BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS019F06

Length=622
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010469825.1|  PREDICTED: BTB/POZ domain-containing protein...  77.0    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010320455.1|  PREDICTED: BTB/POZ domain-containing protein...  76.6    1e-12   Solanum lycopersicum
gb|EYU36560.1|  hypothetical protein MIMGU_mgv1a001528mg              76.3    1e-12   Erythranthe guttata [common monkey flower]
ref|XP_007018025.1|  BTB/POZ domain-containing protein isoform 1      74.3    6e-12   
ref|XP_007018027.1|  BTB/POZ domain-containing protein isoform 3      74.3    7e-12   
ref|XP_009759339.1|  PREDICTED: BTB/POZ domain-containing protein...  74.3    7e-12   Nicotiana sylvestris
gb|EPS65824.1|  hypothetical protein M569_08953                       74.3    8e-12   Genlisea aurea
ref|XP_009631572.1|  PREDICTED: BTB/POZ domain-containing protein...  74.3    8e-12   Nicotiana tomentosiformis
ref|XP_009631574.1|  PREDICTED: BTB/POZ domain-containing protein...  74.3    8e-12   
ref|XP_011074097.1|  PREDICTED: BTB/POZ domain-containing protein...  73.9    1e-11   Sesamum indicum [beniseed]
ref|XP_010414240.1|  PREDICTED: BTB/POZ domain-containing protein...  73.6    1e-11   
ref|XP_010469824.1|  PREDICTED: BTB/POZ domain-containing protein...  73.6    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_006342129.1|  PREDICTED: BTB/POZ domain-containing protein...  73.2    1e-11   Solanum tuberosum [potatoes]
ref|XP_004291228.1|  PREDICTED: BTB/POZ domain-containing protein...  72.8    2e-11   Fragaria vesca subsp. vesca
ref|XP_008221133.1|  PREDICTED: BTB/POZ domain-containing protein...  72.4    3e-11   Prunus mume [ume]
ref|XP_007221940.1|  hypothetical protein PRUPE_ppa001540mg           72.4    3e-11   Prunus persica
ref|XP_006473784.1|  PREDICTED: BTB/POZ domain-containing protein...  72.4    3e-11   Citrus sinensis [apfelsine]
ref|XP_004238427.1|  PREDICTED: BTB/POZ domain-containing protein...  72.0    4e-11   Solanum lycopersicum
ref|XP_011013905.1|  PREDICTED: BTB/POZ domain-containing protein...  72.0    4e-11   Populus euphratica
ref|XP_011041233.1|  PREDICTED: BTB/POZ domain-containing protein...  72.0    4e-11   Populus euphratica
ref|XP_002307790.1|  BTB/POZ domain-containing family protein         71.6    4e-11   
ref|XP_006410166.1|  hypothetical protein EUTSA_v10016264mg           71.6    5e-11   Eutrema salsugineum [saltwater cress]
ref|XP_010094552.1|  BTB/POZ domain-containing protein                71.6    5e-11   Morus notabilis
ref|XP_002510674.1|  protein binding protein, putative                71.6    5e-11   Ricinus communis
ref|XP_006342130.1|  PREDICTED: BTB/POZ domain-containing protein...  71.6    5e-11   Solanum tuberosum [potatoes]
ref|XP_002270675.1|  PREDICTED: BTB/POZ domain-containing protein...  71.2    8e-11   Vitis vinifera
emb|CBI40712.3|  unnamed protein product                              70.9    8e-11   Vitis vinifera
gb|KJB57964.1|  hypothetical protein B456_009G187700                  70.9    8e-11   Gossypium raimondii
ref|XP_008377082.1|  PREDICTED: BTB/POZ domain-containing protein...  70.9    9e-11   
ref|XP_010469826.1|  PREDICTED: BTB/POZ domain-containing protein...  70.9    9e-11   Camelina sativa [gold-of-pleasure]
ref|XP_007018026.1|  BTB/POZ domain-containing protein isoform 2      70.5    9e-11   
ref|XP_008377080.1|  PREDICTED: BTB/POZ domain-containing protein...  70.9    9e-11   Malus domestica [apple tree]
ref|XP_008377081.1|  PREDICTED: BTB/POZ domain-containing protein...  70.9    1e-10   
gb|KHG01113.1|  hypothetical protein F383_22949                       70.9    1e-10   Gossypium arboreum [tree cotton]
ref|XP_006435355.1|  hypothetical protein CICLE_v10003249mg           70.5    1e-10   
ref|XP_006473785.1|  PREDICTED: BTB/POZ domain-containing protein...  70.5    1e-10   Citrus sinensis [apfelsine]
ref|XP_009631576.1|  PREDICTED: BTB/POZ domain-containing protein...  70.5    1e-10   Nicotiana tomentosiformis
gb|KFK23322.1|  hypothetical protein AALP_AAs74635U001200             70.1    1e-10   Arabis alpina [alpine rockcress]
ref|XP_010556054.1|  PREDICTED: BTB/POZ domain-containing protein...  70.1    2e-10   Tarenaya hassleriana [spider flower]
ref|XP_010510327.1|  PREDICTED: BTB/POZ domain-containing protein...  70.1    2e-10   Camelina sativa [gold-of-pleasure]
emb|CDP07293.1|  unnamed protein product                              70.1    2e-10   Coffea canephora [robusta coffee]
ref|XP_002879271.1|  BTB/POZ domain-containing protein                69.7    2e-10   
ref|NP_001189642.1|  BTB/POZ domain-containing protein                69.7    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180618.2|  BTB/POZ domain-containing protein                   69.7    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011034881.1|  PREDICTED: BTB/POZ domain-containing protein...  69.7    2e-10   Populus euphratica
ref|XP_010935266.1|  PREDICTED: BTB/POZ domain-containing protein...  69.7    2e-10   
ref|XP_006293695.1|  hypothetical protein CARUB_v10022653mg           69.3    3e-10   Capsella rubella
ref|XP_011034879.1|  PREDICTED: BTB/POZ domain-containing protein...  69.3    3e-10   Populus euphratica
ref|XP_002300643.1|  BTB/POZ domain-containing family protein         69.3    3e-10   Populus trichocarpa [western balsam poplar]
gb|AES98295.2|  BTB/POZ domain plant protein                          68.6    5e-10   Medicago truncatula
ref|XP_003615337.1|  Kelch-like protein                               68.6    5e-10   
ref|XP_008781287.1|  PREDICTED: BTB/POZ domain-containing protein...  68.6    5e-10   
ref|XP_008781284.1|  PREDICTED: BTB/POZ domain-containing protein...  68.6    5e-10   
dbj|BAD93995.1|  hypothetical protein                                 68.2    7e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CDY29657.1|  BnaA04g17700D                                        67.4    1e-09   Brassica napus [oilseed rape]
ref|XP_009141083.1|  PREDICTED: BTB/POZ domain-containing protein...  67.0    1e-09   Brassica rapa
ref|XP_009141084.1|  PREDICTED: BTB/POZ domain-containing protein...  67.0    1e-09   Brassica rapa
emb|CDX97805.1|  BnaC04g41340D                                        67.0    1e-09   
ref|XP_004512607.1|  PREDICTED: BTB/POZ domain-containing protein...  67.0    2e-09   Cicer arietinum [garbanzo]
ref|XP_004512608.1|  PREDICTED: BTB/POZ domain-containing protein...  66.6    2e-09   Cicer arietinum [garbanzo]
gb|KDP36794.1|  hypothetical protein JCGZ_08085                       66.2    2e-09   Jatropha curcas
ref|XP_006596518.1|  PREDICTED: BTB/POZ domain-containing protein...  66.2    2e-09   
ref|XP_007160598.1|  hypothetical protein PHAVU_001G001100g           66.2    2e-09   Phaseolus vulgaris [French bean]
ref|XP_003545003.1|  PREDICTED: BTB/POZ domain-containing protein...  66.2    3e-09   Glycine max [soybeans]
ref|XP_006596517.1|  PREDICTED: BTB/POZ domain-containing protein...  66.2    3e-09   
gb|AAB63077.1|  unknown protein                                       65.9    3e-09   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH56763.1|  AT2G30600                                            65.5    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009418296.1|  PREDICTED: BTB/POZ domain-containing protein...  65.9    3e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010266159.1|  PREDICTED: BTB/POZ domain-containing protein...  64.3    1e-08   Nelumbo nucifera [Indian lotus]
gb|KEH28127.1|  BTB/POZ domain plant protein                          63.5    2e-08   Medicago truncatula
ref|XP_010692549.1|  PREDICTED: BTB/POZ domain-containing protein...  62.4    5e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010061166.1|  PREDICTED: BTB/POZ domain-containing protein...  62.0    6e-08   Eucalyptus grandis [rose gum]
ref|XP_010061165.1|  PREDICTED: BTB/POZ domain-containing protein...  61.6    8e-08   Eucalyptus grandis [rose gum]
ref|XP_004145539.1|  PREDICTED: BTB/POZ domain-containing protein...  58.9    6e-07   Cucumis sativus [cucumbers]
ref|XP_008452951.1|  PREDICTED: BTB/POZ domain-containing protein...  58.9    6e-07   Cucumis melo [Oriental melon]
ref|XP_004964253.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...  53.9    3e-05   
ref|XP_003561246.1|  PREDICTED: BTB/POZ domain-containing protein...  53.9    3e-05   Brachypodium distachyon [annual false brome]
ref|XP_002437659.1|  hypothetical protein SORBIDRAFT_10g000240        53.5    4e-05   Sorghum bicolor [broomcorn]
ref|XP_006828729.1|  hypothetical protein AMTR_s00001p00041750        52.8    7e-05   
emb|CDM85346.1|  unnamed protein product                              52.0    1e-04   Triticum aestivum [Canadian hard winter wheat]
gb|EEC79014.1|  hypothetical protein OsI_19541                        52.0    1e-04   Oryza sativa Indica Group [Indian rice]
dbj|BAK07994.1|  predicted protein                                    50.8    3e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006664953.1|  PREDICTED: BTB/POZ domain-containing protein...  50.8    4e-04   Oryza brachyantha
gb|AAV43802.1|  unknown protein                                       50.4    4e-04   Oryza sativa Japonica Group [Japonica rice]



>ref|XP_010469825.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Camelina sativa]
Length=818

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/43 (74%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  494  CEGETMEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            C+G+ + +K  KFLTVAPFECAW DDL F EAGRGCVAFDAFA
Sbjct  6    CKGKMVAVKENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFA  48



>ref|XP_010320455.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Solanum lycopersicum]
Length=824

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  497  EGETMEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            +GE ME K KKFLTVAPFECAW +DL F EAGRGCVAFDAFA
Sbjct  18   QGEMMEKKQKKFLTVAPFECAWPNDLRFREAGRGCVAFDAFA  59



>gb|EYU36560.1| hypothetical protein MIMGU_mgv1a001528mg [Erythranthe guttata]
Length=802

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/38 (89%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  509  MEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            ME K KKFLTVAPFECAWRDDL F EAGRGCVAFDAFA
Sbjct  1    MEKKQKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFA  38



>ref|XP_007018025.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY15250.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
Length=805

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  509  MEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            ME K KKFLTVAPFECAWR DL F EAGRGCVAFDAFA
Sbjct  1    MEKKEKKFLTVAPFECAWRKDLKFREAGRGCVAFDAFA  38



>ref|XP_007018027.1| BTB/POZ domain-containing protein isoform 3 [Theobroma cacao]
 gb|EOY15252.1| BTB/POZ domain-containing protein isoform 3 [Theobroma cacao]
Length=789

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  509  MEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            ME K KKFLTVAPFECAWR DL F EAGRGCVAFDAFA
Sbjct  1    MEKKEKKFLTVAPFECAWRKDLKFREAGRGCVAFDAFA  38



>ref|XP_009759339.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nicotiana 
sylvestris]
Length=810

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  500  GETMEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            GE M+ K KKFLTVAPFECAW +DL F EAGRGCVAFDAFA
Sbjct  19   GEMMDKKQKKFLTVAPFECAWPNDLRFREAGRGCVAFDAFA  59



>gb|EPS65824.1| hypothetical protein M569_08953, partial [Genlisea aurea]
Length=780

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  509  MEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            ME K K+FLTVAPFECAW DDL F EAGRGCVAFDAFA
Sbjct  1    MENKHKRFLTVAPFECAWHDDLRFREAGRGCVAFDAFA  38



>ref|XP_009631572.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Nicotiana tomentosiformis]
Length=826

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  500  GETMEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            GE +E K KKFLTVAPFECAW +DL F EAGRGCVAFDAFA
Sbjct  21   GEMLEKKQKKFLTVAPFECAWPNDLRFREAGRGCVAFDAFA  61



>ref|XP_009631574.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009631575.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Nicotiana tomentosiformis]
Length=824

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  500  GETMEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            GE +E K KKFLTVAPFECAW +DL F EAGRGCVAFDAFA
Sbjct  19   GEMLEKKQKKFLTVAPFECAWPNDLRFREAGRGCVAFDAFA  59



>ref|XP_011074097.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Sesamum 
indicum]
Length=804

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  509  MEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            ME K KKFLTVAPF+CAW DDL F EAGRGCVAFDAFA
Sbjct  1    MEKKQKKFLTVAPFQCAWHDDLRFREAGRGCVAFDAFA  38



>ref|XP_010414240.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Camelina 
sativa]
Length=824

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  497  EGETMEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            +G+ + +K  KFLTVAPFECAW DDL F EAGRGCVAFDAFA
Sbjct  12   KGKMVAVKENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFA  53



>ref|XP_010469824.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Camelina sativa]
Length=823

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  497  EGETMEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            +G+ + +K  KFLTVAPFECAW DDL F EAGRGCVAFDAFA
Sbjct  12   KGKMVAVKENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFA  53



>ref|XP_006342129.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Solanum tuberosum]
Length=824

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  503  ETMEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            E ME K KKFLTVAPFECAW +DL F EAGRGCVAFDAFA
Sbjct  20   EMMEKKQKKFLTVAPFECAWPNDLRFREAGRGCVAFDAFA  59



>ref|XP_004291228.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Fragaria 
vesca subsp. vesca]
 ref|XP_011459073.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Fragaria 
vesca subsp. vesca]
Length=803

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  509  MEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            ME K  KFLTVAPFECAWR+DL F EAGRGCVAF+AFA
Sbjct  1    MEKKENKFLTVAPFECAWRNDLKFREAGRGCVAFEAFA  38



>ref|XP_008221133.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
 ref|XP_008221134.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
 ref|XP_008221135.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
 ref|XP_008221136.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
Length=805

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  509  MEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            M+ K KKFLTVAPFECAWR DL F EAGRGCVAF+AFA
Sbjct  2    MDKKEKKFLTVAPFECAWRKDLKFREAGRGCVAFEAFA  39



>ref|XP_007221940.1| hypothetical protein PRUPE_ppa001540mg [Prunus persica]
 gb|EMJ23139.1| hypothetical protein PRUPE_ppa001540mg [Prunus persica]
Length=805

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  509  MEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            M+ K KKFLTVAPFECAWR DL F EAGRGCVAF+AFA
Sbjct  2    MDKKEKKFLTVAPFECAWRKDLKFREAGRGCVAFEAFA  39



>ref|XP_006473784.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Citrus sinensis]
Length=817

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  500  GETMEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            G+  E K KKFLTVAPFECAWR DL F EAGRGCVAF+AFA
Sbjct  10   GKMAEKKEKKFLTVAPFECAWRKDLKFREAGRGCVAFEAFA  50



>ref|XP_004238427.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Solanum lycopersicum]
 ref|XP_010320456.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Solanum lycopersicum]
Length=804

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  509  MEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            ME K KKFLTVAPFECAW +DL F EAGRGCVAFDAFA
Sbjct  2    MEKKQKKFLTVAPFECAWPNDLRFREAGRGCVAFDAFA  39



>ref|XP_011013905.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
 ref|XP_011013907.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
Length=806

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  509  MEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            +E K KKFLTVAPF+CAWR DL F EAGRGCVAFDAFA
Sbjct  2    IEEKEKKFLTVAPFQCAWRKDLKFREAGRGCVAFDAFA  39



>ref|XP_011041233.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
 ref|XP_011041234.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
Length=806

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  509  MEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            +E K KKFLTVAPF+CAWR DL F EAGRGCVAFDAFA
Sbjct  2    IEEKEKKFLTVAPFQCAWRKDLKFREAGRGCVAFDAFA  39



>ref|XP_002307790.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
 gb|EEE94786.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
Length=806

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  509  MEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            +E K KKFLTVAPF+CAWR DL F EAGRGCVAFDAFA
Sbjct  2    IEEKEKKFLTVAPFQCAWRKDLKFREAGRGCVAFDAFA  39



>ref|XP_006410166.1| hypothetical protein EUTSA_v10016264mg [Eutrema salsugineum]
 gb|ESQ51619.1| hypothetical protein EUTSA_v10016264mg [Eutrema salsugineum]
Length=806

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  515  IKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            +K KKFLTVAPFECAW DDL F EAGRGCVAFDAFA
Sbjct  4    LKEKKFLTVAPFECAWSDDLKFREAGRGCVAFDAFA  39



>ref|XP_010094552.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB56306.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=810

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  509  MEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            ME K K+FLTVAPFECAWR DL F EAGRGCVAF+AFA
Sbjct  2    MEKKEKEFLTVAPFECAWRKDLKFREAGRGCVAFEAFA  39



>ref|XP_002510674.1| protein binding protein, putative [Ricinus communis]
 gb|EEF52861.1| protein binding protein, putative [Ricinus communis]
Length=806

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  509  MEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            +E K KKFLTVAPF+CAWR DL F EAGRGCVAFDAFA
Sbjct  2    IEEKEKKFLTVAPFQCAWRKDLKFREAGRGCVAFDAFA  39



>ref|XP_006342130.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006342131.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Solanum tuberosum]
Length=804

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  509  MEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            ME K KKFLTVAPFECAW +DL F EAGRGCVAFDAFA
Sbjct  2    MEKKQKKFLTVAPFECAWPNDLRFREAGRGCVAFDAFA  39



>ref|XP_002270675.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Vitis 
vinifera]
Length=806

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  509  MEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            +E K KKFLTVAPFECAWR DL F EAGRGCVAF+AFA
Sbjct  2    IEKKQKKFLTVAPFECAWRKDLRFREAGRGCVAFEAFA  39



>emb|CBI40712.3| unnamed protein product [Vitis vinifera]
Length=789

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  509  MEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            +E K KKFLTVAPFECAWR DL F EAGRGCVAF+AFA
Sbjct  2    IEKKQKKFLTVAPFECAWRKDLRFREAGRGCVAFEAFA  39



>gb|KJB57964.1| hypothetical protein B456_009G187700 [Gossypium raimondii]
 gb|KJB57965.1| hypothetical protein B456_009G187700 [Gossypium raimondii]
Length=802

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  509  MEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            ME K KKFLTVAPFECAW  DL F EAGRGCV+FDAFA
Sbjct  1    METKEKKFLTVAPFECAWIKDLKFREAGRGCVSFDAFA  38



>ref|XP_008377082.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X3 [Malus domestica]
Length=797

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  509  MEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            M+ K KKFLTVAPFECAWR DL F E+GRGCVAF+AFA
Sbjct  2    MDKKEKKFLTVAPFECAWRKDLKFRESGRGCVAFEAFA  39



>ref|XP_010469826.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
 ref|XP_010469827.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
 ref|XP_010469828.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
 ref|XP_010469829.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
Length=809

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  515  IKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            +K  KFLTVAPFECAW DDL F EAGRGCVAFDAFA
Sbjct  4    VKENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFA  39



>ref|XP_007018026.1| BTB/POZ domain-containing protein isoform 2 [Theobroma cacao]
 gb|EOY15251.1| BTB/POZ domain-containing protein isoform 2 [Theobroma cacao]
Length=495

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  509  MEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            ME K KKFLTVAPFECAWR DL F EAGRGCVAFDAFA
Sbjct  1    MEKKEKKFLTVAPFECAWRKDLKFREAGRGCVAFDAFA  38



>ref|XP_008377080.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Malus domestica]
Length=805

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  509  MEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            M+ K KKFLTVAPFECAWR DL F E+GRGCVAF+AFA
Sbjct  2    MDKKEKKFLTVAPFECAWRKDLKFRESGRGCVAFEAFA  39



>ref|XP_008377081.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Malus domestica]
Length=803

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  509  MEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            M+ K KKFLTVAPFECAWR DL F E+GRGCVAF+AFA
Sbjct  2    MDKKEKKFLTVAPFECAWRKDLKFRESGRGCVAFEAFA  39



>gb|KHG01113.1| hypothetical protein F383_22949 [Gossypium arboreum]
Length=802

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  509  MEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            ME K KKFLTVAPFECAW  DL F EAGRGCV+FDAFA
Sbjct  1    METKEKKFLTVAPFECAWIKDLKFREAGRGCVSFDAFA  38



>ref|XP_006435355.1| hypothetical protein CICLE_v10003249mg [Citrus clementina]
 gb|ESR48595.1| hypothetical protein CICLE_v10003249mg [Citrus clementina]
Length=818

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  512  EIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            E K KKFLTVAPFECAWR DL F EAGRGCVAF+AFA
Sbjct  3    EKKEKKFLTVAPFECAWRKDLKFREAGRGCVAFEAFA  39



>ref|XP_006473785.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Citrus sinensis]
 ref|XP_006473786.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Citrus sinensis]
 gb|KDO85089.1| hypothetical protein CISIN_1g040529mg [Citrus sinensis]
Length=806

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  512  EIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            E K KKFLTVAPFECAWR DL F EAGRGCVAF+AFA
Sbjct  3    EKKEKKFLTVAPFECAWRKDLKFREAGRGCVAFEAFA  39



>ref|XP_009631576.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X3 [Nicotiana tomentosiformis]
Length=804

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  509  MEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            +E K KKFLTVAPFECAW +DL F EAGRGCVAFDAFA
Sbjct  2    LEKKQKKFLTVAPFECAWPNDLRFREAGRGCVAFDAFA  39



>gb|KFK23322.1| hypothetical protein AALP_AAs74635U001200 [Arabis alpina]
Length=807

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  518  KPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            K KK+LTVAPFECAW DDL F EAGRGCVAFDAFA
Sbjct  5    KEKKYLTVAPFECAWSDDLKFREAGRGCVAFDAFA  39



>ref|XP_010556054.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Tarenaya 
hassleriana]
 ref|XP_010556055.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Tarenaya 
hassleriana]
 ref|XP_010556056.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Tarenaya 
hassleriana]
Length=804

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  515  IKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            I+ KKFLTVAPFECAWR+DL F E GRGCVAFDAFA
Sbjct  4    IQEKKFLTVAPFECAWREDLKFREPGRGCVAFDAFA  39



>ref|XP_010510327.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Camelina 
sativa]
 ref|XP_010510328.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Camelina 
sativa]
Length=809

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  518  KPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            K  KFLTVAPFECAW DDL F EAGRGCVAFDAFA
Sbjct  5    KENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFA  39



>emb|CDP07293.1| unnamed protein product [Coffea canephora]
Length=802

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  509  MEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            +E K KKFLTVAPFECAW DDL F EAGRGCVAFDAFA
Sbjct  2    IEKKQKKFLTVAPFECAWCDDLKFREAGRGCVAFDAFA  39



>ref|XP_002879271.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55530.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=809

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  518  KPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            K  KFLTVAPFECAW DDL F EAGRGCVAFDAFA
Sbjct  5    KENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFA  39



>ref|NP_001189642.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08417.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
Length=855

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  518  KPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            K  KFLTVAPFECAW DDL F EAGRGCVAFDAFA
Sbjct  5    KENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFA  39



>ref|NP_180618.2| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 ref|NP_850151.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 ref|NP_001031447.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 ref|NP_001031448.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 sp|Q8LEV3.1|Y2060_ARATH RecName: Full=BTB/POZ domain-containing protein At2g30600 [Arabidopsis 
thaliana]
 gb|AAM62449.1| unknown [Arabidopsis thaliana]
 dbj|BAD42918.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43840.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44307.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08413.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08414.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08415.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08416.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
Length=809

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  518  KPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            K  KFLTVAPFECAW DDL F EAGRGCVAFDAFA
Sbjct  5    KENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFA  39



>ref|XP_011034881.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Populus euphratica]
Length=801

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  515  IKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            I+ KKFLTVAPF+CAWR DL F EAGRGCV FDAFA
Sbjct  2    IEEKKFLTVAPFQCAWRKDLKFREAGRGCVTFDAFA  37



>ref|XP_010935266.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Elaeis 
guineensis]
 ref|XP_010935267.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Elaeis 
guineensis]
 ref|XP_010935268.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Elaeis 
guineensis]
Length=805

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  518  KPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            K KKFLTVAPFECAWR++L F EAGRGCVAF+AFA
Sbjct  5    KQKKFLTVAPFECAWREELRFREAGRGCVAFEAFA  39



>ref|XP_006293695.1| hypothetical protein CARUB_v10022653mg [Capsella rubella]
 gb|EOA26593.1| hypothetical protein CARUB_v10022653mg [Capsella rubella]
Length=809

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  518  KPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            K  KFLTVAPFECAW DDL F EAGRGCVAFDAFA
Sbjct  5    KENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFA  39



>ref|XP_011034879.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Populus euphratica]
 ref|XP_011034880.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Populus euphratica]
Length=808

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  515  IKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            I+ KKFLTVAPF+CAWR DL F EAGRGCV FDAFA
Sbjct  2    IEEKKFLTVAPFQCAWRKDLKFREAGRGCVTFDAFA  37



>ref|XP_002300643.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
 gb|EEE79916.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
Length=801

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  515  IKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            I+  KFLTVAPF+CAWR DL F EAGRGCVAFDAFA
Sbjct  2    IEENKFLTVAPFQCAWRKDLKFREAGRGCVAFDAFA  37



>gb|AES98295.2| BTB/POZ domain plant protein [Medicago truncatula]
Length=799

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  524  KKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            +KFLTV PFECAWR+DL F EAGRGCVAFDAFA
Sbjct  3    EKFLTVPPFECAWREDLKFQEAGRGCVAFDAFA  35



>ref|XP_003615337.1| Kelch-like protein [Medicago truncatula]
Length=884

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  524  KKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            +KFLTV PFECAWR+DL F EAGRGCVAFDAFA
Sbjct  88   EKFLTVPPFECAWREDLKFQEAGRGCVAFDAFA  120



>ref|XP_008781287.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Phoenix dactylifera]
Length=803

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  518  KPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            K KKFLTVAPFECAWR++L F EAGRGCVAF+AFA
Sbjct  5    KQKKFLTVAPFECAWREELRFREAGRGCVAFEAFA  39



>ref|XP_008781284.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008781285.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008781286.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Phoenix dactylifera]
Length=805

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  518  KPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            K KKFLTVAPFECAWR++L F EAGRGCVAF+AFA
Sbjct  5    KQKKFLTVAPFECAWREELRFREAGRGCVAFEAFA  39



>dbj|BAD93995.1| hypothetical protein [Arabidopsis thaliana]
Length=812

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 29/32 (91%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  527  KFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            KFLTVAPFECAW DDL F EAGRGCVAFDAFA
Sbjct  11   KFLTVAPFECAWSDDLKFREAGRGCVAFDAFA  42



>emb|CDY29657.1| BnaA04g17700D [Brassica napus]
Length=844

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  518  KPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            K  KFLTVAPFECAW DDL F E GRGCVAFDAFA
Sbjct  5    KENKFLTVAPFECAWSDDLKFREPGRGCVAFDAFA  39



>ref|XP_009141083.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Brassica rapa]
Length=806

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  518  KPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            K  KFLTVAPFECAW DDL F E GRGCVAFDAFA
Sbjct  10   KENKFLTVAPFECAWSDDLKFREPGRGCVAFDAFA  44



>ref|XP_009141084.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Brassica rapa]
 ref|XP_009141086.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Brassica rapa]
Length=801

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  518  KPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            K  KFLTVAPFECAW DDL F E GRGCVAFDAFA
Sbjct  5    KENKFLTVAPFECAWSDDLKFREPGRGCVAFDAFA  39



>emb|CDX97805.1| BnaC04g41340D [Brassica napus]
Length=796

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  518  KPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            K  KFLTVAPFECAW DDL F E GRGCVAFDAFA
Sbjct  5    KENKFLTVAPFECAWSDDLKFREPGRGCVAFDAFA  39



>ref|XP_004512607.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Cicer arietinum]
Length=815

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  524  KKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            +KFLTVAPFECAWR+DL F EAGRGCV F+AFA
Sbjct  23   EKFLTVAPFECAWREDLKFREAGRGCVTFEAFA  55



>ref|XP_004512608.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Cicer arietinum]
 ref|XP_004512609.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Cicer arietinum]
 ref|XP_004512610.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X4 [Cicer arietinum]
Length=795

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  524  KKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            +KFLTVAPFECAWR+DL F EAGRGCV F+AFA
Sbjct  3    EKFLTVAPFECAWREDLKFREAGRGCVTFEAFA  35



>gb|KDP36794.1| hypothetical protein JCGZ_08085 [Jatropha curcas]
Length=506

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  518  KPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            K KKFLTVAPF+CAWR DL F EAGRGCVAFDAFA
Sbjct  5    KEKKFLTVAPFQCAWRKDLKFREAGRGCVAFDAFA  39



>ref|XP_006596518.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Glycine max]
Length=714

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  527  KFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            KFLTV PFECAWR+DL F EAGRGCVAF+AFA
Sbjct  4    KFLTVPPFECAWREDLKFREAGRGCVAFEAFA  35



>ref|XP_007160598.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
 ref|XP_007160599.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
 gb|ESW32592.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
 gb|ESW32593.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
Length=802

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  527  KFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            KFLTV PFECAWR+DL F EAGRGCVAF+AFA
Sbjct  4    KFLTVPPFECAWREDLKFREAGRGCVAFEAFA  35



>ref|XP_003545003.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Glycine max]
 gb|KHN12601.1| BTB/POZ domain-containing protein [Glycine soja]
Length=802

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  527  KFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            KFLTV PFECAWR+DL F EAGRGCVAF+AFA
Sbjct  4    KFLTVPPFECAWREDLKFREAGRGCVAFEAFA  35



>ref|XP_006596517.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Glycine max]
Length=806

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  527  KFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            KFLTV PFECAWR+DL F EAGRGCVAF+AFA
Sbjct  4    KFLTVPPFECAWREDLKFREAGRGCVAFEAFA  35



>gb|AAB63077.1| unknown protein [Arabidopsis thaliana]
Length=586

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  518  KPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            K  KFLTVAPFECAW DDL F EAGRGCVAFDAFA
Sbjct  5    KENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFA  39



>dbj|BAH56763.1| AT2G30600 [Arabidopsis thaliana]
Length=481

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  518  KPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            K  KFLTVAPFECAW DDL F EAGRGCVAFDAFA
Sbjct  5    KENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFA  39



>ref|XP_009418296.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418297.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418298.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418299.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418300.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418301.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
Length=803

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  518  KPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            K KKFLTVAPF+C WR++L F EAGRGCVAF+AFA
Sbjct  5    KQKKFLTVAPFKCVWREELRFKEAGRGCVAFEAFA  39



>ref|XP_010266159.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
 ref|XP_010266161.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
 ref|XP_010266162.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
 ref|XP_010266163.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
Length=806

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  518  KPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            K KKFLTVAPFECAWR +L F  AGRGCVAF+AFA
Sbjct  5    KQKKFLTVAPFECAWRKELRFRVAGRGCVAFEAFA  39



>gb|KEH28127.1| BTB/POZ domain plant protein [Medicago truncatula]
Length=614

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  524  KKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            +KFLTV PFECAWR+DL F EAGRGCVAFDAFA
Sbjct  3    EKFLTVPPFECAWREDLKFQEAGRGCVAFDAFA  35



>ref|XP_010692549.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010692550.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Beta 
vulgaris subsp. vulgaris]
Length=805

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  518  KPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            K +KFLTVAPFECAW+ +  F EAGRGCV F+AFA
Sbjct  5    KQQKFLTVAPFECAWQKEFKFKEAGRGCVVFEAFA  39



>ref|XP_010061166.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Eucalyptus grandis]
 gb|KCW68087.1| hypothetical protein EUGRSUZ_F01772 [Eucalyptus grandis]
 gb|KCW68088.1| hypothetical protein EUGRSUZ_F01772 [Eucalyptus grandis]
Length=802

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  509  MEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            M  K KKF+ VAPFECAW +DL F EAGRGCVAF+A A
Sbjct  1    MAEKEKKFVRVAPFECAWSEDLMFREAGRGCVAFEASA  38



>ref|XP_010061165.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Eucalyptus grandis]
Length=853

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  509  MEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            M  K KKF+ VAPFECAW +DL F EAGRGCVAF+A A
Sbjct  52   MAEKEKKFVRVAPFECAWSEDLMFREAGRGCVAFEASA  89



>ref|XP_004145539.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Cucumis 
sativus]
 ref|XP_004164111.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Cucumis 
sativus]
 gb|KGN55497.1| hypothetical protein Csa_4G658570 [Cucumis sativus]
Length=806

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  509  MEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            M+ K K  +TVAPFECAW  DL F EAGRGCVAF+A A
Sbjct  2    MDKKEKNSITVAPFECAWLKDLRFREAGRGCVAFEASA  39



>ref|XP_008452951.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Cucumis 
melo]
 ref|XP_008452952.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Cucumis 
melo]
 ref|XP_008452953.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Cucumis 
melo]
Length=806

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  509  MEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            M+ K K  +TVAPFECAW  DL F EAGRGCVAF+A A
Sbjct  2    MDKKEKNSITVAPFECAWLKDLRFREAGRGCVAFEASA  39



>ref|XP_004964253.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At2g30600-like [Setaria italica]
Length=862

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  503  ETMEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            E +E   K+ LTVAPFECAW ++L F E GRGCV+F+A A
Sbjct  2    EFVEETKKRSLTVAPFECAWGEELRFREPGRGCVSFEASA  41



>ref|XP_003561246.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Brachypodium 
distachyon]
Length=812

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +2

Query  524  KKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            K+ LTVAPFECAW +   F EAGRGCVAF+A A
Sbjct  10   KRSLTVAPFECAWDEQFRFTEAGRGCVAFEASA  42



>ref|XP_002437659.1| hypothetical protein SORBIDRAFT_10g000240 [Sorghum bicolor]
 gb|EER89026.1| hypothetical protein SORBIDRAFT_10g000240 [Sorghum bicolor]
Length=807

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  524  KKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            K+ LTVAPFECAW ++L F E GRGC+AF+A A
Sbjct  8    KRSLTVAPFECAWAEELRFGEPGRGCIAFEASA  40



>ref|XP_006828729.1| hypothetical protein AMTR_s00001p00041750 [Amborella trichopoda]
 gb|ERM96145.1| hypothetical protein AMTR_s00001p00041750 [Amborella trichopoda]
Length=827

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 1/35 (3%)
 Frame = +2

Query  518  KPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            K KKFLTVAPFEC W  +  F +AGRGCV F+AFA
Sbjct  28   KQKKFLTVAPFECVWLME-RFRDAGRGCVTFEAFA  61



>emb|CDM85346.1| unnamed protein product [Triticum aestivum]
Length=805

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  524  KKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            K+ LTVAPF+CAW ++  F EAGRGC+AF+A A
Sbjct  7    KRSLTVAPFKCAWGEEFRFVEAGRGCIAFEASA  39



>gb|EEC79014.1| hypothetical protein OsI_19541 [Oryza sativa Indica Group]
Length=806

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +2

Query  524  KKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            K+ +TVAPFECAW ++  F EAGRGC+ F+A A
Sbjct  7    KRSITVAPFECAWDEEFRFREAGRGCITFEASA  39



>dbj|BAK07994.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=487

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  524  KKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            K+ LTVAPFECAW ++  F EAGRGC+AF+A A
Sbjct  7    KRSLTVAPFECAWGEEFRFVEAGRGCIAFEASA  39



>ref|XP_006664953.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Oryza 
brachyantha]
Length=805

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 1/38 (3%)
 Frame = +2

Query  509  MEIKPKKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            ME K K+ +TVAPFECAW +   F EAGRGC+ F+A A
Sbjct  3    MEEK-KRSITVAPFECAWDEGFQFREAGRGCITFEASA  39



>gb|AAV43802.1| unknown protein [Oryza sativa Japonica Group]
Length=806

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/33 (58%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +2

Query  524  KKFLTVAPFECAWRDDLXFXEAGRGCVAFDAFA  622
            K+ +TVAPFECAW ++  F E GRGC+ F+A A
Sbjct  7    KRSITVAPFECAWDEEFRFRETGRGCITFEASA  39



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950