEVDALQKGGNQRARELFLKAWDLQRNRLPDNSNVDKVREFIKNVYVDKKYSVQ  124

Query  517  RGFPRGKGETEDLNGN----RRVDTY  582
            +   +   + + L  +    RR  +Y
Sbjct  125  KSSDKPPRDPQSLRSHEDETRRASSY  150



>ref|XP_011047055.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Populus euphratica]
Length=695

 Score =   197 bits (502),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 91/124 (73%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TFICTTCSGIHREFTHR
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFICTTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV ALQ GGN  A+EIYLK+ + QR  LPD S V+++R+FIK VY+D+
Sbjct  60   VKSVSMSKFTSQEVEALQNGGNQRAREIYLKDWNQQRQRLPDNSKVDKVREFIKDVYMDK  119

Query  502  RYTG  513
            +Y G
Sbjct  120  KYAG  123



>gb|KHN35582.1| Putative ADP-ribosylation factor GTPase-activating protein AGD14 
[Glycine soja]
Length=745

 Score =   198 bits (503),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 94/126 (75%), Positives = 107/126 (85%), Gaps = 1/126 (1%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC +F TFIC TCSGIHREFTHR
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTSFWTFICMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV ALQ GGN  A+EIYLK  D QR  LPD SNVE++R+FI++VYVD 
Sbjct  60   VKSVSMAKFTSQEVDALQNGGNQRAREIYLKNWDFQRQRLPDNSNVEKIREFIRNVYVDG  119

Query  502  RYTGER  519
            RY G +
Sbjct  120  RYAGAK  125



>gb|KJB46060.1| hypothetical protein B456_007G346500 [Gossypium raimondii]
Length=685

 Score =   197 bits (501),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 93/142 (65%), Positives = 112/142 (79%), Gaps = 4/142 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TFIC TCSGIHREFTHR
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFICMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KF+ QEV ALQ GGN  A++IYLK+ D QR  LPD SN +++R+FIK+VYVDR
Sbjct  60   VKSVSMSKFSKQEVEALQNGGNQRARDIYLKDWDLQRQRLPDSSNADKIREFIKNVYVDR  119

Query  502  RYTGERGFPRGKGETEDLNGNR  567
            +Y G +   +      D+  NR
Sbjct  120  KYAGGKSSDK---PPRDMQSNR  138



>ref|XP_004287205.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Fragaria vesca subsp. vesca]
Length=676

 Score =   197 bits (501),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 92/126 (73%), Positives = 107/126 (85%), Gaps = 1/126 (1%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFTHR
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCPNFWTFVCTTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV AL+ GGN  A+EIYLK+ D QR   PD S V+++RDFI+ VYVDR
Sbjct  60   VKSVSMSKFTSQEVKALENGGNQRAREIYLKDWDLQRQRFPDSSKVDKIRDFIRSVYVDR  119

Query  502  RYTGER  519
            +Y G R
Sbjct  120  KYAGGR  125



>ref|XP_011019715.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X4 [Populus euphratica]
Length=729

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 114/146 (78%), Gaps = 3/146 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M  + KE+E+  +IIRGLLK+P+N RC+NCN+LGPQYVC  F TF+C  CSGIHREFTHR
Sbjct  1    MMKKNKEEERIGKIIRGLLKIPENSRCVNCNNLGPQYVCKTFFTFVCKNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+S AKF ++EVSALQ GGN  A++I+LKE +PQRN LPD SN +++RDFIKHVYVDR
Sbjct  61   VKSISTAKFNAEEVSALQAGGNERARQIFLKEWNPQRNQLPDSSNQQKVRDFIKHVYVDR  120

Query  502  RYTGERG---FPRGKGETEDLNGNRR  570
            RYTGE+     PR +   +D +G  R
Sbjct  121  RYTGEKSHEKLPRLRLNDKDDSGENR  146



>ref|XP_003525726.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X1 [Glycine max]
Length=741

 Score =   197 bits (501),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 94/126 (75%), Positives = 107/126 (85%), Gaps = 1/126 (1%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC +F TFIC TCSGIHREFTHR
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTSFWTFICMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV ALQ GGN  A+EIYLK  D QR  LPD SNVE++R+FI++VYVD 
Sbjct  60   VKSVSMAKFTSQEVDALQNGGNQRAREIYLKNWDFQRQRLPDNSNVEKIREFIRNVYVDG  119

Query  502  RYTGER  519
            RY G +
Sbjct  120  RYAGAK  125



>ref|XP_008240628.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Prunus mume]
Length=683

 Score =   197 bits (500),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 92/126 (73%), Positives = 106/126 (84%), Gaps = 1/126 (1%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFTHR
Sbjct  1    MATR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCITCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV ALQ GGN  A+EIYL + D QR  LPD S V+++R+FI+ VYVDR
Sbjct  60   VKSVSMSKFTSQEVEALQNGGNQRAREIYLMDWDLQRQRLPDNSKVDKIREFIRSVYVDR  119

Query  502  RYTGER  519
            +Y G R
Sbjct  120  KYAGGR  125



>ref|XP_007202210.1| hypothetical protein PRUPE_ppa002501mg [Prunus persica]
 gb|EMJ03409.1| hypothetical protein PRUPE_ppa002501mg [Prunus persica]
Length=665

 Score =   197 bits (500),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 92/126 (73%), Positives = 106/126 (84%), Gaps = 1/126 (1%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFTHR
Sbjct  1    MATR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCITCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV ALQ GGN  A+EIYL + D QR  LPD S V+++R+FI+ VYVDR
Sbjct  60   VKSVSMSKFTSQEVEALQNGGNQRAREIYLMDWDLQRQRLPDNSKVDKIREFIRSVYVDR  119

Query  502  RYTGER  519
            +Y G R
Sbjct  120  KYAGGR  125



>ref|XP_007151505.1| hypothetical protein PHAVU_004G052500g [Phaseolus vulgaris]
 gb|ESW23499.1| hypothetical protein PHAVU_004G052500g [Phaseolus vulgaris]
Length=685

 Score =   197 bits (500),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 94/124 (76%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+EKNE+IIRGL+KLP NRRCINCNSLGPQYVC +F TFICTTCSGIHREFTHR
Sbjct  1    MGSR-KEEEKNEKIIRGLMKLPPNRRCINCNSLGPQYVCTSFWTFICTTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV ALQ GGN  A+EIYLK  D QR  LPD SNV+++R+FI+ VYVD 
Sbjct  60   VKSVSMAKFTSQEVDALQSGGNQRAREIYLKNWDFQRQRLPDNSNVDKIREFIRSVYVDG  119

Query  502  RYTG  513
            RY  
Sbjct  120  RYAA  123



>ref|XP_009389148.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X3 [Musa acuminata subsp. malaccensis]
Length=657

 Score =   196 bits (499),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 91/145 (63%), Positives = 114/145 (79%), Gaps = 3/145 (2%)
 Frame = +1

Query  157  KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHRVKSVS  336
            K+DE+NE+IIRGLLKLP NR+CINCNSLGPQYVC+NF TFIC TCSGIHREFTHRVKS+S
Sbjct  5    KQDERNEKIIRGLLKLPPNRKCINCNSLGPQYVCVNFWTFICVTCSGIHREFTHRVKSIS  64

Query  337  MAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDRRYTG-  513
            MAKFTSQEV ALQ GGN  A+EI+LK+ D ++  LP  SN+++LR+FIK+VYV+++Y G 
Sbjct  65   MAKFTSQEVEALQKGGNQRAREIFLKDWDTEKMRLPSSSNLDKLREFIKYVYVEKKYAGG  124

Query  514  --ERGFPRGKGETEDLNGNRRVDTY  582
                  PR     ++   +RR  +Y
Sbjct  125  ISSDKPPRDMQTHKNHEDHRRASSY  149



>emb|CDX75265.1| BnaA01g04370D [Brassica napus]
Length=613

 Score =   196 bits (497),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M ++ KEDE+ E+ IR LLKLP+NRRCINCNSLGPQYVC  F TF+C  CSGIHREFTHR
Sbjct  1    MGSKMKEDERTEKAIRSLLKLPENRRCINCNSLGPQYVCSTFWTFVCINCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFT++EVSAL+ GGN  A++IY KE D QR++ PD SN+ +LRDFI+ VYVD+
Sbjct  61   VKSISMAKFTAEEVSALRVGGNERARQIYFKEWDTQRDAYPDASNISKLRDFIRSVYVDK  120

Query  502  RYTGE  516
            RY+ E
Sbjct  121  RYSTE  125



>ref|XP_011019714.1| PREDICTED: uncharacterized protein LOC105122345 isoform X3 [Populus 
euphratica]
Length=761

 Score =   197 bits (501),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 114/146 (78%), Gaps = 3/146 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M  + KE+E+  +IIRGLLK+P+N RC+NCN+LGPQYVC  F TF+C  CSGIHREFTHR
Sbjct  1    MMKKNKEEERIGKIIRGLLKIPENSRCVNCNNLGPQYVCKTFFTFVCKNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+S AKF ++EVSALQ GGN  A++I+LKE +PQRN LPD SN +++RDFIKHVYVDR
Sbjct  61   VKSISTAKFNAEEVSALQAGGNERARQIFLKEWNPQRNQLPDSSNQQKVRDFIKHVYVDR  120

Query  502  RYTGERG---FPRGKGETEDLNGNRR  570
            RYTGE+     PR +   +D +G  R
Sbjct  121  RYTGEKSHEKLPRLRLNDKDDSGENR  146



>ref|XP_004136610.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like [Cucumis sativus]
 ref|XP_004168097.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like [Cucumis sativus]
 gb|KGN59389.1| hypothetical protein Csa_3G816020 [Cucumis sativus]
Length=673

 Score =   196 bits (498),  Expect = 6e-55, Method: Composition-based stats.
 Identities = 93/126 (74%), Positives = 106/126 (84%), Gaps = 1/126 (1%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NERIIRGL+KLP NRRCINCN LGPQYVC NF TF+C TCSGIHREFTHR
Sbjct  1    MGSR-KEEERNERIIRGLMKLPPNRRCINCNGLGPQYVCTNFWTFVCMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKF+ QEV ALQ GGN  A+EIYLK+ D QR  LP  SNVE++R+FIK+VYVDR
Sbjct  60   VKSVSMAKFSFQEVEALQNGGNQRAREIYLKDWDFQRQRLPVNSNVEKIREFIKNVYVDR  119

Query  502  RYTGER  519
            +Y G R
Sbjct  120  KYAGGR  125



>ref|XP_009125724.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Brassica rapa]
 ref|XP_009125730.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Brassica rapa]
Length=614

 Score =   195 bits (496),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M ++ KEDE+ E+ IR LLKLP+NRRCINCNSLGPQYVC  F TF+C  CSGIHREFTHR
Sbjct  1    MGSKMKEDERTEKAIRSLLKLPENRRCINCNSLGPQYVCSTFWTFVCINCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+SMAKFT++EVSAL+ GGN  A+++Y KE D QR++ PD SN+ +LRDFI+ VYVD+
Sbjct  61   VKSISMAKFTAEEVSALRAGGNERARQVYFKEWDTQRDAYPDASNIFKLRDFIRSVYVDK  120

Query  502  RYTGE  516
            RY+ E
Sbjct  121  RYSTE  125



>ref|XP_003555100.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X1 [Glycine max]
Length=697

 Score =   196 bits (498),  Expect = 8e-55, Method: Composition-based stats.
 Identities = 93/126 (74%), Positives = 107/126 (85%), Gaps = 1/126 (1%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC +F TFIC TCSGIHREFTHR
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTSFWTFICMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV ALQ GGN SA+E+YLK  D QR  LPD SNV+++R+FI+ VYVD 
Sbjct  60   VKSVSMAKFTSQEVDALQNGGNQSARELYLKNWDFQRQRLPDNSNVDKIREFIRSVYVDG  119

Query  502  RYTGER  519
            RY G +
Sbjct  120  RYAGTK  125



>ref|XP_002530953.1| HIV-1 rev binding protein, hrbl, putative [Ricinus communis]
 gb|EEF31425.1| HIV-1 rev binding protein, hrbl, putative [Ricinus communis]
Length=692

 Score =   196 bits (498),  Expect = 8e-55, Method: Composition-based stats.
 Identities = 89/124 (72%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQ+VC NF TF+C TCSGIHREFTHR
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQFVCTNFWTFVCMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQ+V ALQ GGN  A+EIYLK+ D QR  LPD SNV+++R+FIK +YVD+
Sbjct  60   VKSVSMSKFTSQDVEALQNGGNQRAREIYLKDWDQQRQRLPDNSNVDKIREFIKSIYVDK  119

Query  502  RYTG  513
            +Y G
Sbjct  120  KYAG  123



>ref|XP_009389146.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Musa acuminata subsp. malaccensis]
Length=690

 Score =   196 bits (498),  Expect = 9e-55, Method: Composition-based stats.
 Identities = 91/145 (63%), Positives = 114/145 (79%), Gaps = 3/145 (2%)
 Frame = +1

Query  157  KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHRVKSVS  336
            K+DE+NE+IIRGLLKLP NR+CINCNSLGPQYVC+NF TFIC TCSGIHREFTHRVKS+S
Sbjct  5    KQDERNEKIIRGLLKLPPNRKCINCNSLGPQYVCVNFWTFICVTCSGIHREFTHRVKSIS  64

Query  337  MAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDRRYTG-  513
            MAKFTSQEV ALQ GGN  A+EI+LK+ D ++  LP  SN+++LR+FIK+VYV+++Y G 
Sbjct  65   MAKFTSQEVEALQKGGNQRAREIFLKDWDTEKMRLPSSSNLDKLREFIKYVYVEKKYAGG  124

Query  514  --ERGFPRGKGETEDLNGNRRVDTY  582
                  PR     ++   +RR  +Y
Sbjct  125  ISSDKPPRDMQTHKNHEDHRRASSY  149



>ref|XP_009389147.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Musa acuminata subsp. malaccensis]
Length=686

 Score =   196 bits (497),  Expect = 9e-55, Method: Composition-based stats.
 Identities = 91/145 (63%), Positives = 114/145 (79%), Gaps = 3/145 (2%)
 Frame = +1

Query  157  KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHRVKSVS  336
            K+DE+NE+IIRGLLKLP NR+CINCNSLGPQYVC+NF TFIC TCSGIHREFTHRVKS+S
Sbjct  5    KQDERNEKIIRGLLKLPPNRKCINCNSLGPQYVCVNFWTFICVTCSGIHREFTHRVKSIS  64

Query  337  MAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDRRYTG-  513
            MAKFTSQEV ALQ GGN  A+EI+LK+ D ++  LP  SN+++LR+FIK+VYV+++Y G 
Sbjct  65   MAKFTSQEVEALQKGGNQRAREIFLKDWDTEKMRLPSSSNLDKLREFIKYVYVEKKYAGG  124

Query  514  --ERGFPRGKGETEDLNGNRRVDTY  582
                  PR     ++   +RR  +Y
Sbjct  125  ISSDKPPRDMQTHKNHEDHRRASSY  149



>ref|XP_008394005.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Malus domestica]
 ref|XP_008394006.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Malus domestica]
 ref|XP_008394007.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Malus domestica]
 ref|XP_008361059.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Malus domestica]
Length=787

 Score =   196 bits (499),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 89/131 (68%), Positives = 103/131 (79%), Gaps = 0/131 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M    KEDEK ER IR LLKLP+N+RCINCNSLGPQYVC  F TF+CT CSG+HREFTHR
Sbjct  1    MGKGSKEDEKIERTIRSLLKLPENKRCINCNSLGPQYVCTTFMTFVCTNCSGVHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKF ++EVSALQ GGN   ++IY K+ DP+ +S PD SN+  LR FIKHVY+DR
Sbjct  61   VKSVSMAKFNAEEVSALQAGGNERVRQIYFKDWDPEYHSYPDASNLHGLRSFIKHVYIDR  120

Query  502  RYTGERGFPRG  534
            +YTGER    G
Sbjct  121  KYTGERSVYTG  131



>ref|NP_001049974.1| Os03g0323500 [Oryza sativa Japonica Group]
 dbj|BAF11888.1| Os03g0323500 [Oryza sativa Japonica Group]
Length=540

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 110/146 (75%), Gaps = 4/146 (3%)
 Frame = +1

Query  157  KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHRVKSVS  336
            KE+E+NER++RGLLKLP NRRCINCN LGPQYVC +F TF+C +CSGIHREFTHRVKSVS
Sbjct  8    KEEERNERVVRGLLKLPPNRRCINCNGLGPQYVCTSFWTFVCISCSGIHREFTHRVKSVS  67

Query  337  MAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDRRYTGE  516
            M+ FT+QEV ALQ GGN  A+E +LKE D Q+  LPD SNV+ LR+FIK VYV+RRY G 
Sbjct  68   MSTFTTQEVEALQNGGNQRARESFLKEFDAQKMRLPDSSNVDSLREFIKAVYVERRYAGG  127

Query  517  RGFPRGKGETEDLNGN----RRVDTY  582
            R   R   + ++   N    RR  +Y
Sbjct  128  RFSERPPRDKQNQKNNEQEHRRASSY  153



>emb|CDP18503.1| unnamed protein product [Coffea canephora]
Length=687

 Score =   195 bits (495),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 92/130 (71%), Positives = 107/130 (82%), Gaps = 1/130 (1%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M++R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFTHR
Sbjct  1    MSSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFT QEV ALQ GGN  A+EIYLK  D QR  LPD SN E++R+FI++VYV +
Sbjct  60   VKSVSMAKFTFQEVEALQNGGNQRAREIYLKHWDSQRQRLPDNSNAEKVREFIRNVYVMK  119

Query  502  RYTGERGFPR  531
            +Y G   F R
Sbjct  120  KYVGGGSFDR  129



>ref|XP_009416362.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Musa acuminata subsp. malaccensis]
Length=642

 Score =   194 bits (493),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 92/145 (63%), Positives = 113/145 (78%), Gaps = 3/145 (2%)
 Frame = +1

Query  157  KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHRVKSVS  336
            KEDE+NE++IRGLLKLP NR+CINCNSLGPQYVCINF TFIC TCSGIHREFTHRVKS+S
Sbjct  5    KEDERNEKVIRGLLKLPPNRKCINCNSLGPQYVCINFWTFICVTCSGIHREFTHRVKSIS  64

Query  337  MAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDRRYTGE  516
            MAKFTSQEV ALQ GGN  A+E +L++ D +R  LPD SN+++LR+FIK VYVD++Y   
Sbjct  65   MAKFTSQEVEALQRGGNQRARETFLRDWDMERMRLPDSSNLDKLREFIKAVYVDKKYASG  124

Query  517  RGF---PRGKGETEDLNGNRRVDTY  582
            +     PR     ++   +RR  +Y
Sbjct  125  KSSDKPPRDMQSHKNHEDHRRASSY  149



>ref|XP_010550492.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X3 [Tarenaya hassleriana]
Length=610

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 102/124 (82%), Gaps = 1/124 (1%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            MA+R +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC  F TF+C  CSGIHREFTHR
Sbjct  1    MASR-REEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFVCMACSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV ALQ GGN  A+EIYLK  D QR  LPD SN + +R+FIKHVY  +
Sbjct  60   VKSVSMAKFTSQEVEALQNGGNQRAREIYLKHWDYQRQRLPDSSNADGVREFIKHVYEGK  119

Query  502  RYTG  513
            +Y G
Sbjct  120  KYAG  123



>ref|XP_006306972.1| hypothetical protein CARUB_v10008548mg [Capsella rubella]
 gb|EOA39870.1| hypothetical protein CARUB_v10008548mg [Capsella rubella]
Length=617

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 111/153 (73%), Gaps = 8/153 (5%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M    +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC  F TF+C  CSGIHREFTHR
Sbjct  1    MMGSKREEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFVCMACSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV  LQ GGN  A+EIYLK  D QR  LP+ SN +R+R+FIK VYV +
Sbjct  61   VKSVSMSKFTSQEVEVLQNGGNQRAREIYLKNWDHQRQRLPENSNADRVREFIKSVYVQK  120

Query  502  RYTGERGFPR------GKGETEDLNGNRRVDTY  582
            +Y GE    +      G G +E +   RR ++Y
Sbjct  121  KYAGENVTDKPPQDSQGHGSSESV--TRRANSY  151



>ref|XP_011019713.1| PREDICTED: uncharacterized protein LOC105122345 isoform X2 [Populus 
euphratica]
Length=778

 Score =   195 bits (496),  Expect = 3e-54, Method: Composition-based stats.
 Identities = 91/146 (62%), Positives = 114/146 (78%), Gaps = 3/146 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M  + KE+E+  +IIRGLLK+P+N RC+NCN+LGPQYVC  F TF+C  CSGIHREFTHR
Sbjct  1    MMKKNKEEERIGKIIRGLLKIPENSRCVNCNNLGPQYVCKTFFTFVCKNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+S AKF ++EVSALQ GGN  A++I+LKE +PQRN LPD SN +++RDFIKHVYVDR
Sbjct  61   VKSISTAKFNAEEVSALQAGGNERARQIFLKEWNPQRNQLPDSSNQQKVRDFIKHVYVDR  120

Query  502  RYTGERG---FPRGKGETEDLNGNRR  570
            RYTGE+     PR +   +D +G  R
Sbjct  121  RYTGEKSHEKLPRLRLNDKDDSGENR  146



>ref|XP_011019709.1| PREDICTED: uncharacterized protein LOC105122345 isoform X1 [Populus 
euphratica]
 ref|XP_011019710.1| PREDICTED: uncharacterized protein LOC105122345 isoform X1 [Populus 
euphratica]
 ref|XP_011019712.1| PREDICTED: uncharacterized protein LOC105122345 isoform X1 [Populus 
euphratica]
Length=789

 Score =   195 bits (496),  Expect = 3e-54, Method: Composition-based stats.
 Identities = 91/146 (62%), Positives = 114/146 (78%), Gaps = 3/146 (2%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M  + KE+E+  +IIRGLLK+P+N RC+NCN+LGPQYVC  F TF+C  CSGIHREFTHR
Sbjct  1    MMKKNKEEERIGKIIRGLLKIPENSRCVNCNNLGPQYVCKTFFTFVCKNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKS+S AKF ++EVSALQ GGN  A++I+LKE +PQRN LPD SN +++RDFIKHVYVDR
Sbjct  61   VKSISTAKFNAEEVSALQAGGNERARQIFLKEWNPQRNQLPDSSNQQKVRDFIKHVYVDR  120

Query  502  RYTGERG---FPRGKGETEDLNGNRR  570
            RYTGE+     PR +   +D +G  R
Sbjct  121  RYTGEKSHEKLPRLRLNDKDDSGENR  146



>ref|XP_006285581.1| hypothetical protein CARUB_v10007026mg [Capsella rubella]
 gb|EOA18479.1| hypothetical protein CARUB_v10007026mg [Capsella rubella]
Length=631

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KEDE+ E+ +R LLKLP+NRRCINCNSLGPQYVC  F TF+CT CSGIHREFTHR
Sbjct  1    MGSRIKEDERIEKAVRSLLKLPENRRCINCNSLGPQYVCSTFWTFVCTNCSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFT+ EV AL+ GGN  A++IY KE D  R+  PDGSN+ +LRDFI++VYVD+
Sbjct  61   VKSVSMAKFTADEVGALRAGGNERARQIYFKEWDTHRDGYPDGSNIFKLRDFIRNVYVDK  120

Query  502  RYTGE  516
            RY  E
Sbjct  121  RYCSE  125



>ref|XP_010922919.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X3 [Elaeis guineensis]
Length=599

 Score =   193 bits (490),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 111/146 (76%), Gaps = 4/146 (3%)
 Frame = +1

Query  157  KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHRVKSVS  336
            +E+E+NE+IIRGL+K P NR+CINCNSL PQYVC NF TF+CTTCSGIHREFTHRVKSVS
Sbjct  5    REEERNEKIIRGLMKRPPNRKCINCNSLAPQYVCTNFWTFVCTTCSGIHREFTHRVKSVS  64

Query  337  MAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDRRYTGE  516
            MAKFT +EV ALQ GGN  A+EI+LK+ D Q+  LPD SN +R+R FIK+VYVD++Y G 
Sbjct  65   MAKFTKEEVDALQRGGNQHAREIFLKDWDMQQMRLPDSSNADRIRQFIKNVYVDKKYAGG  124

Query  517  RGFPRGKGETEDLNGN----RRVDTY  582
            R   +    TE L  +    +R  +Y
Sbjct  125  RTSDKPSSNTESLTNHGEDQKRASSY  150



>ref|XP_009389149.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X4 [Musa acuminata subsp. malaccensis]
Length=640

 Score =   194 bits (492),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 91/145 (63%), Positives = 114/145 (79%), Gaps = 3/145 (2%)
 Frame = +1

Query  157  KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHRVKSVS  336
            K+DE+NE+IIRGLLKLP NR+CINCNSLGPQYVC+NF TFIC TCSGIHREFTHRVKS+S
Sbjct  5    KQDERNEKIIRGLLKLPPNRKCINCNSLGPQYVCVNFWTFICVTCSGIHREFTHRVKSIS  64

Query  337  MAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDRRYTG-  513
            MAKFTSQEV ALQ GGN  A+EI+LK+ D ++  LP  SN+++LR+FIK+VYV+++Y G 
Sbjct  65   MAKFTSQEVEALQKGGNQRAREIFLKDWDTEKMRLPSSSNLDKLREFIKYVYVEKKYAGG  124

Query  514  --ERGFPRGKGETEDLNGNRRVDTY  582
                  PR     ++   +RR  +Y
Sbjct  125  ISSDKPPRDMQTHKNHEDHRRASSY  149



>gb|KHN05268.1| Putative ADP-ribosylation factor GTPase-activating protein AGD14 
[Glycine soja]
Length=697

 Score =   194 bits (493),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 92/126 (73%), Positives = 106/126 (84%), Gaps = 1/126 (1%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC +F TFIC TCSGIHREFTHR
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTSFWTFICMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV ALQ GGN  A+E+YLK  D QR  LPD SNV+++R+FI+ VYVD 
Sbjct  60   VKSVSMAKFTSQEVDALQNGGNQRARELYLKNWDFQRQRLPDNSNVDKIREFIRSVYVDG  119

Query  502  RYTGER  519
            RY G +
Sbjct  120  RYAGTK  125



>ref|XP_006417658.1| hypothetical protein EUTSA_v10007026mg [Eutrema salsugineum]
 gb|ESQ36011.1| hypothetical protein EUTSA_v10007026mg [Eutrema salsugineum]
Length=648

 Score =   194 bits (492),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 92/148 (62%), Positives = 110/148 (74%), Gaps = 8/148 (5%)
 Frame = +1

Query  157  KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHRVKSVS  336
            +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC  F TF+C  CSGIHREFTHRVKSVS
Sbjct  5    REEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFVCMACSGIHREFTHRVKSVS  64

Query  337  MAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDRRYTGE  516
            M+KFTSQEV  LQ GGN  A+EIYLK  D QR  LPD SN ER+R+FIK+VYV ++Y G 
Sbjct  65   MSKFTSQEVEVLQNGGNQRAREIYLKNWDHQRQRLPDNSNAERVREFIKNVYVQKKYAGA  124

Query  517  R------GFPRGKGETEDLNGNRRVDTY  582
                      +  G +ED+   RR ++Y
Sbjct  125  NVTDKPPNDSQNHGSSEDV--TRRANSY  150



>ref|XP_006417659.1| hypothetical protein EUTSA_v10007026mg [Eutrema salsugineum]
 gb|ESQ36012.1| hypothetical protein EUTSA_v10007026mg [Eutrema salsugineum]
Length=646

 Score =   194 bits (492),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 92/148 (62%), Positives = 110/148 (74%), Gaps = 8/148 (5%)
 Frame = +1

Query  157  KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHRVKSVS  336
            +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC  F TF+C  CSGIHREFTHRVKSVS
Sbjct  5    REEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFVCMACSGIHREFTHRVKSVS  64

Query  337  MAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDRRYTGE  516
            M+KFTSQEV  LQ GGN  A+EIYLK  D QR  LPD SN ER+R+FIK+VYV ++Y G 
Sbjct  65   MSKFTSQEVEVLQNGGNQRAREIYLKNWDHQRQRLPDNSNAERVREFIKNVYVQKKYAGA  124

Query  517  R------GFPRGKGETEDLNGNRRVDTY  582
                      +  G +ED+   RR ++Y
Sbjct  125  NVTDKPPNDSQNHGSSEDV--TRRANSY  150



>ref|XP_010922918.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Elaeis guineensis]
Length=624

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 111/146 (76%), Gaps = 4/146 (3%)
 Frame = +1

Query  157  KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHRVKSVS  336
            +E+E+NE+IIRGL+K P NR+CINCNSL PQYVC NF TF+CTTCSGIHREFTHRVKSVS
Sbjct  5    REEERNEKIIRGLMKRPPNRKCINCNSLAPQYVCTNFWTFVCTTCSGIHREFTHRVKSVS  64

Query  337  MAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDRRYTGE  516
            MAKFT +EV ALQ GGN  A+EI+LK+ D Q+  LPD SN +R+R FIK+VYVD++Y G 
Sbjct  65   MAKFTKEEVDALQRGGNQHAREIFLKDWDMQQMRLPDSSNADRIRQFIKNVYVDKKYAGG  124

Query  517  RGFPRGKGETEDLNGN----RRVDTY  582
            R   +    TE L  +    +R  +Y
Sbjct  125  RTSDKPSSNTESLTNHGEDQKRASSY  150



>gb|EAY87827.1| hypothetical protein OsI_09246 [Oryza sativa Indica Group]
Length=632

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 110/146 (75%), Gaps = 4/146 (3%)
 Frame = +1

Query  157  KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHRVKSVS  336
            KE+E+NER++RGLLKLP NRRCINCN LGPQYVC +F TF+C +CSGIHREFTHRVKSVS
Sbjct  8    KEEERNERVVRGLLKLPPNRRCINCNGLGPQYVCTSFWTFVCISCSGIHREFTHRVKSVS  67

Query  337  MAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDRRYTGE  516
            M+ FT+QEV ALQ GGN  A+E +LKE D Q+  LPD SNV+ LR+FIK VYV+RRY G 
Sbjct  68   MSTFTTQEVEALQNGGNQRARESFLKEFDAQKMRLPDSSNVDSLREFIKAVYVERRYAGG  127

Query  517  RGFPRGKGETEDLNGN----RRVDTY  582
            R   R   + ++   N    RR  +Y
Sbjct  128  RFSERPPRDKQNQKNNEQEHRRASSY  153



>ref|XP_010922917.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Elaeis guineensis]
Length=625

 Score =   193 bits (491),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 111/146 (76%), Gaps = 4/146 (3%)
 Frame = +1

Query  157  KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHRVKSVS  336
            +E+E+NE+IIRGL+K P NR+CINCNSL PQYVC NF TF+CTTCSGIHREFTHRVKSVS
Sbjct  5    REEERNEKIIRGLMKRPPNRKCINCNSLAPQYVCTNFWTFVCTTCSGIHREFTHRVKSVS  64

Query  337  MAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDRRYTGE  516
            MAKFT +EV ALQ GGN  A+EI+LK+ D Q+  LPD SN +R+R FIK+VYVD++Y G 
Sbjct  65   MAKFTKEEVDALQRGGNQHAREIFLKDWDMQQMRLPDSSNADRIRQFIKNVYVDKKYAGG  124

Query  517  RGFPRGKGETEDLNGN----RRVDTY  582
            R   +    TE L  +    +R  +Y
Sbjct  125  RTSDKPSSNTESLTNHGEDQKRASSY  150



>ref|XP_006417657.1| hypothetical protein EUTSA_v10007026mg [Eutrema salsugineum]
 gb|ESQ36010.1| hypothetical protein EUTSA_v10007026mg [Eutrema salsugineum]
Length=647

 Score =   193 bits (491),  Expect = 5e-54, Method: Composition-based stats.
 Identities = 92/148 (62%), Positives = 110/148 (74%), Gaps = 8/148 (5%)
 Frame = +1

Query  157  KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHRVKSVS  336
            +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC  F TF+C  CSGIHREFTHRVKSVS
Sbjct  5    REEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFVCMACSGIHREFTHRVKSVS  64

Query  337  MAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDRRYTGE  516
            M+KFTSQEV  LQ GGN  A+EIYLK  D QR  LPD SN ER+R+FIK+VYV ++Y G 
Sbjct  65   MSKFTSQEVEVLQNGGNQRAREIYLKNWDHQRQRLPDNSNAERVREFIKNVYVQKKYAGA  124

Query  517  R------GFPRGKGETEDLNGNRRVDTY  582
                      +  G +ED+   RR ++Y
Sbjct  125  NVTDKPPNDSQNHGSSEDV--TRRANSY  150



>ref|XP_010553783.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Tarenaya hassleriana]
Length=686

 Score =   193 bits (491),  Expect = 7e-54, Method: Composition-based stats.
 Identities = 88/124 (71%), Positives = 103/124 (83%), Gaps = 1/124 (1%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R +E+E+NE+IIRGL+KLP NRRCINCNS+GPQYVC  F TF+C  CSGIHREFTHR
Sbjct  1    MGSR-REEERNEKIIRGLMKLPPNRRCINCNSMGPQYVCTTFWTFVCIACSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFTSQEV ALQ GGN  A+E+YLK  D QR  LPD SN +R+R+FIKHVYV +
Sbjct  60   VKSVSMAKFTSQEVEALQNGGNQRAREMYLKNWDYQRQRLPDSSNADRVREFIKHVYVQK  119

Query  502  RYTG  513
            +Y G
Sbjct  120  KYAG  123



>ref|XP_010458119.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X4 [Camelina sativa]
Length=613

 Score =   192 bits (489),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 110/153 (72%), Gaps = 8/153 (5%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M    +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC  F TF+C  CSGIHREFTHR
Sbjct  1    MMGSKREEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFVCMACSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV  LQ GGN  A+EIYLK  D QR  LP+ SN ER+R+FIK VYV +
Sbjct  61   VKSVSMSKFTSQEVEVLQNGGNQRAREIYLKNWDHQRQRLPENSNAERVREFIKSVYVQK  120

Query  502  RYTGERGFPRG------KGETEDLNGNRRVDTY  582
            +Y G     +        G +ED+   RR ++Y
Sbjct  121  KYAGANVTDKPLKDIQDHGSSEDM--TRRANSY  151



>ref|XP_010475678.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
Length=613

 Score =   192 bits (489),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 110/153 (72%), Gaps = 8/153 (5%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M    +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC  F TF+C  CSGIHREFTHR
Sbjct  1    MMGSKREEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFVCMACSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV  LQ GGN  A+EIYLK  D QR  LP+ SN ER+R+FIK VYV +
Sbjct  61   VKSVSMSKFTSQEVEVLQNGGNQRAREIYLKNWDHQRQRLPENSNAERVREFIKSVYVQK  120

Query  502  RYTGERGFPRG------KGETEDLNGNRRVDTY  582
            +Y G     +        G +ED+   RR ++Y
Sbjct  121  KYAGANVTDKPLKDSQDHGSSEDM--TRRANSY  151



>ref|XP_003521869.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like [Glycine max]
Length=676

 Score =   192 bits (489),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 90/126 (71%), Positives = 106/126 (84%), Gaps = 1/126 (1%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFTHR
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCANFWTFVCMTCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMA FTSQEV ALQ GGN  A+EI+LK  D QR  LPD SNV+++R+FI++VYVD+
Sbjct  60   VKSVSMAMFTSQEVDALQNGGNQRAREIHLKNWDFQRQRLPDSSNVDKVREFIRNVYVDQ  119

Query  502  RYTGER  519
            RY   +
Sbjct  120  RYAAAK  125



>ref|NP_001031002.1| putative ADP-ribosylation factor GTPase-activating protein AGD14 
[Arabidopsis thaliana]
 dbj|BAD44178.1| unknown protein [Arabidopsis thaliana]
 gb|AEE28333.1| putative ADP-ribosylation factor GTPase-activating protein AGD14 
[Arabidopsis thaliana]
Length=607

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 111/151 (74%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M    +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC  F TF+C  CSGIHREFTHR
Sbjct  1    MMGSKREEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFVCMACSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTS+EV  LQ GGN  A+EIYLK  D QR  LP+ SN ER+R+FIK+VYV +
Sbjct  61   VKSVSMSKFTSKEVEVLQNGGNQRAREIYLKNWDHQRQRLPENSNAERVREFIKNVYVQK  120

Query  502  RYTGERGFPRGKGETEDL----NGNRRVDTY  582
            +Y G     +   +++D     +  RR ++Y
Sbjct  121  KYAGANDADKPSKDSQDHVSSEDMTRRANSY  151



>ref|XP_006306973.1| hypothetical protein CARUB_v10008548mg [Capsella rubella]
 gb|EOA39871.1| hypothetical protein CARUB_v10008548mg [Capsella rubella]
Length=646

 Score =   192 bits (487),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 92/153 (60%), Positives = 111/153 (73%), Gaps = 8/153 (5%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M    +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC  F TF+C  CSGIHREFTHR
Sbjct  1    MMGSKREEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFVCMACSGIHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSM+KFTSQEV  LQ GGN  A+EIYLK  D QR  LP+ SN +R+R+FIK VYV +
Sbjct  61   VKSVSMSKFTSQEVEVLQNGGNQRAREIYLKNWDHQRQRLPENSNADRVREFIKSVYVQK  120

Query  502  RYTGERGFPR------GKGETEDLNGNRRVDTY  582
            +Y GE    +      G G +E +   RR ++Y
Sbjct  121  KYAGENVTDKPPQDSQGHGSSESV--TRRANSY  151



>gb|EMT02442.1| Putative ADP-ribosylation factor GTPase-activating protein AGD14 
[Aegilops tauschii]
Length=1220

 Score =   195 bits (495),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 114/146 (78%), Gaps = 4/146 (3%)
 Frame = +1

Query  157  KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHRVKSVS  336
            +E+E+NE+IIRGL+KLP NR+CINCNS+GPQYVC NF TF C +CSGIHREFTHRVKSVS
Sbjct  5    REEERNEKIIRGLMKLPPNRKCINCNSVGPQYVCTNFWTFTCLSCSGIHREFTHRVKSVS  64

Query  337  MAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDRRYTGE  516
            M+KFT+QEV AL+ GGN  A++IYLK+ D QR  LPD S  +R+R+FI+ VYVD++Y G 
Sbjct  65   MSKFTTQEVRALEQGGNQRARDIYLKDWDWQRMRLPDNSKPDRIREFIRTVYVDKKYAGA  124

Query  517  RGFPRGKGETEDLNGN----RRVDTY  582
            +   +   ++E + GN    RR D+Y
Sbjct  125  KSTDKPATDSESVKGNESETRRPDSY  150



>ref|XP_008394008.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Malus domestica]
 ref|XP_008361060.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Malus domestica]
Length=686

 Score =   192 bits (487),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 89/131 (68%), Positives = 103/131 (79%), Gaps = 0/131 (0%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M    KEDEK ER IR LLKLP+N+RCINCNSLGPQYVC  F TF+CT CSG+HREFTHR
Sbjct  1    MGKGSKEDEKIERTIRSLLKLPENKRCINCNSLGPQYVCTTFMTFVCTNCSGVHREFTHR  60

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKF ++EVSALQ GGN   ++IY K+ DP+ +S PD SN+  LR FIKHVY+DR
Sbjct  61   VKSVSMAKFNAEEVSALQAGGNERVRQIYFKDWDPEYHSYPDASNLHGLRSFIKHVYIDR  120

Query  502  RYTGERGFPRG  534
            +YTGER    G
Sbjct  121  KYTGERSVYTG  131



>ref|XP_004489644.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like [Cicer arietinum]
Length=674

 Score =   191 bits (486),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 90/130 (69%), Positives = 105/130 (81%), Gaps = 1/130 (1%)
 Frame = +1

Query  142  MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFTHR  321
            M +R KE+EK E++IRGL+KLP NRRCINCNSLGPQYVC  F TF C TCSGIHREFTHR
Sbjct  1    MGSR-KEEEKIEKVIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFACITCSGIHREFTHR  59

Query  322  VKSVSMAKFTSQEVSALQGGGNASAKEIYLKELDPQRNSLPDGSNVERLRDFIKHVYVDR  501
            VKSVSMAKFT QEV ALQ GGN  A+++YLK  D QR  LPD SNVE++R+FI++VYVD+
Sbjct  60   VKSVSMAKFTLQEVDALQNGGNQRARDLYLKNWDFQRQRLPDSSNVEKVREFIRNVYVDK  119

Query  502  RYTGERGFPR  531
            RY G +   R
Sbjct  120  RYAGTKSSER  129



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250