BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS020D03

Length=625
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009799456.1|  PREDICTED: probable protein phosphatase 2C 5       320   2e-104   Nicotiana sylvestris
ref|XP_009599009.1|  PREDICTED: probable protein phosphatase 2C 5       317   2e-103   Nicotiana tomentosiformis
ref|XP_011092109.1|  PREDICTED: probable protein phosphatase 2C 5       311   4e-101   Sesamum indicum [beniseed]
ref|XP_004230274.1|  PREDICTED: probable protein phosphatase 2C 5       305   7e-99    Solanum lycopersicum
ref|XP_010259435.1|  PREDICTED: probable protein phosphatase 2C 5...    301   4e-98    Nelumbo nucifera [Indian lotus]
ref|XP_010245443.1|  PREDICTED: probable protein phosphatase 2C 5       303   5e-98    Nelumbo nucifera [Indian lotus]
gb|KHG06373.1|  hypothetical protein F383_32810                         302   1e-97    Gossypium arboreum [tree cotton]
gb|KJB26349.1|  hypothetical protein B456_004G237900                    298   1e-97    Gossypium raimondii
ref|XP_002282985.1|  PREDICTED: probable protein phosphatase 2C 5       302   2e-97    Vitis vinifera
ref|XP_009626600.1|  PREDICTED: probable protein phosphatase 2C 5       301   2e-97    Nicotiana tomentosiformis
ref|XP_007031084.1|  Phosphatase 2C family protein                      301   3e-97    Theobroma cacao [chocolate]
ref|XP_010259431.1|  PREDICTED: probable protein phosphatase 2C 5...    301   4e-97    
ref|XP_006344713.1|  PREDICTED: probable protein phosphatase 2C 5...    299   2e-96    
gb|KJB26348.1|  hypothetical protein B456_004G237900                    299   2e-96    Gossypium raimondii
ref|XP_008450571.1|  PREDICTED: probable protein phosphatase 2C 5       299   2e-96    Cucumis melo [Oriental melon]
ref|XP_004135583.1|  PREDICTED: probable protein phosphatase 2C 5...    298   4e-96    Cucumis sativus [cucumbers]
ref|XP_010088393.1|  putative protein phosphatase 2C 5                  296   5e-96    
ref|XP_002512477.1|  protein phosphatase, putative                      298   7e-96    Ricinus communis
ref|XP_004157232.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    297   8e-96    
gb|KDP23425.1|  hypothetical protein JCGZ_23258                         298   8e-96    Jatropha curcas
ref|XP_009759573.1|  PREDICTED: probable protein phosphatase 2C 5       297   1e-95    Nicotiana sylvestris
gb|EPS69183.1|  hypothetical protein M569_05581                         295   7e-95    Genlisea aurea
ref|XP_010024104.1|  PREDICTED: probable protein phosphatase 2C 5       295   8e-95    Eucalyptus grandis [rose gum]
ref|XP_006472159.1|  PREDICTED: probable protein phosphatase 2C 5...    294   2e-94    Citrus sinensis [apfelsine]
ref|XP_006433490.1|  hypothetical protein CICLE_v10001248mg             294   2e-94    Citrus clementina [clementine]
gb|EYU37269.1|  hypothetical protein MIMGU_mgv1a006832mg                294   2e-94    Erythranthe guttata [common monkey flower]
ref|XP_011036918.1|  PREDICTED: probable protein phosphatase 2C 5...    293   5e-94    Populus euphratica
emb|CDP17226.1|  unnamed protein product                                292   8e-94    Coffea canephora [robusta coffee]
gb|KJB45380.1|  hypothetical protein B456_007G303500                    291   2e-93    Gossypium raimondii
gb|KJB45378.1|  hypothetical protein B456_007G303500                    291   2e-93    Gossypium raimondii
ref|XP_011023737.1|  PREDICTED: probable protein phosphatase 2C 5...    290   5e-93    Populus euphratica
ref|XP_010528916.1|  PREDICTED: probable protein phosphatase 2C 5       290   5e-93    Tarenaya hassleriana [spider flower]
ref|XP_002318970.1|  phosphatase 2C family protein                      290   9e-93    Populus trichocarpa [western balsam poplar]
ref|XP_011466159.1|  PREDICTED: probable protein phosphatase 2C 5       289   1e-92    Fragaria vesca subsp. vesca
ref|XP_006382433.1|  hypothetical protein POPTR_0005s02110g             290   1e-92    Populus trichocarpa [western balsam poplar]
gb|ACJ85200.1|  unknown                                                 283   2e-92    Medicago truncatula
ref|XP_011036917.1|  PREDICTED: probable protein phosphatase 2C 5...    289   2e-92    Populus euphratica
ref|XP_010674109.1|  PREDICTED: probable protein phosphatase 2C 5       288   5e-92    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008388502.1|  PREDICTED: probable protein phosphatase 2C 5       287   7e-92    
ref|XP_010553723.1|  PREDICTED: probable protein phosphatase 2C 5       286   2e-91    Tarenaya hassleriana [spider flower]
ref|XP_011023738.1|  PREDICTED: probable protein phosphatase 2C 5...    286   3e-91    Populus euphratica
ref|XP_011023736.1|  PREDICTED: probable protein phosphatase 2C 5...    286   3e-91    Populus euphratica
ref|XP_003591191.1|  hypothetical protein MTR_1g083750                  284   2e-90    Medicago truncatula
ref|XP_007163342.1|  hypothetical protein PHAVU_001G226800g             283   4e-90    Phaseolus vulgaris [French bean]
gb|ABD28356.2|  Protein phosphatase 2C-like                             283   4e-90    Medicago truncatula
ref|XP_007205239.1|  hypothetical protein PRUPE_ppa006100mg             282   6e-90    
gb|KHN20267.1|  Hypothetical protein glysoja_023830                     282   8e-90    Glycine soja [wild soybean]
gb|AFK41874.1|  unknown                                                 283   1e-89    Medicago truncatula
ref|XP_008245693.1|  PREDICTED: probable protein phosphatase 2C 5       281   1e-89    Prunus mume [ume]
ref|XP_003554626.1|  PREDICTED: probable protein phosphatase 2C 5...    281   2e-89    
ref|XP_008370399.1|  PREDICTED: probable protein phosphatase 2C 5       281   2e-89    Malus domestica [apple tree]
gb|KHN16084.1|  Hypothetical protein glysoja_012060                     281   2e-89    Glycine soja [wild soybean]
gb|KHN03953.1|  Hypothetical protein glysoja_022639                     281   2e-89    Glycine soja [wild soybean]
gb|KJB26350.1|  hypothetical protein B456_004G237900                    279   9e-89    Gossypium raimondii
ref|XP_003521674.1|  PREDICTED: probable protein phosphatase 2C 5...    278   2e-88    Glycine max [soybeans]
ref|XP_006417602.1|  hypothetical protein EUTSA_v10007698mg             278   2e-88    Eutrema salsugineum [saltwater cress]
ref|XP_003626183.1|  hypothetical protein MTR_7g112430                  278   2e-88    Medicago truncatula
ref|XP_006604795.1|  PREDICTED: probable protein phosphatase 2C 5...    278   4e-88    Glycine max [soybeans]
ref|XP_004494559.1|  PREDICTED: probable protein phosphatase 2C 5...    278   4e-88    Cicer arietinum [garbanzo]
gb|AAL31893.1|AF419561_1  At1g09160/T12M4_13                            274   2e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892487.1|  hypothetical protein ARALYDRAFT_471002             275   4e-87    
ref|XP_004495680.1|  PREDICTED: probable protein phosphatase 2C 5...    275   5e-87    Cicer arietinum [garbanzo]
ref|XP_009338205.1|  PREDICTED: probable protein phosphatase 2C 5       275   5e-87    Pyrus x bretschneideri [bai li]
ref|XP_007144975.1|  hypothetical protein PHAVU_007G199100g             275   7e-87    Phaseolus vulgaris [French bean]
ref|NP_172388.1|  putative protein phosphatase 2C                       274   1e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010475741.1|  PREDICTED: probable protein phosphatase 2C 5       274   1e-86    Camelina sativa [gold-of-pleasure]
ref|XP_010458188.1|  PREDICTED: probable protein phosphatase 2C 5       274   1e-86    Camelina sativa [gold-of-pleasure]
ref|XP_010489746.1|  PREDICTED: probable protein phosphatase 2C 5       274   1e-86    Camelina sativa [gold-of-pleasure]
ref|XP_006307591.1|  hypothetical protein CARUB_v10009213mg             273   3e-86    Capsella rubella
gb|AIZ68189.1|  putative protein phosphatase 2C 33                      271   2e-85    Ornithogalum longebracteatum [sea-onion]
ref|XP_008807757.1|  PREDICTED: probable protein phosphatase 2C 33      270   4e-85    Phoenix dactylifera
ref|XP_009110849.1|  PREDICTED: probable protein phosphatase 2C 5       270   5e-85    Brassica rapa
emb|CDY32154.1|  BnaCnng06630D                                          271   1e-84    Brassica napus [oilseed rape]
emb|CDY31109.1|  BnaA08g26590D                                          268   2e-84    Brassica napus [oilseed rape]
ref|XP_009411651.1|  PREDICTED: probable protein phosphatase 2C 33      266   1e-83    
ref|XP_010938321.1|  PREDICTED: probable protein phosphatase 2C 33      266   1e-83    
ref|XP_008795536.1|  PREDICTED: probable protein phosphatase 2C 33      265   6e-83    Phoenix dactylifera
gb|KCW60535.1|  hypothetical protein EUGRSUZ_H03276                     262   3e-82    Eucalyptus grandis [rose gum]
ref|XP_010905680.1|  PREDICTED: probable protein phosphatase 2C 33      263   3e-82    Elaeis guineensis
ref|XP_006842367.1|  hypothetical protein AMTR_s00079p00186650          262   5e-82    
ref|XP_009386662.1|  PREDICTED: probable protein phosphatase 2C 33      261   8e-82    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003592620.1|  hypothetical protein MTR_1g110210                  257   2e-81    
ref|XP_007044253.1|  Phosphatase 2C family protein                      260   3e-81    
ref|XP_009588467.1|  PREDICTED: probable protein phosphatase 2C 1...    260   3e-81    Nicotiana tomentosiformis
ref|XP_009767020.1|  PREDICTED: probable protein phosphatase 2C 1...    259   6e-81    Nicotiana sylvestris
ref|XP_006448418.1|  hypothetical protein CICLE_v10015330mg             259   1e-80    Citrus clementina [clementine]
ref|XP_002279675.1|  PREDICTED: probable protein phosphatase 2C 15      258   1e-80    
ref|XP_002527010.1|  protein phosphatase, putative                      258   1e-80    Ricinus communis
gb|KHG19034.1|  hypothetical protein F383_08660                         257   2e-80    Gossypium arboreum [tree cotton]
gb|KDP29451.1|  hypothetical protein JCGZ_18372                         258   2e-80    Jatropha curcas
ref|XP_008792835.1|  PREDICTED: probable protein phosphatase 2C 1...    258   3e-80    
ref|XP_010264732.1|  PREDICTED: probable protein phosphatase 2C 15      257   4e-80    Nelumbo nucifera [Indian lotus]
ref|XP_004984656.1|  PREDICTED: probable protein phosphatase 2C 3...    253   4e-80    
ref|XP_008792836.1|  PREDICTED: probable protein phosphatase 2C 1...    258   4e-80    Phoenix dactylifera
ref|XP_007142943.1|  hypothetical protein PHAVU_007G030400g             257   6e-80    Phaseolus vulgaris [French bean]
ref|XP_010279327.1|  PREDICTED: probable protein phosphatase 2C 15      256   1e-79    Nelumbo nucifera [Indian lotus]
ref|XP_004497062.1|  PREDICTED: probable protein phosphatase 2C 1...    255   2e-79    Cicer arietinum [garbanzo]
ref|XP_004299042.1|  PREDICTED: probable protein phosphatase 2C 15      254   5e-79    Fragaria vesca subsp. vesca
ref|XP_010906996.1|  PREDICTED: probable protein phosphatase 2C 3...    254   5e-79    Elaeis guineensis
ref|XP_010532274.1|  PREDICTED: probable protein phosphatase 2C 1...    254   5e-79    Tarenaya hassleriana [spider flower]
ref|XP_003555914.1|  PREDICTED: probable protein phosphatase 2C 1...    254   5e-79    Glycine max [soybeans]
dbj|BAK06878.1|  predicted protein                                      254   6e-79    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN06682.1|  Hypothetical protein glysoja_021228                     253   2e-78    Glycine soja [wild soybean]
ref|XP_003558102.1|  PREDICTED: probable protein phosphatase 2C 33      253   2e-78    Brachypodium distachyon [annual false brome]
ref|XP_002312412.1|  phosphatase 2C family protein                      253   2e-78    
ref|XP_006344157.1|  PREDICTED: probable protein phosphatase 2C 1...    253   2e-78    Solanum tuberosum [potatoes]
ref|XP_003536672.1|  PREDICTED: probable protein phosphatase 2C 1...    253   2e-78    Glycine max [soybeans]
ref|XP_010532299.1|  PREDICTED: probable protein phosphatase 2C 1...    253   3e-78    Tarenaya hassleriana [spider flower]
ref|XP_008446622.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    253   3e-78    Cucumis melo [Oriental melon]
ref|XP_004984655.1|  PREDICTED: probable protein phosphatase 2C 3...    252   3e-78    Setaria italica
gb|AFW88634.1|  putative protein phosphatase 2C family protein          252   4e-78    
ref|NP_001149558.1|  LOC100283184                                       252   4e-78    Zea mays [maize]
gb|EEC75070.1|  hypothetical protein OsI_11197                          249   5e-78    Oryza sativa Indica Group [Indian rice]
ref|XP_006378470.1|  hypothetical protein POPTR_0010s13130g             252   5e-78    
gb|ACF87139.1|  unknown                                                 251   6e-78    Zea mays [maize]
ref|XP_007222389.1|  hypothetical protein PRUPE_ppa006061mg             251   6e-78    Prunus persica
ref|XP_009357108.1|  PREDICTED: probable protein phosphatase 2C 15      251   1e-77    Pyrus x bretschneideri [bai li]
gb|KJB31458.1|  hypothetical protein B456_005G192600                    251   1e-77    Gossypium raimondii
ref|XP_010681640.1|  PREDICTED: probable protein phosphatase 2C 15      251   1e-77    
gb|KJB31457.1|  hypothetical protein B456_005G192600                    251   1e-77    Gossypium raimondii
ref|XP_008339644.1|  PREDICTED: probable protein phosphatase 2C 15      251   1e-77    Malus domestica [apple tree]
ref|XP_011022405.1|  PREDICTED: probable protein phosphatase 2C 15      251   1e-77    Populus euphratica
ref|XP_010320753.1|  PREDICTED: probable protein phosphatase 2C 15      251   1e-77    
ref|XP_002465394.1|  hypothetical protein SORBIDRAFT_01g037810          250   2e-77    Sorghum bicolor [broomcorn]
ref|XP_004135083.1|  PREDICTED: probable protein phosphatase 2C 1...    250   3e-77    Cucumis sativus [cucumbers]
ref|NP_001049866.1|  Os03g0301700                                       250   3e-77    
ref|XP_008389261.1|  PREDICTED: probable protein phosphatase 2C 15      249   3e-77    
ref|XP_009356234.1|  PREDICTED: probable protein phosphatase 2C 15      249   4e-77    Pyrus x bretschneideri [bai li]
ref|XP_010044241.1|  PREDICTED: probable protein phosphatase 2C 15      249   5e-77    Eucalyptus grandis [rose gum]
ref|XP_011076426.1|  PREDICTED: probable protein phosphatase 2C 1...    247   6e-77    
ref|XP_008243272.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    248   1e-76    
ref|XP_011076418.1|  PREDICTED: probable protein phosphatase 2C 1...    247   2e-76    
ref|NP_001060712.1|  Os07g0690400                                       248   2e-76    
ref|XP_011076402.1|  PREDICTED: probable protein phosphatase 2C 1...    247   3e-76    Sesamum indicum [beniseed]
gb|KHG10433.1|  hypothetical protein F383_12376                         247   3e-76    Gossypium arboreum [tree cotton]
gb|EMT27882.1|  Putative protein phosphatase 2C 33                      246   5e-76    
ref|XP_010922151.1|  PREDICTED: probable protein phosphatase 2C 3       246   7e-76    Elaeis guineensis
ref|XP_008797622.1|  PREDICTED: probable protein phosphatase 2C 3       246   1e-75    Phoenix dactylifera
ref|XP_009385409.1|  PREDICTED: probable protein phosphatase 2C 3       245   1e-75    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002461259.1|  hypothetical protein SORBIDRAFT_02g043760          245   2e-75    Sorghum bicolor [broomcorn]
gb|EPS73050.1|  hypothetical protein M569_01706                         244   5e-75    Genlisea aurea
ref|XP_010099267.1|  putative protein phosphatase 2C 15                 246   7e-75    
ref|NP_001140347.1|  putative protein phosphatase 2C family protein     243   2e-74    Zea mays [maize]
ref|NP_001141091.1|  putative protein phosphatase 2C family protein     243   2e-74    Zea mays [maize]
ref|XP_003562410.1|  PREDICTED: probable protein phosphatase 2C 33      243   2e-74    Brachypodium distachyon [annual false brome]
dbj|BAJ94997.1|  predicted protein                                      242   2e-74    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAN74505.1|  hypothetical protein VITISV_015889                     241   3e-74    Vitis vinifera
gb|EMS67839.1|  putative protein phosphatase 2C 33                      239   1e-72    Triticum urartu
ref|XP_004958778.1|  PREDICTED: probable protein phosphatase 2C 3...    234   2e-71    Setaria italica
emb|CDX81511.1|  BnaC02g18150D                                          233   8e-71    
ref|NP_177008.1|  putative protein phosphatase 2C 15                    229   2e-69    Arabidopsis thaliana [mouse-ear cress]
gb|EYU30003.1|  hypothetical protein MIMGU_mgv1a006840mg                229   2e-69    Erythranthe guttata [common monkey flower]
ref|XP_002888662.1|  hypothetical protein ARALYDRAFT_894606             229   2e-69    Arabidopsis lyrata subsp. lyrata
ref|XP_010470790.1|  PREDICTED: probable protein phosphatase 2C 15      229   3e-69    Camelina sativa [gold-of-pleasure]
dbj|BAH20040.1|  AT1G68410                                              229   4e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302270.1|  hypothetical protein CARUB_v10020313mg             229   5e-69    Capsella rubella
ref|XP_010415460.1|  PREDICTED: probable protein phosphatase 2C 15      229   5e-69    Camelina sativa [gold-of-pleasure]
ref|XP_010511830.1|  PREDICTED: probable protein phosphatase 2C 15      229   5e-69    Camelina sativa [gold-of-pleasure]
gb|ABR16488.1|  unknown                                                 226   4e-68    Picea sitchensis
tpg|DAA50894.1|  TPA: putative protein phosphatase 2C family protein    229   7e-68    
ref|XP_006855339.1|  hypothetical protein AMTR_s00057p00093140          224   1e-67    Amborella trichopoda
ref|XP_008797259.1|  PREDICTED: probable protein phosphatase 2C 1...    224   2e-67    Phoenix dactylifera
ref|XP_008797258.1|  PREDICTED: probable protein phosphatase 2C 1...    224   3e-67    
ref|XP_008797257.1|  PREDICTED: probable protein phosphatase 2C 1...    225   5e-67    Phoenix dactylifera
ref|XP_009127629.1|  PREDICTED: probable protein phosphatase 2C 15      223   5e-67    Brassica rapa
emb|CDY44900.1|  BnaA02g13820D                                          223   6e-67    Brassica napus [oilseed rape]
ref|XP_006658990.1|  PREDICTED: probable protein phosphatase 2C 3...    222   9e-67    
gb|KHG19035.1|  hypothetical protein F383_08660                         221   1e-66    Gossypium arboreum [tree cotton]
ref|XP_010269263.1|  PREDICTED: probable protein phosphatase 2C 12      219   6e-66    Nelumbo nucifera [Indian lotus]
gb|AIE39589.1|  protein phosphatase 2c                                  209   1e-65    Humulus lupulus [common hop]
ref|XP_010943029.1|  PREDICTED: probable protein phosphatase 2C 1...    219   1e-65    Elaeis guineensis
ref|XP_010939443.1|  PREDICTED: probable protein phosphatase 2C 1...    219   2e-65    
ref|XP_010939442.1|  PREDICTED: probable protein phosphatase 2C 1...    219   2e-65    Elaeis guineensis
gb|AIB05857.1|  orphans transcription factor                            219   2e-65    Zea mays [maize]
ref|XP_006829727.1|  hypothetical protein AMTR_s00126p00104180          218   8e-65    
ref|NP_001151513.1|  LOC100285147                                       219   1e-64    Zea mays [maize]
ref|XP_006595966.1|  PREDICTED: probable protein phosphatase 2C 1...    214   8e-64    Glycine max [soybeans]
gb|KEH22033.1|  protein phosphatase 2C family protein                   214   9e-64    Medicago truncatula
ref|XP_003550341.1|  PREDICTED: probable protein phosphatase 2C 1...    214   1e-63    Glycine max [soybeans]
ref|XP_009409307.1|  PREDICTED: probable protein phosphatase 2C 12      214   1e-63    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010061763.1|  PREDICTED: probable protein phosphatase 2C 12      213   3e-63    Eucalyptus grandis [rose gum]
ref|XP_003545307.1|  PREDICTED: probable protein phosphatase 2C 1...    213   3e-63    Glycine max [soybeans]
ref|XP_004292819.1|  PREDICTED: probable protein phosphatase 2C 12      213   5e-63    Fragaria vesca subsp. vesca
ref|XP_009610734.1|  PREDICTED: probable protein phosphatase 2C 1...    213   6e-63    Nicotiana tomentosiformis
ref|XP_004499069.1|  PREDICTED: probable protein phosphatase 2C 1...    213   7e-63    Cicer arietinum [garbanzo]
ref|XP_002284640.1|  PREDICTED: probable protein phosphatase 2C 12      213   7e-63    Vitis vinifera
ref|XP_009401438.1|  PREDICTED: probable protein phosphatase 2C 1...    210   8e-63    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007017285.1|  Phosphatase 2C family protein isoform 1            212   9e-63    
emb|CDP01349.1|  unnamed protein product                                212   1e-62    Coffea canephora [robusta coffee]
ref|XP_004499068.1|  PREDICTED: probable protein phosphatase 2C 1...    212   1e-62    
ref|XP_002986557.1|  hypothetical protein SELMODRAFT_235036             211   1e-62    
ref|XP_007017286.1|  Phosphatase 2C family protein isoform 2            212   1e-62    
ref|XP_002979083.1|  hypothetical protein SELMODRAFT_109752             211   1e-62    
emb|CAN78409.1|  hypothetical protein VITISV_023178                     212   2e-62    Vitis vinifera
gb|KEH40042.1|  catalytic/protein phosphatase type 2C                   211   2e-62    Medicago truncatula
ref|XP_008805807.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    212   2e-62    
ref|XP_010275585.1|  PREDICTED: probable protein phosphatase 2C 12      211   2e-62    Nelumbo nucifera [Indian lotus]
ref|XP_007222388.1|  hypothetical protein PRUPE_ppa006058mg             211   2e-62    Prunus persica
ref|XP_001757865.1|  predicted protein                                  211   3e-62    
ref|XP_009413632.1|  PREDICTED: probable protein phosphatase 2C 12      211   3e-62    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002455646.1|  hypothetical protein SORBIDRAFT_03g016300          213   3e-62    Sorghum bicolor [broomcorn]
ref|XP_009380915.1|  PREDICTED: probable protein phosphatase 2C 12      211   3e-62    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008220215.1|  PREDICTED: probable protein phosphatase 2C 12      211   3e-62    Prunus mume [ume]
ref|XP_009620218.1|  PREDICTED: probable protein phosphatase 2C 12      211   4e-62    Nicotiana tomentosiformis
ref|XP_009764892.1|  PREDICTED: probable protein phosphatase 2C 1...    211   4e-62    Nicotiana sylvestris
ref|XP_011083856.1|  PREDICTED: probable protein phosphatase 2C 1...    210   4e-62    Sesamum indicum [beniseed]
ref|XP_007160841.1|  hypothetical protein PHAVU_001G021200g             210   5e-62    Phaseolus vulgaris [French bean]
emb|CDM82896.1|  unnamed protein product                                209   6e-62    Triticum aestivum [Canadian hard winter wheat]
gb|AFK36110.1|  unknown                                                 210   6e-62    Medicago truncatula
gb|AES59470.2|  catalytic/protein phosphatase type 2C                   210   6e-62    Medicago truncatula
ref|XP_010519103.1|  PREDICTED: probable protein phosphatase 2C 12      210   7e-62    Tarenaya hassleriana [spider flower]
ref|XP_002510242.1|  protein phosphatase, putative                      209   1e-61    
ref|XP_009401437.1|  PREDICTED: probable protein phosphatase 2C 1...    209   1e-61    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009781091.1|  PREDICTED: probable protein phosphatase 2C 12      209   2e-61    Nicotiana sylvestris
ref|XP_006354899.1|  PREDICTED: probable protein phosphatase 2C 1...    208   2e-61    Solanum tuberosum [potatoes]
ref|XP_004238165.1|  PREDICTED: probable protein phosphatase 2C 12      208   3e-61    Solanum lycopersicum
ref|XP_004968827.1|  PREDICTED: probable protein phosphatase 2C 3...    209   3e-61    Setaria italica
ref|XP_008393818.1|  PREDICTED: probable protein phosphatase 2C 12      208   4e-61    
ref|XP_004487674.1|  PREDICTED: probable protein phosphatase 2C 1...    207   5e-61    Cicer arietinum [garbanzo]
ref|XP_003528265.1|  PREDICTED: probable protein phosphatase 2C 1...    207   6e-61    Glycine max [soybeans]
ref|XP_010092060.1|  putative protein phosphatase 2C 12                 208   8e-61    
ref|XP_009359088.1|  PREDICTED: probable protein phosphatase 2C 12      207   8e-61    Pyrus x bretschneideri [bai li]
ref|XP_004501575.1|  PREDICTED: probable protein phosphatase 2C 1...    206   9e-61    
ref|XP_006581239.1|  PREDICTED: probable protein phosphatase 2C 1...    207   9e-61    Glycine max [soybeans]
ref|XP_009367363.1|  PREDICTED: probable protein phosphatase 2C 12      207   9e-61    Pyrus x bretschneideri [bai li]
gb|KHN22311.1|  Hypothetical protein glysoja_022067                     207   9e-61    Glycine soja [wild soybean]
gb|KDP38368.1|  hypothetical protein JCGZ_04293                         207   1e-60    Jatropha curcas
ref|XP_003567758.1|  PREDICTED: probable protein phosphatase 2C 3...    207   1e-60    Brachypodium distachyon [annual false brome]
ref|XP_010230932.1|  PREDICTED: probable protein phosphatase 2C 3...    207   1e-60    Brachypodium distachyon [annual false brome]
ref|XP_006434795.1|  hypothetical protein CICLE_v10001232mg             205   1e-60    
gb|EEC70750.1|  hypothetical protein OsI_02161                          208   1e-60    Oryza sativa Indica Group [Indian rice]
gb|KHG12192.1|  hypothetical protein F383_19798                         206   2e-60    Gossypium arboreum [tree cotton]
ref|XP_006473344.1|  PREDICTED: probable protein phosphatase 2C 1...    206   2e-60    
ref|XP_008361008.1|  PREDICTED: probable protein phosphatase 2C 12      206   2e-60    
gb|KJB58457.1|  hypothetical protein B456_009G211100                    206   3e-60    Gossypium raimondii
sp|Q0JMD4.2|P2C03_ORYSJ  RecName: Full=Probable protein phosphata...    207   3e-60    Oryza sativa Japonica Group [Japonica rice]
gb|KJB58458.1|  hypothetical protein B456_009G211100                    206   3e-60    Gossypium raimondii
ref|NP_001141493.1|  uncharacterized protein LOC100273605               206   3e-60    Zea mays [maize]
ref|XP_006473342.1|  PREDICTED: probable protein phosphatase 2C 1...    206   3e-60    Citrus sinensis [apfelsine]
ref|XP_006374959.1|  phosphatase 2C family protein                      205   4e-60    Populus trichocarpa [western balsam poplar]
ref|XP_006393585.1|  hypothetical protein EUTSA_v10011502mg             205   5e-60    Eutrema salsugineum [saltwater cress]
gb|EYU25409.1|  hypothetical protein MIMGU_mgv1a006684mg                205   5e-60    Erythranthe guttata [common monkey flower]
ref|XP_002894042.1|  hypothetical protein ARALYDRAFT_473885             205   5e-60    
ref|XP_011030187.1|  PREDICTED: probable protein phosphatase 2C 12      205   5e-60    Populus euphratica
ref|XP_007136673.1|  hypothetical protein PHAVU_009G064200g             205   5e-60    Phaseolus vulgaris [French bean]
gb|KJB58459.1|  hypothetical protein B456_009G211100                    206   7e-60    Gossypium raimondii
ref|XP_006578017.1|  PREDICTED: probable protein phosphatase 2C 1...    202   7e-60    Glycine max [soybeans]
ref|XP_008452538.1|  PREDICTED: probable protein phosphatase 2C 1...    204   8e-60    Cucumis melo [Oriental melon]
ref|XP_006434797.1|  hypothetical protein CICLE_v10001232mg             204   9e-60    Citrus clementina [clementine]
ref|XP_008452534.1|  PREDICTED: probable protein phosphatase 2C 1...    204   1e-59    Cucumis melo [Oriental melon]
gb|EYU36299.1|  hypothetical protein MIMGU_mgv1a006731mg                204   1e-59    Erythranthe guttata [common monkey flower]
ref|XP_010479140.1|  PREDICTED: probable protein phosphatase 2C 12      204   1e-59    Camelina sativa [gold-of-pleasure]
ref|XP_011016491.1|  PREDICTED: probable protein phosphatase 2C 12      204   1e-59    Populus euphratica
ref|XP_011017216.1|  PREDICTED: probable protein phosphatase 2C 12      204   1e-59    Populus euphratica
ref|XP_002302440.2|  phosphatase 2C family protein                      204   2e-59    Populus trichocarpa [western balsam poplar]
ref|XP_004141247.1|  PREDICTED: probable protein phosphatase 2C 1...    204   2e-59    Cucumis sativus [cucumbers]
ref|XP_010500262.1|  PREDICTED: probable protein phosphatase 2C 12      203   2e-59    Camelina sativa [gold-of-pleasure]
ref|XP_010461537.1|  PREDICTED: probable protein phosphatase 2C 12      203   2e-59    Camelina sativa [gold-of-pleasure]
ref|NP_564504.1|  putative protein phosphatase 2C 12                    203   3e-59    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006645937.1|  PREDICTED: probable protein phosphatase 2C 3...    202   3e-59    Oryza brachyantha
ref|XP_004242956.1|  PREDICTED: probable protein phosphatase 2C 12      203   3e-59    Solanum lycopersicum
ref|XP_003603027.1|  hypothetical protein MTR_3g101540                  202   4e-59    Medicago truncatula
gb|KEH35748.1|  catalytic/protein phosphatase type 2C                   202   4e-59    Medicago truncatula
ref|XP_002462493.1|  hypothetical protein SORBIDRAFT_02g026710          202   5e-59    Sorghum bicolor [broomcorn]
ref|XP_003523598.2|  PREDICTED: probable protein phosphatase 2C 1...    202   5e-59    Glycine max [soybeans]
ref|XP_006307585.1|  hypothetical protein CARUB_v10009209mg             202   6e-59    
ref|XP_006307584.1|  hypothetical protein CARUB_v10009209mg             202   6e-59    
ref|NP_001063382.1|  Os09g0459600                                       202   7e-59    
ref|XP_010539072.1|  PREDICTED: probable protein phosphatase 2C 1...    202   7e-59    Tarenaya hassleriana [spider flower]
gb|EPS63832.1|  hypothetical protein M569_10947                         203   7e-59    Genlisea aurea
ref|XP_009107427.1|  PREDICTED: probable protein phosphatase 2C 12      202   8e-59    Brassica rapa
emb|CDY17018.1|  BnaA08g03820D                                          202   8e-59    Brassica napus [oilseed rape]
ref|XP_011074446.1|  PREDICTED: probable protein phosphatase 2C 12      202   9e-59    Sesamum indicum [beniseed]
emb|CDY71436.1|  BnaA05g35860D                                          197   1e-58    Brassica napus [oilseed rape]
emb|CDY25664.1|  BnaC05g25430D                                          198   1e-58    Brassica napus [oilseed rape]
ref|XP_010539071.1|  PREDICTED: probable protein phosphatase 2C 1...    202   1e-58    Tarenaya hassleriana [spider flower]
gb|AAK92805.1|  unknown protein                                         201   1e-58    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008805255.1|  PREDICTED: probable protein phosphatase 2C 12      201   1e-58    Phoenix dactylifera
ref|XP_010667515.1|  PREDICTED: probable protein phosphatase 2C 12      201   3e-58    Beta vulgaris subsp. vulgaris [field beet]
gb|KHN04510.1|  Hypothetical protein glysoja_019597                     202   3e-58    
emb|CDY17840.1|  BnaC08g04540D                                          200   3e-58    
gb|EPS58058.1|  hypothetical protein M569_16758                         194   4e-58    
emb|CDY06741.1|  BnaA10g05200D                                          200   4e-58    
ref|XP_009118925.1|  PREDICTED: probable protein phosphatase 2C 12      200   4e-58    
gb|KJB63822.1|  hypothetical protein B456_010G018200                    200   5e-58    
ref|XP_004957026.1|  PREDICTED: probable protein phosphatase 2C 6...    199   7e-58    
ref|XP_009145043.1|  PREDICTED: probable protein phosphatase 2C 1...    199   8e-58    
gb|EAZ09387.1|  hypothetical protein OsI_31661                          199   9e-58    
ref|XP_009145042.1|  PREDICTED: probable protein phosphatase 2C 1...    198   2e-57    
emb|CDY43845.1|  BnaA05g18570D                                          198   2e-57    
gb|KJB29497.1|  hypothetical protein B456_005G103200                    197   7e-57    
gb|KJB29498.1|  hypothetical protein B456_005G103200                    197   7e-57    
emb|CDY17078.1|  BnaC06g00110D                                          196   1e-56    
ref|XP_007205238.1|  hypothetical protein PRUPE_ppa006100mg             194   2e-56    
gb|ACN27245.1|  unknown                                                 189   4e-56    
ref|XP_004975776.1|  PREDICTED: probable protein phosphatase 2C 4...    192   4e-55    
gb|EEC73439.1|  hypothetical protein OsI_07726                          192   4e-55    
ref|NP_001047178.1|  Os02g0567200                                       192   4e-55    
gb|AAK52556.1|AC079853_9  Unknown protein                               192   6e-55    
ref|XP_002467747.1|  hypothetical protein SORBIDRAFT_01g033320          192   6e-55    
ref|XP_003578238.1|  PREDICTED: probable protein phosphatase 2C 69      192   8e-55    
gb|EMT18728.1|  Putative protein phosphatase 2C 15                      190   9e-55    
ref|XP_004952709.1|  PREDICTED: probable protein phosphatase 2C 1...    192   9e-55    
ref|XP_003589219.1|  Protein phosphatase 2C-like protein                192   1e-54    
ref|XP_004952708.1|  PREDICTED: probable protein phosphatase 2C 1...    191   1e-54    
gb|EMS66083.1|  putative protein phosphatase 2C 15                      189   2e-54    
ref|XP_002454036.1|  hypothetical protein SORBIDRAFT_04g023510          191   2e-54    
ref|XP_003575194.1|  PREDICTED: probable protein phosphatase 2C 15      190   4e-54    
ref|XP_001762099.1|  predicted protein                                  188   4e-54    
gb|AAO38849.1|  calmodulin-binding protein phosphatase                  188   5e-54    
dbj|BAK04527.1|  predicted protein                                      189   5e-54    
ref|XP_006651470.1|  PREDICTED: probable protein phosphatase 2C 1...    189   6e-54    
ref|XP_006660705.1|  PREDICTED: probable protein phosphatase 2C 6...    188   6e-54    
ref|XP_010228539.1|  PREDICTED: probable protein phosphatase 2C 1...    189   8e-54    
tpg|DAA41820.1|  TPA: putative protein phosphatase 2C family protein    180   1e-53    
ref|XP_004984130.1|  PREDICTED: probable protein phosphatase 2C 1...    189   1e-53    
ref|XP_010228538.1|  PREDICTED: probable protein phosphatase 2C 1...    189   1e-53    
ref|XP_001751630.1|  predicted protein                                  187   1e-53    
ref|XP_010916634.1|  PREDICTED: probable protein phosphatase 2C 12      188   2e-53    
gb|EPS59533.1|  hypothetical protein M569_15272                         187   3e-53    
ref|NP_001146789.1|  putative protein phosphatase 2C family protein     187   4e-53    
ref|XP_008658741.1|  PREDICTED: ca2+/calmodulin-dependent protein...    187   4e-53    
ref|XP_008658740.1|  PREDICTED: ca2+/calmodulin-dependent protein...    187   4e-53    
tpg|DAA37566.1|  TPA: putative protein phosphatase 2C family protein    186   5e-53    
ref|XP_008658742.1|  PREDICTED: ca2+/calmodulin-dependent protein...    187   5e-53    
ref|NP_001149520.1|  catalytic/ protein phosphatase type 2C             186   8e-53    
ref|XP_004984131.1|  PREDICTED: probable protein phosphatase 2C 1...    186   8e-53    
gb|ACL54158.1|  unknown                                                 186   9e-53    
ref|NP_001170543.1|  putative protein phosphatase 2C family protein     186   1e-52    
ref|XP_008658738.1|  PREDICTED: ca2+/calmodulin-dependent protein...    187   1e-52    
ref|XP_008646497.1|  PREDICTED: putative protein phosphatase 2C f...    186   1e-52    
ref|XP_008658739.1|  PREDICTED: ca2+/calmodulin-dependent protein...    187   1e-52    
ref|XP_008646491.1|  PREDICTED: putative protein phosphatase 2C f...    186   2e-52    
gb|ACN33405.1|  unknown                                                 185   2e-52    
gb|EMT20440.1|  Putative protein phosphatase 2C 12                      182   1e-51    
ref|XP_001753835.1|  predicted protein                                  181   1e-51    
ref|XP_010906997.1|  PREDICTED: probable protein phosphatase 2C 3...    181   2e-51    
ref|XP_008677565.1|  PREDICTED: uncharacterized protein LOC100382...    182   2e-51    
ref|NP_001152457.1|  Ca2+/calmodulin-dependent protein kinase pho...    182   2e-51    
emb|CAN76446.1|  hypothetical protein VITISV_010117                     188   3e-51    
ref|XP_008677561.1|  PREDICTED: uncharacterized protein LOC100382...    182   5e-51    
emb|CDP00657.1|  unnamed protein product                                181   5e-51    
ref|XP_002961331.1|  hypothetical protein SELMODRAFT_33326              176   3e-50    
ref|XP_009588474.1|  PREDICTED: probable protein phosphatase 2C 3...    177   7e-50    
ref|XP_009767028.1|  PREDICTED: probable protein phosphatase 2C 3...    177   9e-50    
ref|XP_009588473.1|  PREDICTED: probable protein phosphatase 2C 3...    176   2e-49    
ref|XP_009767026.1|  PREDICTED: probable protein phosphatase 2C 3...    176   3e-49    
ref|XP_006648761.1|  PREDICTED: probable protein phosphatase 2C 1...    176   4e-49    
gb|KDO84217.1|  hypothetical protein CISIN_1g045195mg                   176   5e-49    
ref|XP_001759688.1|  predicted protein                                  175   1e-48    
dbj|BAK00932.1|  predicted protein                                      175   2e-48    
ref|XP_003581291.1|  PREDICTED: probable protein phosphatase 2C 4...    174   3e-48    
gb|EEC77369.1|  hypothetical protein OsI_16091                          174   3e-48    
ref|XP_010239966.1|  PREDICTED: probable protein phosphatase 2C 4...    174   4e-48    
sp|Q7XTC7.3|P2C40_ORYSJ  RecName: Full=Probable protein phosphata...    174   4e-48    
gb|EMT30108.1|  Putative protein phosphatase 2C 3                       171   3e-47    
ref|XP_009610735.1|  PREDICTED: probable protein phosphatase 2C 1...    168   3e-46    
emb|CAH67094.1|  H0818E04.11                                            169   5e-46    
ref|XP_001781498.1|  predicted protein                                  167   9e-46    
emb|CAE01570.2|  OSJNBa0064H22.20                                       167   1e-45    
ref|XP_009764893.1|  PREDICTED: probable protein phosphatase 2C 1...    166   2e-45    
ref|XP_010943030.1|  PREDICTED: probable protein phosphatase 2C 1...    163   2e-44    
gb|EMT17740.1|  Putative protein phosphatase 2C 33                      163   6e-44    
gb|KHG12193.1|  hypothetical protein F383_19798                         161   7e-44    
ref|NP_001151313.1|  catalytic/ protein phosphatase type 2C             161   3e-43    
ref|XP_006653467.1|  PREDICTED: probable protein phosphatase 2C 4...    161   3e-43    
ref|XP_002442567.1|  hypothetical protein SORBIDRAFT_08g022065          156   7e-42    
ref|XP_010259436.1|  PREDICTED: probable protein phosphatase 2C 5...    154   3e-41    
ref|XP_006578015.1|  PREDICTED: probable protein phosphatase 2C 1...    153   9e-41    
ref|XP_006578014.1|  PREDICTED: probable protein phosphatase 2C 1...    153   9e-41    
ref|XP_008651098.1|  PREDICTED: uncharacterized protein LOC100273...    149   3e-39    
gb|KEH43094.1|  protein phosphatase 2C family protein                   146   2e-38    
ref|XP_011083858.1|  PREDICTED: probable protein phosphatase 2C 1...    146   2e-38    
ref|XP_006448422.1|  hypothetical protein CICLE_v10018105mg             144   1e-37    
ref|XP_004495681.1|  PREDICTED: probable protein phosphatase 2C 5...    142   4e-37    
gb|EMT09218.1|  Putative protein phosphatase 2C 69                      143   6e-37    
ref|NP_001168732.1|  uncharacterized protein LOC100382524               136   2e-36    
ref|XP_006649947.1|  PREDICTED: probable protein phosphatase 2C 3...    141   2e-36    
tpg|DAA54619.2|  TPA: putative protein phosphatase 2C family protein    132   7e-35    
gb|EEE61087.1|  hypothetical protein OsJ_14978                          137   1e-34    
gb|ACR38631.1|  unknown                                                 134   3e-34    
gb|ACN31161.1|  unknown                                                 132   4e-34    
dbj|BAJ89158.1|  predicted protein                                      132   3e-33    
ref|XP_011083857.1|  PREDICTED: probable protein phosphatase 2C 1...    132   8e-33    
gb|EMS59956.1|  putative protein phosphatase 2C 40                      131   2e-32    
ref|XP_011083859.1|  PREDICTED: probable protein phosphatase 2C 1...    130   3e-32    
ref|XP_008666815.1|  PREDICTED: probable protein phosphatase 2C 33      125   3e-32    
gb|ACF85382.1|  unknown                                                 129   5e-32    
ref|XP_006469091.1|  PREDICTED: probable protein phosphatase 2C 3...    125   1e-30    
gb|EMS65150.1|  putative protein phosphatase 2C 69                      124   7e-30    
emb|CAN67033.1|  hypothetical protein VITISV_001570                     126   1e-29    
gb|AAS21019.1|  protein phosphatase 2C-like protein                     116   3e-29    
emb|CDX95002.1|  BnaC05g06690D                                          116   2e-27    
ref|XP_006448420.1|  hypothetical protein CICLE_v10018331mg             111   2e-25    
ref|XP_002440959.1|  hypothetical protein SORBIDRAFT_09g017870          101   7e-23    
ref|XP_006578016.1|  PREDICTED: probable protein phosphatase 2C 1...  99.0    4e-21    
ref|XP_006581240.1|  PREDICTED: probable protein phosphatase 2C 1...  98.6    7e-21    
ref|XP_002467711.1|  hypothetical protein SORBIDRAFT_01g032916        85.9    3e-18    
gb|KDO76916.1|  hypothetical protein CISIN_1g036522mg                 85.9    4e-18    
gb|KCW86126.1|  hypothetical protein EUGRSUZ_B02819                   82.8    2e-16    
emb|CDY12670.1|  BnaA02g13380D                                        79.0    3e-14    
emb|CDY32568.1|  BnaC02g17610D                                        78.2    5e-14    
ref|XP_005649410.1|  protein serine/threonine phosphatase 2C          79.7    1e-13    
ref|XP_011464236.1|  PREDICTED: probable protein phosphatase 2C 14    79.3    1e-13    
ref|XP_007044826.1|  Phosphatase 2C family protein, putative          77.4    3e-13    
ref|XP_009127582.1|  PREDICTED: probable protein phosphatase 2C 14    77.0    3e-13    
ref|XP_011004862.1|  PREDICTED: probable protein phosphatase 2C 74    75.1    6e-13    
ref|XP_005645754.1|  protein serine/threonine phosphatase 2C          77.4    7e-13    
gb|KDO82206.1|  hypothetical protein CISIN_1g014607mg                 75.5    1e-12    
ref|XP_006376177.1|  hypothetical protein POPTR_0013s10540g           75.5    1e-12    
ref|XP_002503962.1|  predicted protein                                74.3    2e-12    
ref|XP_010100415.1|  putative protein phosphatase 2C 14               75.5    2e-12    
emb|CDY54996.1|  BnaCnng27940D                                        75.1    2e-12    
ref|XP_006391215.1|  hypothetical protein EUTSA_v10018643mg           74.7    2e-12    
ref|XP_009404835.1|  PREDICTED: probable protein phosphatase 2C 74    74.7    3e-12    
gb|ADE76312.1|  unknown                                               73.9    3e-12    
ref|XP_006355649.1|  PREDICTED: probable protein phosphatase 2C 2...  74.3    3e-12    
ref|XP_006438241.1|  hypothetical protein CICLE_v10033904mg           74.3    3e-12    
ref|XP_006411271.1|  hypothetical protein EUTSA_v10017681mg           73.9    4e-12    
ref|XP_011012742.1|  PREDICTED: probable protein phosphatase 2C 74    73.6    4e-12    
ref|XP_010517433.1|  PREDICTED: probable protein phosphatase 2C 30    73.9    4e-12    
emb|CDP13235.1|  unnamed protein product                              73.9    4e-12    
ref|XP_006294355.1|  hypothetical protein CARUB_v10023372mg           73.9    4e-12    
ref|XP_002313987.2|  phosphatase 2C family protein                    73.9    5e-12    
ref|XP_011398457.1|  putative protein phosphatase 2C 5                73.9    5e-12    
ref|XP_006484324.1|  PREDICTED: uncharacterized protein LOC102618638  73.9    8e-12    
ref|XP_005848917.1|  hypothetical protein CHLNCDRAFT_57515            73.9    9e-12    
ref|XP_006301069.1|  hypothetical protein CARUB_v10021462mg           72.8    9e-12    
ref|XP_002879851.1|  predicted protein                                72.4    1e-11    
ref|XP_008351057.1|  PREDICTED: probable protein phosphatase 2C 14    73.6    1e-11    
ref|XP_010930504.1|  PREDICTED: probable protein phosphatase 2C 74    72.8    1e-11    
ref|XP_007221581.1|  hypothetical protein PRUPE_ppa006075mg           72.4    1e-11    
ref|XP_011398946.1|  putative protein phosphatase 2C 15               72.8    2e-11    
ref|XP_011071154.1|  PREDICTED: probable protein phosphatase 2C 14    72.4    2e-11    
ref|XP_010556208.1|  PREDICTED: probable protein phosphatase 2C 14    72.0    2e-11    
ref|XP_004239946.1|  PREDICTED: putative protein phosphatase 2C 53    72.0    2e-11    
ref|XP_008390094.1|  PREDICTED: uncharacterized protein LOC103452380  72.8    2e-11    
ref|XP_002530041.1|  protein phosphatase 2c, putative                 72.4    2e-11    
ref|NP_176948.2|  putative protein phosphatase 2C 14                  72.0    2e-11    
ref|XP_006425095.1|  hypothetical protein CICLE_v10028590mg           70.1    4e-11    
gb|KDP26688.1|  hypothetical protein JCGZ_17846                       71.2    4e-11    
ref|XP_008775736.1|  PREDICTED: probable protein phosphatase 2C 74    70.5    4e-11    
ref|XP_002987740.1|  hypothetical protein SELMODRAFT_13828            70.1    4e-11    
gb|EMT22607.1|  hypothetical protein F775_52099                       68.9    5e-11    
ref|XP_010505742.1|  PREDICTED: probable protein phosphatase 2C 3...  70.9    5e-11    
ref|XP_009421195.1|  PREDICTED: probable protein phosphatase 2C 74    70.9    5e-11    
ref|XP_008221896.1|  PREDICTED: uncharacterized protein LOC103321834  71.2    6e-11    
ref|XP_009133419.1|  PREDICTED: probable protein phosphatase 2C 30    70.1    6e-11    
ref|XP_005646780.1|  protein phosphatase 2C catalytic subunit         69.3    6e-11    
emb|CDY68434.1|  BnaA03g56500D                                        70.1    7e-11    
gb|ABR16214.1|  unknown                                               70.5    7e-11    
ref|XP_010505741.1|  PREDICTED: probable protein phosphatase 2C 3...  70.1    7e-11    
ref|NP_001086890.1|  integrin-linked kinase-associated serine/thr...  69.7    8e-11    
ref|XP_009411435.1|  PREDICTED: probable protein phosphatase 2C 74    69.3    9e-11    
ref|XP_010062371.1|  PREDICTED: probable protein phosphatase 2C 2     70.1    9e-11    
ref|XP_010682310.1|  PREDICTED: uncharacterized protein LOC104897184  70.9    9e-11    
ref|XP_008806972.1|  PREDICTED: probable protein phosphatase 2C 74    70.1    9e-11    
ref|XP_010508896.1|  PREDICTED: probable protein phosphatase 2C 30    69.7    1e-10    
emb|CDY53665.1|  BnaA05g34520D                                        69.7    1e-10    
ref|XP_004136842.1|  PREDICTED: probable protein phosphatase 2C 5...  68.9    1e-10    
gb|KCW69505.1|  hypothetical protein EUGRSUZ_F02951                   69.7    1e-10    
ref|XP_006425096.1|  hypothetical protein CICLE_v10028590mg           69.7    1e-10    
ref|XP_006425097.1|  hypothetical protein CICLE_v10028590mg           69.7    1e-10    
ref|XP_002272594.2|  PREDICTED: probable protein phosphatase 2C 25    69.3    1e-10    
gb|KDO37031.1|  hypothetical protein CISIN_1g015832mg                 69.3    1e-10    
ref|XP_006488551.1|  PREDICTED: probable protein phosphatase 2C 2...  69.7    1e-10    
gb|KDO37030.1|  hypothetical protein CISIN_1g015832mg                 69.7    1e-10    
ref|XP_008455279.1|  PREDICTED: probable protein phosphatase 2C 58    68.6    1e-10    
gb|AAP53708.1|  hypothetical protein LOC_Os10g26850                   67.0    2e-10    
gb|ABK22245.1|  unknown                                               68.9    2e-10    
ref|XP_009404295.1|  PREDICTED: probable protein phosphatase 2C 74    68.9    2e-10    
ref|XP_010554672.1|  PREDICTED: probable protein phosphatase 2C 30    68.9    2e-10    
ref|XP_003062125.1|  predicted protein                                69.7    2e-10    
ref|XP_010511746.1|  PREDICTED: probable protein phosphatase 2C 14    68.9    2e-10    
ref|XP_002525508.1|  protein phosphatase 2c, putative                 68.9    2e-10    
ref|XP_007237966.1|  PREDICTED: integrin-linked kinase-associated...  68.2    3e-10    
ref|XP_010248684.1|  PREDICTED: uncharacterized protein LOC104591523  69.3    3e-10    
gb|EYU20031.1|  hypothetical protein MIMGU_mgv1a007363mg              68.6    3e-10    
ref|XP_004155465.1|  PREDICTED: probable protein phosphatase 2C 5...  67.4    3e-10    
ref|XP_009800621.1|  PREDICTED: probable protein phosphatase 2C 1...  68.6    3e-10    
ref|XP_002887147.1|  hypothetical protein ARALYDRAFT_339024           68.2    4e-10    
tpg|DAA51587.1|  TPA: hypothetical protein ZEAMMB73_095588            68.6    4e-10    
ref|XP_002987519.1|  hypothetical protein SELMODRAFT_13829            67.4    4e-10    
ref|XP_009290265.1|  PREDICTED: integrin-linked kinase-associated...  65.9    4e-10    
ref|XP_011003940.1|  PREDICTED: probable protein phosphatase 2C 25    67.8    4e-10    
ref|XP_010044563.1|  PREDICTED: probable protein phosphatase 2C 14    68.2    4e-10    
gb|KDP45605.1|  hypothetical protein JCGZ_17212                       67.4    4e-10    
gb|EEE56316.1|  hypothetical protein OsJ_05402                        67.4    5e-10    
ref|XP_010487195.1|  PREDICTED: probable protein phosphatase 2C 2     67.8    5e-10    
emb|CAB61839.1|  putative serine/threonine phosphatase type 2c        66.6    5e-10    
ref|XP_004307665.1|  PREDICTED: probable protein phosphatase 2C 25    67.8    5e-10    
gb|KGN63074.1|  hypothetical protein Csa_2G401340                     67.8    5e-10    
gb|KFK41198.1|  hypothetical protein AALP_AA2G098200                  67.8    5e-10    
gb|KHG03774.1|  hypothetical protein F383_27984                       67.8    5e-10    
ref|NP_001025667.1|  integrin-linked kinase-associated serine/thr...  67.4    6e-10    
ref|XP_008457358.1|  PREDICTED: probable protein phosphatase 2C 25    67.4    6e-10    
ref|XP_007435532.1|  PREDICTED: integrin-linked kinase-associated...  66.6    6e-10    
ref|XP_011024932.1|  PREDICTED: probable protein phosphatase 2C 25    67.4    6e-10    
ref|XP_004138664.1|  PREDICTED: probable protein phosphatase 2C 3...  67.4    7e-10    
ref|XP_009631459.1|  PREDICTED: probable protein phosphatase 2C 25    67.4    7e-10    



>ref|XP_009799456.1| PREDICTED: probable protein phosphatase 2C 5 [Nicotiana sylvestris]
Length=428

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/176 (90%), Positives = 163/176 (93%), Gaps = 2/176 (1%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MSEAE+T  KQK TPV  PLGTLIGRELRN  KVE+PT+KYGQAALAKKGEDYFLIKPDC
Sbjct  1    MSEAEITRMKQKTTPV--PLGTLIGRELRNNDKVEQPTLKYGQAALAKKGEDYFLIKPDC  58

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QRI G+  TSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQG  REEWLQALPRALVA
Sbjct  59   QRIPGNPLTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGSSREEWLQALPRALVA  118

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQKGETSGTTVTFVVID WT+TVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  119  GFVKTDIEFQQKGETSGTTVTFVVIDGWTITVASVGDSRCILDTQGGVVSLLTVDH  174



>ref|XP_009599009.1| PREDICTED: probable protein phosphatase 2C 5 [Nicotiana tomentosiformis]
Length=428

 Score =   317 bits (812),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 157/176 (89%), Positives = 163/176 (93%), Gaps = 2/176 (1%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MSEAE+T  KQK TPV  PLGTLIGRELRN  KVE+PT+KYGQAALAKKGEDYFLIK DC
Sbjct  1    MSEAEITRMKQKTTPV--PLGTLIGRELRNNDKVEQPTLKYGQAALAKKGEDYFLIKLDC  58

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QRI G+  TSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQG+ REEWLQALPRALVA
Sbjct  59   QRIPGNPLTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGISREEWLQALPRALVA  118

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQKGETSGTTVTFVVID WT+TVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  119  GFVKTDIEFQQKGETSGTTVTFVVIDGWTITVASVGDSRCILDTQGGVVSLLTVDH  174



>ref|XP_011092109.1| PREDICTED: probable protein phosphatase 2C 5 [Sesamum indicum]
Length=428

 Score =   311 bits (797),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 163/176 (93%), Gaps = 3/176 (2%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS+ EV+  KQK  PV  PLGTLIGRELRNE K+EKPTVKYGQAALAKKGEDYFLIKPDC
Sbjct  1    MSQTEVSNMKQKQQPV--PLGTLIGRELRNE-KLEKPTVKYGQAALAKKGEDYFLIKPDC  57

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QR+ G+ +TSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQ L REEWLQALPRALVA
Sbjct  58   QRVPGNPSTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQTLEREEWLQALPRALVA  117

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQ+GETSGTTVTFVVID WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  118  GFVKTDIEFQQRGETSGTTVTFVVIDGWTVTVASVGDSRCILDTQGGVVSLLTVDH  173



>ref|XP_004230274.1| PREDICTED: probable protein phosphatase 2C 5 [Solanum lycopersicum]
 ref|XP_010313289.1| PREDICTED: probable protein phosphatase 2C 5 [Solanum lycopersicum]
 ref|XP_010313296.1| PREDICTED: probable protein phosphatase 2C 5 [Solanum lycopersicum]
Length=427

 Score =   305 bits (782),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 162/176 (92%), Gaps = 3/176 (2%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MSEAE+T  KQ  T V+  LGTLIGRELRN+ KVE+PT+KYGQAALAKKGED FLIKPDC
Sbjct  1    MSEAEITKMKQNATSVS--LGTLIGRELRND-KVEQPTIKYGQAALAKKGEDCFLIKPDC  57

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QRI G+  TSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIP+G+ REEWLQALPRALVA
Sbjct  58   QRIPGNPLTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPEGISREEWLQALPRALVA  117

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQKGETSGTTVTFVVID WT+TVASVGDSRCILDTQGGV+SLLTVDH
Sbjct  118  GFVKTDIEFQQKGETSGTTVTFVVIDGWTITVASVGDSRCILDTQGGVISLLTVDH  173



>ref|XP_010259435.1| PREDICTED: probable protein phosphatase 2C 5 isoform X2 [Nelumbo 
nucifera]
Length=357

 Score =   301 bits (771),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 157/176 (89%), Gaps = 4/176 (2%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS  E++  +    P  VPL TLIGRELRN  K EKP+++YGQAALAKKGEDYFLIKPDC
Sbjct  1    MSRTEISRMR----PPLVPLATLIGRELRNSDKTEKPSIRYGQAALAKKGEDYFLIKPDC  56

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QRI G+  +SFSVFAIFDGHNGISAAIFAKENLLN+V+SAIPQG+ REEWLQALPRALVA
Sbjct  57   QRIPGNPASSFSVFAIFDGHNGISAAIFAKENLLNHVMSAIPQGISREEWLQALPRALVA  116

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQ+KGETSGTTVTFVVID WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  117  GFVKTDIEFQRKGETSGTTVTFVVIDGWTVTVASVGDSRCILDTQGGVVSLLTVDH  172



>ref|XP_010245443.1| PREDICTED: probable protein phosphatase 2C 5 [Nelumbo nucifera]
 ref|XP_010245444.1| PREDICTED: probable protein phosphatase 2C 5 [Nelumbo nucifera]
 ref|XP_010245446.1| PREDICTED: probable protein phosphatase 2C 5 [Nelumbo nucifera]
Length=428

 Score =   303 bits (776),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 163/176 (93%), Gaps = 4/176 (2%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS  EV++ +   +P+ VPLGTLIGRELRN  K+EKP+V+YGQAALAKKGEDYFLIKPDC
Sbjct  1    MSRTEVSIMR---SPL-VPLGTLIGRELRNSEKIEKPSVRYGQAALAKKGEDYFLIKPDC  56

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QR+ G+ ++SFSVFAIFDGHNGISAAIFAKENLLN+V+SAIPQG+ REEWLQALPRALVA
Sbjct  57   QRLPGNPSSSFSVFAIFDGHNGISAAIFAKENLLNHVMSAIPQGIPREEWLQALPRALVA  116

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQ+KGETSGTTVTFVVID WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  117  GFVKTDIEFQRKGETSGTTVTFVVIDGWTVTVASVGDSRCILDTQGGVVSLLTVDH  172



>gb|KHG06373.1| hypothetical protein F383_32810 [Gossypium arboreum]
Length=428

 Score =   302 bits (774),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 159/176 (90%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS+AEV   K    P  VPL TLIGRELRNE KVEKP VKYGQAALAKKGEDYFL+KPDC
Sbjct  1    MSQAEVLRMK----PPLVPLATLIGRELRNE-KVEKPFVKYGQAALAKKGEDYFLVKPDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QRI G+  +SFSVFAIFDGHNGISAAIFAKENLL+NVLSAIPQG+ REEWLQALPRALVA
Sbjct  56   QRIPGNPASSFSVFAIFDGHNGISAAIFAKENLLSNVLSAIPQGISREEWLQALPRALVA  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQ+GETSGTTVTFVVID WTVTVASVGDSRCILDTQGG+VSLLTVDH
Sbjct  116  GFVKTDIEFQQRGETSGTTVTFVVIDGWTVTVASVGDSRCILDTQGGIVSLLTVDH  171



>gb|KJB26349.1| hypothetical protein B456_004G237900 [Gossypium raimondii]
Length=304

 Score =   298 bits (762),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 158/176 (90%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS+AEV   K    P  VPL TLIGRELRNE KVEKP VKYGQAALAKKGEDYFL+K DC
Sbjct  1    MSQAEVLRMK----PPLVPLATLIGRELRNE-KVEKPFVKYGQAALAKKGEDYFLVKLDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QRI G+  TSFSVFAIFDGHNGISAAIFAKENLL+N+LSAIPQG+ REEWLQALPRALVA
Sbjct  56   QRIPGNPATSFSVFAIFDGHNGISAAIFAKENLLSNILSAIPQGISREEWLQALPRALVA  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQ+GETSGTTVTFVVID WTVTVASVGDSRCILDTQGG+VSLLTVDH
Sbjct  116  GFVKTDIEFQQRGETSGTTVTFVVIDAWTVTVASVGDSRCILDTQGGIVSLLTVDH  171



>ref|XP_002282985.1| PREDICTED: probable protein phosphatase 2C 5 [Vitis vinifera]
 emb|CBI39560.3| unnamed protein product [Vitis vinifera]
Length=430

 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 158/176 (90%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MSE EV+  K       VPL TLIGRELRNE KVEKP +KYGQAALAKKGEDYFLIK DC
Sbjct  1    MSETEVSRMKSS----LVPLATLIGRELRNE-KVEKPYIKYGQAALAKKGEDYFLIKTDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QR+ G+ +TSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQG+GRE WLQALPRALVA
Sbjct  56   QRVPGNPSTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGIGREGWLQALPRALVA  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQKGETSGTTVTFVVID WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  116  GFVKTDIEFQQKGETSGTTVTFVVIDGWTVTVASVGDSRCILDTQGGVVSLLTVDH  171



>ref|XP_009626600.1| PREDICTED: probable protein phosphatase 2C 5 [Nicotiana tomentosiformis]
Length=427

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 160/176 (91%), Gaps = 3/176 (2%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS  EVT  KQK  PV  PLGTLI RELR+++ VEKPTVKYGQA LAKKGEDYFL+KPDC
Sbjct  1    MSGTEVTRMKQKAAPV--PLGTLISRELRSDN-VEKPTVKYGQAGLAKKGEDYFLVKPDC  57

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QRI+G+++TSFSVFAI DGHNGISAAIF KENLLNNVLSAIPQGL REEWLQALPRALVA
Sbjct  58   QRITGNTSTSFSVFAILDGHNGISAAIFTKENLLNNVLSAIPQGLDREEWLQALPRALVA  117

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQKGETSGTTVTFVVID WT+TVASVGDSRCILDTQ GVVSLLTVDH
Sbjct  118  GFVKTDIEFQQKGETSGTTVTFVVIDGWTITVASVGDSRCILDTQEGVVSLLTVDH  173



>ref|XP_007031084.1| Phosphatase 2C family protein [Theobroma cacao]
 gb|EOY11586.1| Phosphatase 2C family protein [Theobroma cacao]
Length=428

 Score =   301 bits (771),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 160/176 (91%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS+AEV+  K    P  VPL TLIGRELRNE KVEKP VK+GQAALAKKGEDYFL+KPDC
Sbjct  1    MSQAEVSRMK----PPLVPLATLIGRELRNE-KVEKPFVKFGQAALAKKGEDYFLVKPDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QR+ G+  T+FSVFAIFDGHNGISAAIFAKENLL+NVLSAIPQG+ REEWLQALPRALVA
Sbjct  56   QRVPGNPATTFSVFAIFDGHNGISAAIFAKENLLSNVLSAIPQGISREEWLQALPRALVA  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQ+GETSGTTVTFVVID WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  116  GFVKTDIEFQQRGETSGTTVTFVVIDGWTVTVASVGDSRCILDTQGGVVSLLTVDH  171



>ref|XP_010259431.1| PREDICTED: probable protein phosphatase 2C 5 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010259432.1| PREDICTED: probable protein phosphatase 2C 5 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010259433.1| PREDICTED: probable protein phosphatase 2C 5 isoform X1 [Nelumbo 
nucifera]
Length=432

 Score =   301 bits (770),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 157/176 (89%), Gaps = 4/176 (2%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS  E++  +    P  VPL TLIGRELRN  K EKP+++YGQAALAKKGEDYFLIKPDC
Sbjct  1    MSRTEISRMR----PPLVPLATLIGRELRNSDKTEKPSIRYGQAALAKKGEDYFLIKPDC  56

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QRI G+  +SFSVFAIFDGHNGISAAIFAKENLLN+V+SAIPQG+ REEWLQALPRALVA
Sbjct  57   QRIPGNPASSFSVFAIFDGHNGISAAIFAKENLLNHVMSAIPQGISREEWLQALPRALVA  116

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQ+KGETSGTTVTFVVID WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  117  GFVKTDIEFQRKGETSGTTVTFVVIDGWTVTVASVGDSRCILDTQGGVVSLLTVDH  172



>ref|XP_006344713.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X1 
[Solanum tuberosum]
 ref|XP_006344714.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X2 
[Solanum tuberosum]
Length=427

 Score =   299 bits (765),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 161/176 (91%), Gaps = 3/176 (2%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MSEAE+T  KQK T  +VPLGTLIGRELRN+ KVE+ T+KYGQAALAKKGED FLIK DC
Sbjct  1    MSEAEITRMKQKTT--SVPLGTLIGRELRND-KVEQRTIKYGQAALAKKGEDCFLIKLDC  57

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QRI G+  TSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIP+G+ REEWLQAL RALVA
Sbjct  58   QRIPGNPLTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPEGISREEWLQALRRALVA  117

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQKGETSGTTVTFVVID WT+TVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  118  GFVKTDIEFQQKGETSGTTVTFVVIDGWTITVASVGDSRCILDTQGGVVSLLTVDH  173



>gb|KJB26348.1| hypothetical protein B456_004G237900 [Gossypium raimondii]
 gb|KJB26351.1| hypothetical protein B456_004G237900 [Gossypium raimondii]
 gb|KJB26352.1| hypothetical protein B456_004G237900 [Gossypium raimondii]
Length=428

 Score =   299 bits (765),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 158/176 (90%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS+AEV   K    P  VPL TLIGRELRNE KVEKP VKYGQAALAKKGEDYFL+K DC
Sbjct  1    MSQAEVLRMK----PPLVPLATLIGRELRNE-KVEKPFVKYGQAALAKKGEDYFLVKLDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QRI G+  TSFSVFAIFDGHNGISAAIFAKENLL+N+LSAIPQG+ REEWLQALPRALVA
Sbjct  56   QRIPGNPATSFSVFAIFDGHNGISAAIFAKENLLSNILSAIPQGISREEWLQALPRALVA  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQ+GETSGTTVTFVVID WTVTVASVGDSRCILDTQGG+VSLLTVDH
Sbjct  116  GFVKTDIEFQQRGETSGTTVTFVVIDAWTVTVASVGDSRCILDTQGGIVSLLTVDH  171



>ref|XP_008450571.1| PREDICTED: probable protein phosphatase 2C 5 [Cucumis melo]
 ref|XP_008450572.1| PREDICTED: probable protein phosphatase 2C 5 [Cucumis melo]
 ref|XP_008450573.1| PREDICTED: probable protein phosphatase 2C 5 [Cucumis melo]
 ref|XP_008450574.1| PREDICTED: probable protein phosphatase 2C 5 [Cucumis melo]
Length=428

 Score =   299 bits (765),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 161/176 (91%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS+ EV+  K   TP+ VPL TLIGRELRNE KVEKP VKYGQAALAKKGEDYFLIKPDC
Sbjct  1    MSQTEVSRIK---TPL-VPLATLIGRELRNE-KVEKPFVKYGQAALAKKGEDYFLIKPDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QRI G+ +T+FSVFAIFDGHNGISAAIFAKE+LL NVLSAIPQG+ RE+WLQALPRALVA
Sbjct  56   QRIPGNPSTAFSVFAIFDGHNGISAAIFAKEHLLENVLSAIPQGVNREKWLQALPRALVA  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQKGETSGTTVTFVVID WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  116  GFVKTDIEFQQKGETSGTTVTFVVIDGWTVTVASVGDSRCILDTQGGVVSLLTVDH  171



>ref|XP_004135583.1| PREDICTED: probable protein phosphatase 2C 5-like [Cucumis sativus]
 gb|KGN66026.1| hypothetical protein Csa_1G568550 [Cucumis sativus]
Length=428

 Score =   298 bits (763),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 160/176 (91%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS+ EV+  K   TP+ VPL TLIGRELRNE KVEKP VKYGQAALAKKGEDYFLIKPDC
Sbjct  1    MSQTEVSRIK---TPL-VPLATLIGRELRNE-KVEKPFVKYGQAALAKKGEDYFLIKPDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QRI G+ +T+FSVFAIFDGHNGISAAIFAKE+LL NVLSAIPQG  RE+WLQALPRALVA
Sbjct  56   QRIPGNPSTAFSVFAIFDGHNGISAAIFAKEHLLENVLSAIPQGANREKWLQALPRALVA  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQKGETSGTTVTFVVID WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  116  GFVKTDIEFQQKGETSGTTVTFVVIDGWTVTVASVGDSRCILDTQGGVVSLLTVDH  171



>ref|XP_010088393.1| putative protein phosphatase 2C 5 [Morus notabilis]
 gb|EXC35964.1| putative protein phosphatase 2C 5 [Morus notabilis]
Length=368

 Score =   296 bits (758),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 161/185 (87%), Gaps = 14/185 (8%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS  E+T  + KP+PV  PL TLIGRELRNE KVEKP VKYGQAALAKKGEDYFLIK DC
Sbjct  1    MSHTEIT--RMKPSPV--PLATLIGRELRNE-KVEKPFVKYGQAALAKKGEDYFLIKLDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QRI G+ +TSFSVFAIFDGHNGISAAIFAKENLL+NVLSAIPQG+ REEWLQALPRALVA
Sbjct  56   QRIPGNPSTSFSVFAIFDGHNGISAAIFAKENLLDNVLSAIPQGISREEWLQALPRALVA  115

Query  417  GFVKTDIEFQQK---------GETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSL  569
            GFVKTDIEFQQK         GETSGTTVTFVVID WTVTVASVGDSRCILDTQGGVVSL
Sbjct  116  GFVKTDIEFQQKGMFRTYFIVGETSGTTVTFVVIDGWTVTVASVGDSRCILDTQGGVVSL  175

Query  570  LTVDH  584
            LTVDH
Sbjct  176  LTVDH  180



>ref|XP_002512477.1| protein phosphatase, putative [Ricinus communis]
 gb|EEF49929.1| protein phosphatase, putative [Ricinus communis]
Length=436

 Score =   298 bits (763),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 160/177 (90%), Gaps = 5/177 (3%)
 Frame = +3

Query  54   EMSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPD  233
             +S AEV+  K   TP+ +PLGTLIGRELRNE KVEKP VKYGQAALAKKGEDYFLIKPD
Sbjct  9    HVSTAEVSRMK---TPL-IPLGTLIGRELRNE-KVEKPFVKYGQAALAKKGEDYFLIKPD  63

Query  234  CQRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALV  413
            CQRI G ++TSFSVFAIFDGHNGISAAIFAKENLL+NVLSAIPQ   REEWLQALPRALV
Sbjct  64   CQRIPGDASTSFSVFAIFDGHNGISAAIFAKENLLDNVLSAIPQESSREEWLQALPRALV  123

Query  414  AGFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            AGFVKTDIEFQQK ETSGTTVTFVVID WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  124  AGFVKTDIEFQQKRETSGTTVTFVVIDGWTVTVASVGDSRCILDTQGGVVSLLTVDH  180



>ref|XP_004157232.1| PREDICTED: LOW QUALITY PROTEIN: probable protein phosphatase 
2C 5-like [Cucumis sativus]
Length=428

 Score =   297 bits (761),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 160/176 (91%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS+ EV+  K   TP+ VPL TLIGRELRNE KVEKP VKYGQAALAKKGEDYFLIKPDC
Sbjct  1    MSQTEVSRIK---TPL-VPLATLIGRELRNE-KVEKPFVKYGQAALAKKGEDYFLIKPDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QRI G+ +T+FSVFAIFDGHNGISAAIFAKE+LL NVLSAIPQG  RE+WLQALPRALVA
Sbjct  56   QRIPGNPSTAFSVFAIFDGHNGISAAIFAKEHLLENVLSAIPQGANREKWLQALPRALVA  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQKGETSGTTVTFVVID WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  116  GFVKTDIEFQQKGETSGTTVTFVVIDGWTVTVASVGDSRCILDTQGGVVSLLTVDH  171



>gb|KDP23425.1| hypothetical protein JCGZ_23258 [Jatropha curcas]
Length=437

 Score =   298 bits (762),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 158/177 (89%), Gaps = 5/177 (3%)
 Frame = +3

Query  54   EMSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPD  233
             +S AEV+  K    P  VPLGTLIGRELRNE KVEKP +KYGQAALAKKGEDYFLIKPD
Sbjct  9    HVSTAEVSRMK----PPLVPLGTLIGRELRNE-KVEKPFLKYGQAALAKKGEDYFLIKPD  63

Query  234  CQRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALV  413
            CQRI G  +TSFSVFAIFDGHNGISAAIFAKENLL+NVLSAIPQ + REEWLQALPRALV
Sbjct  64   CQRIQGDPSTSFSVFAIFDGHNGISAAIFAKENLLDNVLSAIPQEISREEWLQALPRALV  123

Query  414  AGFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            AGFVKTDIEFQQ+ ETSGTTVTFVVID WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  124  AGFVKTDIEFQQRRETSGTTVTFVVIDGWTVTVASVGDSRCILDTQGGVVSLLTVDH  180



>ref|XP_009759573.1| PREDICTED: probable protein phosphatase 2C 5 [Nicotiana sylvestris]
Length=427

 Score =   297 bits (761),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 157/176 (89%), Gaps = 3/176 (2%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS AE T  KQK  PV  PLGTLI RELRN++ VEKPTVKYGQA LAKKGEDYFL++PDC
Sbjct  1    MSRAEFTRMKQKAAPV--PLGTLISRELRNDN-VEKPTVKYGQAGLAKKGEDYFLVRPDC  57

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QRI G+++T FSVFAI DGHNGISAAIF KENLLNNVLSAI QGL REEWLQALPRALVA
Sbjct  58   QRIPGNTSTYFSVFAILDGHNGISAAIFTKENLLNNVLSAILQGLDREEWLQALPRALVA  117

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQKGETSGTTVTFVVID WT+TVASVGDSRCILDTQ GVVSLLTVDH
Sbjct  118  GFVKTDIEFQQKGETSGTTVTFVVIDGWTITVASVGDSRCILDTQEGVVSLLTVDH  173



>gb|EPS69183.1| hypothetical protein M569_05581, partial [Genlisea aurea]
Length=425

 Score =   295 bits (755),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 153/159 (96%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPLGTLIGRELR+E K+EKPT+KYGQAALAKKGEDYFLIKPDC+R+ G  +TSFSVFAIF
Sbjct  15   VPLGTLIGRELRHE-KLEKPTLKYGQAALAKKGEDYFLIKPDCERVPGDPSTSFSVFAIF  73

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNGISAAIFAKENLLNNVLSAIPQ LGRE+WLQ LP+ALVAGFVKTDIEFQQ+GETSG
Sbjct  74   DGHNGISAAIFAKENLLNNVLSAIPQALGREDWLQTLPKALVAGFVKTDIEFQQRGETSG  133

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFVVID+WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  134  TTVTFVVIDDWTVTVASVGDSRCILDTQGGVVSLLTVDH  172



>ref|XP_010024104.1| PREDICTED: probable protein phosphatase 2C 5 [Eucalyptus grandis]
Length=427

 Score =   295 bits (755),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 157/176 (89%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS+AEV+  K    P  VPL TLIGRELR   KVEKP VKYGQAALAKKGEDYFL KPDC
Sbjct  1    MSQAEVSRMK----PPLVPLATLIGRELRG-GKVEKPLVKYGQAALAKKGEDYFLTKPDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            +RI+G  +TSFSVFAIFDGHNGISAAIFAKENLL NVLSAIPQG+ R++WLQALPRALVA
Sbjct  56   ERIAGDPSTSFSVFAIFDGHNGISAAIFAKENLLANVLSAIPQGVSRDDWLQALPRALVA  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQ+GETSGTTVTFVVID WT+TVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  116  GFVKTDIEFQQRGETSGTTVTFVVIDGWTITVASVGDSRCILDTQGGVVSLLTVDH  171



>ref|XP_006472159.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X1 
[Citrus sinensis]
 ref|XP_006472160.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X2 
[Citrus sinensis]
Length=427

 Score =   294 bits (752),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 159/176 (90%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            M++ EV   K    P+ VPL TLIGRELRNE K+EKP VKYGQAALAKKGEDYFLIKPDC
Sbjct  1    MNQTEVPQMK---APL-VPLATLIGRELRNE-KIEKPFVKYGQAALAKKGEDYFLIKPDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QRI G+++TSFSVFAIFDGHNG+SAAIF KE+LLNNVLSAIPQG  R+EWLQALPRALVA
Sbjct  56   QRIPGNASTSFSVFAIFDGHNGVSAAIFTKESLLNNVLSAIPQGASRDEWLQALPRALVA  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQ+KGETSGTTVTFVVID WTVTVASVGDSRCILDTQGG+VSLLTVDH
Sbjct  116  GFVKTDIEFQKKGETSGTTVTFVVIDGWTVTVASVGDSRCILDTQGGIVSLLTVDH  171



>ref|XP_006433490.1| hypothetical protein CICLE_v10001248mg [Citrus clementina]
 ref|XP_006433491.1| hypothetical protein CICLE_v10001248mg [Citrus clementina]
 gb|ESR46730.1| hypothetical protein CICLE_v10001248mg [Citrus clementina]
 gb|ESR46731.1| hypothetical protein CICLE_v10001248mg [Citrus clementina]
 gb|KDO81742.1| hypothetical protein CISIN_1g014281mg [Citrus sinensis]
 gb|KDO81743.1| hypothetical protein CISIN_1g014281mg [Citrus sinensis]
Length=427

 Score =   294 bits (752),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 159/176 (90%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            M++ EV   K    P+ VPL TLIGRELRNE K+EKP VKYGQAALAKKGEDYFLIKPDC
Sbjct  1    MNQTEVPQMK---APL-VPLATLIGRELRNE-KIEKPFVKYGQAALAKKGEDYFLIKPDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QRI G+++TSFSVFAIFDGHNG+SAAIF KE+LLNNVLSAIPQG  R+EWLQALPRALVA
Sbjct  56   QRIPGNASTSFSVFAIFDGHNGVSAAIFTKESLLNNVLSAIPQGASRDEWLQALPRALVA  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQ+KGETSGTTVTFVVID WTVTVASVGDSRCILDTQGG+VSLLTVDH
Sbjct  116  GFVKTDIEFQKKGETSGTTVTFVVIDGWTVTVASVGDSRCILDTQGGIVSLLTVDH  171



>gb|EYU37269.1| hypothetical protein MIMGU_mgv1a006832mg [Erythranthe guttata]
Length=430

 Score =   294 bits (753),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 155/169 (92%), Gaps = 3/169 (2%)
 Frame = +3

Query  78   MTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSS  257
            M +++  P+  PLGTLIGRELRNE KVEKPTVKYGQAALAKKGEDYFL+K DCQR+    
Sbjct  10   MKQKQQQPI--PLGTLIGRELRNE-KVEKPTVKYGQAALAKKGEDYFLVKLDCQRVLADP  66

Query  258  TTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDI  437
            +TSFSVFAIFDGHNGISAAIF KENLLNNVLSAIPQ LGREEWLQALPRALVAGFVKTDI
Sbjct  67   STSFSVFAIFDGHNGISAAIFTKENLLNNVLSAIPQQLGREEWLQALPRALVAGFVKTDI  126

Query  438  EFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            EFQQ+GETSGTTVTFVVID WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  127  EFQQRGETSGTTVTFVVIDGWTVTVASVGDSRCILDTQGGVVSLLTVDH  175



>ref|XP_011036918.1| PREDICTED: probable protein phosphatase 2C 5 isoform X2 [Populus 
euphratica]
Length=428

 Score =   293 bits (749),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 156/176 (89%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS+ EV+  +    P  VPL TLIGRELRNE K+EKP VKYGQAALAKKGEDYFLIKPDC
Sbjct  1    MSQDEVSRMR----PPLVPLATLIGRELRNE-KIEKPYVKYGQAALAKKGEDYFLIKPDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QR+ G  +TSFSVFAIFDGHNGISAAIFAKE LL+NVLSAIPQ + REEWLQALPRALVA
Sbjct  56   QRVPGDLSTSFSVFAIFDGHNGISAAIFAKEQLLDNVLSAIPQDISREEWLQALPRALVA  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQ GETSGTTVTFV+ID WTVTVASVGDSRCILD+QGGVVSLLTVDH
Sbjct  116  GFVKTDIEFQQGGETSGTTVTFVIIDGWTVTVASVGDSRCILDSQGGVVSLLTVDH  171



>emb|CDP17226.1| unnamed protein product [Coffea canephora]
Length=429

 Score =   292 bits (748),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 157/176 (89%), Gaps = 3/176 (2%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS+AE++  KQKP    VPLG LIGRELRNE KVEK TVKYGQ ALAKKGEDYFLIKPDC
Sbjct  1    MSKAEISKMKQKPP--LVPLGALIGRELRNE-KVEKRTVKYGQTALAKKGEDYFLIKPDC  57

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QR+  + +TSFSVFAIFDGHNGISAAIFAKENLL NVLSAIP+GLG EEWLQALPRALVA
Sbjct  58   QRVVDNQSTSFSVFAIFDGHNGISAAIFAKENLLKNVLSAIPEGLGGEEWLQALPRALVA  117

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEF+Q GE SGTTVTFVVID WTVTVASVGDSRCILDTQGGVVSLLT +H
Sbjct  118  GFVKTDIEFRQGGEKSGTTVTFVVIDGWTVTVASVGDSRCILDTQGGVVSLLTGNH  173



>gb|KJB45380.1| hypothetical protein B456_007G303500 [Gossypium raimondii]
Length=418

 Score =   291 bits (745),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 150/162 (93%), Gaps = 1/162 (1%)
 Frame = +3

Query  99   PVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVF  278
            P  VPL TL+GRELRN  KVEKP VK+GQAALAKKGEDYFLIKPDC+R+ G+  TSFSVF
Sbjct  3    PPLVPLATLLGRELRN-VKVEKPFVKFGQAALAKKGEDYFLIKPDCERVPGNPETSFSVF  61

Query  279  AIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGE  458
            AIFDGHNGISAAIFAKENLL NVLSAIPQG+ REEWLQALPRALVAGFVKTDIEFQQKGE
Sbjct  62   AIFDGHNGISAAIFAKENLLGNVLSAIPQGINREEWLQALPRALVAGFVKTDIEFQQKGE  121

Query  459  TSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TSGTTVTFVVID WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  122  TSGTTVTFVVIDGWTVTVASVGDSRCILDTQGGVVSLLTVDH  163



>gb|KJB45378.1| hypothetical protein B456_007G303500 [Gossypium raimondii]
 gb|KJB45379.1| hypothetical protein B456_007G303500 [Gossypium raimondii]
 gb|KJB45381.1| hypothetical protein B456_007G303500 [Gossypium raimondii]
Length=420

 Score =   291 bits (745),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 150/162 (93%), Gaps = 1/162 (1%)
 Frame = +3

Query  99   PVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVF  278
            P  VPL TL+GRELRN  KVEKP VK+GQAALAKKGEDYFLIKPDC+R+ G+  TSFSVF
Sbjct  3    PPLVPLATLLGRELRN-VKVEKPFVKFGQAALAKKGEDYFLIKPDCERVPGNPETSFSVF  61

Query  279  AIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGE  458
            AIFDGHNGISAAIFAKENLL NVLSAIPQG+ REEWLQALPRALVAGFVKTDIEFQQKGE
Sbjct  62   AIFDGHNGISAAIFAKENLLGNVLSAIPQGINREEWLQALPRALVAGFVKTDIEFQQKGE  121

Query  459  TSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TSGTTVTFVVID WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  122  TSGTTVTFVVIDGWTVTVASVGDSRCILDTQGGVVSLLTVDH  163



>ref|XP_011023737.1| PREDICTED: probable protein phosphatase 2C 5 isoform X2 [Populus 
euphratica]
Length=436

 Score =   290 bits (743),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 150/162 (93%), Gaps = 1/162 (1%)
 Frame = +3

Query  99   PVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVF  278
            P  VPL TLIGRELRNE K+EKP VKYGQAALAKKGEDYFLIKPDCQR+ G  +TSFSVF
Sbjct  20   PPLVPLATLIGRELRNE-KIEKPFVKYGQAALAKKGEDYFLIKPDCQRVPGDLSTSFSVF  78

Query  279  AIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGE  458
            AIFDGHNG+SAAIF KE LL+NVLSAIPQ + REEWLQALP+ALVAGFVKTDIEFQQKGE
Sbjct  79   AIFDGHNGVSAAIFVKEKLLDNVLSAIPQDITREEWLQALPQALVAGFVKTDIEFQQKGE  138

Query  459  TSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TSGTTVTFVVIDEWTVTVASVGDSRCILD+QGGVVSLLTVDH
Sbjct  139  TSGTTVTFVVIDEWTVTVASVGDSRCILDSQGGVVSLLTVDH  180



>ref|XP_010528916.1| PREDICTED: probable protein phosphatase 2C 5 [Tarenaya hassleriana]
Length=422

 Score =   290 bits (742),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  90   KPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSF  269
            +P P  VPL TLIGRELR   KVEKP +KYGQAALA+KGEDYFLIKPDCQRI G  +TSF
Sbjct  8    RPKPPLVPLATLIGRELRG-GKVEKPFIKYGQAALARKGEDYFLIKPDCQRIPGDPSTSF  66

Query  270  SVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQ  449
            SVFAIFDGHNGISAAIFAKE LL+NVLSAIPQG+ R+EWLQALPRALVAGFVKTDIEFQQ
Sbjct  67   SVFAIFDGHNGISAAIFAKECLLDNVLSAIPQGVSRDEWLQALPRALVAGFVKTDIEFQQ  126

Query  450  KGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            KGETSGTTVTFV+ID WT+TVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  127  KGETSGTTVTFVLIDGWTITVASVGDSRCILDTQGGVVSLLTVDH  171



>ref|XP_002318970.1| phosphatase 2C family protein [Populus trichocarpa]
 gb|EEE94893.1| phosphatase 2C family protein [Populus trichocarpa]
Length=436

 Score =   290 bits (742),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 150/162 (93%), Gaps = 1/162 (1%)
 Frame = +3

Query  99   PVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVF  278
            P  VPL TLIGRELRNE K+EKP VKYGQAALAKKGEDYFLIKPDCQR+ G  +TSFSVF
Sbjct  20   PPLVPLATLIGRELRNE-KIEKPFVKYGQAALAKKGEDYFLIKPDCQRVPGDLSTSFSVF  78

Query  279  AIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGE  458
            AIFDGHNG+SAAIF KE LL+NVLSAIPQ + REEWLQALP+ALVAGFVKTDIEFQQKGE
Sbjct  79   AIFDGHNGVSAAIFVKEKLLDNVLSAIPQDITREEWLQALPQALVAGFVKTDIEFQQKGE  138

Query  459  TSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TSGTTVTFVVIDEWTVTVASVGDSRCILD+QGGVVSLLTVDH
Sbjct  139  TSGTTVTFVVIDEWTVTVASVGDSRCILDSQGGVVSLLTVDH  180



>ref|XP_011466159.1| PREDICTED: probable protein phosphatase 2C 5 [Fragaria vesca 
subsp. vesca]
Length=426

 Score =   289 bits (740),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 159/176 (90%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MSE EV   K   +P+ VPL TL+GRE+R+E KVE+P +KYGQAALAKKGEDYFLIKPDC
Sbjct  1    MSETEVARMK---SPL-VPLATLLGREIRSE-KVEEPFLKYGQAALAKKGEDYFLIKPDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            +RI  + +TSFSVFAIFDGHNGISAAI+AKE LL+NVLSAIPQGL R+EWLQALPRALVA
Sbjct  56   RRIHANPSTSFSVFAIFDGHNGISAAIYAKETLLDNVLSAIPQGLTRDEWLQALPRALVA  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQKGETSGTTVTFVVID WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  116  GFVKTDIEFQQKGETSGTTVTFVVIDGWTVTVASVGDSRCILDTQGGVVSLLTVDH  171



>ref|XP_006382433.1| hypothetical protein POPTR_0005s02110g [Populus trichocarpa]
 gb|ERP60230.1| hypothetical protein POPTR_0005s02110g [Populus trichocarpa]
Length=443

 Score =   290 bits (741),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 150/162 (93%), Gaps = 1/162 (1%)
 Frame = +3

Query  99   PVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVF  278
            P  VPL TLIGRELRNE K+EKP VKYGQAALAKKGEDYFLIKPDCQR++G  +TSFSVF
Sbjct  26   PPLVPLATLIGRELRNE-KIEKPYVKYGQAALAKKGEDYFLIKPDCQRVAGDLSTSFSVF  84

Query  279  AIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGE  458
            AIFDGHNGISAAIFAKE LL+NVLSAIPQ + REEWLQALPRALVAGFVKTDIEFQQ GE
Sbjct  85   AIFDGHNGISAAIFAKEQLLDNVLSAIPQDISREEWLQALPRALVAGFVKTDIEFQQGGE  144

Query  459  TSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TSGTTVTFV+ID WTVTVASVGDSRCILD+QGGVVSLLTVDH
Sbjct  145  TSGTTVTFVIIDGWTVTVASVGDSRCILDSQGGVVSLLTVDH  186



>gb|ACJ85200.1| unknown [Medicago truncatula]
Length=247

 Score =   283 bits (723),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 154/176 (88%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS+AE++  KQ   P+ VPL TLIGRELRN  K EKP VKYGQA LAKKGEDYFLIK DC
Sbjct  1    MSKAELSRMKQ---PL-VPLATLIGRELRN-GKTEKPFVKYGQAGLAKKGEDYFLIKTDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
             R+ G S+TSFSVFAI DGHNGISAAIFAKEN++NNV+SAIPQG+ REEWLQALPRALV 
Sbjct  56   HRVPGDSSTSFSVFAILDGHNGISAAIFAKENIINNVMSAIPQGVSREEWLQALPRALVV  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
             FVKTD+EFQ+KGETSGTT TFV+ID WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  116  AFVKTDMEFQKKGETSGTTATFVIIDGWTVTVASVGDSRCILDTQGGVVSLLTVDH  171



>ref|XP_011036917.1| PREDICTED: probable protein phosphatase 2C 5 isoform X1 [Populus 
euphratica]
Length=437

 Score =   289 bits (739),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 149/162 (92%), Gaps = 1/162 (1%)
 Frame = +3

Query  99   PVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVF  278
            P  VPL TLIGRELRNE K+EKP VKYGQAALAKKGEDYFLIKPDCQR+ G  +TSFSVF
Sbjct  20   PPLVPLATLIGRELRNE-KIEKPYVKYGQAALAKKGEDYFLIKPDCQRVPGDLSTSFSVF  78

Query  279  AIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGE  458
            AIFDGHNGISAAIFAKE LL+NVLSAIPQ + REEWLQALPRALVAGFVKTDIEFQQ GE
Sbjct  79   AIFDGHNGISAAIFAKEQLLDNVLSAIPQDISREEWLQALPRALVAGFVKTDIEFQQGGE  138

Query  459  TSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TSGTTVTFV+ID WTVTVASVGDSRCILD+QGGVVSLLTVDH
Sbjct  139  TSGTTVTFVIIDGWTVTVASVGDSRCILDSQGGVVSLLTVDH  180



>ref|XP_010674109.1| PREDICTED: probable protein phosphatase 2C 5 [Beta vulgaris subsp. 
vulgaris]
Length=427

 Score =   288 bits (736),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 155/176 (88%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS+ EV+  +    P  VPLGTLIGRELR+E KVEKP ++YGQAALAKKGEDYFLIK DC
Sbjct  1    MSQTEVSRAE----PPLVPLGTLIGRELRSE-KVEKPIIRYGQAALAKKGEDYFLIKTDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QRI G  +TSFSVF IFDGHNGISAAIF KENLLNNVL A+P+G  REEWLQALP+ALVA
Sbjct  56   QRIPGDPSTSFSVFGIFDGHNGISAAIFTKENLLNNVLCAVPEGASREEWLQALPQALVA  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQKGE+SGTTVTFVVID WTVTVASVGDSRCILDTQGGVV+LLTVDH
Sbjct  116  GFVKTDIEFQQKGESSGTTVTFVVIDGWTVTVASVGDSRCILDTQGGVVTLLTVDH  171



>ref|XP_008388502.1| PREDICTED: probable protein phosphatase 2C 5 [Malus domestica]
 ref|XP_008388503.1| PREDICTED: probable protein phosphatase 2C 5 [Malus domestica]
Length=427

 Score =   287 bits (735),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 153/176 (87%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS+ EV+  K   TP+A    TLIGRELR E KVEKP +KYGQA LAKKGEDYFLIK DC
Sbjct  1    MSQIEVSAMKSPLTPLA----TLIGRELRGE-KVEKPYLKYGQAGLAKKGEDYFLIKTDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QRI    +TSFSVFAIFDGHNGISAAIF KENLL NVLSAIPQG  R+EWLQALPRALVA
Sbjct  56   QRIHSDPSTSFSVFAIFDGHNGISAAIFTKENLLANVLSAIPQGTSRDEWLQALPRALVA  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQKGETSGTTVTFVVID+WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  116  GFVKTDIEFQQKGETSGTTVTFVVIDDWTVTVASVGDSRCILDTQGGVVSLLTVDH  171



>ref|XP_010553723.1| PREDICTED: probable protein phosphatase 2C 5 [Tarenaya hassleriana]
Length=429

 Score =   286 bits (732),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 150/165 (91%), Gaps = 1/165 (1%)
 Frame = +3

Query  90   KPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSF  269
            KP P  VPL  LIGRELR E K EKP +KY QAALAKKGEDYFLIKPDCQRI G  +TSF
Sbjct  8    KPKPPLVPLAALIGRELRGE-KDEKPFIKYCQAALAKKGEDYFLIKPDCQRIPGDPSTSF  66

Query  270  SVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQ  449
            SVFAIFDGHNGISAAIFAKE+LL+NVLSAIPQG+ R+EWL+ALPRALVAGFVKTDIEFQQ
Sbjct  67   SVFAIFDGHNGISAAIFAKEHLLDNVLSAIPQGVSRDEWLKALPRALVAGFVKTDIEFQQ  126

Query  450  KGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            KGETSGTTVTFV+ID WT+TVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  127  KGETSGTTVTFVLIDGWTITVASVGDSRCILDTQGGVVSLLTVDH  171



>ref|XP_011023738.1| PREDICTED: probable protein phosphatase 2C 5 isoform X3 [Populus 
euphratica]
Length=428

 Score =   286 bits (731),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 156/177 (88%), Gaps = 6/177 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS+  ++  +    P  VPL TLIGRELRNE K+EKP VKYGQAALAKKGEDYFLIKPDC
Sbjct  1    MSQDNISRMR----PPLVPLATLIGRELRNE-KIEKPFVKYGQAALAKKGEDYFLIKPDC  55

Query  237  QRISGSSTTSFSVFA-IFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALV  413
            QR+ G  +TSFSVFA IFDGHNG+SAAIF KE LL+NVLSAIPQ + REEWLQALP+ALV
Sbjct  56   QRVPGDLSTSFSVFAQIFDGHNGVSAAIFVKEKLLDNVLSAIPQDITREEWLQALPQALV  115

Query  414  AGFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            AGFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILD+QGGVVSLLTVDH
Sbjct  116  AGFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDSQGGVVSLLTVDH  172



>ref|XP_011023736.1| PREDICTED: probable protein phosphatase 2C 5 isoform X1 [Populus 
euphratica]
Length=437

 Score =   286 bits (732),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 150/163 (92%), Gaps = 2/163 (1%)
 Frame = +3

Query  99   PVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVF  278
            P  VPL TLIGRELRNE K+EKP VKYGQAALAKKGEDYFLIKPDCQR+ G  +TSFSVF
Sbjct  20   PPLVPLATLIGRELRNE-KIEKPFVKYGQAALAKKGEDYFLIKPDCQRVPGDLSTSFSVF  78

Query  279  A-IFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKG  455
            A IFDGHNG+SAAIF KE LL+NVLSAIPQ + REEWLQALP+ALVAGFVKTDIEFQQKG
Sbjct  79   AQIFDGHNGVSAAIFVKEKLLDNVLSAIPQDITREEWLQALPQALVAGFVKTDIEFQQKG  138

Query  456  ETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            ETSGTTVTFVVIDEWTVTVASVGDSRCILD+QGGVVSLLTVDH
Sbjct  139  ETSGTTVTFVVIDEWTVTVASVGDSRCILDSQGGVVSLLTVDH  181



>ref|XP_003591191.1| hypothetical protein MTR_1g083750 [Medicago truncatula]
 gb|AES61442.1| protein phosphatase 2C family protein [Medicago truncatula]
Length=423

 Score =   284 bits (726),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 154/176 (88%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS+AE++  KQ   P+ VPL TLIGRELRN  K EKP VKYGQA LAKKGEDYFLIK DC
Sbjct  1    MSKAELSRMKQ---PL-VPLATLIGRELRN-GKTEKPFVKYGQAGLAKKGEDYFLIKTDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
             R+ G S+TSFSVFAI DGHNGISAAIFAKEN++NNV+SAIPQG+ REEWLQALPRALV 
Sbjct  56   HRVPGDSSTSFSVFAILDGHNGISAAIFAKENIINNVMSAIPQGVSREEWLQALPRALVV  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
             FVKTD+EFQ+KGETSGTT TFV+ID WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  116  AFVKTDMEFQKKGETSGTTATFVIIDGWTVTVASVGDSRCILDTQGGVVSLLTVDH  171



>ref|XP_007163342.1| hypothetical protein PHAVU_001G226800g [Phaseolus vulgaris]
 gb|ESW35336.1| hypothetical protein PHAVU_001G226800g [Phaseolus vulgaris]
Length=429

 Score =   283 bits (724),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 153/176 (87%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS  E++ TK  P    VPLGTLIGRE+RN  KVEKP VKYGQA LAKKGEDYFLIK DC
Sbjct  1    MSRTELSRTKPPP----VPLGTLIGREIRN-GKVEKPFVKYGQAGLAKKGEDYFLIKTDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
             R+ G ++T+FSVFAIFDGHNGISAAIFAKENLL+NVLSAIPQ + R+ WLQALPRALV 
Sbjct  56   LRVPGDASTAFSVFAIFDGHNGISAAIFAKENLLSNVLSAIPQDISRDAWLQALPRALVV  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQKGETSGTT TFV++D WT+TVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  116  GFVKTDIEFQQKGETSGTTATFVLVDGWTITVASVGDSRCILDTQGGVVSLLTVDH  171



>gb|ABD28356.2| Protein phosphatase 2C-like [Medicago truncatula]
Length=440

 Score =   283 bits (724),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 154/176 (88%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS+AE++  KQ   P+ VPL TLIGRELRN  K EKP VKYGQA LAKKGEDYFLIK DC
Sbjct  1    MSKAELSRMKQ---PL-VPLATLIGRELRN-GKTEKPFVKYGQAGLAKKGEDYFLIKTDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
             R+ G S+TSFSVFAI DGHNGISAAIFAKEN++NNV+SAIPQG+ REEWLQALPRALV 
Sbjct  56   HRVPGDSSTSFSVFAILDGHNGISAAIFAKENIINNVMSAIPQGVSREEWLQALPRALVV  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
             FVKTD+EFQ+KGETSGTT TFV+ID WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  116  AFVKTDMEFQKKGETSGTTATFVIIDGWTVTVASVGDSRCILDTQGGVVSLLTVDH  171



>ref|XP_007205239.1| hypothetical protein PRUPE_ppa006100mg [Prunus persica]
 gb|EMJ06438.1| hypothetical protein PRUPE_ppa006100mg [Prunus persica]
Length=427

 Score =   282 bits (722),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 153/176 (87%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS+ EV+  K       VPL TLIGRELR+E KVEKP +KYGQAA+AKKGED FLIK DC
Sbjct  1    MSQTEVSGMKA----TLVPLATLIGRELRSE-KVEKPYLKYGQAAVAKKGEDCFLIKTDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QR   + +TSFSVFAIFDGHNGISAAIFAKENLL NVLSAIPQG+ R+EWL ALPRALVA
Sbjct  56   QRTHSNPSTSFSVFAIFDGHNGISAAIFAKENLLANVLSAIPQGISRDEWLHALPRALVA  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQKGETSGTTVTFVVID WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  116  GFVKTDIEFQQKGETSGTTVTFVVIDGWTVTVASVGDSRCILDTQGGVVSLLTVDH  171



>gb|KHN20267.1| Hypothetical protein glysoja_023830 [Glycine soja]
Length=428

 Score =   282 bits (721),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 153/176 (87%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS  E++  KQ P    VPL TLIG+ELRN  K+EKP VKYGQA LAKKGEDYFLIK DC
Sbjct  1    MSTTELSNMKQPP----VPLATLIGQELRN-GKIEKPFVKYGQAGLAKKGEDYFLIKTDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QR+ G S+T FSVFAIFDGHNGISAAIFAKE++L+NVLSAIPQ +GR+EWLQALPRALV 
Sbjct  56   QRVPGDSSTLFSVFAIFDGHNGISAAIFAKESILSNVLSAIPQDMGRDEWLQALPRALVV  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVK DIEFQ+KGETSGTT TFV+ID WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  116  GFVKPDIEFQKKGETSGTTATFVLIDRWTVTVASVGDSRCILDTQGGVVSLLTVDH  171



>gb|AFK41874.1| unknown [Medicago truncatula]
Length=468

 Score =   283 bits (724),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 154/176 (88%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS+AE++  KQ   P+ VPL TLIGRELRN  K EKP VKYGQA LAKKGEDYFLIK DC
Sbjct  1    MSKAELSRMKQ---PL-VPLATLIGRELRN-GKTEKPFVKYGQAGLAKKGEDYFLIKTDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
             R+ G S+TSFSVFAI DGHNGISAAIFAKEN++NNV+SAIPQG+ REEWLQALPRALV 
Sbjct  56   HRVPGDSSTSFSVFAILDGHNGISAAIFAKENIINNVMSAIPQGVSREEWLQALPRALVV  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
             FVKTD+EFQ+KGETSGTT TFV+ID WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  116  AFVKTDMEFQKKGETSGTTATFVIIDGWTVTVASVGDSRCILDTQGGVVSLLTVDH  171



>ref|XP_008245693.1| PREDICTED: probable protein phosphatase 2C 5 [Prunus mume]
 ref|XP_008245698.1| PREDICTED: probable protein phosphatase 2C 5 [Prunus mume]
 ref|XP_008245707.1| PREDICTED: probable protein phosphatase 2C 5 [Prunus mume]
Length=428

 Score =   281 bits (720),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 155/176 (88%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS+ EV+  K    P+ VPL TLIGRELR+E K+EKP +KYGQAA+AKKGED FLIK DC
Sbjct  1    MSQTEVSGMK---APL-VPLATLIGRELRSE-KIEKPYLKYGQAAVAKKGEDCFLIKTDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QR   + +TSFSVFAIFDGHNGISAAIFAKENLL NVLSAIPQG+ R+EWL ALPRALVA
Sbjct  56   QRTHSNPSTSFSVFAIFDGHNGISAAIFAKENLLANVLSAIPQGISRDEWLHALPRALVA  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQKGETSGTTVTFVVID WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  116  GFVKTDIEFQQKGETSGTTVTFVVIDGWTVTVASVGDSRCILDTQGGVVSLLTVDH  171



>ref|XP_003554626.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X1 
[Glycine max]
 ref|XP_006604794.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X2 
[Glycine max]
 gb|KHN43329.1| Hypothetical protein glysoja_001912 [Glycine soja]
Length=429

 Score =   281 bits (719),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 152/176 (86%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS  E++  K  P    VPLGTLIGRELRN  KVEKP VKYGQA LAKKGEDYFLIK DC
Sbjct  1    MSRIELSRAKSAP----VPLGTLIGRELRN-GKVEKPFVKYGQAGLAKKGEDYFLIKTDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
             R+ G ++T+FSVFA+FDGHNGISAAIFAKENLL+NVLSAIPQ + R+ WLQALPRALV 
Sbjct  56   LRVPGDASTAFSVFAVFDGHNGISAAIFAKENLLSNVLSAIPQDISRDAWLQALPRALVV  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQKGETSGTT TFV++D WT+TVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  116  GFVKTDIEFQQKGETSGTTATFVLVDGWTITVASVGDSRCILDTQGGVVSLLTVDH  171



>ref|XP_008370399.1| PREDICTED: probable protein phosphatase 2C 5 [Malus domestica]
 ref|XP_008370400.1| PREDICTED: probable protein phosphatase 2C 5 [Malus domestica]
Length=427

 Score =   281 bits (719),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 151/176 (86%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS+ EV+  K  P    +PL TLIG+ELR E +VEKP +KYGQA LAKKGEDYFLIK DC
Sbjct  1    MSQIEVSAMKSSP----IPLATLIGQELRGE-EVEKPYLKYGQAGLAKKGEDYFLIKTDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QRI    +T+FSVFAIFDGHNGISAAIF KENLL NVLSAIPQG+ R+EWL ALPRALVA
Sbjct  56   QRIHSDPSTTFSVFAIFDGHNGISAAIFTKENLLANVLSAIPQGISRDEWLLALPRALVA  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQKGETSGTTVTFVVID WTVT ASVGDSRCILDTQGGVVSLLTVDH
Sbjct  116  GFVKTDIEFQQKGETSGTTVTFVVIDGWTVTAASVGDSRCILDTQGGVVSLLTVDH  171



>gb|KHN16084.1| Hypothetical protein glysoja_012060 [Glycine soja]
Length=428

 Score =   281 bits (718),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 153/176 (87%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS  E++  KQ P    VPL TLIG+ELRN  K+EKP VKYGQA LAKKGEDYFLIK DC
Sbjct  1    MSRTELSNMKQPP----VPLATLIGQELRN-GKIEKPFVKYGQAGLAKKGEDYFLIKADC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QR+ G S+T FSVFAIFDGHNGISAAIFAKE++L+NVLSAIPQ + R+EWLQALPRALV 
Sbjct  56   QRVPGDSSTLFSVFAIFDGHNGISAAIFAKESILSNVLSAIPQDISRDEWLQALPRALVV  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQ+KGETSGTT TFV++D WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  116  GFVKTDIEFQKKGETSGTTATFVLVDGWTVTVASVGDSRCILDTQGGVVSLLTVDH  171



>gb|KHN03953.1| Hypothetical protein glysoja_022639 [Glycine soja]
Length=426

 Score =   281 bits (718),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 152/176 (86%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS  E++  K  P    VPLGTLIGRELRN  KVEKP VKYGQ+ LAKKGEDYFLIK DC
Sbjct  1    MSRIELSRAKSAP----VPLGTLIGRELRN-GKVEKPFVKYGQSGLAKKGEDYFLIKTDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
             R+ G ++T+FSVFA+FDGHNGISAAIFAKENLL+NVLSAIPQ + R+ WLQALPRALV 
Sbjct  56   LRVPGDASTAFSVFAVFDGHNGISAAIFAKENLLSNVLSAIPQDISRDAWLQALPRALVV  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQKGETSGTT TFV++D WT+TVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  116  GFVKTDIEFQQKGETSGTTATFVLVDGWTITVASVGDSRCILDTQGGVVSLLTVDH  171



>gb|KJB26350.1| hypothetical protein B456_004G237900 [Gossypium raimondii]
Length=421

 Score =   279 bits (714),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 151/176 (86%), Gaps = 12/176 (7%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS+AEV   K    P  VPL TLIGRELRNE KVEKP VKYGQAALAKKGEDYFL+K DC
Sbjct  1    MSQAEVLRMK----PPLVPLATLIGRELRNE-KVEKPFVKYGQAALAKKGEDYFLVKLDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QRI G+  TSFSVFAIFDGHNGISAAIFAKENLL+N+LSAIPQG+ REEWLQALPRALVA
Sbjct  56   QRIPGNPATSFSVFAIFDGHNGISAAIFAKENLLSNILSAIPQGISREEWLQALPRALVA  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQ+       VTFVVID WTVTVASVGDSRCILDTQGG+VSLLTVDH
Sbjct  116  GFVKTDIEFQQR-------VTFVVIDAWTVTVASVGDSRCILDTQGGIVSLLTVDH  164



>ref|XP_003521674.1| PREDICTED: probable protein phosphatase 2C 5-like [Glycine max]
Length=426

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 151/176 (86%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS  E++  K  P    VPLGTLIGRELRN  KVEKP VKYGQ+ LAKKGEDYFLIK DC
Sbjct  1    MSRIELSRAKSAP----VPLGTLIGRELRN-GKVEKPFVKYGQSGLAKKGEDYFLIKTDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
             R+ G ++T+FSVFA+FDGHNGISAAIFAKENLL+NVLSAIPQ + R+ WLQALPRALV 
Sbjct  56   LRVPGDASTAFSVFAVFDGHNGISAAIFAKENLLSNVLSAIPQDISRDAWLQALPRALVV  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQKGETSGTT TFV++D WTVTVASVGDSRCI DTQGGVVSLLTVDH
Sbjct  116  GFVKTDIEFQQKGETSGTTATFVLVDGWTVTVASVGDSRCISDTQGGVVSLLTVDH  171



>ref|XP_006417602.1| hypothetical protein EUTSA_v10007698mg [Eutrema salsugineum]
 ref|XP_006417603.1| hypothetical protein EUTSA_v10007698mg [Eutrema salsugineum]
 dbj|BAJ34364.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ35955.1| hypothetical protein EUTSA_v10007698mg [Eutrema salsugineum]
 gb|ESQ35956.1| hypothetical protein EUTSA_v10007698mg [Eutrema salsugineum]
Length=428

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 154/176 (88%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS ++ + TK       VPL TLIGRELR+E KVEKP VKYGQAALAKKGEDYFLIK DC
Sbjct  1    MSPSKGSRTKHS----LVPLATLIGRELRSE-KVEKPLVKYGQAALAKKGEDYFLIKTDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            +R++G  +++FSVF IFDGHNG SAAI+ KE+LL+NV+SAIPQG  REEWLQALPRALVA
Sbjct  56   ERVTGDPSSAFSVFGIFDGHNGNSAAIYTKEHLLDNVVSAIPQGATREEWLQALPRALVA  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQKGETSGTTVTFV+ID WT+TVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  116  GFVKTDIEFQQKGETSGTTVTFVIIDGWTITVASVGDSRCILDTQGGVVSLLTVDH  171



>ref|XP_003626183.1| hypothetical protein MTR_7g112430 [Medicago truncatula]
 gb|AES82401.1| protein phosphatase 2C family protein [Medicago truncatula]
Length=428

 Score =   278 bits (711),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 153/176 (87%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS+ E  +++ KP+PV  PL TLIGRE+RNE KVEKP VK+GQA LAKKGEDYFLIK DC
Sbjct  1    MSKRE--LSRMKPSPV--PLATLIGREIRNE-KVEKPFVKFGQAGLAKKGEDYFLIKTDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
             R+ G  +T+FSVFAIFDGHNGISAAI+ KENLLNNVLSAIPQ + R+ WLQALPRALV 
Sbjct  56   HRVPGDPSTAFSVFAIFDGHNGISAAIYTKENLLNNVLSAIPQDISRDAWLQALPRALVV  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTD EFQ+KGETSGTT TFV++D WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  116  GFVKTDTEFQKKGETSGTTATFVIVDGWTVTVASVGDSRCILDTQGGVVSLLTVDH  171



>ref|XP_006604795.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X3 
[Glycine max]
Length=427

 Score =   278 bits (710),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 151/171 (88%), Gaps = 3/171 (2%)
 Frame = +3

Query  72   VTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISG  251
            + +++ K  PV  PLGTLIGRELRN  KVEKP VKYGQA LAKKGEDYFLIK DC R+ G
Sbjct  2    IELSRAKSAPV--PLGTLIGRELRN-GKVEKPFVKYGQAGLAKKGEDYFLIKTDCLRVPG  58

Query  252  SSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKT  431
             ++T+FSVFA+FDGHNGISAAIFAKENLL+NVLSAIPQ + R+ WLQALPRALV GFVKT
Sbjct  59   DASTAFSVFAVFDGHNGISAAIFAKENLLSNVLSAIPQDISRDAWLQALPRALVVGFVKT  118

Query  432  DIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            DIEFQQKGETSGTT TFV++D WT+TVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  119  DIEFQQKGETSGTTATFVLVDGWTITVASVGDSRCILDTQGGVVSLLTVDH  169



>ref|XP_004494559.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X1 
[Cicer arietinum]
 ref|XP_004494560.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X2 
[Cicer arietinum]
Length=429

 Score =   278 bits (710),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 151/176 (86%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS+ E++  K  P    VPL TLIGRELRN+ KVEKP VKYGQA LAKKGEDYFLIK DC
Sbjct  1    MSKRELSRMKSPP----VPLATLIGRELRNK-KVEKPFVKYGQAGLAKKGEDYFLIKTDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
             R++G  +T+FSVFAIFDGHNGISAAI+AKENLLNNVLSAIPQ + R+ WLQALPRALV 
Sbjct  56   HRVAGDPSTAFSVFAIFDGHNGISAAIYAKENLLNNVLSAIPQDISRDAWLQALPRALVV  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTD EFQQKGETSGTT T V++D WTVTVASVGDSRCIL+TQGGVVSLLTVDH
Sbjct  116  GFVKTDTEFQQKGETSGTTATIVLVDGWTVTVASVGDSRCILNTQGGVVSLLTVDH  171



>gb|AAL31893.1|AF419561_1 At1g09160/T12M4_13 [Arabidopsis thaliana]
Length=355

 Score =   274 bits (700),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL TLIGRELR+E KVEKP VKYGQAALAKKGEDYFLIK DC+R+ G  +++FSVF IF
Sbjct  14   VPLATLIGRELRSE-KVEKPFVKYGQAALAKKGEDYFLIKTDCERVPGDPSSAFSVFGIF  72

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG SAAI+ KE+LL NV+SAIPQG  R+EWLQALPRALVAGFVKTDIEFQQKGETSG
Sbjct  73   DGHNGNSAAIYTKEHLLENVVSAIPQGASRDEWLQALPRALVAGFVKTDIEFQQKGETSG  132

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+ID WT+TVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  133  TTVTFVIIDGWTITVASVGDSRCILDTQGGVVSLLTVDH  171



>ref|XP_002892487.1| hypothetical protein ARALYDRAFT_471002 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68746.1| hypothetical protein ARALYDRAFT_471002 [Arabidopsis lyrata subsp. 
lyrata]
Length=428

 Score =   275 bits (704),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL TLIGRELR+E KVEKP VKYGQAALAKKGEDYFLIK DC+R+ G  +++FSVF IF
Sbjct  14   VPLATLIGRELRSE-KVEKPFVKYGQAALAKKGEDYFLIKTDCERVPGDPSSAFSVFGIF  72

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG SAAI+ KE+LL+NV+SAIPQG  REEWLQALPRALVAGFVKTDIEFQQKGETSG
Sbjct  73   DGHNGNSAAIYTKEHLLDNVVSAIPQGASREEWLQALPRALVAGFVKTDIEFQQKGETSG  132

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+ID WT+TVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  133  TTVTFVIIDGWTITVASVGDSRCILDTQGGVVSLLTVDH  171



>ref|XP_004495680.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X1 
[Cicer arietinum]
Length=423

 Score =   275 bits (702),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 144/159 (91%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            +PL TLIGRELRNE K E+P VKYGQA LAKKGEDYFLIK DCQR+ G S+T FSVFAIF
Sbjct  14   IPLATLIGRELRNE-KTEQPFVKYGQAGLAKKGEDYFLIKTDCQRVPGDSSTLFSVFAIF  72

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNGISAAIFAKE++LNNV+SAIPQG+ R+EWLQALPRALV  F+KTD+EFQQ+GETSG
Sbjct  73   DGHNGISAAIFAKESILNNVMSAIPQGISRDEWLQALPRALVVSFLKTDMEFQQQGETSG  132

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV+ID WTVTVASVGDSRCILDTQGG VSLLTVDH
Sbjct  133  TTATFVIIDGWTVTVASVGDSRCILDTQGGAVSLLTVDH  171



>ref|XP_009338205.1| PREDICTED: probable protein phosphatase 2C 5 [Pyrus x bretschneideri]
 ref|XP_009338206.1| PREDICTED: probable protein phosphatase 2C 5 [Pyrus x bretschneideri]
Length=427

 Score =   275 bits (702),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 152/176 (86%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS+ EV+  K   +P+ +PL TLIG+ELR E +VEKP +KYGQA LAKKGEDYFLIK DC
Sbjct  1    MSQIEVSAMK---SPL-IPLATLIGQELRGE-EVEKPYLKYGQAGLAKKGEDYFLIKTDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QRI    +T+FSVFAIFDGHNGISAAIF KENLL NVLSAIP G+ R+EWL ALPRALVA
Sbjct  56   QRIHSDPSTTFSVFAIFDGHNGISAAIFTKENLLANVLSAIPPGVSRDEWLLALPRALVA  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQKGETSGTTVTFVVID WTVT ASVGDSRCILDTQGGVVSLLTVDH
Sbjct  116  GFVKTDIEFQQKGETSGTTVTFVVIDGWTVTAASVGDSRCILDTQGGVVSLLTVDH  171



>ref|XP_007144975.1| hypothetical protein PHAVU_007G199100g [Phaseolus vulgaris]
 gb|ESW16969.1| hypothetical protein PHAVU_007G199100g [Phaseolus vulgaris]
Length=429

 Score =   275 bits (702),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 150/176 (85%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS  + +  KQ P    VPL TLIGRELRN  K+EKP VK+GQA LAKKGEDYFLIK D 
Sbjct  1    MSRTDSSNMKQPP----VPLATLIGRELRN-GKIEKPFVKFGQAGLAKKGEDYFLIKTDY  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QR+ G S+T FSVFAIFDGHNGISAAIFAKEN+L+NVLSAIPQ + R+EWLQALPRALV 
Sbjct  56   QRVPGDSSTLFSVFAIFDGHNGISAAIFAKENILSNVLSAIPQDISRDEWLQALPRALVV  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
             FVKTDIEFQ+KGETSGTT TFV+ID WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  116  AFVKTDIEFQKKGETSGTTATFVLIDGWTVTVASVGDSRCILDTQGGVVSLLTVDH  171



>ref|NP_172388.1| putative protein phosphatase 2C [Arabidopsis thaliana]
 ref|NP_849621.1| putative protein phosphatase 2C [Arabidopsis thaliana]
 sp|O80492.1|P2C05_ARATH RecName: Full=Probable protein phosphatase 2C 5; Short=AtPP2C05 
[Arabidopsis thaliana]
 gb|AAC24088.1| Contains similarity to protein phosphatase 2C (ABI1) gb|X78886 
from A. thaliana [Arabidopsis thaliana]
 gb|ABM06026.1| At1g09160 [Arabidopsis thaliana]
 dbj|BAH19588.1| AT1G09160 [Arabidopsis thaliana]
 gb|AEE28405.1| putative protein phosphatase 2C 5 [Arabidopsis thaliana]
 gb|AEE28406.1| putative protein phosphatase 2C [Arabidopsis thaliana]
Length=428

 Score =   274 bits (700),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL TLIGRELR+E KVEKP VKYGQAALAKKGEDYFLIK DC+R+ G  +++FSVF IF
Sbjct  14   VPLATLIGRELRSE-KVEKPFVKYGQAALAKKGEDYFLIKTDCERVPGDPSSAFSVFGIF  72

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG SAAI+ KE+LL NV+SAIPQG  R+EWLQALPRALVAGFVKTDIEFQQKGETSG
Sbjct  73   DGHNGNSAAIYTKEHLLENVVSAIPQGASRDEWLQALPRALVAGFVKTDIEFQQKGETSG  132

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+ID WT+TVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  133  TTVTFVIIDGWTITVASVGDSRCILDTQGGVVSLLTVDH  171



>ref|XP_010475741.1| PREDICTED: probable protein phosphatase 2C 5 [Camelina sativa]
 ref|XP_010475742.1| PREDICTED: probable protein phosphatase 2C 5 [Camelina sativa]
Length=428

 Score =   274 bits (700),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL TLIG ELR+E KVEKP +KYGQAALAKKGEDYFLIK DCQR+ G  ++SFSVF IF
Sbjct  14   VPLATLIGNELRSE-KVEKPLIKYGQAALAKKGEDYFLIKTDCQRVPGDPSSSFSVFGIF  72

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG SAAI+ KE+LL+NV+SAIPQG  R+EWLQALPRALVAGFVKTDIEFQQKGETSG
Sbjct  73   DGHNGNSAAIYTKEHLLDNVVSAIPQGASRDEWLQALPRALVAGFVKTDIEFQQKGETSG  132

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+ID WT+TVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  133  TTVTFVLIDGWTITVASVGDSRCILDTQGGVVSLLTVDH  171



>ref|XP_010458188.1| PREDICTED: probable protein phosphatase 2C 5 [Camelina sativa]
 ref|XP_010458189.1| PREDICTED: probable protein phosphatase 2C 5 [Camelina sativa]
Length=428

 Score =   274 bits (700),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL TLIG ELR+E KVEKP +KYGQAALAKKGEDYFLIK DCQR+ G  ++SFSVF IF
Sbjct  14   VPLATLIGNELRSE-KVEKPLIKYGQAALAKKGEDYFLIKTDCQRVPGDPSSSFSVFGIF  72

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG SAAI+ KE+LL+NV+SAIPQG  R+EWLQALPRALVAGFVKTDIEFQQKGETSG
Sbjct  73   DGHNGNSAAIYTKEHLLDNVVSAIPQGASRDEWLQALPRALVAGFVKTDIEFQQKGETSG  132

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+ID WT+TVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  133  TTVTFVLIDGWTITVASVGDSRCILDTQGGVVSLLTVDH  171



>ref|XP_010489746.1| PREDICTED: probable protein phosphatase 2C 5 [Camelina sativa]
 ref|XP_010489753.1| PREDICTED: probable protein phosphatase 2C 5 [Camelina sativa]
Length=428

 Score =   274 bits (700),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL TLIG ELR+E KVEKP +KYGQAALAKKGEDYFLIK DCQR+ G  ++SFSVF IF
Sbjct  14   VPLATLIGNELRSE-KVEKPLIKYGQAALAKKGEDYFLIKTDCQRVPGDPSSSFSVFGIF  72

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG SAAI+ KE+LL+NV+SAIPQG  R+EWLQALPRALVAGFVKTDIEFQQKGETSG
Sbjct  73   DGHNGNSAAIYTKEHLLDNVVSAIPQGASRDEWLQALPRALVAGFVKTDIEFQQKGETSG  132

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+ID WT+TVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  133  TTVTFVLIDGWTITVASVGDSRCILDTQGGVVSLLTVDH  171



>ref|XP_006307591.1| hypothetical protein CARUB_v10009213mg [Capsella rubella]
 gb|EOA40489.1| hypothetical protein CARUB_v10009213mg [Capsella rubella]
Length=428

 Score =   273 bits (698),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 154/176 (88%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS ++ + TK    P+ VPL TLIG ELR+E KVEKP +KYGQAALAKKGEDYFLIK DC
Sbjct  1    MSVSKASGTKH---PL-VPLATLIGNELRSE-KVEKPLIKYGQAALAKKGEDYFLIKTDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QR+ G  +++FSVF IFDGHNG SAAI+ KE+LL+NV+SAIPQG  R+EWLQALPRALVA
Sbjct  56   QRVPGDPSSAFSVFGIFDGHNGNSAAIYTKEHLLDNVVSAIPQGASRDEWLQALPRALVA  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQKGETSGTTVTFV+ID WT+TVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  116  GFVKTDIEFQQKGETSGTTVTFVLIDGWTITVASVGDSRCILDTQGGVVSLLTVDH  171



>gb|AIZ68189.1| putative protein phosphatase 2C 33 [Ornithogalum saundersiae]
Length=432

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 151/174 (87%), Gaps = 6/174 (3%)
 Frame = +3

Query  78   MTKQKPT-----PVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQR  242
            MT  +P      P  VPL TLIGRELR E K E+P+++YG A LAK+GED FLIKPDC R
Sbjct  1    MTNHQPRDPSARPPLVPLATLIGRELRGE-KSERPSLRYGHAGLAKRGEDLFLIKPDCLR  59

Query  243  ISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGF  422
            I G+++T+FSVFAIFDGHNG+SAA+F KE+LL++V+SAIPQG+GR+EWLQ LPRALVAGF
Sbjct  60   IPGNNSTAFSVFAIFDGHNGVSAAVFTKEHLLDHVMSAIPQGIGRDEWLQELPRALVAGF  119

Query  423  VKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            VKTDI+FQ+KGE SGTTVTFVVID WTVTVASVGDSRCILD+QGGVVSLLTVDH
Sbjct  120  VKTDIDFQRKGEASGTTVTFVVIDGWTVTVASVGDSRCILDSQGGVVSLLTVDH  173



>ref|XP_008807757.1| PREDICTED: probable protein phosphatase 2C 33 [Phoenix dactylifera]
Length=437

 Score =   270 bits (690),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 146/162 (90%), Gaps = 1/162 (1%)
 Frame = +3

Query  99   PVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVF  278
            P  VPL TLIGRELR + K EKPT+K G  A AK+GEDYFLIKPDC RI G+S++SFSVF
Sbjct  14   PPLVPLATLIGRELRGD-KSEKPTLKCGHHAFAKRGEDYFLIKPDCLRIPGNSSSSFSVF  72

Query  279  AIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGE  458
            AIFDGHNG+SAA+FAKE+LL+NV+SAIP GLGREEWLQALP+ALVAGFV+TDI+FQ+KGE
Sbjct  73   AIFDGHNGVSAAVFAKEHLLDNVMSAIPPGLGREEWLQALPQALVAGFVRTDIDFQRKGE  132

Query  459  TSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TSGTTVT VV+D W VTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  133  TSGTTVTLVVVDGWRVTVASVGDSRCILDTQGGVVSLLTVDH  174



>ref|XP_009110849.1| PREDICTED: probable protein phosphatase 2C 5 [Brassica rapa]
 ref|XP_009110850.1| PREDICTED: probable protein phosphatase 2C 5 [Brassica rapa]
Length=427

 Score =   270 bits (689),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 151/176 (86%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS ++ + TK+      VPL TLIGRELR+E K+EKP + YGQAALAKKGED+FLIK DC
Sbjct  1    MSPSKASRTKES----LVPLATLIGRELRSE-KLEKPLLIYGQAALAKKGEDFFLIKTDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            +R+ G  +++FSVF IFDGHNG SAAI+ KE LL+NV+SAIPQG  R+EWLQALPRALVA
Sbjct  56   ERVPGDPSSAFSVFGIFDGHNGNSAAIYTKERLLDNVVSAIPQGASRDEWLQALPRALVA  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQKGETSGTTVTFV+ID WT+TV SVGDSRCILDTQGGVVSLLTVDH
Sbjct  116  GFVKTDIEFQQKGETSGTTVTFVIIDGWTITVGSVGDSRCILDTQGGVVSLLTVDH  171



>emb|CDY32154.1| BnaCnng06630D [Brassica napus]
Length=500

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 151/176 (86%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS ++ + TK+      VPL TLIGRELR+E K+EKP + YGQAALAKKGED+FLIK DC
Sbjct  75   MSPSKASRTKES----LVPLATLIGRELRSE-KLEKPLLIYGQAALAKKGEDFFLIKTDC  129

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            +R+ G  +++FSVF IFDGHNG SAAI+ KE LL+NV+SAIPQG  REEWLQALPRALVA
Sbjct  130  ERVPGDPSSAFSVFGIFDGHNGNSAAIYTKERLLDNVVSAIPQGASREEWLQALPRALVA  189

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQKGETSGTTVTFV+ID WT+TV SVGDSRCILDTQGGVVSLLTVDH
Sbjct  190  GFVKTDIEFQQKGETSGTTVTFVIIDGWTITVGSVGDSRCILDTQGGVVSLLTVDH  245



>emb|CDY31109.1| BnaA08g26590D [Brassica napus]
Length=427

 Score =   268 bits (686),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 151/176 (86%), Gaps = 5/176 (3%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS ++ + TK+      VPL TLIGRELR+E K+EKP + YGQAALAKKGED+FLIK DC
Sbjct  1    MSPSKASRTKES----LVPLATLIGRELRSE-KLEKPLLIYGQAALAKKGEDFFLIKTDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            +R+ G  +++FSVF IFDGHNG SAAI+ KE LL+NV+SAIPQG  R+EWLQ+LPRALVA
Sbjct  56   ERVPGDPSSAFSVFGIFDGHNGNSAAIYTKERLLDNVVSAIPQGASRDEWLQSLPRALVA  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTDIEFQQKGETSGTTVTFV+ID WT+TV SVGDSRCILDTQGGVVSLLTVDH
Sbjct  116  GFVKTDIEFQQKGETSGTTVTFVIIDGWTITVGSVGDSRCILDTQGGVVSLLTVDH  171



>ref|XP_009411651.1| PREDICTED: probable protein phosphatase 2C 33 [Musa acuminata 
subsp. malaccensis]
Length=429

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 143/162 (88%), Gaps = 1/162 (1%)
 Frame = +3

Query  99   PVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVF  278
            P  VPL TLIGRELR   K EKP +KYG AA AK+GEDYFL++PDC R+ G + +SFSVF
Sbjct  14   PPMVPLATLIGRELRG-GKSEKPAIKYGHAAFAKRGEDYFLVRPDCLRVPGDAASSFSVF  72

Query  279  AIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGE  458
            AIFDGHNG+SAA+FAKE+LL +V+SAIPQG+GREEWL+ALPRALVAGFVKTDI+FQ+KGE
Sbjct  73   AIFDGHNGVSAAVFAKEHLLEHVMSAIPQGIGREEWLEALPRALVAGFVKTDIDFQRKGE  132

Query  459  TSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TSGTT T VV+D WTVTVASVGDSRCILD+Q GVVSLLTVDH
Sbjct  133  TSGTTATLVVVDGWTVTVASVGDSRCILDSQDGVVSLLTVDH  174



>ref|XP_010938321.1| PREDICTED: probable protein phosphatase 2C 33 [Elaeis guineensis]
Length=433

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 144/162 (89%), Gaps = 1/162 (1%)
 Frame = +3

Query  99   PVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVF  278
            P  VPL TLIGREL  + K EKPTVK G  A AK+GEDYFL+KPDC RI G+ ++SFSVF
Sbjct  14   PPLVPLATLIGRELHGD-KSEKPTVKCGHHAFAKRGEDYFLVKPDCLRIPGNPSSSFSVF  72

Query  279  AIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGE  458
            AIFDGHNG+SAA+F KE+LL+NV+SAIP GLGREEWLQALP+ALVAGFV+TDI+FQ+KGE
Sbjct  73   AIFDGHNGVSAAVFTKEHLLDNVMSAIPPGLGREEWLQALPQALVAGFVRTDIDFQRKGE  132

Query  459  TSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TSGTTVT VV+D WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  133  TSGTTVTLVVVDGWTVTVASVGDSRCILDTQGGVVSLLTVDH  174



>ref|XP_008795536.1| PREDICTED: probable protein phosphatase 2C 33 [Phoenix dactylifera]
Length=433

 Score =   265 bits (676),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 143/162 (88%), Gaps = 1/162 (1%)
 Frame = +3

Query  99   PVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVF  278
            P  VPL TLIGREL  + K EKPTVK G  A AK+GEDYFL+KPDC RI G+ ++SFSVF
Sbjct  14   PPLVPLATLIGRELHGD-KSEKPTVKCGHHAFAKRGEDYFLVKPDCLRIPGNPSSSFSVF  72

Query  279  AIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGE  458
            AIFDGHNG+SAA+F KE+LL+NV SAIP GLGREEWLQALP+ALVAGFV+TDI+FQ+KGE
Sbjct  73   AIFDGHNGVSAAVFTKEHLLDNVTSAIPPGLGREEWLQALPQALVAGFVRTDIDFQRKGE  132

Query  459  TSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TSGTTVT VV+D WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  133  TSGTTVTLVVVDGWTVTVASVGDSRCILDTQGGVVSLLTVDH  174



>gb|KCW60535.1| hypothetical protein EUGRSUZ_H03276 [Eucalyptus grandis]
Length=415

 Score =   262 bits (670),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 145/176 (82%), Gaps = 17/176 (10%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS+AEV+  K    P  VPL TLIGRELR   KVEKP VKYGQAALAKKGEDYFL KPDC
Sbjct  1    MSQAEVSRMK----PPLVPLATLIGRELRG-GKVEKPLVKYGQAALAKKGEDYFLTKPDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            +RI+G  +TSFSVFAIFDGHNGISAAIFAKENLL NVLSAIPQG+ R++WLQALPRALVA
Sbjct  56   ERIAGDPSTSFSVFAIFDGHNGISAAIFAKENLLANVLSAIPQGVSRDDWLQALPRALVA  115

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
                        GETSGTTVTFVVID WT+TVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  116  ------------GETSGTTVTFVVIDGWTITVASVGDSRCILDTQGGVVSLLTVDH  159



>ref|XP_010905680.1| PREDICTED: probable protein phosphatase 2C 33 [Elaeis guineensis]
 ref|XP_010905681.1| PREDICTED: probable protein phosphatase 2C 33 [Elaeis guineensis]
Length=455

 Score =   263 bits (673),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 143/159 (90%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL TLIGRELR + K EKP VK G  A AK+GEDYFLIKPD  RI G+ +TSFSVFAIF
Sbjct  35   VPLATLIGRELRGD-KSEKPIVKCGHHAFAKRGEDYFLIKPDYLRIPGNPSTSFSVFAIF  93

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG+SAA+FAKE+LL+NV+SAIP GLGREEWLQALP+ALVAGFV+TDI+FQ+KGETSG
Sbjct  94   DGHNGVSAAVFAKEHLLDNVMSAIPPGLGREEWLQALPQALVAGFVRTDIDFQRKGETSG  153

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVT VV+D WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  154  TTVTLVVVDGWTVTVASVGDSRCILDTQGGVVSLLTVDH  192



>ref|XP_006842367.1| hypothetical protein AMTR_s00079p00186650 [Amborella trichopoda]
 gb|ERN04042.1| hypothetical protein AMTR_s00079p00186650 [Amborella trichopoda]
Length=431

 Score =   262 bits (669),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 142/159 (89%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI RELRNE K+EKP +KYG AA AKKGED++LIK DCQRI GSS +++SVFAIF
Sbjct  18   VPLAALISRELRNE-KIEKPCIKYGYAAQAKKGEDFYLIKTDCQRIPGSSNSTYSVFAIF  76

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+ +E+LL +V+SAIP+GLGREEWLQALPRALVAGFVK D EFQ KGETSG
Sbjct  77   DGHNGNAAAIYTREHLLEHVVSAIPRGLGREEWLQALPRALVAGFVKADKEFQSKGETSG  136

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+ID WTVTVASVGDSRCILD+QGGV+SLLTVDH
Sbjct  137  TTVTFVIIDGWTVTVASVGDSRCILDSQGGVISLLTVDH  175



>ref|XP_009386662.1| PREDICTED: probable protein phosphatase 2C 33 [Musa acuminata 
subsp. malaccensis]
Length=428

 Score =   261 bits (668),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 143/162 (88%), Gaps = 1/162 (1%)
 Frame = +3

Query  99   PVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVF  278
            P  VPL TLIGRELR   K EKP ++YG AA AK+GEDYFL++PDC R+ G +++SFSVF
Sbjct  14   PTMVPLATLIGRELRG-GKSEKPAIRYGHAAFAKRGEDYFLVRPDCLRVPGDASSSFSVF  72

Query  279  AIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGE  458
            AIFDGHNG+SAA+FAKE+LL++V+SAIPQG+GREEWL+ L RALVAGFVKTDI+FQ+KGE
Sbjct  73   AIFDGHNGVSAAVFAKEHLLDHVMSAIPQGIGREEWLETLQRALVAGFVKTDIDFQRKGE  132

Query  459  TSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TSGTT T VV+D WTVTVASVGDSRCILD+Q GVVSLLTVDH
Sbjct  133  TSGTTATLVVVDGWTVTVASVGDSRCILDSQDGVVSLLTVDH  174



>ref|XP_003592620.1| hypothetical protein MTR_1g110210 [Medicago truncatula]
 gb|AES62871.1| protein phosphatase 2C family protein [Medicago truncatula]
Length=327

 Score =   257 bits (656),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 142/159 (89%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ RE+++E K+EKPTV+ GQAA +KKGEDYFLIK DCQR+ G+S+TSFSVFAIF
Sbjct  14   VPLAALLKREMKSE-KMEKPTVRIGQAAQSKKGEDYFLIKIDCQRVPGNSSTSFSVFAIF  72

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AA++ KENLLN+VL A+P+GLGR+EWLQALPRALVAGFVKTD EFQ +GETSG
Sbjct  73   DGHNGNAAAVYTKENLLNHVLCALPRGLGRDEWLQALPRALVAGFVKTDKEFQSRGETSG  132

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILDTQGG V+ LTVDH
Sbjct  133  TTATFVIVDRWTVTVASVGDSRCILDTQGGAVTTLTVDH  171



>ref|XP_007044253.1| Phosphatase 2C family protein [Theobroma cacao]
 gb|EOY00085.1| Phosphatase 2C family protein [Theobroma cacao]
Length=428

 Score =   260 bits (664),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 142/159 (89%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI RE++NE K+EKPTV+YG AA ++KGEDYFLIK DCQR+ G+ +++FSVFAIF
Sbjct  14   VPLAALISREMKNE-KMEKPTVRYGHAAQSRKGEDYFLIKTDCQRVPGNPSSTFSVFAIF  72

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAIF +E+LL++VLSA+P+GLGREEWLQALPRALVAGFVKTD EFQ +GETSG
Sbjct  73   DGHNGNAAAIFTREHLLSHVLSAVPRGLGREEWLQALPRALVAGFVKTDKEFQSRGETSG  132

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILDTQGG VS LTVDH
Sbjct  133  TTATFVIVDAWTVTVASVGDSRCILDTQGGAVSTLTVDH  171



>ref|XP_009588467.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009588468.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009588469.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009588470.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009588471.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009588472.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
tomentosiformis]
Length=429

 Score =   260 bits (664),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 142/159 (89%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI RELRNE K+EKPTV+YG AA +KKGEDYFL+K DCQR+ G+ ++SFSVFAIF
Sbjct  15   VPLAALISRELRNE-KMEKPTVRYGCAAQSKKGEDYFLMKSDCQRVQGNPSSSFSVFAIF  73

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AA+F+K++LLN+VLSAIP+GLGR+EWL ALPRALVAGFVKTD EFQ+KG+TSG
Sbjct  74   DGHNGTAAAVFSKDHLLNHVLSAIPRGLGRDEWLHALPRALVAGFVKTDKEFQRKGQTSG  133

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVA VGDSRCILDTQGG VS LTVDH
Sbjct  134  TTATFVIVDGWTVTVACVGDSRCILDTQGGAVSELTVDH  172



>ref|XP_009767020.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009767021.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009767022.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009767023.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009767024.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009767025.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
sylvestris]
Length=429

 Score =   259 bits (662),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI RELRNE K+EKPTV+YG AA +KKGEDYFL+K DCQR+ G+ ++SFSVFAIF
Sbjct  15   VPLAALISRELRNE-KMEKPTVRYGCAAQSKKGEDYFLMKTDCQRVQGNPSSSFSVFAIF  73

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AA+F+K++LLN+VLSAIP GLGR+EWL ALPRALVAGFVKTD EFQ+KG+TSG
Sbjct  74   DGHNGTAAAVFSKDHLLNHVLSAIPHGLGRDEWLHALPRALVAGFVKTDKEFQRKGQTSG  133

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVA VGDSRCILDTQGG VS LTVDH
Sbjct  134  TTATFVIVDGWTVTVACVGDSRCILDTQGGAVSELTVDH  172



>ref|XP_006448418.1| hypothetical protein CICLE_v10015330mg [Citrus clementina]
 ref|XP_006448419.1| hypothetical protein CICLE_v10015330mg [Citrus clementina]
 ref|XP_006468741.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X1 
[Citrus sinensis]
 ref|XP_006468742.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X2 
[Citrus sinensis]
 gb|ESR61658.1| hypothetical protein CICLE_v10015330mg [Citrus clementina]
 gb|ESR61659.1| hypothetical protein CICLE_v10015330mg [Citrus clementina]
Length=428

 Score =   259 bits (661),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI RE+RNE K+EKP V +GQAA ++KGEDYFLIK DCQR+ G+ +++FSVFAIF
Sbjct  14   VPLAALISREMRNE-KMEKPNVSFGQAAQSRKGEDYFLIKTDCQRVPGNPSSTFSVFAIF  72

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+ KENLLN+VL AIP+GLGR+EWLQALPRALVAGFVKTD EFQ +GETSG
Sbjct  73   DGHNGNAAAIYTKENLLNHVLGAIPRGLGRDEWLQALPRALVAGFVKTDKEFQSRGETSG  132

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILD QGG VS LTVDH
Sbjct  133  TTATFVIVDRWTVTVASVGDSRCILDAQGGAVSTLTVDH  171



>ref|XP_002279675.1| PREDICTED: probable protein phosphatase 2C 15 [Vitis vinifera]
 ref|XP_010644317.1| PREDICTED: probable protein phosphatase 2C 15 [Vitis vinifera]
 ref|XP_010644359.1| PREDICTED: probable protein phosphatase 2C 15 [Vitis vinifera]
 ref|XP_010644395.1| PREDICTED: probable protein phosphatase 2C 15 [Vitis vinifera]
 ref|XP_010644423.1| PREDICTED: probable protein phosphatase 2C 15 [Vitis vinifera]
 emb|CBI26983.3| unnamed protein product [Vitis vinifera]
Length=427

 Score =   258 bits (660),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI RE+R+E K+EKPTV+YG AA ++KGEDYFL+K DCQRI G+S+++FSVFAI 
Sbjct  13   VPLAALINREMRSE-KMEKPTVRYGCAAQSRKGEDYFLMKTDCQRIPGNSSSTFSVFAIL  71

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAIF +ENLLN+VL A+P+GLGREEWLQALPRALVAGFVKTD EFQ +GETSG
Sbjct  72   DGHNGNAAAIFTRENLLNHVLGAMPRGLGREEWLQALPRALVAGFVKTDKEFQSRGETSG  131

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILDTQGG VS LTVDH
Sbjct  132  TTATFVIVDGWTVTVASVGDSRCILDTQGGAVSTLTVDH  170



>ref|XP_002527010.1| protein phosphatase, putative [Ricinus communis]
 gb|EEF35382.1| protein phosphatase, putative [Ricinus communis]
Length=428

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI RE++NE K+EKPTV+ G AA ++KGEDYFLIK DCQR+ G+S+++FSVFAIF
Sbjct  14   VPLAALISREMKNE-KMEKPTVRCGSAAQSRKGEDYFLIKTDCQRVPGNSSSTFSVFAIF  72

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAIF +ENLLN++L AIP+GLGREEWLQALPRALVAGFVKTD EFQ +GETSG
Sbjct  73   DGHNGNAAAIFTRENLLNHILGAIPRGLGREEWLQALPRALVAGFVKTDKEFQSRGETSG  132

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILD QGG VS LTVDH
Sbjct  133  TTATFVIVDGWTVTVASVGDSRCILDAQGGAVSTLTVDH  171



>gb|KHG19034.1| hypothetical protein F383_08660 [Gossypium arboreum]
Length=416

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 138/162 (85%), Gaps = 13/162 (8%)
 Frame = +3

Query  99   PVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVF  278
            P  VPL TL+GRELRN  KVEKP VK+GQAALAKKGEDYFLIKPDC+R+ G+  TSFSVF
Sbjct  3    PPLVPLATLLGRELRN-VKVEKPFVKFGQAALAKKGEDYFLIKPDCERVPGNPETSFSVF  61

Query  279  AIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGE  458
            AIFDGHNGISAAIFAKENLL NVLSAIPQG+ REEWLQALPRALVA            GE
Sbjct  62   AIFDGHNGISAAIFAKENLLGNVLSAIPQGINREEWLQALPRALVA------------GE  109

Query  459  TSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TSGTTVTFVVID WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  110  TSGTTVTFVVIDGWTVTVASVGDSRCILDTQGGVVSLLTVDH  151



>gb|KDP29451.1| hypothetical protein JCGZ_18372 [Jatropha curcas]
Length=432

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI RE+RNE K+EKPT++YG AA ++KGEDYFL+K DCQR+ G+ +++FSVFAIF
Sbjct  14   VPLAALISREMRNE-KMEKPTLRYGYAAQSRKGEDYFLMKTDCQRVPGNPSSTFSVFAIF  72

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAIF +ENLLN+VL A+P+GLGREEWLQALPRALVAGFVKTD EFQ +GETSG
Sbjct  73   DGHNGNAAAIFTRENLLNHVLGALPRGLGREEWLQALPRALVAGFVKTDKEFQSRGETSG  132

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILD QGG VS LTVDH
Sbjct  133  TTATFVIVDGWTVTVASVGDSRCILDAQGGAVSSLTVDH  171



>ref|XP_008792835.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008778229.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Phoenix 
dactylifera]
Length=460

 Score =   258 bits (659),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LIGREL++E K+EKP ++YG AA +KKGEDYFLIK DC R+ G+ +++FSVFA+ 
Sbjct  44   VPLAVLIGRELKSE-KMEKPCIRYGCAAQSKKGEDYFLIKVDCHRLPGNPSSAFSVFAVL  102

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+A+ENLLN+VLSAIP+GL REEWLQALPRALVAGFVKTD EFQ +G+TSG
Sbjct  103  DGHNGNAAAIYARENLLNHVLSAIPRGLSREEWLQALPRALVAGFVKTDKEFQSRGQTSG  162

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+ID WT+TVASVGDSRCILD  GGVVSLLTVDH
Sbjct  163  TTVTFVIIDGWTITVASVGDSRCILDAHGGVVSLLTVDH  201



>ref|XP_010264732.1| PREDICTED: probable protein phosphatase 2C 15 [Nelumbo nucifera]
 ref|XP_010264741.1| PREDICTED: probable protein phosphatase 2C 15 [Nelumbo nucifera]
Length=437

 Score =   257 bits (657),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI REL++E K+EKP+V+YG AA ++KGEDYFLIK DCQR+ G+S+++FSVFAIF
Sbjct  23   VPLAALISRELKSE-KMEKPSVRYGYAAQSRKGEDYFLIKTDCQRVPGNSSSTFSVFAIF  81

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAIF +ENLLN+VL A+P+GLGREEWL ALPRALVAGFVKTD EFQ +GETSG
Sbjct  82   DGHNGNAAAIFTRENLLNHVLGALPRGLGREEWLHALPRALVAGFVKTDKEFQNRGETSG  141

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILD QGG VS+LTVDH
Sbjct  142  TTATFVIVDGWTVTVASVGDSRCILDAQGGAVSILTVDH  180



>ref|XP_004984656.1| PREDICTED: probable protein phosphatase 2C 33-like isoform X2 
[Setaria italica]
Length=289

 Score =   253 bits (645),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 145/168 (86%), Gaps = 2/168 (1%)
 Frame = +3

Query  81   TKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSST  260
            T+ K +P A+PL TLIGRELR +   E+P V+YG +  AK+GEDYFL+KPDC R+ G  +
Sbjct  6    TEGKLSP-ALPLATLIGRELRGDGS-ERPLVRYGHSGFAKRGEDYFLVKPDCLRVPGDPS  63

Query  261  TSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIE  440
            ++FSVFA+FDGHNG+SAA+F+KE LL +V+SA+PQG+ RE+WLQALPRALVAGFVKTDI+
Sbjct  64   SAFSVFAVFDGHNGVSAAVFSKEKLLEHVMSAVPQGISREDWLQALPRALVAGFVKTDID  123

Query  441  FQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            FQ+KGETSGTT T VV+D +TVTVASVGDSRCILDTQGG VSLLTVDH
Sbjct  124  FQRKGETSGTTATLVVVDGFTVTVASVGDSRCILDTQGGEVSLLTVDH  171



>ref|XP_008792836.1| PREDICTED: probable protein phosphatase 2C 15 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008778230.1| PREDICTED: probable protein phosphatase 2C 15 isoform X2 [Phoenix 
dactylifera]
Length=458

 Score =   258 bits (659),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LIGREL++E K+EKP ++YG AA +KKGEDYFLIK DC R+ G+ +++FSVFA+ 
Sbjct  44   VPLAVLIGRELKSE-KMEKPCIRYGCAAQSKKGEDYFLIKVDCHRLPGNPSSAFSVFAVL  102

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+A+ENLLN+VLSAIP+GL REEWLQALPRALVAGFVKTD EFQ +G+TSG
Sbjct  103  DGHNGNAAAIYARENLLNHVLSAIPRGLSREEWLQALPRALVAGFVKTDKEFQSRGQTSG  162

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+ID WT+TVASVGDSRCILD  GGVVSLLTVDH
Sbjct  163  TTVTFVIIDGWTITVASVGDSRCILDAHGGVVSLLTVDH  201



>ref|XP_007142943.1| hypothetical protein PHAVU_007G030400g [Phaseolus vulgaris]
 gb|ESW14937.1| hypothetical protein PHAVU_007G030400g [Phaseolus vulgaris]
Length=431

 Score =   257 bits (656),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ RE+++E K+EKPTV++G AA +KKGEDYFLIK DCQR+SG+ ++SFSVFAIF
Sbjct  14   VPLAALLKREMKSE-KMEKPTVRFGHAAQSKKGEDYFLIKTDCQRVSGNPSSSFSVFAIF  72

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAIF +ENLLN+VLSA+P+GLGR+EWL ALPRALVAGFVKTD EFQ +GETSG
Sbjct  73   DGHNGNAAAIFTRENLLNHVLSALPRGLGRDEWLHALPRALVAGFVKTDKEFQSRGETSG  132

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRC+LD QGG VS LTVDH
Sbjct  133  TTATFVIVDRWTVTVASVGDSRCVLDAQGGAVSSLTVDH  171



>ref|XP_010279327.1| PREDICTED: probable protein phosphatase 2C 15 [Nelumbo nucifera]
 ref|XP_010279328.1| PREDICTED: probable protein phosphatase 2C 15 [Nelumbo nucifera]
 ref|XP_010279329.1| PREDICTED: probable protein phosphatase 2C 15 [Nelumbo nucifera]
 ref|XP_010279330.1| PREDICTED: probable protein phosphatase 2C 15 [Nelumbo nucifera]
Length=437

 Score =   256 bits (654),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI REL++E K+EKP+V+YG AA ++KGEDYFL+K DCQRI G+S+++FSVFAIF
Sbjct  23   VPLAALISRELKSE-KMEKPSVRYGHAAQSRKGEDYFLVKTDCQRIPGNSSSTFSVFAIF  81

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAIF +ENLLN+VL AIP+GLG+EEWL ALPRALVAGFVKTD EFQ +GETSG
Sbjct  82   DGHNGNAAAIFTRENLLNHVLGAIPRGLGQEEWLHALPRALVAGFVKTDKEFQSRGETSG  141

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILD QGG VS+LTVDH
Sbjct  142  TTATFVIVDGWTVTVASVGDSRCILDAQGGSVSILTVDH  180



>ref|XP_004497062.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X1 
[Cicer arietinum]
 ref|XP_004497063.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X2 
[Cicer arietinum]
 ref|XP_004497064.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X3 
[Cicer arietinum]
Length=429

 Score =   255 bits (651),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ RE+++E K+EKP V+ GQAA +KKGEDYFLIK DCQR+ G+S+TSFSVFAI+
Sbjct  15   VPLAALLKREMKSE-KMEKPNVRIGQAAQSKKGEDYFLIKTDCQRVPGNSSTSFSVFAIY  73

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAIF KENLLN+VL A+ +GLGREEWLQALPRALVAGFVKTD EFQ +GETSG
Sbjct  74   DGHNGNAAAIFTKENLLNHVLCALHRGLGREEWLQALPRALVAGFVKTDKEFQSRGETSG  133

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILDTQGG V+ LTVDH
Sbjct  134  TTATFVIVDRWTVTVASVGDSRCILDTQGGAVTTLTVDH  172



>ref|XP_004299042.1| PREDICTED: probable protein phosphatase 2C 15 [Fragaria vesca 
subsp. vesca]
 ref|XP_011464089.1| PREDICTED: probable protein phosphatase 2C 15 [Fragaria vesca 
subsp. vesca]
Length=429

 Score =   254 bits (649),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI REL+NE K+EKPTV+YG AA ++KGEDYFLIK D QR+ G+S+++FS FAIF
Sbjct  14   VPLAALISRELKNE-KMEKPTVRYGHAAQSRKGEDYFLIKTDGQRVPGNSSSTFSAFAIF  72

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+ KENLLN+VLSAIP+GLGREEWLQALPRALVAGFVK D +FQ +GETSG
Sbjct  73   DGHNGNAAAIYTKENLLNHVLSAIPRGLGREEWLQALPRALVAGFVKADKDFQSRGETSG  132

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT T V++D WTVTVASVGDSRCILDTQGG VS LTVDH
Sbjct  133  TTATVVIVDGWTVTVASVGDSRCILDTQGGAVSTLTVDH  171



>ref|XP_010906996.1| PREDICTED: probable protein phosphatase 2C 3 isoform X1 [Elaeis 
guineensis]
Length=438

 Score =   254 bits (650),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI REL+NE K+EKP ++YG AA ++KGEDYFLIK DC R+ G+ +++FSVFA+F
Sbjct  24   VPLAALISRELKNE-KMEKPCIRYGCAAQSRKGEDYFLIKVDCHRLPGNPSSAFSVFAVF  82

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+A++NLLN+VLSAIP+GL REEWLQ+LPRALVAGFVKTD EFQ +G+TSG
Sbjct  83   DGHNGNAAAIYARDNLLNHVLSAIPRGLSREEWLQSLPRALVAGFVKTDKEFQSRGQTSG  142

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+ID WT+TVASVGDSRCILD  GGVVSLLTVDH
Sbjct  143  TTVTFVIIDGWTITVASVGDSRCILDAHGGVVSLLTVDH  181



>ref|XP_010532274.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010532282.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010532290.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Tarenaya 
hassleriana]
Length=409

 Score =   254 bits (648),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI RE++ E K+EKPTV+YGQAA ++KGEDYFLIK DC R+ G+S+T+FSVFAIF
Sbjct  24   VPLAALISREMKTE-KMEKPTVRYGQAAQSRKGEDYFLIKTDCLRVPGNSSTAFSVFAIF  82

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AA+F+++NLLN++L+AIP+GL REEWL ALPRALVAGFVKTD EFQ +GETSG
Sbjct  83   DGHNGNAAAVFSRDNLLNHILTAIPRGLSREEWLHALPRALVAGFVKTDKEFQSRGETSG  142

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILD QGG VS LTVDH
Sbjct  143  TTATFVIVDGWTVTVASVGDSRCILDNQGGSVSTLTVDH  181



>ref|XP_003555914.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X1 
[Glycine max]
 ref|XP_006605919.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X2 
[Glycine max]
 ref|XP_006605920.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X3 
[Glycine max]
 gb|KHN11390.1| Hypothetical protein glysoja_015285 [Glycine soja]
Length=431

 Score =   254 bits (649),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ RE+++E K+EKPTV+ G AA +KKGEDYFLIK DCQR+ G+S++SFSVFAIF
Sbjct  14   VPLAALLKREMKSE-KMEKPTVRVGHAAQSKKGEDYFLIKTDCQRVPGNSSSSFSVFAIF  72

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAIF +E+LLN+VL A+P+GLGR+EWLQALPRALVAGFVKTD EFQ +GETSG
Sbjct  73   DGHNGNAAAIFTREHLLNHVLGALPRGLGRDEWLQALPRALVAGFVKTDKEFQSRGETSG  132

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILDTQGG V+ LTVDH
Sbjct  133  TTATFVIVDRWTVTVASVGDSRCILDTQGGAVTSLTVDH  171



>dbj|BAK06878.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=433

 Score =   254 bits (649),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 141/162 (87%), Gaps = 1/162 (1%)
 Frame = +3

Query  99   PVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVF  278
            P A+PL TLIGRELR     E+P V+YG +  AK+GEDYFL+KPDC RI G  ++SFSVF
Sbjct  11   PPALPLATLIGRELRGGGS-ERPLVRYGHSGFAKRGEDYFLVKPDCLRIPGDPSSSFSVF  69

Query  279  AIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGE  458
            A+FDGHNG+SAA+F+KE+LL++V++A+PQG+ RE+WLQ LPRALVAGFVKTDI+FQ+KGE
Sbjct  70   AVFDGHNGVSAAVFSKEHLLDDVMNAVPQGISREDWLQVLPRALVAGFVKTDIDFQRKGE  129

Query  459  TSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
             SGTT T VVID +TVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  130  MSGTTATLVVIDGFTVTVASVGDSRCILDTQGGVVSLLTVDH  171



>gb|KHN06682.1| Hypothetical protein glysoja_021228 [Glycine soja]
Length=431

 Score =   253 bits (646),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ RE+++E K+EKPTV+ G AA +KKGEDYFLIK DCQR+ G+S++SFSV+A+F
Sbjct  14   VPLAALLKREMKSE-KMEKPTVRVGHAAQSKKGEDYFLIKTDCQRVPGNSSSSFSVYAVF  72

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAIF +E+LLN+VL A+P+GLGR+EWLQALPRALVAGFVKTD EFQ +GETSG
Sbjct  73   DGHNGNAAAIFTREHLLNHVLGALPRGLGRDEWLQALPRALVAGFVKTDKEFQSRGETSG  132

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILDTQGG V+ LTVDH
Sbjct  133  TTATFVIVDRWTVTVASVGDSRCILDTQGGAVTSLTVDH  171



>ref|XP_003558102.1| PREDICTED: probable protein phosphatase 2C 33 [Brachypodium distachyon]
Length=433

 Score =   253 bits (646),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 145/170 (85%), Gaps = 1/170 (1%)
 Frame = +3

Query  75   TMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGS  254
            + ++++  P A+PL TLIGRELR     E+P V+YG +  AK+GEDYFL+KPDC R+ G 
Sbjct  3    SASREERLPPALPLATLIGRELRGGGS-ERPLVRYGHSGFAKRGEDYFLVKPDCFRVPGD  61

Query  255  STTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTD  434
             +++FSVFA+FDGHNG+SAA+F+KE+LL +V+SA+PQG+ RE+WLQ LPRALVAGFVKTD
Sbjct  62   PSSAFSVFAVFDGHNGVSAAVFSKEHLLEDVMSAVPQGISREDWLQVLPRALVAGFVKTD  121

Query  435  IEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            I+FQ+KGE SGTT T VV+D +TVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  122  IDFQRKGEMSGTTATLVVVDGFTVTVASVGDSRCILDTQGGVVSLLTVDH  171



>ref|XP_002312412.1| phosphatase 2C family protein [Populus trichocarpa]
 gb|EEE89779.1| phosphatase 2C family protein [Populus trichocarpa]
Length=428

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI RE+  E K+EKPTVKYG AA ++KGED+FLIK DCQR+ G+S+++FSVFAIF
Sbjct  14   VPLAALISREMMIE-KMEKPTVKYGHAAQSRKGEDHFLIKMDCQRVPGNSSSTFSVFAIF  72

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+ +ENLLN++L A+P+GLGREEW+QALPRALVAGFVKTD EFQ +GETSG
Sbjct  73   DGHNGNAAAIYTRENLLNHILGAMPRGLGREEWIQALPRALVAGFVKTDKEFQSRGETSG  132

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILD QGG VS LTVDH
Sbjct  133  TTATFVIVDRWTVTVASVGDSRCILDAQGGAVSSLTVDH  171



>ref|XP_006344157.1| PREDICTED: probable protein phosphatase 2C 15-like [Solanum tuberosum]
Length=429

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI RELRNE K+EKPTV+YG AA +KKGEDY+L+  DCQR+ G+ +++FSVFAIF
Sbjct  15   VPLAALISRELRNE-KMEKPTVRYGCAAQSKKGEDYYLMTTDCQRVQGNPSSTFSVFAIF  73

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AA+F++++LLN+VL AIP GLGR+EWL ALPRALVAGFVKTD EFQ KG+TSG
Sbjct  74   DGHNGTAAAVFSRDHLLNHVLGAIPCGLGRDEWLHALPRALVAGFVKTDKEFQSKGQTSG  133

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILDTQGG VS LTVDH
Sbjct  134  TTATFVIVDRWTVTVASVGDSRCILDTQGGAVSELTVDH  172



>ref|XP_003536672.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X1 
[Glycine max]
 ref|XP_006589677.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X2 
[Glycine max]
 ref|XP_006589678.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X3 
[Glycine max]
 ref|XP_006589679.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X4 
[Glycine max]
Length=431

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ RE+++E K+EKPTV+ G AA +KKGEDYFLIK DCQR+ G+S++SFSV+A+F
Sbjct  14   VPLAALLKREMKSE-KMEKPTVRVGHAAQSKKGEDYFLIKTDCQRVPGNSSSSFSVYAVF  72

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAIF +E+LLN+VL A+P+GLGR+EWLQALPRALVAGFVKTD EFQ +GETSG
Sbjct  73   DGHNGNAAAIFTREHLLNHVLGALPRGLGRDEWLQALPRALVAGFVKTDKEFQSRGETSG  132

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILDTQGG V+ LTVDH
Sbjct  133  TTATFVIVDRWTVTVASVGDSRCILDTQGGAVTSLTVDH  171



>ref|XP_010532299.1| PREDICTED: probable protein phosphatase 2C 15 isoform X2 [Tarenaya 
hassleriana]
Length=440

 Score =   253 bits (645),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI RE++ E K+EKPTV+YGQAA ++KGEDYFLIK DC R+ G+S+T+FSVFAIF
Sbjct  24   VPLAALISREMKTE-KMEKPTVRYGQAAQSRKGEDYFLIKTDCLRVPGNSSTAFSVFAIF  82

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AA+F+++NLLN++L+AIP+GL REEWL ALPRALVAGFVKTD EFQ +GETSG
Sbjct  83   DGHNGNAAAVFSRDNLLNHILTAIPRGLSREEWLHALPRALVAGFVKTDKEFQSRGETSG  142

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILD QGG VS LTVDH
Sbjct  143  TTATFVIVDGWTVTVASVGDSRCILDNQGGSVSTLTVDH  181



>ref|XP_008446622.1| PREDICTED: LOW QUALITY PROTEIN: probable protein phosphatase 
2C 15 [Cucumis melo]
Length=434

 Score =   253 bits (645),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI +E+RNE ++EKPTV+YG AA ++KGEDYFL+K DCQR+ G+ +++FSVFAIF
Sbjct  18   VPLAALISKEVRNE-RLEKPTVRYGNAAQSRKGEDYFLMKTDCQRVPGNPSSTFSVFAIF  76

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAIF +E+LL++VL A+P+GLG+EEWLQALPRALVAGFVKTD EFQ +GETSG
Sbjct  77   DGHNGNAAAIFTREHLLSHVLGALPRGLGQEEWLQALPRALVAGFVKTDKEFQSRGETSG  136

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV+ID WTVTVASVGDSRCILDTQGG VS LTVDH
Sbjct  137  TTATFVIIDGWTVTVASVGDSRCILDTQGGAVSALTVDH  175



>ref|XP_004984655.1| PREDICTED: probable protein phosphatase 2C 33-like isoform X1 
[Setaria italica]
Length=430

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 145/168 (86%), Gaps = 2/168 (1%)
 Frame = +3

Query  81   TKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSST  260
            T+ K +P A+PL TLIGRELR +   E+P V+YG +  AK+GEDYFL+KPDC R+ G  +
Sbjct  6    TEGKLSP-ALPLATLIGRELRGDGS-ERPLVRYGHSGFAKRGEDYFLVKPDCLRVPGDPS  63

Query  261  TSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIE  440
            ++FSVFA+FDGHNG+SAA+F+KE LL +V+SA+PQG+ RE+WLQALPRALVAGFVKTDI+
Sbjct  64   SAFSVFAVFDGHNGVSAAVFSKEKLLEHVMSAVPQGISREDWLQALPRALVAGFVKTDID  123

Query  441  FQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            FQ+KGETSGTT T VV+D +TVTVASVGDSRCILDTQGG VSLLTVDH
Sbjct  124  FQRKGETSGTTATLVVVDGFTVTVASVGDSRCILDTQGGEVSLLTVDH  171



>gb|AFW88634.1| putative protein phosphatase 2C family protein [Zea mays]
Length=430

 Score =   252 bits (643),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 140/160 (88%), Gaps = 1/160 (1%)
 Frame = +3

Query  105  AVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAI  284
            A+PL TLIGRELR +   E+P V+YG +  AK+GEDYFL+KPDC R+ G  ++SFSVFA+
Sbjct  13   ALPLATLIGRELRGDG-TERPHVRYGHSGFAKRGEDYFLVKPDCLRVPGDPSSSFSVFAV  71

Query  285  FDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETS  464
            FDGHNG+SAA+F+KE LL +V+SA+P+G+ RE+WLQALPRALVAGFVKTDI+FQ+KGETS
Sbjct  72   FDGHNGVSAAVFSKEKLLEHVMSAVPEGISREDWLQALPRALVAGFVKTDIDFQRKGETS  131

Query  465  GTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GTT T VV+D +TVTVASVGDSRCILDTQGG VSLLTVDH
Sbjct  132  GTTATLVVVDGFTVTVASVGDSRCILDTQGGEVSLLTVDH  171



>ref|NP_001149558.1| LOC100283184 [Zea mays]
 gb|ACG35830.1| protein phosphatase 2C-like [Zea mays]
Length=430

 Score =   252 bits (643),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 140/160 (88%), Gaps = 1/160 (1%)
 Frame = +3

Query  105  AVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAI  284
            A+PL TLIGRELR +   E+P V+YG +  AK+GEDYFL+KPDC R+ G  ++SFSVFA+
Sbjct  13   ALPLATLIGRELRGDG-TERPHVRYGHSGFAKRGEDYFLVKPDCLRVPGDPSSSFSVFAV  71

Query  285  FDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETS  464
            FDGHNG+SAA+F+KE LL +V+SA+P+G+ RE+WLQALPRALVAGFVKTDI+FQ+KGETS
Sbjct  72   FDGHNGVSAAVFSKEKLLEHVMSAVPEGISREDWLQALPRALVAGFVKTDIDFQRKGETS  131

Query  465  GTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GTT T VV+D +TVTVASVGDSRCILDTQGG VSLLTVDH
Sbjct  132  GTTATLVVVDGFTVTVASVGDSRCILDTQGGEVSLLTVDH  171



>gb|EEC75070.1| hypothetical protein OsI_11197 [Oryza sativa Indica Group]
Length=350

 Score =   249 bits (636),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 140/160 (88%), Gaps = 1/160 (1%)
 Frame = +3

Query  105  AVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAI  284
            ++PL TLIGRELR     E+P V+YG    AK+GEDYFL+KPDC R+ G  +++FSVFA+
Sbjct  14   SLPLATLIGRELRGGGS-ERPLVRYGHFGFAKRGEDYFLVKPDCLRVPGDPSSAFSVFAV  72

Query  285  FDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETS  464
            FDGHNG+SAA+F+KE+LL +V+SA+PQG+GR++WLQALPRALVAGFVKTDI+FQ+KGE S
Sbjct  73   FDGHNGVSAAVFSKEHLLEHVMSAVPQGIGRDDWLQALPRALVAGFVKTDIDFQRKGEAS  132

Query  465  GTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GTT T VV+D +TVTVASVGDSRCILDTQGGV+SLLTVDH
Sbjct  133  GTTATLVVVDGFTVTVASVGDSRCILDTQGGVISLLTVDH  172



>ref|XP_006378470.1| hypothetical protein POPTR_0010s13130g [Populus trichocarpa]
 gb|ERP56267.1| hypothetical protein POPTR_0010s13130g [Populus trichocarpa]
Length=428

 Score =   252 bits (643),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 137/159 (86%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI RE+R E K+EKP VKYG AA ++KGEDYFLIK DCQR+ G+S+++FSVFAIF
Sbjct  14   VPLAALISREMRIE-KMEKPIVKYGHAAQSRKGEDYFLIKMDCQRLPGNSSSTFSVFAIF  72

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+ +ENLLN++L AIP+ LGREEWLQALPRALVAGFVKTD EFQ +GETSG
Sbjct  73   DGHNGNAAAIYTRENLLNHILGAIPRDLGREEWLQALPRALVAGFVKTDKEFQSRGETSG  132

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILD QGG V  LTVDH
Sbjct  133  TTATFVIVDRWTVTVASVGDSRCILDAQGGAVFSLTVDH  171



>gb|ACF87139.1| unknown [Zea mays]
 gb|AFW88633.1| putative protein phosphatase 2C family protein [Zea mays]
 gb|AIB05383.1| orphans transcription factor, partial [Zea mays]
Length=399

 Score =   251 bits (640),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 140/160 (88%), Gaps = 1/160 (1%)
 Frame = +3

Query  105  AVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAI  284
            A+PL TLIGRELR +   E+P V+YG +  AK+GEDYFL+KPDC R+ G  ++SFSVFA+
Sbjct  13   ALPLATLIGRELRGDG-TERPHVRYGHSGFAKRGEDYFLVKPDCLRVPGDPSSSFSVFAV  71

Query  285  FDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETS  464
            FDGHNG+SAA+F+KE LL +V+SA+P+G+ RE+WLQALPRALVAGFVKTDI+FQ+KGETS
Sbjct  72   FDGHNGVSAAVFSKEKLLEHVMSAVPEGISREDWLQALPRALVAGFVKTDIDFQRKGETS  131

Query  465  GTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GTT T VV+D +TVTVASVGDSRCILDTQGG VSLLTVDH
Sbjct  132  GTTATLVVVDGFTVTVASVGDSRCILDTQGGEVSLLTVDH  171



>ref|XP_007222389.1| hypothetical protein PRUPE_ppa006061mg [Prunus persica]
 gb|EMJ23588.1| hypothetical protein PRUPE_ppa006061mg [Prunus persica]
Length=429

 Score =   251 bits (642),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI REL++E K+EKPTV+YG AA ++KGEDYFLIK D QR++G+S+++FS FAIF
Sbjct  14   VPLAALISRELKSE-KMEKPTVRYGHAAQSRKGEDYFLIKTDGQRVTGNSSSTFSAFAIF  72

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AA++ +ENLL +VL AIP+GLGREEWLQALPRALVAGFVKTD +FQ +GETSG
Sbjct  73   DGHNGNAAAVYTRENLLKHVLGAIPRGLGREEWLQALPRALVAGFVKTDKDFQSRGETSG  132

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILDTQGG VS LTVDH
Sbjct  133  TTATFVIVDGWTVTVASVGDSRCILDTQGGAVSTLTVDH  171



>ref|XP_009357108.1| PREDICTED: probable protein phosphatase 2C 15 [Pyrus x bretschneideri]
Length=428

 Score =   251 bits (640),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI REL++E K+EKPTV+YG AA ++KGEDYFLIK D QR+ G+S+++FS FAIF
Sbjct  13   VPLAALISRELKSE-KMEKPTVRYGHAAQSRKGEDYFLIKTDGQRVPGNSSSAFSAFAIF  71

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AA++ +ENLL +VL AIP+GLGREEWLQALPRALVAGFVKTD +FQ +GETSG
Sbjct  72   DGHNGNAAAVYTRENLLKHVLGAIPRGLGREEWLQALPRALVAGFVKTDKDFQSRGETSG  131

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILDTQGG VS LTVDH
Sbjct  132  TTATFVIVDGWTVTVASVGDSRCILDTQGGAVSTLTVDH  170



>gb|KJB31458.1| hypothetical protein B456_005G192600 [Gossypium raimondii]
Length=427

 Score =   251 bits (640),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI RE++NE K+EKP+V+ G AA ++KGEDYFL+K DCQR+ G+ +++FSVFAIF
Sbjct  14   VPLAALISREMKNE-KMEKPSVRCGHAAQSRKGEDYFLVKTDCQRVPGNPSSTFSVFAIF  72

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAIF +E+LL+++LSA+P+GLGREEW QALPRALVAGFVKTD EFQ +GETSG
Sbjct  73   DGHNGNAAAIFTREHLLSHILSAVPRGLGREEWFQALPRALVAGFVKTDKEFQSRGETSG  132

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILDTQGG +S LTVDH
Sbjct  133  TTATFVIVDAWTVTVASVGDSRCILDTQGGGISTLTVDH  171



>ref|XP_010681640.1| PREDICTED: probable protein phosphatase 2C 15 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010681641.1| PREDICTED: probable protein phosphatase 2C 15 [Beta vulgaris 
subsp. vulgaris]
Length=425

 Score =   251 bits (640),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            +PL  LI RE++NE K+EKP+V YG AA +KKGEDY+L+K DCQR+ G+S+++FSVFAIF
Sbjct  16   IPLAALISREMKNE-KMEKPSVCYGYAAQSKKGEDYYLVKTDCQRVPGNSSSTFSVFAIF  74

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+ +ENLLN+VL+A+P+GLGR+EWL ALPRALVAGFVKTD EFQ +GETSG
Sbjct  75   DGHNGNAAAIYTRENLLNHVLAALPRGLGRDEWLHALPRALVAGFVKTDKEFQHRGETSG  134

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVA VGDSRC+LD QGG VS LTVDH
Sbjct  135  TTATFVIVDRWTVTVACVGDSRCVLDVQGGTVSDLTVDH  173



>gb|KJB31457.1| hypothetical protein B456_005G192600 [Gossypium raimondii]
 gb|KJB31459.1| hypothetical protein B456_005G192600 [Gossypium raimondii]
 gb|KJB31460.1| hypothetical protein B456_005G192600 [Gossypium raimondii]
Length=428

 Score =   251 bits (640),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI RE++NE K+EKP+V+ G AA ++KGEDYFL+K DCQR+ G+ +++FSVFAIF
Sbjct  14   VPLAALISREMKNE-KMEKPSVRCGHAAQSRKGEDYFLVKTDCQRVPGNPSSTFSVFAIF  72

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAIF +E+LL+++LSA+P+GLGREEW QALPRALVAGFVKTD EFQ +GETSG
Sbjct  73   DGHNGNAAAIFTREHLLSHILSAVPRGLGREEWFQALPRALVAGFVKTDKEFQSRGETSG  132

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILDTQGG +S LTVDH
Sbjct  133  TTATFVIVDAWTVTVASVGDSRCILDTQGGGISTLTVDH  171



>ref|XP_008339644.1| PREDICTED: probable protein phosphatase 2C 15 [Malus domestica]
Length=428

 Score =   251 bits (640),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI REL++E K+EKPTV+YG AA ++KGEDYFLIK D QR+ G+S+++FS FAIF
Sbjct  13   VPLAALISRELKSE-KMEKPTVRYGHAAQSRKGEDYFLIKTDGQRVPGNSSSAFSAFAIF  71

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AA++ +ENLL +VL AIP+GLGREEWLQALPRALVAGFVKTD +FQ +GETSG
Sbjct  72   DGHNGNAAAVYTRENLLKHVLGAIPRGLGREEWLQALPRALVAGFVKTDKDFQSRGETSG  131

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILDTQGG VS LTVDH
Sbjct  132  TTATFVIVDGWTVTVASVGDSRCILDTQGGAVSTLTVDH  170



>ref|XP_011022405.1| PREDICTED: probable protein phosphatase 2C 15 [Populus euphratica]
 ref|XP_011022414.1| PREDICTED: probable protein phosphatase 2C 15 [Populus euphratica]
 ref|XP_011022422.1| PREDICTED: probable protein phosphatase 2C 15 [Populus euphratica]
 ref|XP_011022430.1| PREDICTED: probable protein phosphatase 2C 15 [Populus euphratica]
 ref|XP_011022439.1| PREDICTED: probable protein phosphatase 2C 15 [Populus euphratica]
 ref|XP_011022447.1| PREDICTED: probable protein phosphatase 2C 15 [Populus euphratica]
Length=428

 Score =   251 bits (640),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 138/159 (87%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI RE+R E K+EKPTVKYG AA ++KGED+FLIK DCQR+ G+S++SFSVFAIF
Sbjct  14   VPLAALISREMRIE-KMEKPTVKYGHAAQSRKGEDHFLIKMDCQRVPGNSSSSFSVFAIF  72

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+ +ENLLN++L A+P GLGREEW+QALPRALVAGFVKTD EFQ +GETSG
Sbjct  73   DGHNGNAAAIYTRENLLNHILGAMPCGLGREEWIQALPRALVAGFVKTDKEFQSRGETSG  132

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D  TVTVASVGDSRCILD QGG VS LTVDH
Sbjct  133  TTATFVIVDRRTVTVASVGDSRCILDAQGGAVSSLTVDH  171



>ref|XP_010320753.1| PREDICTED: probable protein phosphatase 2C 15 [Solanum lycopersicum]
 ref|XP_010320754.1| PREDICTED: probable protein phosphatase 2C 15 [Solanum lycopersicum]
Length=429

 Score =   251 bits (640),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI RELRNE K+EKPTV+YG AA +KKGEDY+L+  DCQRI G+ +++FSVFAIF
Sbjct  15   VPLAALISRELRNE-KMEKPTVRYGCAAQSKKGEDYYLMTTDCQRIHGNPSSAFSVFAIF  73

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AA++++++LLN+VL AIP GLGR+EWLQALPRALV GFVKTD EFQ+KG TSG
Sbjct  74   DGHNGTAAAVYSRDHLLNHVLGAIPCGLGRDEWLQALPRALVVGFVKTDKEFQKKGLTSG  133

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILDTQGG VS LTVDH
Sbjct  134  TTATFVIVDRWTVTVASVGDSRCILDTQGGAVSELTVDH  172



>ref|XP_002465394.1| hypothetical protein SORBIDRAFT_01g037810 [Sorghum bicolor]
 gb|EER92392.1| hypothetical protein SORBIDRAFT_01g037810 [Sorghum bicolor]
Length=431

 Score =   250 bits (639),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 138/159 (87%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            +PL TLIGRELR +   E+P V+YG +  AK+GEDYFL+KPDC R+ G  ++SFSVFA+F
Sbjct  15   LPLATLIGRELRGDG-TERPHVRYGHSGFAKRGEDYFLVKPDCLRVPGDPSSSFSVFAVF  73

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG+SAA+F+KE LL +V+SA+PQG+ RE+WLQALPRALVAGFVKTDI+FQ+KGETSG
Sbjct  74   DGHNGVSAAVFSKEKLLEHVMSAVPQGISREDWLQALPRALVAGFVKTDIDFQRKGETSG  133

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT T VV+D +TVTVASVGDSRCILDT GG VSLLTVDH
Sbjct  134  TTATLVVVDGFTVTVASVGDSRCILDTHGGEVSLLTVDH  172



>ref|XP_004135083.1| PREDICTED: probable protein phosphatase 2C 15-like [Cucumis sativus]
 ref|XP_004159290.1| PREDICTED: probable protein phosphatase 2C 15-like [Cucumis sativus]
 gb|KGN52100.1| hypothetical protein Csa_5G610350 [Cucumis sativus]
Length=433

 Score =   250 bits (638),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI +E+R+E ++EKPTV+YG AA ++KGEDYFL+K DCQR+ G+ +++FSVFAIF
Sbjct  18   VPLAALISKEVRSE-RLEKPTVRYGNAAQSRKGEDYFLMKTDCQRVPGNPSSTFSVFAIF  76

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAIF +E+LL +VL A+P+GLG+EEWLQALPRALVAGFVKTD EFQ +GETSG
Sbjct  77   DGHNGNAAAIFTREHLLTHVLGALPRGLGQEEWLQALPRALVAGFVKTDKEFQSRGETSG  136

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV+ID WTVTVASVGDSRCILDTQGG VS LTVDH
Sbjct  137  TTATFVIIDGWTVTVASVGDSRCILDTQGGAVSALTVDH  175



>ref|NP_001049866.1| Os03g0301700 [Oryza sativa Japonica Group]
 sp|Q10MN6.1|P2C33_ORYSJ RecName: Full=Probable protein phosphatase 2C 33; Short=OsPP2C33 
[Oryza sativa Japonica Group]
 gb|ABF95489.1| protein phosphatase 2C, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11780.1| Os03g0301700 [Oryza sativa Japonica Group]
 dbj|BAG95269.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95599.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97753.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58898.1| hypothetical protein OsJ_10527 [Oryza sativa Japonica Group]
Length=432

 Score =   250 bits (638),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 140/160 (88%), Gaps = 1/160 (1%)
 Frame = +3

Query  105  AVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAI  284
            ++PL TLIGRELR     E+P V+YG    AK+GEDYFL+KPDC R+ G  +++FSVFA+
Sbjct  14   SLPLATLIGRELRGGGS-ERPLVRYGHFGFAKRGEDYFLVKPDCLRVPGDPSSAFSVFAV  72

Query  285  FDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETS  464
            FDGHNG+SAA+F+KE+LL +V+SA+PQG+GR++WLQALPRALVAGFVKTDI+FQ+KGE S
Sbjct  73   FDGHNGVSAAVFSKEHLLEHVMSAVPQGIGRDDWLQALPRALVAGFVKTDIDFQRKGEAS  132

Query  465  GTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GTT T VV+D +TVTVASVGDSRCILDTQGGV+SLLTVDH
Sbjct  133  GTTATLVVVDGFTVTVASVGDSRCILDTQGGVISLLTVDH  172



>ref|XP_008389261.1| PREDICTED: probable protein phosphatase 2C 15 [Malus domestica]
 ref|XP_008360042.1| PREDICTED: probable protein phosphatase 2C 15 [Malus domestica]
Length=427

 Score =   249 bits (637),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI REL++E K+EKPTV+YG AA ++KGEDYFLIK D QR+ G+S+++F+ FAIF
Sbjct  13   VPLAALISRELKSE-KMEKPTVRYGHAAQSRKGEDYFLIKTDGQRVPGNSSSAFTAFAIF  71

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AA++ +ENLL +VL AIP+GLGREEWLQALPRALVAGFVKTD +FQ +GETSG
Sbjct  72   DGHNGNAAAVYTRENLLKHVLGAIPRGLGREEWLQALPRALVAGFVKTDKDFQSRGETSG  131

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILDTQGG VS LTVDH
Sbjct  132  TTATFVIVDGWTVTVASVGDSRCILDTQGGAVSTLTVDH  170



>ref|XP_009356234.1| PREDICTED: probable protein phosphatase 2C 15 [Pyrus x bretschneideri]
Length=428

 Score =   249 bits (637),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI REL++E K+EKPTV+YG AA ++KGEDYFLIK D QR+ G+S+++F+ FAIF
Sbjct  13   VPLAALISRELKSE-KMEKPTVRYGHAAQSRKGEDYFLIKTDGQRVPGNSSSAFTAFAIF  71

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AA++ +ENLL +VL AIP+GLGREEWLQALPRALVAGFVKTD +FQ +GETSG
Sbjct  72   DGHNGNAAAVYTRENLLKHVLGAIPRGLGREEWLQALPRALVAGFVKTDKDFQSRGETSG  131

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILDTQGG VS LTVDH
Sbjct  132  TTATFVIVDGWTVTVASVGDSRCILDTQGGAVSTLTVDH  170



>ref|XP_010044241.1| PREDICTED: probable protein phosphatase 2C 15 [Eucalyptus grandis]
 gb|KCW86301.1| hypothetical protein EUGRSUZ_B02992 [Eucalyptus grandis]
Length=428

 Score =   249 bits (636),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 142/159 (89%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI RE++NE K+EKPTV+YG A+ +KKGED+FLIK DCQR+ G+ ++++SVFA+F
Sbjct  14   VPLAALINREMKNE-KLEKPTVRYGCASQSKKGEDFFLIKTDCQRVPGNPSSAYSVFAVF  72

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI++KE+LLN+++SA+P+GLGRE+WLQALPRALVAGFVKTD EFQ++GETSG
Sbjct  73   DGHNGNAAAIYSKEHLLNHIISAMPRGLGREDWLQALPRALVAGFVKTDKEFQRRGETSG  132

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVA VGDSRC+LD QGG VS LTVDH
Sbjct  133  TTATFVIVDGWTVTVACVGDSRCVLDAQGGAVSNLTVDH  171



>ref|XP_011076426.1| PREDICTED: probable protein phosphatase 2C 15 isoform X3 [Sesamum 
indicum]
Length=377

 Score =   247 bits (631),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 137/159 (86%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI REL+NE K+E+PTV+YG AA ++KGEDYF +K DCQR+ G+ +T FSVF IF
Sbjct  15   VPLAALISRELKNE-KMERPTVRYGSAAQSRKGEDYFFMKTDCQRVPGNPSTFFSVFGIF  73

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAIF++++LLN VL AIP+GLGR+EWL ALPRALVAGFVKTD EFQ KG+TSG
Sbjct  74   DGHNGSAAAIFSRDHLLNYVLDAIPRGLGRDEWLHALPRALVAGFVKTDKEFQSKGKTSG  133

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILD QGG VS+LTVDH
Sbjct  134  TTATFVIVDGWTVTVASVGDSRCILDAQGGGVSVLTVDH  172



>ref|XP_008243272.1| PREDICTED: LOW QUALITY PROTEIN: probable protein phosphatase 
2C 15 [Prunus mume]
Length=431

 Score =   248 bits (633),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 138/159 (87%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI REL++E K+EKPTV+YG AA ++KGEDYFLIK D QR+ G+S+++FS FAIF
Sbjct  14   VPLAALISRELKSE-KMEKPTVRYGHAAQSRKGEDYFLIKTDGQRVPGNSSSTFSAFAIF  72

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AA++ +ENLL +VL AIP+GLGREEWLQALPRALVAGFVKTD +FQ +GETSG
Sbjct  73   DGHNGNAAAVYTRENLLKHVLGAIPRGLGREEWLQALPRALVAGFVKTDKDFQSRGETSG  132

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILDTQGG V  LTVDH
Sbjct  133  TTATFVIVDGWTVTVASVGDSRCILDTQGGAVCTLTVDH  171



>ref|XP_011076418.1| PREDICTED: probable protein phosphatase 2C 15 isoform X2 [Sesamum 
indicum]
Length=414

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 137/159 (86%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI REL+NE K+E+PTV+YG AA ++KGEDYF +K DCQR+ G+ +T FSVF IF
Sbjct  15   VPLAALISRELKNE-KMERPTVRYGSAAQSRKGEDYFFMKTDCQRVPGNPSTFFSVFGIF  73

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAIF++++LLN VL AIP+GLGR+EWL ALPRALVAGFVKTD EFQ KG+TSG
Sbjct  74   DGHNGSAAAIFSRDHLLNYVLDAIPRGLGRDEWLHALPRALVAGFVKTDKEFQSKGKTSG  133

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILD QGG VS+LTVDH
Sbjct  134  TTATFVIVDGWTVTVASVGDSRCILDAQGGGVSVLTVDH  172



>ref|NP_001060712.1| Os07g0690400 [Oryza sativa Japonica Group]
 dbj|BAC83509.1| protein phosphatase 2C-like [Oryza sativa Japonica Group]
 dbj|BAF22626.1| Os07g0690400 [Oryza sativa Japonica Group]
 gb|EAZ05225.1| hypothetical protein OsI_27423 [Oryza sativa Indica Group]
 dbj|BAG90982.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86930.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67858.1| hypothetical protein OsJ_25666 [Oryza sativa Japonica Group]
Length=431

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 143/169 (85%), Gaps = 1/169 (1%)
 Frame = +3

Query  78   MTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSS  257
            + K++  P A+PL TLIGRELR     E+P+++YG A  AK+GEDYFL+KPDC R+ G +
Sbjct  4    IAKERRLPPALPLATLIGRELRAGGS-ERPSLRYGHAGFAKRGEDYFLVKPDCLRVPGDT  62

Query  258  TTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDI  437
            +T+FSVFA+FDGHNG+SAA+++KE+LL +V+SA+P  +GR++WLQALPRALVAGFVK DI
Sbjct  63   STAFSVFAVFDGHNGVSAAVYSKEHLLEHVMSALPPDIGRDDWLQALPRALVAGFVKADI  122

Query  438  EFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            +FQ+KGE SGTT T VV+D +TVTVASVGDSRCILDTQGG V LLTVDH
Sbjct  123  DFQRKGEVSGTTATLVVVDGFTVTVASVGDSRCILDTQGGEVQLLTVDH  171



>ref|XP_011076402.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Sesamum 
indicum]
 ref|XP_011076409.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Sesamum 
indicum]
Length=428

 Score =   247 bits (631),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 137/159 (86%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI REL+NE K+E+PTV+YG AA ++KGEDYF +K DCQR+ G+ +T FSVF IF
Sbjct  15   VPLAALISRELKNE-KMERPTVRYGSAAQSRKGEDYFFMKTDCQRVPGNPSTFFSVFGIF  73

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAIF++++LLN VL AIP+GLGR+EWL ALPRALVAGFVKTD EFQ KG+TSG
Sbjct  74   DGHNGSAAAIFSRDHLLNYVLDAIPRGLGRDEWLHALPRALVAGFVKTDKEFQSKGKTSG  133

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILD QGG VS+LTVDH
Sbjct  134  TTATFVIVDGWTVTVASVGDSRCILDAQGGGVSVLTVDH  172



>gb|KHG10433.1| hypothetical protein F383_12376 [Gossypium arboreum]
Length=426

 Score =   247 bits (630),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 139/159 (87%), Gaps = 3/159 (2%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI RE++NE K+EKP+V+YG AA ++KGEDYFL+K DCQR+ G+ +++FSVFAIF
Sbjct  14   VPLAALISREMKNE-KMEKPSVRYGHAAQSRKGEDYFLVKTDCQRVPGNPSSTFSVFAIF  72

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAIF +E+LL+++LSA+P+GLGREEW QALPRALVAGFVKTD EFQ   ETSG
Sbjct  73   DGHNGNAAAIFTREHLLSHILSAVPRGLGREEWFQALPRALVAGFVKTDKEFQS--ETSG  130

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV+ID WTVTVASVGDSRCILDTQGG +S LTVDH
Sbjct  131  TTATFVIIDAWTVTVASVGDSRCILDTQGGGISTLTVDH  169



>gb|EMT27882.1| Putative protein phosphatase 2C 33 [Aegilops tauschii]
Length=408

 Score =   246 bits (627),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 145/176 (82%), Gaps = 7/176 (4%)
 Frame = +3

Query  75   TMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGS  254
            + + ++  P A+PL TLIGRELR     E+P V+ G +  AK+GEDYFL+KPDC RI G 
Sbjct  3    SASNEEMLPPALPLATLIGRELRGGGS-ERPLVRSGHSGFAKRGEDYFLVKPDCLRIPGD  61

Query  255  STTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTD  434
             +++FSVFA+FDGHNG+SAA+F+KE+LL++V+SA+PQG+ RE+WLQ LPRALVAGFVKTD
Sbjct  62   PSSAFSVFAVFDGHNGVSAAVFSKEHLLDDVMSAVPQGISREDWLQVLPRALVAGFVKTD  121

Query  435  IEFQQKGET------SGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            I+FQ+KGET      SGTT T VVID +TVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  122  IDFQRKGETQREGEMSGTTATLVVIDGFTVTVASVGDSRCILDTQGGVVSLLTVDH  177



>ref|XP_010922151.1| PREDICTED: probable protein phosphatase 2C 3 [Elaeis guineensis]
 ref|XP_010922158.1| PREDICTED: probable protein phosphatase 2C 3 [Elaeis guineensis]
Length=432

 Score =   246 bits (629),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 138/159 (87%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL++E K+E+P ++YG AA +KKGEDYFL+K DCQR+ G+ +++F VFA+F
Sbjct  18   VPLAALMKRELKSE-KMERPCIRYGCAAQSKKGEDYFLMKTDCQRLPGNPSSTFCVFAVF  76

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+ ++NLLN+VLSAIP+GL REEWLQALPRALVAGFVK D EFQ +G+TSG
Sbjct  77   DGHNGNAAAIYTRDNLLNHVLSAIPRGLSREEWLQALPRALVAGFVKADKEFQSRGQTSG  136

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV+ID WT+TVASVGDSRCILD Q GVVSLLTVDH
Sbjct  137  TTATFVIIDGWTITVASVGDSRCILDAQSGVVSLLTVDH  175



>ref|XP_008797622.1| PREDICTED: probable protein phosphatase 2C 3 [Phoenix dactylifera]
Length=434

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 138/159 (87%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI REL++E K+E+P ++YG AA +KKGEDYF +K DC R+ G+ +++FSVFA+F
Sbjct  20   VPLAALIRRELKSE-KMERPCIRYGCAAQSKKGEDYFFMKTDCHRLPGNPSSTFSVFAVF  78

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+ ++NLLN+VLSAIP+GL REEWLQALPRALVAGFVKTD EFQ +G+TSG
Sbjct  79   DGHNGNAAAIYTRDNLLNHVLSAIPRGLSREEWLQALPRALVAGFVKTDKEFQSRGQTSG  138

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV+ID WT+TVASVGDSRCILD + GVVSLLTVDH
Sbjct  139  TTATFVIIDGWTITVASVGDSRCILDARSGVVSLLTVDH  177



>ref|XP_009385409.1| PREDICTED: probable protein phosphatase 2C 3 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009385410.1| PREDICTED: probable protein phosphatase 2C 3 [Musa acuminata 
subsp. malaccensis]
Length=432

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 142/176 (81%), Gaps = 1/176 (1%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            M+  +    ++  +   VPL  LIG E R E K+E+P ++YG AA +KKGEDYFLI+ DC
Sbjct  1    MAGGDGERRRRHSSGAMVPLALLIGEEARME-KMERPRIRYGCAAQSKKGEDYFLIRTDC  59

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
             R+ G  ++SFSVFA+ DGHNG +AAI+ ++NLLN+V+ AIP GLGREEWLQALPRALVA
Sbjct  60   CRVLGDPSSSFSVFAVLDGHNGNAAAIYTRDNLLNHVMGAIPHGLGREEWLQALPRALVA  119

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTD EFQ+KG+TSGTTVTFV+ID WT+TVASVGDSRCILD QGGV+S LTVDH
Sbjct  120  GFVKTDKEFQRKGQTSGTTVTFVIIDGWTITVASVGDSRCILDAQGGVISALTVDH  175



>ref|XP_002461259.1| hypothetical protein SORBIDRAFT_02g043760 [Sorghum bicolor]
 gb|EER97780.1| hypothetical protein SORBIDRAFT_02g043760 [Sorghum bicolor]
Length=429

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 139/171 (81%), Gaps = 1/171 (1%)
 Frame = +3

Query  72   VTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISG  251
             T  + +  P A+PL TLIGRELR     E+P ++YG A  AK+GEDYFL+KPDC R+ G
Sbjct  2    ATAARDRRLPPALPLATLIGRELRAGGS-ERPALRYGHAGFAKRGEDYFLVKPDCLRVPG  60

Query  252  SSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKT  431
               ++FSVFA+FDGHNG+SAA+++KE+LL +V+SA+P  +GRE+WLQALPRALVAGFVK 
Sbjct  61   DPASAFSVFAVFDGHNGVSAAVYSKEHLLEHVMSALPPDIGREDWLQALPRALVAGFVKA  120

Query  432  DIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            DI+FQ+KGE SGTT T VVID +TVTVASVGDSRCILDTQGG + LLTVDH
Sbjct  121  DIDFQRKGEVSGTTATLVVIDGFTVTVASVGDSRCILDTQGGELQLLTVDH  171



>gb|EPS73050.1| hypothetical protein M569_01706, partial [Genlisea aurea]
Length=436

 Score =   244 bits (623),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 137/159 (86%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI RE +N+ K+EKPTV+YG AA ++KGEDYFL+K DC R+ G+ +TSFSVF IF
Sbjct  18   VPLAALISREFKND-KLEKPTVRYGSAAQSRKGEDYFLMKNDCHRVPGNLSTSFSVFGIF  76

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAIF++++LLN VL AIP+GLGR+EWL ALPRALVAGFVKTD EFQ KG+TSG
Sbjct  77   DGHNGSAAAIFSRDHLLNYVLDAIPRGLGRDEWLHALPRALVAGFVKTDKEFQSKGKTSG  136

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILD+ GG VS+LTVDH
Sbjct  137  TTATFVIVDGWTVTVASVGDSRCILDSPGGGVSVLTVDH  175



>ref|XP_010099267.1| putative protein phosphatase 2C 15 [Morus notabilis]
 gb|EXB77531.1| putative protein phosphatase 2C 15 [Morus notabilis]
Length=526

 Score =   246 bits (628),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 138/159 (87%), Gaps = 2/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI RE+++E K+EKPTV+ G AA ++KGEDYFL+K DCQR+ G+ +T+FS FAIF
Sbjct  17   VPLAALISREMKSE-KMEKPTVRCGYAAQSRKGEDYFLMKTDCQRVPGNPSTTFSAFAIF  75

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAIF +ENLLN+VL AIP+ LGR+EWLQALPRALVAGFVKTD EFQ +GETSG
Sbjct  76   DGHNGNAAAIFTRENLLNHVLGAIPRDLGRDEWLQALPRALVAGFVKTDKEFQSRGETSG  135

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVASVGDSRCILDTQGG VS LTVDH
Sbjct  136  TTATFVIVDGWTVTVASVGDSRCILDTQGG-VSTLTVDH  173



>ref|NP_001140347.1| putative protein phosphatase 2C family protein [Zea mays]
 gb|ACF83634.1| unknown [Zea mays]
 gb|ACN31638.1| unknown [Zea mays]
 gb|ACN31791.1| unknown [Zea mays]
 tpg|DAA41819.1| TPA: putative protein phosphatase 2C family protein [Zea mays]
 gb|AIB05717.1| orphans transcription factor, partial [Zea mays]
Length=429

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 139/171 (81%), Gaps = 1/171 (1%)
 Frame = +3

Query  72   VTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISG  251
             T  +++  P A+PL TLIGRELR     E+P ++YG A  AK+GEDYFL+KPDC R+ G
Sbjct  2    ATAARERRLPPALPLATLIGRELRAGGS-ERPALRYGHAGFAKRGEDYFLVKPDCLRVPG  60

Query  252  SSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKT  431
               ++FSVFA+FDGHNG+SAA+++KE+LL +V+SA+   +GRE+WLQALPRALVAGFVK 
Sbjct  61   DPASAFSVFAVFDGHNGVSAAVYSKEHLLEHVMSALSPDIGREDWLQALPRALVAGFVKA  120

Query  432  DIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            DI+FQ+KGE SGTT T VVID +TVTVASVGDSRCILDTQGG + LLTVDH
Sbjct  121  DIDFQRKGEVSGTTATLVVIDGFTVTVASVGDSRCILDTQGGELQLLTVDH  171



>ref|NP_001141091.1| putative protein phosphatase 2C family protein [Zea mays]
 gb|ACF78579.1| unknown [Zea mays]
 gb|ACG37352.1| Ca2+/calmodulin-dependent protein kinase phosphatase [Zea mays]
 tpg|DAA64230.1| TPA: putative protein phosphatase 2C family protein [Zea mays]
 gb|AIB05716.1| orphans transcription factor, partial [Zea mays]
Length=429

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 139/170 (82%), Gaps = 1/170 (1%)
 Frame = +3

Query  75   TMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGS  254
            T  +++  P  +PL TLIGRELR     E+P ++YG A  AK+GEDYFL+KPDC R+ G 
Sbjct  3    TAARERRLPPTLPLATLIGRELRAGGS-ERPALRYGHAGFAKRGEDYFLVKPDCVRVPGD  61

Query  255  STTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTD  434
              ++FSVFA+FDGHNG+SAA+++KE+LL +V+SA+P  +GR++WLQALPRALVAGFVK D
Sbjct  62   PASAFSVFAVFDGHNGVSAAVYSKEHLLEHVMSALPPDIGRDDWLQALPRALVAGFVKAD  121

Query  435  IEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            I+FQ+KGE SGTT T VVID +TVTVASVGDSRCILDTQGG + LLTVDH
Sbjct  122  IDFQRKGEVSGTTATLVVIDGFTVTVASVGDSRCILDTQGGELQLLTVDH  171



>ref|XP_003562410.1| PREDICTED: probable protein phosphatase 2C 33 [Brachypodium distachyon]
Length=432

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 137/163 (84%), Gaps = 2/163 (1%)
 Frame = +3

Query  99   PVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVF  278
            P A+PL TLIGRELR     E+P ++YG A  AK+GEDYFL+KPDC R+ G  +T+FSVF
Sbjct  12   PPALPLATLIGRELRAGGS-ERPALRYGHAGFAKRGEDYFLVKPDCLRVPGDPSTAFSVF  70

Query  279  AIFDGHNGISAAIFAKENLLNNVLSAIPQGLG-REEWLQALPRALVAGFVKTDIEFQQKG  455
            A+FDGHNG+SAA+F+KE+LL +V+SA+P  +G REEWLQALPRALVAGFVK DIEFQ+KG
Sbjct  71   AVFDGHNGVSAAVFSKEHLLEHVMSALPPDIGGREEWLQALPRALVAGFVKADIEFQRKG  130

Query  456  ETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            E SGTT T VV+D +TVTVASVGDSRCILDTQGG + LLTVDH
Sbjct  131  EVSGTTATLVVVDGFTVTVASVGDSRCILDTQGGELQLLTVDH  173



>dbj|BAJ94997.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=433

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 140/168 (83%), Gaps = 2/168 (1%)
 Frame = +3

Query  84   KQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTT  263
            +++  P A+PL TLIGRELR     E+P ++YG A  AK+GEDYFL+KPDC R+ G  +T
Sbjct  7    ERRKLPPALPLATLIGRELRAGGS-ERPALRYGHAGFAKRGEDYFLVKPDCLRVPGDPST  65

Query  264  SFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLG-REEWLQALPRALVAGFVKTDIE  440
            +FSVFA+FDGHNG+SAA+F+KE+LL +V+SA+P  +G REEWLQALPRALVAGFVK DI+
Sbjct  66   AFSVFAVFDGHNGVSAAVFSKEHLLEHVMSALPPDIGGREEWLQALPRALVAGFVKADID  125

Query  441  FQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            FQ+KGE SGTT T VV+D +TVTVASVGDSRCILDTQGG + LLTVDH
Sbjct  126  FQRKGEVSGTTATLVVVDGFTVTVASVGDSRCILDTQGGELQLLTVDH  173



>emb|CAN74505.1| hypothetical protein VITISV_015889 [Vitis vinifera]
Length=406

 Score =   241 bits (616),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 135/176 (77%), Gaps = 29/176 (16%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MSE EV+  K       VPL TLIGRELRNE KVEKP +KYGQAALAKKGEDYFLIK DC
Sbjct  1    MSETEVSRMKSS----LVPLATLIGRELRNE-KVEKPYIKYGQAALAKKGEDYFLIKTDC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            QR+ G+ +TSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQG+GRE            
Sbjct  56   QRVPGNPSTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGIGRE------------  103

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
                        GETSGTTVTFVVID WTVTVASVGDSRCILDTQGGVVSLLTVDH
Sbjct  104  ------------GETSGTTVTFVVIDGWTVTVASVGDSRCILDTQGGVVSLLTVDH  147



>gb|EMS67839.1| putative protein phosphatase 2C 33 [Triticum urartu]
Length=505

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 146/200 (73%), Gaps = 31/200 (16%)
 Frame = +3

Query  75   TMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGS  254
            + + ++  P A+PL TLIGRELR     E+P V+YG +  AK+GEDYFL+KPDC R+ G 
Sbjct  3    SASNEETLPPALPLATLIGRELRGGGS-ERPLVRYGHSGFAKRGEDYFLVKPDCLRVPGD  61

Query  255  STTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTD  434
             +++FSVFA+FDGHNG+SAA+F+KE+LL++V+SA+PQG+ RE+WLQ LPRALVAGFVKTD
Sbjct  62   PSSAFSVFAVFDGHNGVSAAVFSKEHLLDDVMSAVPQGISREDWLQVLPRALVAGFVKTD  121

Query  435  IEFQQKGET------------------------------SGTTVTFVVIDEWTVTVASVG  524
            I+FQ+KGET                              SGTT T VVID +TVTVASVG
Sbjct  122  IDFQRKGETQREVLAMPLYSPANLITKMLLTLGIGAGEMSGTTATLVVIDGFTVTVASVG  181

Query  525  DSRCILDTQGGVVSLLTVDH  584
            DSRCILDTQGGVVSLLTVDH
Sbjct  182  DSRCILDTQGGVVSLLTVDH  201



>ref|XP_004958778.1| PREDICTED: probable protein phosphatase 2C 33-like [Setaria italica]
Length=430

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = +3

Query  120  TLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIFDGHN  299
            TLIGRELR  +  E+PT++YG A  AK+GEDYFL+KPDC R+ G  +++FSVFA+FDGHN
Sbjct  19   TLIGRELR-AAGSERPTLRYGHAGFAKRGEDYFLVKPDCLRVPGDPSSAFSVFAVFDGHN  77

Query  300  GISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSGTTVT  479
            G+SAA+++KE+LL +V+SA+P  +GR++WLQALPRALVAGFVK DI+FQ+KGE SGTT T
Sbjct  78   GVSAAVYSKEHLLEHVISALPPDIGRDDWLQALPRALVAGFVKADIDFQRKGEVSGTTAT  137

Query  480  FVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
             VVID +TVTVASVGDSRCILDTQGG + LLTVDH
Sbjct  138  LVVIDGFTVTVASVGDSRCILDTQGGELQLLTVDH  172



>emb|CDX81511.1| BnaC02g18150D [Brassica napus]
Length=438

 Score =   233 bits (595),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 133/159 (84%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ RE R  +K+EKP V+YG+AA ++KGEDY LI  D  R+  +S+T+FSVFAIF
Sbjct  15   VPLAALLSRETR-AAKMEKPIVRYGEAAQSRKGEDYLLINTDTLRLPPNSSTAFSVFAIF  73

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AA+F +ENLLN+VLSA+P+GL R+EWLQALPRALV+GFVKTD EFQ +GETSG
Sbjct  74   DGHNGKAAAVFTRENLLNHVLSALPRGLSRDEWLQALPRALVSGFVKTDKEFQSRGETSG  133

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVA VGDSRCILDT GG VS LTVDH
Sbjct  134  TTATFVIVDGWTVTVACVGDSRCILDTSGGSVSNLTVDH  172



>ref|NP_177008.1| putative protein phosphatase 2C 15 [Arabidopsis thaliana]
 ref|NP_001031252.1| putative protein phosphatase 2C 15 [Arabidopsis thaliana]
 sp|Q9M9C6.1|P2C15_ARATH RecName: Full=Probable protein phosphatase 2C 15; Short=AtPP2C15 
[Arabidopsis thaliana]
 gb|AAF26041.1|AC015986_4 putative protein phosphatase; 14863-16856 [Arabidopsis thaliana]
 gb|AAK92818.1| putative protein phosphatase [Arabidopsis thaliana]
 gb|AAM14234.1| putative protein phosphatase [Arabidopsis thaliana]
 gb|AEE34790.1| putative protein phosphatase 2C 15 [Arabidopsis thaliana]
 gb|AEE34791.1| putative protein phosphatase 2C 15 [Arabidopsis thaliana]
Length=436

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 133/159 (84%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI RE +  +K+EKP V++GQAA ++KGEDY LIK D  R+  +S+T+FSVFA+F
Sbjct  19   VPLAALISRETK-AAKMEKPIVRFGQAAQSRKGEDYVLIKTDSLRVPSNSSTAFSVFAVF  77

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AA++ +ENLLN+V+SA+P GL R+EWL ALPRALV+GFVKTD EFQ +GETSG
Sbjct  78   DGHNGKAAAVYTRENLLNHVISALPSGLSRDEWLHALPRALVSGFVKTDKEFQSRGETSG  137

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVA VGDSRCILDT+GG VS LTVDH
Sbjct  138  TTATFVIVDGWTVTVACVGDSRCILDTKGGSVSNLTVDH  176



>gb|EYU30003.1| hypothetical protein MIMGU_mgv1a006840mg [Erythranthe guttata]
 gb|EYU30004.1| hypothetical protein MIMGU_mgv1a006840mg [Erythranthe guttata]
Length=429

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 133/159 (84%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI REL+ E K+EK +++ G AA ++KGEDYFLIK DCQR+ G+ +TSFSVF +F
Sbjct  15   VPLAALISRELKME-KMEKTSLRIGSAAQSRKGEDYFLIKTDCQRVPGNPSTSFSVFGLF  73

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAIF+K++LLN V+ AIP+GLGR+EWLQALPRALVAGFVKTD EFQ KG+TSG
Sbjct  74   DGHNGNAAAIFSKDHLLNYVMDAIPRGLGRDEWLQALPRALVAGFVKTDKEFQSKGKTSG  133

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV+ID   VTVASVGDSRC+LD QG  VS LT+DH
Sbjct  134  TTATFVIIDGLMVTVASVGDSRCVLDAQGCNVSDLTIDH  172



>ref|XP_002888662.1| hypothetical protein ARALYDRAFT_894606 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64921.1| hypothetical protein ARALYDRAFT_894606 [Arabidopsis lyrata subsp. 
lyrata]
Length=438

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 133/159 (84%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI RE +  +K+EKP V++GQAA ++KGEDY LIK D  R+  +S+T+FSVFA+F
Sbjct  21   VPLAALISRETK-AAKMEKPIVRFGQAAQSRKGEDYVLIKTDSLRVPSNSSTAFSVFAVF  79

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AA++ +ENLLN+V+SA+P GL R+EWL ALPRALV+GFVKTD EFQ +GETSG
Sbjct  80   DGHNGKAAAVYTRENLLNHVISALPSGLSRDEWLHALPRALVSGFVKTDKEFQSRGETSG  139

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVA VGDSRCILDT+GG VS LTVDH
Sbjct  140  TTATFVIVDGWTVTVACVGDSRCILDTKGGSVSNLTVDH  178



>ref|XP_010470790.1| PREDICTED: probable protein phosphatase 2C 15 [Camelina sativa]
 ref|XP_010470791.1| PREDICTED: probable protein phosphatase 2C 15 [Camelina sativa]
 ref|XP_010470792.1| PREDICTED: probable protein phosphatase 2C 15 [Camelina sativa]
Length=439

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 133/159 (84%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI RE +  +K+EKP V++GQAA ++KGEDY LIK D  R+  +STT+FSVFA+F
Sbjct  22   VPLAALISRETK-AAKMEKPFVRFGQAAQSRKGEDYVLIKTDSLRVPSNSTTAFSVFAVF  80

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AA+F +ENLL++V+SA+P GL R+EWL ALPRALV+GFVKTD EFQ +GETSG
Sbjct  81   DGHNGKAAAVFTRENLLDHVISALPSGLSRDEWLHALPRALVSGFVKTDKEFQSRGETSG  140

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVA VGDSRCILDT+GG VS LTVDH
Sbjct  141  TTATFVIVDGWTVTVACVGDSRCILDTKGGSVSNLTVDH  179



>dbj|BAH20040.1| AT1G68410 [Arabidopsis thaliana]
Length=436

 Score =   229 bits (583),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 133/159 (84%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI RE +  +K+EKP V++GQAA ++KGEDY LIK D  R+  +S+T+FSVFA+F
Sbjct  19   VPLAALISRETK-AAKMEKPIVRFGQAAQSRKGEDYVLIKTDSLRVPSNSSTAFSVFAVF  77

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AA++ +ENLLN+V+SA+P GL R+EWL ALPRALV+GFVKTD EFQ +GETSG
Sbjct  78   DGHNGKAAAVYTRENLLNHVISALPSGLSRDEWLHALPRALVSGFVKTDKEFQGRGETSG  137

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVA VGDSRCILDT+GG VS LTVDH
Sbjct  138  TTATFVIVDGWTVTVACVGDSRCILDTKGGSVSNLTVDH  176



>ref|XP_006302270.1| hypothetical protein CARUB_v10020313mg [Capsella rubella]
 gb|EOA35168.1| hypothetical protein CARUB_v10020313mg [Capsella rubella]
Length=437

 Score =   229 bits (583),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 133/159 (84%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI RE +  +K+EKP V++GQAA ++KGEDY LIK D  R+  +S+T+FSVFA+F
Sbjct  20   VPLAALISRETK-AAKMEKPIVRFGQAAQSRKGEDYVLIKTDSLRVPSNSSTAFSVFAVF  78

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AA+F +ENLL++V+SA+P GL R+EWL ALPRALV+GFVKTD EFQ +GETSG
Sbjct  79   DGHNGKAAAVFTRENLLDHVISALPSGLSRDEWLHALPRALVSGFVKTDKEFQSRGETSG  138

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVA VGDSRCILDT+GG VS LTVDH
Sbjct  139  TTATFVIVDGWTVTVACVGDSRCILDTKGGSVSNLTVDH  177



>ref|XP_010415460.1| PREDICTED: probable protein phosphatase 2C 15 [Camelina sativa]
Length=442

 Score =   229 bits (583),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 133/159 (84%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI RE +  +K+EKP V++GQAA ++KGEDY LIK D  R+  +S+T+FSVFA+F
Sbjct  25   VPLAALISRETK-AAKMEKPIVRFGQAAQSRKGEDYVLIKTDSLRVPSNSSTAFSVFAVF  83

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AA+F +ENLL++V+SA+P GL R+EWL ALPRALV+GFVKTD EFQ +GETSG
Sbjct  84   DGHNGKAAAVFTRENLLDHVISALPSGLSRDEWLHALPRALVSGFVKTDKEFQSRGETSG  143

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVA VGDSRCILDT+GG VS LTVDH
Sbjct  144  TTATFVIVDGWTVTVACVGDSRCILDTKGGSVSNLTVDH  182



>ref|XP_010511830.1| PREDICTED: probable protein phosphatase 2C 15 [Camelina sativa]
 ref|XP_010511832.1| PREDICTED: probable protein phosphatase 2C 15 [Camelina sativa]
Length=440

 Score =   229 bits (583),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 133/159 (84%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  LI RE +  +K+EKP V++GQAA ++KGEDY LIK D  R+  +S+T+FSVFA+F
Sbjct  23   VPLAALISRETK-AAKMEKPIVRFGQAAQSRKGEDYVLIKTDSLRVPSNSSTAFSVFAVF  81

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AA+F +ENLL++V+SA+P GL R+EWL ALPRALV+GFVKTD EFQ +GETSG
Sbjct  82   DGHNGKAAAVFTRENLLDHVISALPSGLSRDEWLHALPRALVSGFVKTDKEFQSRGETSG  141

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVA VGDSRCILDT+GG VS LTVDH
Sbjct  142  TTATFVIVDGWTVTVACVGDSRCILDTKGGSVSNLTVDH  180



>gb|ABR16488.1| unknown [Picea sitchensis]
Length=436

 Score =   226 bits (576),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 134/159 (84%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL+NE K+EKPT++ GQA  +KKGED+ LIK +CQ+I G   ++F+VFAIF
Sbjct  25   VPLAELLKRELKNE-KIEKPTIRSGQAGQSKKGEDFTLIKLECQKIPGDGASTFAVFAIF  83

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AA+++KENLL +++SA+P GL RE+WL  LPRA+VAGFVKTD EFQ K +TSG
Sbjct  84   DGHNGSAAALYSKENLLKDIMSAMPTGLSREDWLSVLPRAMVAGFVKTDKEFQVKEQTSG  143

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTV+FV+ID WT+TVASVGDSRCIL++ GG+VSLL+ DH
Sbjct  144  TTVSFVIIDGWTITVASVGDSRCILESPGGLVSLLSADH  182



>tpg|DAA50894.1| TPA: putative protein phosphatase 2C family protein [Zea mays]
Length=565

 Score =   229 bits (583),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 134/168 (80%), Gaps = 4/168 (2%)
 Frame = +3

Query  81   TKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSST  260
            T   P P+   L TLIG EL +    E+P ++YG A  AK+GEDYFL+KPDC R+ G   
Sbjct  137  TSCPPPPL---LATLIGLEL-HAGGSERPALRYGHAGFAKRGEDYFLVKPDCLRVPGDPA  192

Query  261  TSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIE  440
            ++FSVFA+FDGHNG+SAA+++KE+LL +V+SA+P  + RE+WLQALPRALVAGFVK DI+
Sbjct  193  SAFSVFAVFDGHNGVSAAVYSKEHLLEHVMSALPPDIDREDWLQALPRALVAGFVKADID  252

Query  441  FQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            FQ+KGE SGTT T VVID +TVTVASVGDSRCILDTQGG + LLTVDH
Sbjct  253  FQRKGEVSGTTATLVVIDGFTVTVASVGDSRCILDTQGGELQLLTVDH  300



>ref|XP_006855339.1| hypothetical protein AMTR_s00057p00093140 [Amborella trichopoda]
 gb|ERN16806.1| hypothetical protein AMTR_s00057p00093140 [Amborella trichopoda]
Length=412

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 136/176 (77%), Gaps = 4/176 (2%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            M ++E    K+ P     PL TLI RELRN+ +VEKP+++YG A+ AKKGEDYFLI+ DC
Sbjct  12   MGDSEPEEAKRSPL---TPLATLISRELRND-RVEKPSLRYGHASQAKKGEDYFLIRTDC  67

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVA  416
            Q I G   + F+VFA+FDGH G +AA+FAKENLLN+++SA+P+   R+EW + LP+ALVA
Sbjct  68   QIIPGFPKSDFAVFAVFDGHEGNAAALFAKENLLNHIVSAMPRCADRKEWSRNLPQALVA  127

Query  417  GFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GFVKTD +F+ +G+ SGTT T V+ID WTVTVASVGDSRCILD   G VSLLTVDH
Sbjct  128  GFVKTDKDFRSRGDNSGTTATLVIIDGWTVTVASVGDSRCILDLHDGAVSLLTVDH  183



>ref|XP_008797259.1| PREDICTED: probable protein phosphatase 2C 12 isoform X3 [Phoenix 
dactylifera]
Length=432

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 128/159 (81%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL +E K+EKP + +GQA+ +KKGED+ L+K DCQRI G   T+FSVFA+F
Sbjct  11   VPLAVLLKRELTSE-KIEKPDILHGQASQSKKGEDFTLLKSDCQRIPGDGVTTFSVFALF  69

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+AKENLLNN+L AIP  L R+EWL ALPRALVAGFVKTD +FQ K  TSG
Sbjct  70   DGHNGSAAAIYAKENLLNNILCAIPSDLSRDEWLAALPRALVAGFVKTDKDFQTKAHTSG  129

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+IDEW VTVASVGDSRCIL++  G +  ++ DH
Sbjct  130  TTVTFVIIDEWVVTVASVGDSRCILESAEGSIYYMSADH  168



>ref|XP_008797258.1| PREDICTED: probable protein phosphatase 2C 12 isoform X2 [Phoenix 
dactylifera]
Length=433

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 128/159 (81%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL +E K+EKP + +GQA+ +KKGED+ L+K DCQRI G   T+FSVFA+F
Sbjct  11   VPLAVLLKRELTSE-KIEKPDILHGQASQSKKGEDFTLLKSDCQRIPGDGVTTFSVFALF  69

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+AKENLLNN+L AIP  L R+EWL ALPRALVAGFVKTD +FQ K  TSG
Sbjct  70   DGHNGSAAAIYAKENLLNNILCAIPSDLSRDEWLAALPRALVAGFVKTDKDFQTKAHTSG  129

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+IDEW VTVASVGDSRCIL++  G +  ++ DH
Sbjct  130  TTVTFVIIDEWVVTVASVGDSRCILESAEGSIYYMSADH  168



>ref|XP_008797257.1| PREDICTED: probable protein phosphatase 2C 12 isoform X1 [Phoenix 
dactylifera]
Length=493

 Score =   225 bits (573),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 128/159 (81%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL +E K+EKP + +GQA+ +KKGED+ L+K DCQRI G   T+FSVFA+F
Sbjct  11   VPLAVLLKRELTSE-KIEKPDILHGQASQSKKGEDFTLLKSDCQRIPGDGVTTFSVFALF  69

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+AKENLLNN+L AIP  L R+EWL ALPRALVAGFVKTD +FQ K  TSG
Sbjct  70   DGHNGSAAAIYAKENLLNNILCAIPSDLSRDEWLAALPRALVAGFVKTDKDFQTKAHTSG  129

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+IDEW VTVASVGDSRCIL++  G +  ++ DH
Sbjct  130  TTVTFVIIDEWVVTVASVGDSRCILESAEGSIYYMSADH  168



>ref|XP_009127629.1| PREDICTED: probable protein phosphatase 2C 15 [Brassica rapa]
Length=426

 Score =   223 bits (568),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 128/159 (81%), Gaps = 10/159 (6%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ RE R  +K+EKP V+YG+AA ++KGEDY LI  D         T+FSVFAIF
Sbjct  15   VPLAALLSRETR-AAKMEKPIVRYGEAAQSRKGEDYLLINTD---------TTFSVFAIF  64

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AA+F +ENLLN+VLSA+P+GL R+EWLQALPRALV+GFVKTD EFQ +GETSG
Sbjct  65   DGHNGKAAAVFTRENLLNHVLSALPRGLSRDEWLQALPRALVSGFVKTDKEFQSRGETSG  124

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVA VGDSRCILDT GG VS LTVDH
Sbjct  125  TTATFVIVDGWTVTVACVGDSRCILDTSGGSVSNLTVDH  163



>emb|CDY44900.1| BnaA02g13820D [Brassica napus]
Length=413

 Score =   223 bits (567),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 128/159 (81%), Gaps = 10/159 (6%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ RE R  +K+EKP V+YG+AA ++KGEDY LI  D         T+FSVFAIF
Sbjct  15   VPLAALLSRETR-AAKMEKPIVRYGEAAQSRKGEDYLLINTD---------TTFSVFAIF  64

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AA+F +ENLLN+VLSA+P+GL R+EWLQALPRALV+GFVKTD EFQ +GETSG
Sbjct  65   DGHNGKAAAVFTRENLLNHVLSALPRGLSRDEWLQALPRALVSGFVKTDKEFQSRGETSG  124

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV++D WTVTVA VGDSRCILDT GG VS LTVDH
Sbjct  125  TTATFVIVDGWTVTVACVGDSRCILDTSGGSVSNLTVDH  163



>ref|XP_006658990.1| PREDICTED: probable protein phosphatase 2C 33-like [Oryza brachyantha]
Length=404

 Score =   222 bits (565),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +3

Query  162  KPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLN  341
            +P+++YG A  AK+GEDYFL+KPDC R+    +T+FSVFA+FDGHNG+SAA ++KE+L  
Sbjct  4    RPSLRYGHAGFAKRGEDYFLVKPDCLRVPADPSTAFSVFAVFDGHNGVSAAGYSKEHLXX  63

Query  342  NVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASV  521
             V+SA+PQG+GR++WLQALPRALVAGFVK DI+FQ+KGE SGTT T VV+D +TVTVASV
Sbjct  64   XVMSAVPQGIGRDDWLQALPRALVAGFVKADIDFQRKGEVSGTTATLVVVDGFTVTVASV  123

Query  522  GDSRCILDTQGGVVSLLTVDH  584
            GDSRCILDTQGG V LLTVDH
Sbjct  124  GDSRCILDTQGGEVQLLTVDH  144



>gb|KHG19035.1| hypothetical protein F383_08660 [Gossypium arboreum]
Length=397

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 117/139 (84%), Gaps = 12/139 (9%)
 Frame = +3

Query  168  TVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNV  347
             +   +AALAKKGEDYFLIKPDC+R+ G+  TSFSVFAIFDGHNGISAAIFAKENLL NV
Sbjct  14   NLSQAEAALAKKGEDYFLIKPDCERVPGNPETSFSVFAIFDGHNGISAAIFAKENLLGNV  73

Query  348  LSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGD  527
            LSAIPQG+ REEWLQALPRALVA            GETSGTTVTFVVID WTVTVASVGD
Sbjct  74   LSAIPQGINREEWLQALPRALVA------------GETSGTTVTFVVIDGWTVTVASVGD  121

Query  528  SRCILDTQGGVVSLLTVDH  584
            SRCILDTQGGVVSLLTVDH
Sbjct  122  SRCILDTQGGVVSLLTVDH  140



>ref|XP_010269263.1| PREDICTED: probable protein phosphatase 2C 12 [Nelumbo nucifera]
Length=386

 Score =   219 bits (558),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 127/159 (80%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL NE K+EKP + +GQA  +KKGED+ L+K +C+R+ G   T+FSVF +F
Sbjct  10   VPLAVLLKRELSNE-KIEKPEIVHGQANQSKKGEDFTLLKTECERVPGDGVTTFSVFGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+ KENLLNNVL+AIP  L R+EWL ALPRALVAGFVKTD +FQQK + SG
Sbjct  69   DGHNGSAAAIYTKENLLNNVLAAIPSDLSRDEWLGALPRALVAGFVKTDKDFQQKAQKSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+ID WT+TVASVGDSRCI ++  GV+  L+ DH
Sbjct  129  TTVTFVIIDGWTITVASVGDSRCIFESADGVIYSLSADH  167



>gb|AIE39589.1| protein phosphatase 2c, partial [Humulus lupulus]
Length=114

 Score =   209 bits (533),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 106/115 (92%), Gaps = 1/115 (1%)
 Frame = +3

Query  111  PLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIFD  290
            PL TLIGRELR E KVEKP VKYGQAALAKKGEDYFLIKPDCQRI G+  TSFSVFAIFD
Sbjct  1    PLATLIGRELRGE-KVEKPFVKYGQAALAKKGEDYFLIKPDCQRIPGNPLTSFSVFAIFD  59

Query  291  GHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKG  455
            GHNGISAAIFAKENLL+N+LSAIPQG  REEWLQALPRALVAGFVKTDIEFQQKG
Sbjct  60   GHNGISAAIFAKENLLDNILSAIPQGASREEWLQALPRALVAGFVKTDIEFQQKG  114



>ref|XP_010943029.1| PREDICTED: probable protein phosphatase 2C 12 isoform X1 [Elaeis 
guineensis]
Length=432

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 127/159 (80%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL +E K EKP + +GQA+ +KKGED+ L+K DCQRI G   T+FSVFA+F
Sbjct  11   VPLAVLLKRELTSE-KNEKPEILHGQASQSKKGEDFTLLKSDCQRIPGDGVTTFSVFALF  69

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+AKENLLNN+L AIP  L R+EWL ALPRALVAGFVKTD +FQ K  TSG
Sbjct  70   DGHNGSAAAIYAKENLLNNILCAIPSDLSRDEWLAALPRALVAGFVKTDKDFQTKAHTSG  129

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+ID W VTVASVGDSRCIL++  G++  L+ DH
Sbjct  130  TTVTFVIIDGWVVTVASVGDSRCILESAEGLIYSLSADH  168



>ref|XP_010939443.1| PREDICTED: probable protein phosphatase 2C 12 isoform X2 [Elaeis 
guineensis]
Length=421

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 127/159 (80%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL +E K++KP V +GQA+ +KKGED+ L+K DCQRI G   T+FSVFA+F
Sbjct  11   VPLAVLLKRELTSE-KIDKPDVLHGQASQSKKGEDFTLLKLDCQRIPGDGVTTFSVFALF  69

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+AKENLLNN+L AIP  L R+EWL ALPRALVAGFVKTD +FQ +  TSG
Sbjct  70   DGHNGSAAAIYAKENLLNNILCAIPSDLSRDEWLAALPRALVAGFVKTDKDFQTRARTSG  129

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+ID W VTVASVGDSRCIL++  G V  L+ DH
Sbjct  130  TTVTFVIIDGWVVTVASVGDSRCILESAEGSVYYLSADH  168



>ref|XP_010939442.1| PREDICTED: probable protein phosphatase 2C 12 isoform X1 [Elaeis 
guineensis]
Length=432

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 127/159 (80%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL +E K++KP V +GQA+ +KKGED+ L+K DCQRI G   T+FSVFA+F
Sbjct  11   VPLAVLLKRELTSE-KIDKPDVLHGQASQSKKGEDFTLLKLDCQRIPGDGVTTFSVFALF  69

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+AKENLLNN+L AIP  L R+EWL ALPRALVAGFVKTD +FQ +  TSG
Sbjct  70   DGHNGSAAAIYAKENLLNNILCAIPSDLSRDEWLAALPRALVAGFVKTDKDFQTRARTSG  129

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+ID W VTVASVGDSRCIL++  G V  L+ DH
Sbjct  130  TTVTFVIIDGWVVTVASVGDSRCILESAEGSVYYLSADH  168



>gb|AIB05857.1| orphans transcription factor, partial [Zea mays]
Length=433

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 126/152 (83%), Gaps = 6/152 (4%)
 Frame = +3

Query  147  ESKVEKPTVKYGQAALAKKGEDYFLIKPDCQR--ISGSSTTS----FSVFAIFDGHNGIS  308
            ES++E+P ++YG AA  KKGED+FL++ DC R  IS SS+ S    F+VFAI DGHNG +
Sbjct  77   ESRLERPLLRYGCAAQCKKGEDFFLLRTDCLRPAISVSSSASPHPIFAVFAILDGHNGNA  136

Query  309  AAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSGTTVTFVV  488
            AAI+ ++NLLN+VLSA+P+GL REEWL  LPRALVAGFVKTD EFQ KG+TSGTT TFV+
Sbjct  137  AAIYTRDNLLNHVLSAMPRGLSREEWLHMLPRALVAGFVKTDKEFQSKGQTSGTTATFVI  196

Query  489  IDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            ID WT+TVASVGDSRCILD QGG VSLLTVDH
Sbjct  197  IDGWTITVASVGDSRCILDAQGGAVSLLTVDH  228



>ref|XP_006829727.1| hypothetical protein AMTR_s00126p00104180 [Amborella trichopoda]
 gb|ERM97143.1| hypothetical protein AMTR_s00126p00104180 [Amborella trichopoda]
Length=430

 Score =   218 bits (554),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 128/159 (81%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL NE K+E+P + +GQA+ +KKGED+ L+K +CQRI G   T+FSVFA+F
Sbjct  2    VPLAVLLKRELTNE-KIERPDILHGQASQSKKGEDFTLLKTECQRILGDGITTFSVFALF  60

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+ KENLLNNVLSA+P  L R+EWL ALPRALVAGFVKTD +FQ+K ++SG
Sbjct  61   DGHNGSAAAIYTKENLLNNVLSAVPSDLSRDEWLAALPRALVAGFVKTDKDFQEKAQSSG  120

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+ID W VTVASVGDSRC L++  G +  L+ DH
Sbjct  121  TTVTFVIIDGWVVTVASVGDSRCFLESAEGSIYSLSADH  159



>ref|NP_001151513.1| LOC100285147 [Zea mays]
 gb|ACG43141.1| protein phosphatase 2C ABI2 [Zea mays]
Length=484

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 126/152 (83%), Gaps = 6/152 (4%)
 Frame = +3

Query  147  ESKVEKPTVKYGQAALAKKGEDYFLIKPDCQR--ISGSSTTS----FSVFAIFDGHNGIS  308
            ES++E+P ++YG AA  KKGED+FL++ DC R  IS SS+ S    F+VFAI DGHNG +
Sbjct  77   ESRLERPLLRYGCAAQCKKGEDFFLLRTDCLRPAISVSSSASPHPIFAVFAILDGHNGNA  136

Query  309  AAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSGTTVTFVV  488
            AAI+ ++NLLN+VLSA+P+GL REEWL  LPRALVAGFVKTD EFQ KG+TSGTT TFV+
Sbjct  137  AAIYTRDNLLNHVLSAMPRGLSREEWLHMLPRALVAGFVKTDKEFQSKGQTSGTTATFVI  196

Query  489  IDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            ID WT+TVASVGDSRCILD QGG VSLLTVDH
Sbjct  197  IDGWTITVASVGDSRCILDAQGGAVSLLTVDH  228



>ref|XP_006595966.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X2 
[Glycine max]
Length=386

 Score =   214 bits (544),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL NE K+EKP + +GQA  +KKGED  L+K +CQR+ G   +++SVF +F
Sbjct  10   VPLSVLLRRELANE-KIEKPEIAHGQACQSKKGEDLTLLKTECQRVVGDGVSTYSVFGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+AKENLLNNVLS IP  L R+EW+ ALPRALVAGFVKTD +FQ+KG+ SG
Sbjct  69   DGHNGSAAAIYAKENLLNNVLSVIPPDLNRDEWIAALPRALVAGFVKTDKDFQEKGQKSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+I+ W VTVASVGDSRC+L++  G +  L+ DH
Sbjct  129  TTVTFVIIEGWVVTVASVGDSRCVLESSDGELYYLSADH  167



>gb|KEH22033.1| protein phosphatase 2C family protein [Medicago truncatula]
Length=426

 Score =   214 bits (546),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 139/182 (76%), Gaps = 11/182 (6%)
 Frame = +3

Query  57   MSEAEVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC  236
            MS  E  ++K  P+PV+  L TL+ RELR E K EK  VKYG+ ++ KKGEDY LIK  C
Sbjct  1    MSRKE--LSKISPSPVS--LATLLDRELR-EEKGEKRFVKYGEESMTKKGEDYGLIKTCC  55

Query  237  QRISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGL---GREEWLQALPRA  407
             R+ G  +T+FSVFAIFDGH+GISAA++AKENLLNNVL  IP+ +    R+ WL ALPRA
Sbjct  56   HRVPGDPSTAFSVFAIFDGHSGISAAVYAKENLLNNVLKEIPKDIISSSRDAWLHALPRA  115

Query  408  LVAGFVKTDIEFQQ-KGETSGTTVTFVVIDEWTVTVASVGDSRCIL--DTQGGVVSLLTV  578
            LVAGFVKTD++FQ  KGE SGTT TFVV+DE  VTVASVGDSRCIL  +  GGVVS+LTV
Sbjct  116  LVAGFVKTDMDFQSIKGEMSGTTATFVVVDESIVTVASVGDSRCILVDNKGGGVVSILTV  175

Query  579  DH  584
            DH
Sbjct  176  DH  177



>ref|XP_003550341.1| PREDICTED: probable protein phosphatase 2C 12-like [Glycine max]
 gb|KHN12774.1| Hypothetical protein glysoja_008737 [Glycine soja]
Length=428

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 127/159 (80%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL NE K+EKP + +GQA  +KKGED  L+K +CQR+ G   +++SVF +F
Sbjct  10   VPLSVLLRRELANE-KIEKPEIAHGQACQSKKGEDLTLLKTECQRVVGDGVSTYSVFGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI++KENLLNNVLSAIP  L R+EW+ ALPRALVAGFVKTD +FQ+KG+ SG
Sbjct  69   DGHNGSAAAIYSKENLLNNVLSAIPPDLNRDEWIAALPRALVAGFVKTDKDFQEKGQKSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+I+ W VTVASVGDSRC+L++  G +  L+ DH
Sbjct  129  TTVTFVIIEGWVVTVASVGDSRCVLESSDGELYYLSADH  167



>ref|XP_009409307.1| PREDICTED: probable protein phosphatase 2C 12 [Musa acuminata 
subsp. malaccensis]
Length=432

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 127/160 (79%), Gaps = 1/160 (1%)
 Frame = +3

Query  105  AVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAI  284
            +VPLG L+ +E  +E K+E P + YGQA  +KKGED+ L+K +CQR+ G   T+FSVFA+
Sbjct  8    SVPLGVLLMKEQTSE-KIEDPDILYGQANQSKKGEDFTLLKAECQRVPGDGVTTFSVFAL  66

Query  285  FDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETS  464
            FDGHNG +AAI++KENLLNN+L+AIP  L R+EWL ALPRALVAGF+KTD +FQ K  +S
Sbjct  67   FDGHNGSAAAIYSKENLLNNILNAIPSNLNRDEWLAALPRALVAGFIKTDKDFQTKARSS  126

Query  465  GTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            GTTVTFV+ID W VTVASVGDSRCIL++  G +  L+ DH
Sbjct  127  GTTVTFVIIDGWVVTVASVGDSRCILESAEGSIYCLSADH  166



>ref|XP_010061763.1| PREDICTED: probable protein phosphatase 2C 12 [Eucalyptus grandis]
 gb|KCW68759.1| hypothetical protein EUGRSUZ_F02357 [Eucalyptus grandis]
Length=431

 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 130/159 (82%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL NE K+++P + +GQA+ +KKGEDY L+K +CQRI G   T++SVFA+F
Sbjct  10   VPLSVLLKRELANE-KIDRPEIVHGQASQSKKGEDYTLLKTECQRIVGDGVTTYSVFALF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AA+++KENLLNNVL+A+P  L R+EW+ ALPRALVAGFVKTD +FQ+K +TSG
Sbjct  69   DGHNGSAAAVYSKENLLNNVLAAMPSDLNRDEWVTALPRALVAGFVKTDKDFQEKAQTSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTF++I+ W +TVASVGDSRCIL++  G +  L+ DH
Sbjct  129  TTVTFLIIEGWVITVASVGDSRCILESAEGTIYHLSEDH  167



>ref|XP_003545307.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X1 
[Glycine max]
 gb|KHN35672.1| Hypothetical protein glysoja_037582 [Glycine soja]
Length=428

 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL NE K+EKP + +GQA  +KKGED  L+K +CQR+ G   +++SVF +F
Sbjct  10   VPLSVLLRRELANE-KIEKPEIAHGQACQSKKGEDLTLLKTECQRVVGDGVSTYSVFGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+AKENLLNNVLS IP  L R+EW+ ALPRALVAGFVKTD +FQ+KG+ SG
Sbjct  69   DGHNGSAAAIYAKENLLNNVLSVIPPDLNRDEWIAALPRALVAGFVKTDKDFQEKGQKSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+I+ W VTVASVGDSRC+L++  G +  L+ DH
Sbjct  129  TTVTFVIIEGWVVTVASVGDSRCVLESSDGELYYLSADH  167



>ref|XP_004292819.1| PREDICTED: probable protein phosphatase 2C 12 [Fragaria vesca 
subsp. vesca]
Length=432

 Score =   213 bits (542),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 129/159 (81%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL NE K+E+P + YGQA+ +KKGED+ ++K DCQR+ G   +++SVFA+F
Sbjct  12   VPLSVLLKRELANE-KIERPEIIYGQASQSKKGEDFTMVKTDCQRVVGDGVSTYSVFALF  70

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI++KENLL+N+L+AIP  L R+EW+ ALPR+LVAGFVKTD EFQ+K +TSG
Sbjct  71   DGHNGSAAAIYSKENLLSNILAAIPSDLNRDEWIAALPRSLVAGFVKTDKEFQEKAQTSG  130

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+I+ W ++VASVGDSRCI++   G V  L+ DH
Sbjct  131  TTVTFVIIEGWVISVASVGDSRCIVEPAEGGVYYLSADH  169



>ref|XP_009610734.1| PREDICTED: probable protein phosphatase 2C 12 isoform X1 [Nicotiana 
tomentosiformis]
Length=429

 Score =   213 bits (541),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL NE K+E+P + +GQA+ +KKGED+  +K +CQR+ G   T+FSVF +F
Sbjct  10   VPLSVLLKRELANE-KIERPEISHGQASQSKKGEDFTFLKTECQRVLGDGVTTFSVFGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI++KENLL NVLSAIP  L R+EW+ ALPRALVAGFVKTD EFQ+K + SG
Sbjct  69   DGHNGSAAAIYSKENLLQNVLSAIPSDLNRDEWVAALPRALVAGFVKTDKEFQEKAQKSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+I+ W VTVASVGDSRCIL++  G +  L+ DH
Sbjct  129  TTVTFVIIEGWVVTVASVGDSRCILESAEGGIYYLSADH  167



>ref|XP_004499069.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X2 
[Cicer arietinum]
Length=428

 Score =   213 bits (541),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL  E K+EKP + +GQA  +KKGED+ L+K +CQR+ G    ++SV+ +F
Sbjct  10   VPLSVLLKRELMIE-KIEKPEIVHGQAGQSKKGEDFTLLKAECQRMMGDGVYTYSVYGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI++KENLLNNVLSAIP  L R+EWL ALPRALVAGFVKTD +FQQKG+ SG
Sbjct  69   DGHNGSAAAIYSKENLLNNVLSAIPPDLNRDEWLAALPRALVAGFVKTDKDFQQKGQKSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+I+ W VTVASVGDSRC+L++  G +  L+ DH
Sbjct  129  TTVTFVIIEGWVVTVASVGDSRCVLESSEGEIYYLSADH  167



>ref|XP_002284640.1| PREDICTED: probable protein phosphatase 2C 12 [Vitis vinifera]
 ref|XP_010664578.1| PREDICTED: probable protein phosphatase 2C 12 [Vitis vinifera]
 ref|XP_010664579.1| PREDICTED: probable protein phosphatase 2C 12 [Vitis vinifera]
 ref|XP_010664580.1| PREDICTED: probable protein phosphatase 2C 12 [Vitis vinifera]
 emb|CBI19533.3| unnamed protein product [Vitis vinifera]
Length=429

 Score =   213 bits (541),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 129/159 (81%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL +E K+EKP + +GQA+ +KKGED+ L+K +CQR+ G   +++SVF +F
Sbjct  10   VPLSVLLKRELASE-KIEKPDIIHGQASQSKKGEDFTLLKTECQRVVGDGVSTYSVFGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI++KENLLNNVL+AIP  L R+EW+ ALPRALVAGFVKTDI+FQ+K  TSG
Sbjct  69   DGHNGSAAAIYSKENLLNNVLAAIPPELSRDEWVAALPRALVAGFVKTDIDFQEKARTSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+I+ W VTVASVGDSRCIL++  G +  L+ DH
Sbjct  129  TTVTFVIIEGWVVTVASVGDSRCILESAEGDIYHLSADH  167



>ref|XP_009401438.1| PREDICTED: probable protein phosphatase 2C 12 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=356

 Score =   210 bits (535),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 132/172 (77%), Gaps = 6/172 (3%)
 Frame = +3

Query  75   TMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGS  254
            ++ +++P    VPL  L+ RE+ +E K+E+P V +GQA+ +KKGED+ L+K DC+R+ G 
Sbjct  4    SVARERPM---VPLAVLLRREITSE-KMERPDVLHGQASQSKKGEDFTLLKTDCRRVPGD  59

Query  255  --STTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVK  428
              +  +FSVFA+FDGHNG  AA +AKENLL+NVLSAIP  L REEWL ALPRALVAGFVK
Sbjct  60   RDADATFSVFALFDGHNGSGAATYAKENLLDNVLSAIPSDLTREEWLAALPRALVAGFVK  119

Query  429  TDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TD EFQ K  +SGTTVTFV+ID W VTVASVGDSRCIL++  G V  L+ DH
Sbjct  120  TDKEFQTKAHSSGTTVTFVIIDGWVVTVASVGDSRCILESAEGSVYYLSADH  171



>ref|XP_007017285.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 gb|EOY14510.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
Length=428

 Score =   212 bits (540),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 127/159 (80%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL NE K+EKP + +GQA+ +KKGED+ L+K +CQR  G   T+FSVF +F
Sbjct  10   VPLSVLLKRELANE-KIEKPEIVHGQASQSKKGEDFTLLKTECQRAIGDGVTTFSVFGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+ KENLLNNVL+AIP  L R+EW+ ALPRALVAGFVKTD +FQ++ +TSG
Sbjct  69   DGHNGSAAAIYTKENLLNNVLNAIPTDLNRDEWVAALPRALVAGFVKTDKDFQERAQTSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+I+ W +TVASVGDSRCIL++  G +  L+ DH
Sbjct  129  TTVTFVIIEGWVITVASVGDSRCILESAEGGIYYLSADH  167



>emb|CDP01349.1| unnamed protein product [Coffea canephora]
Length=429

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 128/159 (81%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL NE KVE+P + +GQA+ +KKGED+ L+K +CQR+ G   T++SVF +F
Sbjct  10   VPLSVLLKRELANE-KVERPELSHGQASQSKKGEDFTLLKTECQRVLGDGITTYSVFGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI++KENLLNNVL AIP  L R+EW+ ALPRALVAGFVKTD +FQ++ +TSG
Sbjct  69   DGHNGSAAAIYSKENLLNNVLGAIPADLNRDEWVSALPRALVAGFVKTDKDFQERAQTSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+I+ W VTVASVGDSRC+L++  G +  L+ DH
Sbjct  129  TTVTFVIIEGWVVTVASVGDSRCVLESAEGDIYYLSADH  167



>ref|XP_004499068.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X1 
[Cicer arietinum]
Length=439

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL  E K+EKP + +GQA  +KKGED+ L+K +CQR+ G    ++SV+ +F
Sbjct  10   VPLSVLLKRELMIE-KIEKPEIVHGQAGQSKKGEDFTLLKAECQRMMGDGVYTYSVYGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI++KENLLNNVLSAIP  L R+EWL ALPRALVAGFVKTD +FQQKG+ SG
Sbjct  69   DGHNGSAAAIYSKENLLNNVLSAIPPDLNRDEWLAALPRALVAGFVKTDKDFQQKGQKSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+I+ W VTVASVGDSRC+L++  G +  L+ DH
Sbjct  129  TTVTFVIIEGWVVTVASVGDSRCVLESSEGEIYYLSADH  167



>ref|XP_002986557.1| hypothetical protein SELMODRAFT_235036 [Selaginella moellendorffii]
 gb|EFJ12414.1| hypothetical protein SELMODRAFT_235036 [Selaginella moellendorffii]
Length=414

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 127/154 (82%), Gaps = 2/154 (1%)
 Frame = +3

Query  123  LIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIFDGHNG  302
            L+ RE+R E +VE+P ++YG AA +KKGED+ L+K DCQR+ G  +++F VFAIFDGHNG
Sbjct  6    LLSREVRPE-RVERPVLQYGHAAQSKKGEDFVLVKTDCQRVPGDGSSTFGVFAIFDGHNG  64

Query  303  ISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSGTTVTF  482
             +AAI++KENL+N+V+ A+P GL REEWL  LPRALVAGFVK D EFQ++ ++SGTT TF
Sbjct  65   AAAAIYSKENLVNDVMGAVPSGLSREEWLALLPRALVAGFVKADKEFQRREQSSGTTATF  124

Query  483  VVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            VVID  TVT ASVGDSRCILD++G V++ LTVDH
Sbjct  125  VVIDGLTVTAASVGDSRCILDSEGAVIT-LTVDH  157



>ref|XP_007017286.1| Phosphatase 2C family protein isoform 2 [Theobroma cacao]
 gb|EOY14511.1| Phosphatase 2C family protein isoform 2 [Theobroma cacao]
Length=439

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 127/159 (80%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL NE K+EKP + +GQA+ +KKGED+ L+K +CQR  G   T+FSVF +F
Sbjct  10   VPLSVLLKRELANE-KIEKPEIVHGQASQSKKGEDFTLLKTECQRAIGDGVTTFSVFGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+ KENLLNNVL+AIP  L R+EW+ ALPRALVAGFVKTD +FQ++ +TSG
Sbjct  69   DGHNGSAAAIYTKENLLNNVLNAIPTDLNRDEWVAALPRALVAGFVKTDKDFQERAQTSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+I+ W +TVASVGDSRCIL++  G +  L+ DH
Sbjct  129  TTVTFVIIEGWVITVASVGDSRCILESAEGGIYYLSADH  167



>ref|XP_002979083.1| hypothetical protein SELMODRAFT_109752 [Selaginella moellendorffii]
 gb|EFJ20040.1| hypothetical protein SELMODRAFT_109752 [Selaginella moellendorffii]
Length=420

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 127/154 (82%), Gaps = 2/154 (1%)
 Frame = +3

Query  123  LIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIFDGHNG  302
            L+ RE+R E +VE+P ++YG AA +KKGED+ L+K DCQR+ G  +++F VFAIFDGHNG
Sbjct  6    LLSREVRPE-RVERPVLQYGHAAQSKKGEDFVLVKTDCQRVPGDGSSTFGVFAIFDGHNG  64

Query  303  ISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSGTTVTF  482
             +AAI++KENL+N+V+ A+P GL REEWL  LPRALVAGFVK D EFQ++ ++SGTT TF
Sbjct  65   AAAAIYSKENLVNDVMGAVPSGLSREEWLALLPRALVAGFVKADKEFQRREQSSGTTATF  124

Query  483  VVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            VVID  TVT ASVGDSRCILD++G V++ LTVDH
Sbjct  125  VVIDGLTVTAASVGDSRCILDSEGAVIT-LTVDH  157



>emb|CAN78409.1| hypothetical protein VITISV_023178 [Vitis vinifera]
Length=450

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 129/159 (81%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL +E K+EKP + +GQA+ +KKGED+ L+K +CQR+ G   +++SVF +F
Sbjct  10   VPLSVLLKRELASE-KIEKPDIIHGQASQSKKGEDFTLLKTECQRVVGDGVSTYSVFGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI++KENLLNNVL+AIP  L R+EW+ ALPRALVAGFVKTDI+FQ+K  TSG
Sbjct  69   DGHNGSAAAIYSKENLLNNVLAAIPPELSRDEWVAALPRALVAGFVKTDIDFQEKARTSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+I+ W VTVASVGDSRCIL++  G +  L+ DH
Sbjct  129  TTVTFVIIEGWVVTVASVGDSRCILESAEGDIYHLSADH  167



>gb|KEH40042.1| catalytic/protein phosphatase type 2C [Medicago truncatula]
Length=412

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL +E K+EKP + +GQA  +KKGED+ L+K DCQR+ G    ++SV+ +F
Sbjct  11   VPLSVLLKRELMSE-KIEKPEIVHGQAGQSKKGEDFALLKSDCQRMVGDGVYTYSVYGLF  69

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI++KENLLNNV+SAIP  L R+EWL ALPRALVAGFVKTD +F +KG+ SG
Sbjct  70   DGHNGSAAAIYSKENLLNNVVSAIPPDLNRDEWLAALPRALVAGFVKTDKDFAEKGQKSG  129

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+I+ W VTVASVGDSRC+L++  G +  L+ DH
Sbjct  130  TTVTFVIIEGWVVTVASVGDSRCVLESSEGGIYYLSADH  168



>ref|XP_008805807.1| PREDICTED: LOW QUALITY PROTEIN: probable protein phosphatase 
2C 12 [Phoenix dactylifera]
Length=456

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 124/159 (78%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL +E K+EKP + +GQA+  KKGED+ LIK DCQRI G   T+FSVFA+F
Sbjct  35   VPLAVLLKRELTSE-KIEKPEILHGQASQRKKGEDFTLIKSDCQRIPGDGVTTFSVFALF  93

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+AKENLLNN+L AIP  L R+EWL ALPRALVAGFVKTD +FQ K  TSG
Sbjct  94   DGHNGSAAAIYAKENLLNNILCAIPSDLSRDEWLAALPRALVAGFVKTDKDFQTKEHTSG  153

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+ID   VTVASVGDS CIL++  G +  L+ DH
Sbjct  154  TTVTFVIIDGRVVTVASVGDSLCILESAEGSIYYLSADH  192



>ref|XP_010275585.1| PREDICTED: probable protein phosphatase 2C 12 [Nelumbo nucifera]
 ref|XP_010275586.1| PREDICTED: probable protein phosphatase 2C 12 [Nelumbo nucifera]
Length=435

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 129/172 (75%), Gaps = 3/172 (2%)
 Frame = +3

Query  69   EVTMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRIS  248
            E   TKQ+     VPL  L+ REL NE K+ KP + +G+A  +KKGED+ L+K +C+R+ 
Sbjct  15   ETMPTKQEHQ--MVPLAVLLKRELSNE-KIGKPDIIHGEANQSKKGEDFTLLKTECERVP  71

Query  249  GSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVK  428
            G   T+FSVFAIFDGHNG  AAI+A+ENLLNNVL AIP  + R+EWL  LPRALVAGFVK
Sbjct  72   GDEVTTFSVFAIFDGHNGSEAAIYARENLLNNVLGAIPSDISRDEWLATLPRALVAGFVK  131

Query  429  TDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TD  FQ+K +TSGTTVTFV+ID W +TVASVGDSRCIL++  G +  L+ DH
Sbjct  132  TDKGFQEKAQTSGTTVTFVIIDGWVITVASVGDSRCILESAEGDIYSLSADH  183



>ref|XP_007222388.1| hypothetical protein PRUPE_ppa006058mg [Prunus persica]
 gb|EMJ23587.1| hypothetical protein PRUPE_ppa006058mg [Prunus persica]
Length=429

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 130/169 (77%), Gaps = 1/169 (1%)
 Frame = +3

Query  78   MTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSS  257
            M+ +      VPL  L+ REL NE K+E+P + +GQA+ +KKGED+ L+K +CQR+ G  
Sbjct  1    MSNKNENHQTVPLSVLLKRELANE-KIERPEIVHGQASQSKKGEDFTLVKTECQRVVGDG  59

Query  258  TTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDI  437
             +++SVF +FDGHNG +AAI++KENLLNNVL+A+P  L R+EW+ ALPRA VAGFVKTD 
Sbjct  60   VSTYSVFGLFDGHNGSAAAIYSKENLLNNVLAAMPSDLNRDEWVAALPRAFVAGFVKTDK  119

Query  438  EFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            EFQ++ +TSGTTVTFV+I+ W ++VASVGDSRCIL+   G V  L+ DH
Sbjct  120  EFQERAQTSGTTVTFVIIEGWVISVASVGDSRCILEPAEGGVYYLSADH  168



>ref|XP_001757865.1| predicted protein [Physcomitrella patens]
 gb|EDQ77505.1| predicted protein [Physcomitrella patens]
Length=415

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 128/159 (81%), Gaps = 2/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL +L+  EL+NE  VE P ++ G A   +KGED+ L+K DCQRI G  +++F+VF IF
Sbjct  2    VPLASLLAYELKNEI-VENPLLRCGLALQPRKGEDFALVKTDCQRIPGDGSSTFAVFGIF  60

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+ KENLLN+V+SA+  GL R++WL ALPRALVAGFVKTD EFQ K +TSG
Sbjct  61   DGHNGSAAAIYTKENLLNDVMSALSPGLKRDDWLAALPRALVAGFVKTDKEFQAKEQTSG  120

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFVVID WT+TVA VGDSRC+LD+Q GVV+ LTVDH
Sbjct  121  TTVTFVVIDGWTITVACVGDSRCVLDSQ-GVVTDLTVDH  158



>ref|XP_009413632.1| PREDICTED: probable protein phosphatase 2C 12 [Musa acuminata 
subsp. malaccensis]
Length=419

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 125/159 (79%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ RE+  E ++EKP + YG+A+ +KKGED+ L+K +CQR+ G   T+FSVFA+F
Sbjct  10   VPLAVLLRREMSWE-RIEKPDILYGEASESKKGEDFTLVKTECQRVPGQGDTTFSVFALF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AA ++KENLLNNVLSAIP  L R EW+QALPRALVAGFVKTD +F++    SG
Sbjct  69   DGHNGAAAATYSKENLLNNVLSAIPSDLSRNEWIQALPRALVAGFVKTDKDFKKIASVSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+ID W VTVASVGDSRCIL++  G V  L+ DH
Sbjct  129  TTVTFVIIDGWVVTVASVGDSRCILESAEGSVYFLSADH  167



>ref|XP_002455646.1| hypothetical protein SORBIDRAFT_03g016300 [Sorghum bicolor]
 gb|EES00766.1| hypothetical protein SORBIDRAFT_03g016300 [Sorghum bicolor]
Length=496

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 125/159 (79%), Gaps = 6/159 (4%)
 Frame = +3

Query  126  IGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQR------ISGSSTTSFSVFAIF  287
            +G E+  E+++E+P ++YG AA  KKGED+FL++ DC R         S   +F+VFA+ 
Sbjct  82   VGGEVAAETRLERPLLRYGCAAQCKKGEDFFLLRTDCPRPAISVSFPDSPHPTFAVFAVL  141

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+ ++NLLN+VLSA+P+GL R+EWL  LP ALVAGFVKTD EFQ KG+TSG
Sbjct  142  DGHNGNAAAIYTRDNLLNHVLSAMPRGLSRDEWLHMLPIALVAGFVKTDKEFQSKGQTSG  201

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TT TFV+ID WT+TVASVGDSRCILD QGG VSLLTVDH
Sbjct  202  TTATFVIIDGWTITVASVGDSRCILDAQGGAVSLLTVDH  240



>ref|XP_009380915.1| PREDICTED: probable protein phosphatase 2C 12 [Musa acuminata 
subsp. malaccensis]
Length=432

 Score =   211 bits (537),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 125/161 (78%), Gaps = 2/161 (1%)
 Frame = +3

Query  105  AVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAI  284
            A+PLG L+ RE  +E K+E P   YGQA+ +KKGED+  +K +CQR+ G   T+F+VFAI
Sbjct  9    AMPLGVLLKRESTSE-KIENPDFLYGQASQSKKGEDFTFLKAECQRVPGDGVTTFAVFAI  67

Query  285  FDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETS  464
            FDGHNG +AAI+AKENLLNN+L AIP  L R+EWL ALPRALVAGFVKTD +FQ K  +S
Sbjct  68   FDGHNGSAAAIYAKENLLNNILYAIPSNLNRDEWLAALPRALVAGFVKTDKDFQTKAHSS  127

Query  465  GTTVTFVVIDEWTVTVASVGDSRCILDTQG-GVVSLLTVDH  584
            GTTVTFV+ID W VTVASVGDSRCIL++   G +  L+ DH
Sbjct  128  GTTVTFVIIDGWVVTVASVGDSRCILESAAEGSIYCLSADH  168



>ref|XP_008220215.1| PREDICTED: probable protein phosphatase 2C 12 [Prunus mume]
Length=429

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 130/169 (77%), Gaps = 1/169 (1%)
 Frame = +3

Query  78   MTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSS  257
            M+ +      VPL  L+ REL NE K+E+P + +GQA+ +KKGED+ L+K +CQR+ G  
Sbjct  1    MSNKNENHQTVPLSVLLKRELANE-KIERPEIVHGQASQSKKGEDFTLVKTECQRVVGDG  59

Query  258  TTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDI  437
             +++SVF +FDGHNG +AAI++KENLLNNVL+A+P  L R+EW+ ALPRA VAGFVKTD 
Sbjct  60   VSTYSVFGLFDGHNGSAAAIYSKENLLNNVLAAMPSDLNRDEWVAALPRAFVAGFVKTDK  119

Query  438  EFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            EFQ++ +TSGTTVTFV+I+ W ++VASVGDSRCIL+   G V  L+ DH
Sbjct  120  EFQERAQTSGTTVTFVIIEGWVISVASVGDSRCILEPAEGGVYYLSADH  168



>ref|XP_009620218.1| PREDICTED: probable protein phosphatase 2C 12 [Nicotiana tomentosiformis]
Length=426

 Score =   211 bits (536),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL NE K+E+P + +GQA+ +KKGED+  +K +CQR+ G    ++SVF +F
Sbjct  10   VPLSVLLKRELANE-KIERPEISHGQASQSKKGEDFTFVKTECQRVLGDGVATYSVFGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+AKENLL NVLSAIP  L R+EW+ ALPRALVAGFVKTD +FQ++ +TSG
Sbjct  69   DGHNGSAAAIYAKENLLQNVLSAIPPDLSRDEWVAALPRALVAGFVKTDKDFQERAKTSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+I+ W VTVASVGDSRCIL++  G +  L+ DH
Sbjct  129  TTVTFVIIEGWVVTVASVGDSRCILESAEGGIYYLSADH  167



>ref|XP_009764892.1| PREDICTED: probable protein phosphatase 2C 12 isoform X1 [Nicotiana 
sylvestris]
Length=429

 Score =   211 bits (536),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 125/159 (79%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL NE K+E P + +GQA+ +KKGED+  +K +CQR+ G   T+FSVF +F
Sbjct  10   VPLSVLLKRELANE-KIEMPEICHGQASQSKKGEDFTFLKTECQRVLGDGVTTFSVFGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI++KENLL NVLSAIP  L R+EW+ ALPRALVAGFVKTD EFQ+K + SG
Sbjct  69   DGHNGSAAAIYSKENLLQNVLSAIPSDLNRDEWVAALPRALVAGFVKTDKEFQEKAQKSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+I+ W VTVASVGDSRCIL++  G +  L+ DH
Sbjct  129  TTVTFVIIEGWVVTVASVGDSRCILESAEGGIYYLSADH  167



>ref|XP_011083856.1| PREDICTED: probable protein phosphatase 2C 12 isoform X1 [Sesamum 
indicum]
Length=431

 Score =   210 bits (535),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 127/159 (80%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL NE K+E+P + +GQA+ +KKGED+  IK +CQR+ G   T++SVFA+F
Sbjct  11   VPLSVLLKRELANE-KIERPEISHGQASQSKKGEDFTFIKTECQRVLGDGVTTYSVFALF  69

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+AKENLLNNVLSAIP  L  +EW+ ALPRALVAGFVKTD +FQQ+ +TSG
Sbjct  70   DGHNGSAAAIYAKENLLNNVLSAIPPDLNSDEWIAALPRALVAGFVKTDKDFQQRAQTSG  129

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+I+ W +TVASVGDSR +L++  G +  L+ DH
Sbjct  130  TTVTFVIIEGWVLTVASVGDSRGVLESAEGTIYYLSADH  168



>ref|XP_007160841.1| hypothetical protein PHAVU_001G021200g [Phaseolus vulgaris]
 gb|ESW32835.1| hypothetical protein PHAVU_001G021200g [Phaseolus vulgaris]
Length=427

 Score =   210 bits (535),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 125/159 (79%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL +E K+E P + +GQA  +KKGED  L+K +CQR+ G   +++SVF +F
Sbjct  10   VPLSVLLKRELAHE-KIENPEIVHGQACQSKKGEDLTLVKTECQRMVGDGVSTYSVFGMF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+ KENLLNNVLSAIP  L R+EW+ ALPRALVAGFVKTD +FQ+KG+ SG
Sbjct  69   DGHNGSAAAIYTKENLLNNVLSAIPPDLNRDEWIAALPRALVAGFVKTDKDFQEKGQKSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+I+ W VTVASVGDSRC+L++  G +  L+ DH
Sbjct  129  TTVTFVIIEGWVVTVASVGDSRCVLESSDGEIYYLSADH  167



>emb|CDM82896.1| unnamed protein product [Triticum aestivum]
Length=409

 Score =   209 bits (533),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 129/189 (68%), Gaps = 30/189 (16%)
 Frame = +3

Query  108  VPLGTLIGRELRNE-----------------------SKVEKPTVKYGQAALAKKGEDYF  218
            VPL  LI  E R E                       ++  +P ++YG AA +KKGED+F
Sbjct  22   VPLAALIKEESRTERHAVTRSRICAREDGGVGGEVGEAETRRPLLRYGCAAQSKKGEDFF  81

Query  219  LIKPDCQR-------ISGSSTTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGR  377
            L++ DC R        + S   +F+VFA+ DGHNG +AAI+ ++NLLN+VLSA+PQGL R
Sbjct  82   LLRTDCARPSTSSSSSTTSHPPTFAVFAVLDGHNGDAAAIYTRDNLLNHVLSAMPQGLSR  141

Query  378  EEWLQALPRALVAGFVKTDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGG  557
            EEWL +LPRALVAGFVKTD EFQ KG+TSGTT TF +ID WT+TVASVGDSRCILD QGG
Sbjct  142  EEWLHSLPRALVAGFVKTDKEFQTKGQTSGTTATFAIIDGWTITVASVGDSRCILDAQGG  201

Query  558  VVSLLTVDH  584
             VSLLTVDH
Sbjct  202  AVSLLTVDH  210



>gb|AFK36110.1| unknown [Medicago truncatula]
Length=428

 Score =   210 bits (534),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL +E K+EKP + +GQA  +KKGED+ L+K DCQR+ G    ++SV+ +F
Sbjct  11   VPLSVLLKRELMSE-KIEKPEIVHGQAGQSKKGEDFALLKSDCQRMVGDGVYTYSVYGLF  69

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI++KENLLNNV+SAIP  L R+EWL ALPRALVAGFVKTD +F +KG+ SG
Sbjct  70   DGHNGSAAAIYSKENLLNNVVSAIPPDLNRDEWLAALPRALVAGFVKTDKDFAEKGQKSG  129

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+I+ W VTVASVGDSRC+L++  G +  L+ DH
Sbjct  130  TTVTFVIIEGWVVTVASVGDSRCVLESSEGGIYYLSADH  168



>gb|AES59470.2| catalytic/protein phosphatase type 2C [Medicago truncatula]
Length=428

 Score =   210 bits (534),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL +E K+EKP + +GQA  +KKGED+ L+K DCQR+ G    ++SV+ +F
Sbjct  11   VPLSVLLKRELMSE-KIEKPEIVHGQAGQSKKGEDFALLKSDCQRMVGDGVYTYSVYGLF  69

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI++KENLLNNV+SAIP  L R+EWL ALPRALVAGFVKTD +F +KG+ SG
Sbjct  70   DGHNGSAAAIYSKENLLNNVVSAIPPDLNRDEWLAALPRALVAGFVKTDKDFAEKGQKSG  129

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+I+ W VTVASVGDSRC+L++  G +  L+ DH
Sbjct  130  TTVTFVIIEGWVVTVASVGDSRCVLESSEGGIYYLSADH  168



>ref|XP_010519103.1| PREDICTED: probable protein phosphatase 2C 12 [Tarenaya hassleriana]
Length=428

 Score =   210 bits (534),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 120/159 (75%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ RE  NE K+E P + YGQA  +KKGED+ L+K +CQR  G   T+FSVF IF
Sbjct  10   VPLSVLLKRESANE-KIENPEIVYGQANQSKKGEDFTLLKTECQRAMGDGVTTFSVFGIF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG  AAI+ KENLL NVL+AIP  L R+EW+ ALPRALVAGFVKTD +FQ+K  TSG
Sbjct  69   DGHNGTGAAIYTKENLLTNVLAAIPSDLNRDEWVAALPRALVAGFVKTDKDFQEKARTSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+ID W VTVASVGDSRCIL+   G V  L+ DH
Sbjct  129  TTVTFVIIDGWVVTVASVGDSRCILEPAEGGVYYLSADH  167



>ref|XP_002510242.1| protein phosphatase, putative [Ricinus communis]
 gb|EEF52429.1| protein phosphatase, putative [Ricinus communis]
Length=425

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 127/159 (80%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL NE +VEKP + +GQA+ +KKGED+ L+K +CQR+ G   +++SVF +F
Sbjct  10   VPLSVLLKRELANE-RVEKPEILHGQASQSKKGEDFTLLKTECQRVLGDGVSTYSVFGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+ KENLLNNV++A+P  L R+EW+ ALPRALVAGFVKTD +FQ + +TSG
Sbjct  69   DGHNGSAAAIYTKENLLNNVIAAMPPDLNRDEWVAALPRALVAGFVKTDKDFQMRAQTSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+I+ W +TVASVGDSRCIL++  G V  L+ DH
Sbjct  129  TTVTFVIIEGWVITVASVGDSRCILESAEGDVYYLSADH  167



>ref|XP_009401437.1| PREDICTED: probable protein phosphatase 2C 12 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=434

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 132/172 (77%), Gaps = 6/172 (3%)
 Frame = +3

Query  75   TMTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGS  254
            ++ +++P    VPL  L+ RE+ +E K+E+P V +GQA+ +KKGED+ L+K DC+R+ G 
Sbjct  4    SVARERPM---VPLAVLLRREITSE-KMERPDVLHGQASQSKKGEDFTLLKTDCRRVPGD  59

Query  255  --STTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVK  428
              +  +FSVFA+FDGHNG  AA +AKENLL+NVLSAIP  L REEWL ALPRALVAGFVK
Sbjct  60   RDADATFSVFALFDGHNGSGAATYAKENLLDNVLSAIPSDLTREEWLAALPRALVAGFVK  119

Query  429  TDIEFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TD EFQ K  +SGTTVTFV+ID W VTVASVGDSRCIL++  G V  L+ DH
Sbjct  120  TDKEFQTKAHSSGTTVTFVIIDGWVVTVASVGDSRCILESAEGSVYYLSADH  171



>ref|XP_009781091.1| PREDICTED: probable protein phosphatase 2C 12 [Nicotiana sylvestris]
Length=426

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 125/159 (79%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL NE K+E+P + +GQA+ +KKGED+  +K +CQR+ G    ++SVF +F
Sbjct  10   VPLSVLLKRELANE-KIERPEISHGQASQSKKGEDFTFVKTECQRVLGDGVATYSVFGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+AKENLL NVL AIP  L R+EW+ ALPRALVAGFVKTD +FQ++ +TSG
Sbjct  69   DGHNGSAAAIYAKENLLQNVLGAIPPDLSRDEWIAALPRALVAGFVKTDKDFQERAKTSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+I+ W VTVASVGDSRCIL++  G +  L+ DH
Sbjct  129  TTVTFVIIEGWVVTVASVGDSRCILESAEGGIYYLSADH  167



>ref|XP_006354899.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X1 
[Solanum tuberosum]
Length=428

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 125/159 (79%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL NE K+E P + +GQA+ +KKGED+  +K +CQR+ G    ++SVF +F
Sbjct  10   VPLSVLLKRELANE-KIESPELSHGQASQSKKGEDFTFVKAECQRVLGDGVATYSVFGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI++KENLL NVLSAIP  L R+EW+ ALPRALVAGFVKTD +FQ+K +TSG
Sbjct  69   DGHNGSAAAIYSKENLLQNVLSAIPPDLSRDEWVAALPRALVAGFVKTDKDFQEKAKTSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+I+ W VTVASVGDSRCIL++  G +  L+ DH
Sbjct  129  TTVTFVIIEGWVVTVASVGDSRCILESAEGGIYYLSADH  167



>ref|XP_004238165.1| PREDICTED: probable protein phosphatase 2C 12 [Solanum lycopersicum]
Length=428

 Score =   208 bits (530),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 125/159 (79%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL NE K+E P + +GQA+ +KKGED+  +K +CQR+ G    ++SVF +F
Sbjct  10   VPLSVLLKRELANE-KIESPELSHGQASQSKKGEDFTFVKTECQRVLGDGVATYSVFGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI++KENLL NVLSAIP  L R+EW+ ALPRALVAGFVKTD +FQ+K +TSG
Sbjct  69   DGHNGSAAAIYSKENLLQNVLSAIPPDLSRDEWVAALPRALVAGFVKTDKDFQEKAKTSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+I+ W VTVASVGDSRCIL++  G +  L+ DH
Sbjct  129  TTVTFVIIEGWVVTVASVGDSRCILESAEGGIYYLSADH  167



>ref|XP_004968827.1| PREDICTED: probable protein phosphatase 2C 3-like [Setaria italica]
Length=483

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 122/151 (81%), Gaps = 7/151 (5%)
 Frame = +3

Query  153  KVEKPTVKYGQAALAKKGEDYFLIKPDCQR-------ISGSSTTSFSVFAIFDGHNGISA  311
            + ++P ++YG AA +KKGED+FL++ DC R        + S   +F+VFA+ DGHNG +A
Sbjct  76   RRQRPLLRYGCAAQSKKGEDFFLLRTDCPRPSTSASSSAASPHPTFAVFAVLDGHNGNAA  135

Query  312  AIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSGTTVTFVVI  491
            AI+ ++NLLN+VLSA+P+GL REEWL ALPRALVAGFVKTD EFQ KG+TSGTT TFV+I
Sbjct  136  AIYTRDNLLNHVLSAMPRGLSREEWLHALPRALVAGFVKTDKEFQSKGQTSGTTATFVII  195

Query  492  DEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            D WT+TVASVGDSRCILD QGG VSLLTVDH
Sbjct  196  DGWTITVASVGDSRCILDAQGGTVSLLTVDH  226



>ref|XP_008393818.1| PREDICTED: probable protein phosphatase 2C 12 [Malus domestica]
Length=430

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 130/169 (77%), Gaps = 1/169 (1%)
 Frame = +3

Query  78   MTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSS  257
            M+ ++     VPL  L+ REL NE K+E+P + +GQA+ +KKGED+ L+K +CQRI G  
Sbjct  1    MSTKRENHQTVPLSVLLKRELANE-KIERPEIIHGQASQSKKGEDFTLVKTECQRIVGDG  59

Query  258  TTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDI  437
             +++SVF +FDGHNG +AAI++KENLL NVL+AIP  L R+EW+ ALPRA VAGFVKTD 
Sbjct  60   VSTYSVFGLFDGHNGSAAAIYSKENLLTNVLAAIPSDLNRDEWVAALPRAFVAGFVKTDK  119

Query  438  EFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            EFQ++ +TSGTTVTFV+I+ W ++VASVGDSRCI++   G V  L+ DH
Sbjct  120  EFQERSQTSGTTVTFVIIEGWVISVASVGDSRCIVEPAEGGVYYLSADH  168



>ref|XP_004487674.1| PREDICTED: probable protein phosphatase 2C 12-like [Cicer arietinum]
Length=428

 Score =   207 bits (528),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 125/159 (79%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL   + REL  E K+EKP + +GQA  +KKGED+ L+K +CQR+ G    ++SVF +F
Sbjct  10   VPLSVFLKRELMIE-KIEKPEIVHGQAFQSKKGEDFTLLKTECQRMMGDGVYTYSVFGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGH+G +AAI++KENLLNNVLSAIP  L R+EWL ALPRALVAGFVKTD +FQQKG+ SG
Sbjct  69   DGHSGSAAAIYSKENLLNNVLSAIPPDLNRDEWLAALPRALVAGFVKTDKDFQQKGQKSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+I+ W VTVASVGDSRC+L++  G +  L+ DH
Sbjct  129  TTVTFVIIEGWVVTVASVGDSRCVLESSEGGIYYLSADH  167



>ref|XP_003528265.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X1 
[Glycine max]
Length=429

 Score =   207 bits (527),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 128/162 (79%), Gaps = 3/162 (2%)
 Frame = +3

Query  105  AVPLGTLIGRELRNESKVEKPTV--KYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVF  278
            +VPL  L+ REL NE K+EKP V   +GQA+  KKGED+ L+K +CQR+ G   +++SVF
Sbjct  9    SVPLSVLLKRELANE-KIEKPEVVILHGQASENKKGEDFTLLKTECQRVLGDGVSTYSVF  67

Query  279  AIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGE  458
             +FDGHNG +AAI+AKENLLNNVLSAIP  L R+EW+ ALPRALVAGFVKTD +FQ+K +
Sbjct  68   GLFDGHNGSAAAIYAKENLLNNVLSAIPSDLNRDEWVAALPRALVAGFVKTDKDFQEKAQ  127

Query  459  TSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TSGTTVTF++++ W +TVASVGDSRCIL+   G +  L+ DH
Sbjct  128  TSGTTVTFMIVEGWVLTVASVGDSRCILEPSEGGIFYLSADH  169



>ref|XP_010092060.1| putative protein phosphatase 2C 12 [Morus notabilis]
 gb|EXB50007.1| putative protein phosphatase 2C 12 [Morus notabilis]
Length=460

 Score =   208 bits (529),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 127/159 (80%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL NE K+E+P + +GQA+ +KKGED+ L+K +CQR+ G   +++SVF +F
Sbjct  10   VPLSVLLKRELANE-KIERPEIVHGQASQSKKGEDFTLLKTECQRMVGDGVSTYSVFGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI++KENLL+N+LSAIP  L R+EW+ ALPRALVAGFVKTD +FQ++ + SG
Sbjct  69   DGHNGSAAAIYSKENLLSNILSAIPSDLNRDEWIAALPRALVAGFVKTDKDFQERAQMSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+I+ W +TVASVGDSRCIL+   G +  L+ DH
Sbjct  129  TTVTFVIIEGWVITVASVGDSRCILEAAEGGIYYLSADH  167



>ref|XP_009359088.1| PREDICTED: probable protein phosphatase 2C 12 [Pyrus x bretschneideri]
 ref|XP_009359363.1| PREDICTED: probable protein phosphatase 2C 12 [Pyrus x bretschneideri]
Length=430

 Score =   207 bits (527),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 130/169 (77%), Gaps = 1/169 (1%)
 Frame = +3

Query  78   MTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSS  257
            M+ +      VPL  L+ REL NE K+E+P + +GQA+ +KKGED+ L+K +CQRI G  
Sbjct  1    MSTRSENHQTVPLSVLLKRELANE-KIERPELIHGQASQSKKGEDFTLVKTECQRIVGDG  59

Query  258  TTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDI  437
             +++SVF +FDGHNG +AAI++KENLLNNVL+AIP  L ++EW+ ALPRA VAGFVKTD 
Sbjct  60   VSTYSVFGLFDGHNGSAAAIYSKENLLNNVLAAIPSDLNKDEWVAALPRAFVAGFVKTDK  119

Query  438  EFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            EFQ++ +TSGTTVTFV+I+ W ++VASVGDSRCI++   G V  L+ DH
Sbjct  120  EFQERAKTSGTTVTFVIIEGWVISVASVGDSRCIVEPAEGGVYYLSADH  168



>ref|XP_004501575.1| PREDICTED: probable protein phosphatase 2C 12-like [Cicer arietinum]
Length=374

 Score =   206 bits (523),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 123/162 (76%), Gaps = 3/162 (2%)
 Frame = +3

Query  105  AVPLGTLIGRELRNESKVEKP--TVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVF  278
            +VPL  L+ REL NE K+EKP   V YG A+  KKGED+ L+K +CQR+     +++SVF
Sbjct  10   SVPLSVLLKRELANE-KIEKPDMVVVYGHASENKKGEDFILLKTECQRVVADGVSTYSVF  68

Query  279  AIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGE  458
             +FDGHNG +AAI+AKENLLNNVL AIP  L R+EW+ ALPRALVAGFVKTD +FQQK  
Sbjct  69   GLFDGHNGSAAAIYAKENLLNNVLCAIPPDLNRDEWVAALPRALVAGFVKTDKDFQQKAR  128

Query  459  TSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TSGTTVTFV+I+ W +TVASVGDSRC+L+   G    L+ DH
Sbjct  129  TSGTTVTFVIIEGWVITVASVGDSRCVLEPSEGGSHDLSADH  170



>ref|XP_006581239.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X2 
[Glycine max]
Length=437

 Score =   207 bits (527),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 128/162 (79%), Gaps = 3/162 (2%)
 Frame = +3

Query  105  AVPLGTLIGRELRNESKVEKPTV--KYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVF  278
            +VPL  L+ REL NE K+EKP V   +GQA+  KKGED+ L+K +CQR+ G   +++SVF
Sbjct  9    SVPLSVLLKRELANE-KIEKPEVVILHGQASENKKGEDFTLLKTECQRVLGDGVSTYSVF  67

Query  279  AIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGE  458
             +FDGHNG +AAI+AKENLLNNVLSAIP  L R+EW+ ALPRALVAGFVKTD +FQ+K +
Sbjct  68   GLFDGHNGSAAAIYAKENLLNNVLSAIPSDLNRDEWVAALPRALVAGFVKTDKDFQEKAQ  127

Query  459  TSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TSGTTVTF++++ W +TVASVGDSRCIL+   G +  L+ DH
Sbjct  128  TSGTTVTFMIVEGWVLTVASVGDSRCILEPSEGGIFYLSADH  169



>ref|XP_009367363.1| PREDICTED: probable protein phosphatase 2C 12 [Pyrus x bretschneideri]
 ref|XP_009367364.1| PREDICTED: probable protein phosphatase 2C 12 [Pyrus x bretschneideri]
Length=430

 Score =   207 bits (526),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 129/169 (76%), Gaps = 1/169 (1%)
 Frame = +3

Query  78   MTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSS  257
            M+ +      VPL  L+ REL NE K+E+P + +GQA+ +KKGED+ L+K +CQRI G  
Sbjct  1    MSTKSENHQTVPLSVLLKRELANE-KIERPEIIHGQASQSKKGEDFTLVKTECQRIVGDG  59

Query  258  TTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDI  437
             +++SVF +FDGHNG +AAI++KENLL NVL+AIP  L R+EW+ ALPRA VAGFVKTD 
Sbjct  60   VSTYSVFGLFDGHNGSAAAIYSKENLLTNVLAAIPSDLNRDEWVAALPRAFVAGFVKTDK  119

Query  438  EFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            EFQ++ +TSGTTVTFV+I+ W ++VASVGDSRCI++   G V  L+ DH
Sbjct  120  EFQERAQTSGTTVTFVIIEGWVISVASVGDSRCIVEPAEGGVYYLSADH  168



>gb|KHN22311.1| Hypothetical protein glysoja_022067 [Glycine soja]
Length=429

 Score =   207 bits (526),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 128/162 (79%), Gaps = 3/162 (2%)
 Frame = +3

Query  105  AVPLGTLIGRELRNESKVEKPTV--KYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVF  278
            +VPL  L+ REL NE K+EKP V   +GQA+  KKGED+ L+K +CQR+ G   +++SVF
Sbjct  9    SVPLSVLLKRELANE-KIEKPEVVILHGQASENKKGEDFTLLKTECQRVLGDGVSTYSVF  67

Query  279  AIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGE  458
             +FDGHNG +AAI+AKENLLNNVLSAIP  L R+EW+ ALPRALVAGFVKTD +FQ+K +
Sbjct  68   GLFDGHNGSAAAIYAKENLLNNVLSAIPSDLNRDEWVAALPRALVAGFVKTDKDFQEKAQ  127

Query  459  TSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TSGTTVTF++++ W +TVASVGDSRCIL+   G +  L+ DH
Sbjct  128  TSGTTVTFMIVEGWVLTVASVGDSRCILEPYEGGIFYLSADH  169



>gb|KDP38368.1| hypothetical protein JCGZ_04293 [Jatropha curcas]
Length=430

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 125/159 (79%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL +E +VEKP + +G A+ +KKGED+ LIK +CQR+ G   +++SVF +F
Sbjct  10   VPLSVLLKRELASE-RVEKPDILHGHASQSKKGEDFTLIKTECQRVVGDGVSTYSVFGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+ KENLLNN+ SA+P  L R+EW+ ALPRALVAGFVKTD +FQ K +TSG
Sbjct  69   DGHNGSAAAIYTKENLLNNITSALPPDLNRDEWVAALPRALVAGFVKTDKDFQSKAQTSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+I+ W +TVASVGDSRCIL++  G V  L+ DH
Sbjct  129  TTVTFVIIEGWVITVASVGDSRCILESAEGDVYYLSADH  167



>ref|XP_003567758.1| PREDICTED: probable protein phosphatase 2C 3 isoform X2 [Brachypodium 
distachyon]
Length=468

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 123/153 (80%), Gaps = 7/153 (5%)
 Frame = +3

Query  147  ESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTT-------SFSVFAIFDGHNGI  305
            E+   +P ++YG AA +KKGED+FL++ DC R S S ++       +F+VFA+ DGHNG 
Sbjct  60   EAPTRRPLLRYGCAAQSKKGEDFFLLRTDCARPSTSYSSPTSSHHPTFAVFAVLDGHNGN  119

Query  306  SAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSGTTVTFV  485
            +AAI+ ++NLLN+VLSA+P+GL R EWL ALPRALV+GFVKTD EFQ KG+TSGTT TFV
Sbjct  120  AAAIYTRDNLLNHVLSAMPRGLSRNEWLHALPRALVSGFVKTDKEFQTKGQTSGTTATFV  179

Query  486  VIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            +ID WT+TVASVGDSRCILD QGG VSLLTVDH
Sbjct  180  IIDGWTITVASVGDSRCILDAQGGSVSLLTVDH  212



>ref|XP_010230932.1| PREDICTED: probable protein phosphatase 2C 3 isoform X1 [Brachypodium 
distachyon]
Length=470

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 123/153 (80%), Gaps = 7/153 (5%)
 Frame = +3

Query  147  ESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTT-------SFSVFAIFDGHNGI  305
            E+   +P ++YG AA +KKGED+FL++ DC R S S ++       +F+VFA+ DGHNG 
Sbjct  60   EAPTRRPLLRYGCAAQSKKGEDFFLLRTDCARPSTSYSSPTSSHHPTFAVFAVLDGHNGN  119

Query  306  SAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSGTTVTFV  485
            +AAI+ ++NLLN+VLSA+P+GL R EWL ALPRALV+GFVKTD EFQ KG+TSGTT TFV
Sbjct  120  AAAIYTRDNLLNHVLSAMPRGLSRNEWLHALPRALVSGFVKTDKEFQTKGQTSGTTATFV  179

Query  486  VIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            +ID WT+TVASVGDSRCILD QGG VSLLTVDH
Sbjct  180  IIDGWTITVASVGDSRCILDAQGGSVSLLTVDH  212



>ref|XP_006434795.1| hypothetical protein CICLE_v10001232mg [Citrus clementina]
 ref|XP_006434796.1| hypothetical protein CICLE_v10001232mg [Citrus clementina]
 gb|ESR48035.1| hypothetical protein CICLE_v10001232mg [Citrus clementina]
 gb|ESR48036.1| hypothetical protein CICLE_v10001232mg [Citrus clementina]
Length=362

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL NE K+EKP + +GQA+ +KKGED+ L+K +CQR  G   T+FSV+ +F
Sbjct  10   VPLSVLLKRELANE-KIEKPDIVHGQASQSKKGEDFTLLKNECQRAMGDGVTTFSVYGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+ KENLL NVL+AIP  L R+EW+ ALPRA VAGFVKTD +FQ+K  TSG
Sbjct  69   DGHNGSAAAIYTKENLLKNVLNAIPSELNRDEWISALPRATVAGFVKTDKDFQEKARTSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVT V+I+ W +TV SVGDSRCIL++  G +  L+ DH
Sbjct  129  TTVTLVIIEGWAITVGSVGDSRCILESAEGDIYYLSADH  167



>gb|EEC70750.1| hypothetical protein OsI_02161 [Oryza sativa Indica Group]
Length=485

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 121/152 (80%), Gaps = 10/152 (7%)
 Frame = +3

Query  159  EKPTVKYGQAALAKKGEDYFLIKPDCQR----------ISGSSTTSFSVFAIFDGHNGIS  308
             +P ++YG AA +KKGED+FL++ DC R          ++ S   +F+VFA+ DGHNG +
Sbjct  76   RRPLLRYGCAAQSKKGEDFFLLRTDCARPSTSSSSSSSLASSPPHTFAVFAVLDGHNGNA  135

Query  309  AAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSGTTVTFVV  488
            AAI+ ++NLLN+VLSA+P+GL REEWL ALPRALVAGFVKTD EFQ KG+TSGTT TFV+
Sbjct  136  AAIYTRDNLLNHVLSAMPRGLSREEWLHALPRALVAGFVKTDKEFQHKGQTSGTTATFVI  195

Query  489  IDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            ID WT+TVASVGDSRCILD QGG VSLLTVDH
Sbjct  196  IDGWTITVASVGDSRCILDAQGGAVSLLTVDH  227



>gb|KHG12192.1| hypothetical protein F383_19798 [Gossypium arboreum]
Length=428

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ RE  +E K+E P + +GQA+ +KKGED+ L+K +CQR  G    +FSVF +F
Sbjct  10   VPLSVLLKRESESE-KIENPEILHGQASQSKKGEDFTLLKTECQRAMGDGVATFSVFGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+ KENLLNNVLSAIP  L R+EW+ ALPRALVAGFVKTD +FQ K +TSG
Sbjct  69   DGHNGSAAAIYTKENLLNNVLSAIPADLNRDEWVAALPRALVAGFVKTDKDFQAKAKTSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+ID W VTVASVGDSRCI ++  G +  L+ DH
Sbjct  129  TTVTFVIIDGWVVTVASVGDSRCIFESGEGGIYYLSADH  167



>ref|XP_006473344.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X3 
[Citrus sinensis]
Length=429

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL NE K+EKP + +GQA+ +KKGED+ L+K +CQR  G   T+FSV+ +F
Sbjct  10   VPLSVLLKRELANE-KIEKPDIVHGQASQSKKGEDFTLLKNECQRAMGDGVTTFSVYGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+ KENLL NVL+AIP  L R+EW+ ALPRA+VAGFVKTD +FQ+K  TSG
Sbjct  69   DGHNGSAAAIYTKENLLKNVLNAIPSELNRDEWISALPRAMVAGFVKTDKDFQEKARTSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVT V+I+ W +TV SVGDSRCIL++  G +  L+ DH
Sbjct  129  TTVTLVIIEGWAITVGSVGDSRCILESAEGDIYYLSADH  167



>ref|XP_008361008.1| PREDICTED: probable protein phosphatase 2C 12 [Malus domestica]
Length=430

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 129/169 (76%), Gaps = 1/169 (1%)
 Frame = +3

Query  78   MTKQKPTPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSS  257
            M+ +      VPL  L+ REL NE K+E+P + +GQA+ +KKGED+ L+K +CQRI G  
Sbjct  1    MSTKXENHQTVPLSVLLKRELANE-KIERPEIIHGQASQSKKGEDFTLVKTECQRIVGDG  59

Query  258  TTSFSVFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDI  437
             +++SVF +FDGHNG +AAI++KENLL NVL+AIP  L R+EW+ ALPRA VAGFVKTD 
Sbjct  60   VSTYSVFGLFDGHNGSAAAIYSKENLLTNVLAAIPSDLNRDEWVAALPRAFVAGFVKTDK  119

Query  438  EFQQKGETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            EFQ++ +TSGTTVTFV+I+ W ++VASVGDSRCI++   G V  L+ DH
Sbjct  120  EFQERSQTSGTTVTFVIIEGWVISVASVGDSRCIVEPAEGGVYYLSADH  168



>gb|KJB58457.1| hypothetical protein B456_009G211100 [Gossypium raimondii]
Length=428

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ RE  +E K+E P + +GQA+ +KKGED+ L+K +CQR  G    +FSVF +F
Sbjct  10   VPLSVLLKRESESE-KIENPEILHGQASQSKKGEDFTLLKTECQRAMGDGVATFSVFGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+ KENLLNN+LSAIP  L R+EW+ ALPRALVAGFVKTD +FQ K +TSG
Sbjct  69   DGHNGSAAAIYTKENLLNNILSAIPADLNRDEWVAALPRALVAGFVKTDKDFQAKAKTSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+ID W VTVASVGDSRCI ++  G +  L+ DH
Sbjct  129  TTVTFVIIDGWVVTVASVGDSRCIFESGEGGIYYLSADH  167



>sp|Q0JMD4.2|P2C03_ORYSJ RecName: Full=Probable protein phosphatase 2C 3; Short=OsPP2C03 
[Oryza sativa Japonica Group]
 gb|EEE54680.1| hypothetical protein OsJ_01986 [Oryza sativa Japonica Group]
Length=485

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 120/150 (80%), Gaps = 10/150 (7%)
 Frame = +3

Query  165  PTVKYGQAALAKKGEDYFLIKPDCQR----------ISGSSTTSFSVFAIFDGHNGISAA  314
            P ++YG AA +KKGED+FL++ DC R          ++ S   +F+VFA+ DGHNG +AA
Sbjct  78   PLLRYGCAAQSKKGEDFFLLRTDCARPSTSSSSSSSLASSPPHTFAVFAVLDGHNGNAAA  137

Query  315  IFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSGTTVTFVVID  494
            I+ ++NLLN+VLSA+P+GL REEWL ALPRALVAGFVKTD EFQ KG+TSGTT TFV+ID
Sbjct  138  IYTRDNLLNHVLSAMPRGLSREEWLHALPRALVAGFVKTDKEFQHKGQTSGTTATFVIID  197

Query  495  EWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
             WT+TVASVGDSRCILD QGG VSLLTVDH
Sbjct  198  GWTITVASVGDSRCILDAQGGAVSLLTVDH  227



>gb|KJB58458.1| hypothetical protein B456_009G211100 [Gossypium raimondii]
Length=428

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ RE  +E K+E P + +GQA+ +KKGED+ L+K +CQR  G    +FSVF +F
Sbjct  10   VPLSVLLKRESESE-KIENPEILHGQASQSKKGEDFTLLKTECQRAMGDGVATFSVFGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+ KENLLNN+LSAIP  L R+EW+ ALPRALVAGFVKTD +FQ K +TSG
Sbjct  69   DGHNGSAAAIYTKENLLNNILSAIPADLNRDEWVAALPRALVAGFVKTDKDFQAKAKTSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+ID W VTVASVGDSRCI ++  G +  L+ DH
Sbjct  129  TTVTFVIIDGWVVTVASVGDSRCIFESGEGGIYYLSADH  167



>ref|NP_001141493.1| uncharacterized protein LOC100273605 [Zea mays]
 gb|ACF86485.1| unknown [Zea mays]
 gb|ACG34181.1| protein phosphatase 2C ABI1 [Zea mays]
 gb|ACN28927.1| unknown [Zea mays]
 gb|ACN29100.1| unknown [Zea mays]
 gb|ACN34718.1| unknown [Zea mays]
 tpg|DAA61781.1| TPA: putative protein phosphatase 2C family protein [Zea mays]
 gb|AIB04842.1| orphans transcription factor, partial [Zea mays]
Length=431

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 124/164 (76%), Gaps = 2/164 (1%)
 Frame = +3

Query  96   TPVAVPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDC-QRISGSSTTSFS  272
            +P  VPLG L+ RE+  E ++E+P V  G+A L++KGED+ L++ D  QRI G  +TSFS
Sbjct  6    SPGTVPLGVLLRREVTKE-RMERPDVLCGEANLSRKGEDFTLLRADAGQRIPGDPSTSFS  64

Query  273  VFAIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQK  452
            VFAIFDGHNG  AAI+A+ENLL NVL AIP    REEWL  LPRALVA FVKTD +FQ  
Sbjct  65   VFAIFDGHNGSGAAIYARENLLKNVLRAIPTCFCREEWLAVLPRALVAAFVKTDKDFQAV  124

Query  453  GETSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
             ETSGTTVTFV+IDEW VTVASVGDSRCIL++  G +  L+ DH
Sbjct  125  DETSGTTVTFVIIDEWVVTVASVGDSRCILESADGSIYFLSADH  168



>ref|XP_006473342.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X1 
[Citrus sinensis]
 ref|XP_006473343.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X2 
[Citrus sinensis]
Length=432

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL NE K+EKP + +GQA+ +KKGED+ L+K +CQR  G   T+FSV+ +F
Sbjct  10   VPLSVLLKRELANE-KIEKPDIVHGQASQSKKGEDFTLLKNECQRAMGDGVTTFSVYGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+ KENLL NVL+AIP  L R+EW+ ALPRA+VAGFVKTD +FQ+K  TSG
Sbjct  69   DGHNGSAAAIYTKENLLKNVLNAIPSELNRDEWISALPRAMVAGFVKTDKDFQEKARTSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVT V+I+ W +TV SVGDSRCIL++  G +  L+ DH
Sbjct  129  TTVTLVIIEGWAITVGSVGDSRCILESAEGDIYYLSADH  167



>ref|XP_006374959.1| phosphatase 2C family protein [Populus trichocarpa]
 gb|ERP52756.1| phosphatase 2C family protein [Populus trichocarpa]
Length=429

 Score =   205 bits (522),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 125/159 (79%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL NE +VEKP + YGQA+ +KKGED+ L+K +CQRI G   T++SVF +F
Sbjct  11   VPLSVLLKRELANE-RVEKPEILYGQASQSKKGEDFTLLKTECQRIVGDGITTYSVFGLF  69

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+ KENLLNN+++A+P  L R+EW+ ALPRALVAGFVKTD +FQ++  TSG
Sbjct  70   DGHNGSAAAIYTKENLLNNIIAAMPPDLNRDEWVAALPRALVAGFVKTDKDFQERARTSG  129

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTF +I+   +TVASVGDSRCIL++  G +  L+ DH
Sbjct  130  TTVTFAIIEGLFITVASVGDSRCILESAEGDIYYLSADH  168



>ref|XP_006393585.1| hypothetical protein EUTSA_v10011502mg [Eutrema salsugineum]
 dbj|BAJ34367.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ30871.1| hypothetical protein EUTSA_v10011502mg [Eutrema salsugineum]
Length=428

 Score =   205 bits (522),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ RE  NE K++ P + +GQA  +KKGED+ L+K +CQR+ G   T+FSVF +F
Sbjct  10   VPLSVLLKRESANE-KIDNPELVHGQANQSKKGEDFTLVKTECQRVMGDGVTTFSVFGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+ KENLLNNVL+AIP  L R+EW+ ALPRALVAGFVKTD +FQ++  TSG
Sbjct  69   DGHNGSAAAIYTKENLLNNVLAAIPSDLNRDEWVAALPRALVAGFVKTDKDFQERARTSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+++ W V+VASVGDSRCIL+   G V  L+ DH
Sbjct  129  TTVTFVIVEGWVVSVASVGDSRCILEPAEGGVYYLSADH  167



>gb|EYU25409.1| hypothetical protein MIMGU_mgv1a006684mg [Erythranthe guttata]
Length=435

 Score =   205 bits (522),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 127/159 (80%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL NE K+E+P + +GQA+ +KKGED+  +K +CQR+ G   T+FSVFA+F
Sbjct  11   VPLSVLLKRELANE-KIERPEIVHGQASQSKKGEDFTFVKTECQRVLGDGVTTFSVFALF  69

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI++KENLL+NVLSAIP  L  +EW+ ALPRALVAGFVKTD +FQ++ +TSG
Sbjct  70   DGHNGSAAAIYSKENLLSNVLSAIPPDLNSDEWVSALPRALVAGFVKTDKDFQERAQTSG  129

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+I+ W +TVASVGDSR IL++  G +  L+ DH
Sbjct  130  TTVTFVIIEGWFLTVASVGDSRGILESAEGAIYYLSADH  168



>ref|XP_002894042.1| hypothetical protein ARALYDRAFT_473885 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70301.1| hypothetical protein ARALYDRAFT_473885 [Arabidopsis lyrata subsp. 
lyrata]
Length=428

 Score =   205 bits (521),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ RE  NE K++ P + +GQA  +KKGED+ L+K +CQR+ G   T+FSVF +F
Sbjct  10   VPLSVLLKRESANE-KIDNPELIHGQANQSKKGEDFTLVKTECQRVMGDGVTTFSVFGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+ KENLLNNVL+AIP  L R+EW+ ALPRALVAGFVKTD +FQ++  TSG
Sbjct  69   DGHNGSAAAIYTKENLLNNVLAAIPSDLNRDEWVAALPRALVAGFVKTDKDFQERARTSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+++ W V+VASVGDSRCIL+   G V  L+ DH
Sbjct  129  TTVTFVIVEGWVVSVASVGDSRCILEPAEGGVYYLSADH  167



>ref|XP_011030187.1| PREDICTED: probable protein phosphatase 2C 12 [Populus euphratica]
Length=429

 Score =   205 bits (521),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 125/159 (79%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL NE +VEKP + YGQA+ +KKGED+ L+K +CQRI G   T++SVF +F
Sbjct  11   VPLSVLLKRELANE-RVEKPEILYGQASQSKKGEDFTLLKTECQRIVGDGITTYSVFGLF  69

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+ KENLLNN+++A+P  L R+EW+ ALPRALVAGFVKTD +FQ++  TSG
Sbjct  70   DGHNGSAAAIYTKENLLNNIIAAMPPDLNRDEWVAALPRALVAGFVKTDKDFQERARTSG  129

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTF +I+   +TVASVGDSRCIL++  G +  L+ DH
Sbjct  130  TTVTFAIIEGLFITVASVGDSRCILESAEGDIYYLSADH  168



>ref|XP_007136673.1| hypothetical protein PHAVU_009G064200g [Phaseolus vulgaris]
 gb|ESW08667.1| hypothetical protein PHAVU_009G064200g [Phaseolus vulgaris]
Length=429

 Score =   205 bits (521),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 124/161 (77%), Gaps = 3/161 (2%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVK--YGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFA  281
            VPL  L+ REL NE K+EKP V   +GQA+  KKGED+ L+K +CQR+ G   +++SVF 
Sbjct  10   VPLSVLLKRELANE-KIEKPDVVIVHGQASENKKGEDFMLLKTECQRVVGDGVSTYSVFG  68

Query  282  IFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGET  461
            +FDGHNG +AAI+ KENLLNNVLSAIP  L R+EW+ ALPRALVAGFVKTD +FQ+K  T
Sbjct  69   LFDGHNGSAAAIYTKENLLNNVLSAIPSELNRDEWVSALPRALVAGFVKTDKDFQEKAHT  128

Query  462  SGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            SGTTVTF++ID   VTVASVGDSRCIL+   G +  L+ DH
Sbjct  129  SGTTVTFMIIDGCVVTVASVGDSRCILEPYEGGIYYLSADH  169



>gb|KJB58459.1| hypothetical protein B456_009G211100 [Gossypium raimondii]
Length=460

 Score =   206 bits (523),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ RE  +E K+E P + +GQA+ +KKGED+ L+K +CQR  G    +FSVF +F
Sbjct  10   VPLSVLLKRESESE-KIENPEILHGQASQSKKGEDFTLLKTECQRAMGDGVATFSVFGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+ KENLLNN+LSAIP  L R+EW+ ALPRALVAGFVKTD +FQ K +TSG
Sbjct  69   DGHNGSAAAIYTKENLLNNILSAIPADLNRDEWVAALPRALVAGFVKTDKDFQAKAKTSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTFV+ID W VTVASVGDSRCI ++  G +  L+ DH
Sbjct  129  TTVTFVIIDGWVVTVASVGDSRCIFESGEGGIYYLSADH  167



>ref|XP_006578017.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X5 
[Glycine max]
Length=328

 Score =   202 bits (513),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 125/162 (77%), Gaps = 3/162 (2%)
 Frame = +3

Query  105  AVPLGTLIGRELRNESKVEKPTV--KYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVF  278
            +V L  L+ REL NE K EKP V   +GQA+  KKGED+ L+K +CQR+ G   +++SVF
Sbjct  9    SVSLSVLLKRELANE-KNEKPEVVILHGQASENKKGEDFTLLKTECQRVLGDGVSTYSVF  67

Query  279  AIFDGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGE  458
             +FDGHNG +AAI+AKENLLNNVLSAIP  L R+EW+ ALPRALVAGFVKTD +FQ+K +
Sbjct  68   GLFDGHNGSAAAIYAKENLLNNVLSAIPSDLNRDEWVAALPRALVAGFVKTDKDFQEKAQ  127

Query  459  TSGTTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TSGTTVTF++ + W VTVASVGDSRCIL+   G +  L+ DH
Sbjct  128  TSGTTVTFMITEGWVVTVASVGDSRCILEPSEGGIYYLSADH  169



>ref|XP_008452538.1| PREDICTED: probable protein phosphatase 2C 12 isoform X2 [Cucumis 
melo]
Length=428

 Score =   204 bits (520),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL  E K+E+P + +GQA+ +KKGED+ L+K +C+R+ G   +++SVF +F
Sbjct  10   VPLSVLLKRELAIE-KIERPEIVHGQASQSKKGEDFTLLKTECERVVGDGVSTYSVFGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+AKENLLNNVL+AIP  L R+EW+ ALPRALVAGFVKTD +FQ K +TSG
Sbjct  69   DGHNGSAAAIYAKENLLNNVLAAIPSDLNRDEWIAALPRALVAGFVKTDKDFQAKAQTSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTF++I+ W +TVASVGDSRC L++  G +  L+ DH
Sbjct  129  TTVTFMIIEGWVLTVASVGDSRCTLESSEGGIYYLSADH  167



>ref|XP_006434797.1| hypothetical protein CICLE_v10001232mg [Citrus clementina]
 ref|XP_006434798.1| hypothetical protein CICLE_v10001232mg [Citrus clementina]
 gb|ESR48037.1| hypothetical protein CICLE_v10001232mg [Citrus clementina]
 gb|ESR48038.1| hypothetical protein CICLE_v10001232mg [Citrus clementina]
Length=429

 Score =   204 bits (520),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL NE K+EKP + +GQA+ +KKGED+ L+K +CQR  G   T+FSV+ +F
Sbjct  10   VPLSVLLKRELANE-KIEKPDIVHGQASQSKKGEDFTLLKNECQRAMGDGVTTFSVYGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+ KENLL NVL+AIP  L R+EW+ ALPRA VAGFVKTD +FQ+K  TSG
Sbjct  69   DGHNGSAAAIYTKENLLKNVLNAIPSELNRDEWISALPRATVAGFVKTDKDFQEKARTSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVT V+I+ W +TV SVGDSRCIL++  G +  L+ DH
Sbjct  129  TTVTLVIIEGWAITVGSVGDSRCILESAEGDIYYLSADH  167



>ref|XP_008452534.1| PREDICTED: probable protein phosphatase 2C 12 isoform X1 [Cucumis 
melo]
 ref|XP_008452535.1| PREDICTED: probable protein phosphatase 2C 12 isoform X1 [Cucumis 
melo]
 ref|XP_008452536.1| PREDICTED: probable protein phosphatase 2C 12 isoform X1 [Cucumis 
melo]
 ref|XP_008452537.1| PREDICTED: probable protein phosphatase 2C 12 isoform X1 [Cucumis 
melo]
Length=439

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = +3

Query  108  VPLGTLIGRELRNESKVEKPTVKYGQAALAKKGEDYFLIKPDCQRISGSSTTSFSVFAIF  287
            VPL  L+ REL  E K+E+P + +GQA+ +KKGED+ L+K +C+R+ G   +++SVF +F
Sbjct  10   VPLSVLLKRELAIE-KIERPEIVHGQASQSKKGEDFTLLKTECERVVGDGVSTYSVFGLF  68

Query  288  DGHNGISAAIFAKENLLNNVLSAIPQGLGREEWLQALPRALVAGFVKTDIEFQQKGETSG  467
            DGHNG +AAI+AKENLLNNVL+AIP  L R+EW+ ALPRALVAGFVKTD +FQ K +TSG
Sbjct  69   DGHNGSAAAIYAKENLLNNVLAAIPSDLNRDEWIAALPRALVAGFVKTDKDFQAKAQTSG  128

Query  468  TTVTFVVIDEWTVTVASVGDSRCILDTQGGVVSLLTVDH  584
            TTVTF++I+ W +TVASVGDSRC L++  G +  L+ DH
Sbjct  129  TTVTFMIIEGWVLTVASVGDSRCTLESSEGGIYYLSADH  167



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380