BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS019E04

Length=526
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004236784.1|  PREDICTED: putative lysine-specific demethyl...    140   1e-34   Solanum lycopersicum
ref|XP_009804681.1|  PREDICTED: putative lysine-specific demethyl...    139   2e-34   Nicotiana sylvestris
ref|XP_006361437.1|  PREDICTED: uncharacterized protein LOC102593415    139   4e-34   
ref|XP_009613002.1|  PREDICTED: putative lysine-specific demethyl...    138   8e-34   Nicotiana tomentosiformis
emb|CDO99990.1|  unnamed protein product                                130   4e-31   Coffea canephora [robusta coffee]
gb|KDP23713.1|  hypothetical protein JCGZ_23546                         117   9e-27   Jatropha curcas
ref|XP_007143964.1|  hypothetical protein PHAVU_007G117400g             115   5e-26   Phaseolus vulgaris [French bean]
ref|XP_011101609.1|  PREDICTED: putative lysine-specific demethyl...    114   1e-25   Sesamum indicum [beniseed]
ref|XP_010262342.1|  PREDICTED: lysine-specific demethylase JMJ18       114   2e-25   Nelumbo nucifera [Indian lotus]
emb|CBI22382.3|  unnamed protein product                                110   2e-24   Vitis vinifera
ref|XP_002266063.2|  PREDICTED: putative lysine-specific demethyl...    110   2e-24   Vitis vinifera
gb|EYU19891.1|  hypothetical protein MIMGU_mgv1a026881mg                110   2e-24   Erythranthe guttata [common monkey flower]
ref|XP_007030413.1|  Transcription factor jumonji family protein ...    108   2e-23   
ref|XP_011036303.1|  PREDICTED: putative lysine-specific demethyl...    107   3e-23   Populus euphratica
ref|XP_006371089.1|  hypothetical protein POPTR_0019s03550g             106   6e-23   
ref|XP_002325772.2|  hypothetical protein POPTR_0019s03550g             106   7e-23   
ref|XP_006375851.1|  hypothetical protein POPTR_0013s04370g             106   9e-23   
ref|XP_011038513.1|  PREDICTED: putative lysine-specific demethyl...    106   9e-23   Populus euphratica
ref|XP_011038514.1|  PREDICTED: putative lysine-specific demethyl...    105   1e-22   Populus euphratica
ref|XP_003555549.2|  PREDICTED: probable lysine-specific demethyl...    104   4e-22   Glycine max [soybeans]
gb|KHN14767.1|  Putative lysine-specific demethylase JMJ14              103   7e-22   Glycine soja [wild soybean]
ref|XP_006589229.1|  PREDICTED: probable lysine-specific demethyl...    103   7e-22   Glycine max [soybeans]
ref|XP_002521976.1|  transcription factor, putative                     102   1e-21   
ref|XP_009379753.1|  PREDICTED: putative lysine-specific demethyl...    102   2e-21   
ref|XP_009364440.1|  PREDICTED: putative lysine-specific demethyl...    101   4e-21   Pyrus x bretschneideri [bai li]
ref|XP_008388726.1|  PREDICTED: probable lysine-specific demethyl...    100   7e-21   
ref|XP_008388723.1|  PREDICTED: probable lysine-specific demethyl...    100   7e-21   
gb|KJB44858.1|  hypothetical protein B456_007G276200                    100   8e-21   Gossypium raimondii
gb|KJB44857.1|  hypothetical protein B456_007G276200                  99.4    2e-20   Gossypium raimondii
gb|KJB44853.1|  hypothetical protein B456_007G276200                  99.4    2e-20   Gossypium raimondii
ref|XP_004495524.1|  PREDICTED: probable lysine-specific demethyl...  97.1    1e-19   Cicer arietinum [garbanzo]
gb|KDO44525.1|  hypothetical protein CISIN_1g0443881mg                95.9    1e-19   Citrus sinensis [apfelsine]
ref|XP_010695040.1|  PREDICTED: lysine-specific demethylase JMJ18     96.7    1e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008218326.1|  PREDICTED: probable lysine-specific demethyl...  96.7    1e-19   Prunus mume [ume]
ref|XP_010043290.1|  PREDICTED: putative lysine-specific demethyl...  96.7    2e-19   Eucalyptus grandis [rose gum]
ref|XP_010043289.1|  PREDICTED: putative lysine-specific demethyl...  96.7    2e-19   
ref|XP_004152824.1|  PREDICTED: probable lysine-specific demethyl...  96.3    2e-19   Cucumis sativus [cucumbers]
ref|XP_006487711.1|  PREDICTED: probable lysine-specific demethyl...  95.9    3e-19   Citrus sinensis [apfelsine]
ref|XP_007208130.1|  hypothetical protein PRUPE_ppa000401mg           95.9    3e-19   
ref|XP_006442674.1|  hypothetical protein CICLE_v10018536mg           95.9    3e-19   Citrus clementina [clementine]
ref|XP_008441838.1|  PREDICTED: probable lysine-specific demethyl...  95.9    3e-19   Cucumis melo [Oriental melon]
ref|XP_010102231.1|  putative lysine-specific demethylase             94.4    1e-18   
ref|XP_008370740.1|  PREDICTED: probable lysine-specific demethyl...  93.6    2e-18   
ref|XP_009343755.1|  PREDICTED: putative lysine-specific demethyl...  92.0    7e-18   Pyrus x bretschneideri [bai li]
ref|XP_004302095.1|  PREDICTED: putative lysine-specific demethyl...  89.4    5e-17   Fragaria vesca subsp. vesca
ref|XP_008785239.1|  PREDICTED: probable lysine-specific demethyl...  89.4    5e-17   
gb|KEH42922.1|  transcription factor jumonji family protein           88.2    1e-16   Medicago truncatula
gb|KEH42923.1|  transcription factor jumonji family protein           88.2    1e-16   Medicago truncatula
emb|CDX97499.1|  BnaC08g13640D                                        85.5    4e-16   
ref|XP_010935913.1|  PREDICTED: putative lysine-specific demethyl...  86.3    6e-16   Elaeis guineensis
ref|XP_010935914.1|  PREDICTED: putative lysine-specific demethyl...  86.3    6e-16   
emb|CDY31135.1|  BnaA08g26850D                                        85.9    6e-16   Brassica napus [oilseed rape]
ref|XP_006417665.1|  hypothetical protein EUTSA_v10006592mg           85.9    7e-16   
ref|XP_009110879.1|  PREDICTED: probable lysine-specific demethyl...  85.1    1e-15   Brassica rapa
ref|XP_010652378.1|  PREDICTED: putative lysine-specific demethyl...  84.0    3e-15   Vitis vinifera
ref|XP_010652379.1|  PREDICTED: putative lysine-specific demethyl...  83.6    3e-15   Vitis vinifera
ref|XP_010528755.1|  PREDICTED: putative lysine-specific demethyl...  83.6    4e-15   Tarenaya hassleriana [spider flower]
emb|CDX95046.1|  BnaC05g06250D                                        83.6    4e-15   
ref|XP_010934317.1|  PREDICTED: lysine-specific demethylase JMJ18...  83.2    7e-15   Elaeis guineensis
ref|XP_010934318.1|  PREDICTED: lysine-specific demethylase JMJ18...  82.8    7e-15   
ref|XP_010475668.1|  PREDICTED: putative lysine-specific demethyl...  82.8    8e-15   Camelina sativa [gold-of-pleasure]
gb|AAF99757.1|AC003981_7  F22O13.10                                   81.3    3e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010458105.1|  PREDICTED: putative lysine-specific demethyl...  80.9    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010906801.1|  PREDICTED: lysine-specific demethylase JMJ18...  80.1    7e-14   
ref|NP_172338.4|  transcription factor PKDM7D                         79.7    8e-14   
ref|XP_010906800.1|  PREDICTED: lysine-specific demethylase JMJ18...  79.7    8e-14   Elaeis guineensis
emb|CDX93549.1|  BnaA06g04990D                                        79.3    1e-13   
ref|XP_006365897.1|  PREDICTED: probable lysine-specific demethyl...  79.0    1e-13   Solanum tuberosum [potatoes]
ref|XP_009148114.1|  PREDICTED: probable lysine-specific demethyl...  79.0    1e-13   Brassica rapa
ref|XP_008810597.1|  PREDICTED: probable lysine-specific demethyl...  78.2    3e-13   
ref|XP_006303885.1|  hypothetical protein CARUB_v10008112mg           77.4    4e-13   Capsella rubella
ref|XP_002532040.1|  transcription factor, putative                   77.0    5e-13   
ref|XP_002889706.1|  transcription factor jumonji family protein      77.4    5e-13   Arabidopsis lyrata subsp. lyrata
ref|XP_010321827.1|  PREDICTED: putative lysine-specific demethyl...  76.6    8e-13   Solanum lycopersicum
ref|XP_004240500.1|  PREDICTED: putative lysine-specific demethyl...  76.3    9e-13   Solanum lycopersicum
ref|XP_008802145.1|  PREDICTED: probable lysine-specific demethyl...  76.3    1e-12   Phoenix dactylifera
gb|KDO60470.1|  hypothetical protein CISIN_1g039459mg                 74.7    3e-12   Citrus sinensis [apfelsine]
ref|XP_010553771.1|  PREDICTED: putative lysine-specific demethyl...  73.2    1e-11   Tarenaya hassleriana [spider flower]
ref|XP_010553773.1|  PREDICTED: putative lysine-specific demethyl...  73.2    1e-11   Tarenaya hassleriana [spider flower]
ref|XP_010489147.1|  PREDICTED: putative lysine-specific demethyl...  73.2    1e-11   
ref|XP_010489113.1|  PREDICTED: putative lysine-specific demethyl...  73.2    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_009391986.1|  PREDICTED: putative lysine-specific demethyl...  72.8    1e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009392003.1|  PREDICTED: lysine-specific demethylase JMJ70...  72.8    1e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009392011.1|  PREDICTED: putative lysine-specific demethyl...  72.8    2e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009803913.1|  PREDICTED: putative lysine-specific demethyl...  72.4    2e-11   Nicotiana sylvestris
ref|XP_010553772.1|  PREDICTED: putative lysine-specific demethyl...  72.4    2e-11   Tarenaya hassleriana [spider flower]
emb|CDP03753.1|  unnamed protein product                              71.2    4e-11   Coffea canephora [robusta coffee]
ref|XP_006443821.1|  hypothetical protein CICLE_v10018924mg           70.9    6e-11   
ref|XP_009420230.1|  PREDICTED: lysine-specific demethylase JMJ70...  70.1    1e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU33161.1|  hypothetical protein MIMGU_mgv1a000700mg              66.6    1e-09   Erythranthe guttata [common monkey flower]
ref|XP_002454748.1|  hypothetical protein SORBIDRAFT_04g036630        64.7    6e-09   Sorghum bicolor [broomcorn]
gb|KJB72100.1|  hypothetical protein B456_011G159200                  60.5    1e-08   Gossypium raimondii
gb|KJB82261.1|  hypothetical protein B456_013G185400                  60.1    2e-08   Gossypium raimondii
gb|EPS64275.1|  hypothetical protein M569_10506                       63.2    2e-08   Genlisea aurea
ref|XP_008679195.1|  PREDICTED: LOW QUALITY PROTEIN: probable lys...  63.2    2e-08   
gb|AFW64061.1|  hypothetical protein ZEAMMB73_080311                  62.8    3e-08   
gb|KJB82296.1|  hypothetical protein B456_013G187600                  62.0    4e-08   Gossypium raimondii
gb|KJB82295.1|  hypothetical protein B456_013G187600                  62.0    4e-08   Gossypium raimondii
ref|XP_008677535.1|  PREDICTED: uncharacterized protein LOC100381...  62.0    5e-08   
ref|XP_008679190.1|  PREDICTED: probable lysine-specific demethyl...  61.6    6e-08   
ref|XP_008677534.1|  PREDICTED: uncharacterized protein LOC100381...  61.6    6e-08   
ref|XP_008679191.1|  PREDICTED: probable lysine-specific demethyl...  61.6    6e-08   
ref|XP_003567797.1|  PREDICTED: lysine-specific demethylase JMJ703    61.6    6e-08   Brachypodium distachyon [annual false brome]
gb|AFW64059.1|  hypothetical protein ZEAMMB73_612811                  60.8    7e-08   
gb|AFW64065.1|  hypothetical protein ZEAMMB73_911522                  60.8    7e-08   
ref|XP_010652383.1|  PREDICTED: putative lysine-specific demethyl...  61.2    7e-08   Vitis vinifera
gb|AFW64064.1|  hypothetical protein ZEAMMB73_911522                  61.2    7e-08   
gb|AFW64063.1|  hypothetical protein ZEAMMB73_354748                  60.5    1e-07   
ref|XP_010652382.1|  PREDICTED: putative lysine-specific demethyl...  60.1    2e-07   Vitis vinifera
ref|XP_006654139.1|  PREDICTED: probable lysine-specific demethyl...  59.7    3e-07   Oryza brachyantha
ref|XP_011080061.1|  PREDICTED: putative lysine-specific demethyl...  58.9    3e-07   Sesamum indicum [beniseed]
ref|XP_011080056.1|  PREDICTED: putative lysine-specific demethyl...  58.9    4e-07   Sesamum indicum [beniseed]
gb|KJB76741.1|  hypothetical protein B456_012G104500                  56.2    5e-07   Gossypium raimondii
gb|KJB76742.1|  hypothetical protein B456_012G104500                  56.2    6e-07   Gossypium raimondii
ref|XP_006857306.1|  hypothetical protein AMTR_s00067p00062020        58.5    7e-07   
ref|XP_011028819.1|  PREDICTED: putative lysine-specific demethyl...  57.4    1e-06   Populus euphratica
ref|XP_011028823.1|  PREDICTED: putative lysine-specific demethyl...  57.4    1e-06   Populus euphratica
ref|XP_004954297.1|  PREDICTED: probable lysine-specific demethyl...  56.2    3e-06   Setaria italica
gb|AFW76914.1|  hypothetical protein ZEAMMB73_798608                  55.1    7e-06   
ref|XP_004965199.1|  PREDICTED: probable lysine-specific demethyl...  55.1    8e-06   Setaria italica
gb|AFW76913.1|  hypothetical protein ZEAMMB73_798608                  55.1    8e-06   
ref|XP_008648146.1|  PREDICTED: uncharacterized protein LOC100383...  55.1    8e-06   Zea mays [maize]
ref|XP_002300773.2|  hypothetical protein POPTR_0002s03840g           54.7    1e-05   
ref|XP_004954299.1|  PREDICTED: probable lysine-specific demethyl...  54.3    1e-05   Setaria italica
gb|EEC78664.1|  hypothetical protein OsI_18782                        54.3    2e-05   Oryza sativa Indica Group [Indian rice]
ref|NP_001054867.1|  Os05g0196500                                     53.9    2e-05   
ref|XP_009369472.1|  PREDICTED: putative lysine-specific demethyl...  50.1    3e-04   Pyrus x bretschneideri [bai li]
ref|XP_007162550.1|  hypothetical protein PHAVU_001G161600g           49.7    4e-04   Phaseolus vulgaris [French bean]
ref|XP_006604493.1|  PREDICTED: probable lysine-specific demethyl...  49.7    5e-04   
ref|XP_008680638.1|  PREDICTED: probable lysine-specific demethyl...  48.9    5e-04   



>ref|XP_004236784.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Solanum 
lycopersicum]
 ref|XP_010319277.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Solanum 
lycopersicum]
 ref|XP_010319278.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Solanum 
lycopersicum]
Length=1191

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 92/120 (77%), Gaps = 1/120 (1%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGTEL  HC+K+E +D+S IPPGFESLA FTL++V++N  + N  +++SE +  R++VE 
Sbjct  1    MGTELVRHCIKEEDMDISAIPPGFESLAPFTLKQVENNRLRINQSSTASESKSHRSQVET  60

Query  350  DLEGVEDAK-LKSIRRRPCMNYGQVENSSGDESDSEQKVSFRPQLPKGVIRGCEECVNCQ  526
            ++EG ED K +KS+RR+P +NYG+ E SS DES S+Q  S R  LPKGVIRGCE C+NCQ
Sbjct  61   NIEGNEDVKMMKSLRRKPGVNYGKYEKSSEDESGSDQNPSVRSSLPKGVIRGCEGCLNCQ  120



>ref|XP_009804681.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Nicotiana 
sylvestris]
 ref|XP_009804682.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Nicotiana 
sylvestris]
 ref|XP_009804683.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Nicotiana 
sylvestris]
Length=1254

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 87/120 (73%), Gaps = 1/120 (1%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGTEL  HCVK+E +D+S+IPPGFESLA FTL KV +N    N  +S SE +   +++E 
Sbjct  1    MGTELVRHCVKEEDMDISSIPPGFESLAPFTLRKVDNNRLTINQPSSVSESKSHGSRIEA  60

Query  350  DLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDSEQKVSFRPQLPKGVIRGCEECVNCQ  526
             +EG ED K+ KS+RR+P +NYG+ E SS DES+ EQ    RP LPKGVIRGCE C+NCQ
Sbjct  61   YIEGTEDGKMIKSLRRKPGINYGKYEKSSEDESEPEQNPFVRPSLPKGVIRGCEACLNCQ  120



>ref|XP_006361437.1| PREDICTED: uncharacterized protein LOC102593415 [Solanum tuberosum]
Length=1617

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 90/120 (75%), Gaps = 1/120 (1%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGTEL  HC+K+E +D+S IPPGFESLA FTL++V++N    N  +++SE +  R++VE 
Sbjct  1    MGTELVRHCIKEEDMDISAIPPGFESLAPFTLKQVENNRLMINQSSTASESKSDRSQVET  60

Query  350  DLEGVEDAK-LKSIRRRPCMNYGQVENSSGDESDSEQKVSFRPQLPKGVIRGCEECVNCQ  526
             +EG ED K +KS+RR+P +NYG+ E SS DES S+Q  S R  LPKGVIRGCE C+NCQ
Sbjct  61   SIEGHEDGKMMKSLRRKPGVNYGKYEKSSEDESGSDQNTSVRHSLPKGVIRGCEGCLNCQ  120



>ref|XP_009613002.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Nicotiana 
tomentosiformis]
 ref|XP_009613003.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Nicotiana 
tomentosiformis]
 ref|XP_009613004.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Nicotiana 
tomentosiformis]
Length=1255

 Score =   138 bits (347),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 87/120 (73%), Gaps = 1/120 (1%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGTEL  HCVK+E +D+S+IPPGFESLA FTL KV +N    N  +S SE +   ++VE 
Sbjct  1    MGTELVRHCVKEEDMDISSIPPGFESLAPFTLRKVDNNRLMINQPSSVSESKSHGSQVET  60

Query  350  DLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDSEQKVSFRPQLPKGVIRGCEECVNCQ  526
             +EG ED K+ KS+RR+P +NYG+ E SS DES+ +Q    RP LPKGVIRGCE C+NCQ
Sbjct  61   YIEGTEDGKMIKSLRRKPGINYGKYEKSSEDESEPDQNPFVRPSLPKGVIRGCEACLNCQ  120



>emb|CDO99990.1| unnamed protein product [Coffea canephora]
Length=1264

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 92/120 (77%), Gaps = 2/120 (2%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGTEL   C+K+E +D+ +IPPGFES+A FTL+KV+D + K +   S+S  + Q  ++E 
Sbjct  1    MGTELVRTCIKEENMDIPSIPPGFESIAPFTLKKVEDKDIKVDHSPSASGSESQSTRMEI  60

Query  350  DLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDSEQKVSFRPQLPKGVIRGCEECVNCQ  526
            ++E  ++ K+ K++RRRP +NY  ++NSSGDESDSEQK+  + +LPKGVIRGC+ECVNCQ
Sbjct  61   EIEYSKEGKIAKTLRRRPWINYCHLDNSSGDESDSEQKL-LKSRLPKGVIRGCDECVNCQ  119



>gb|KDP23713.1| hypothetical protein JCGZ_23546 [Jatropha curcas]
Length=1276

 Score =   117 bits (294),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 90/132 (68%), Gaps = 15/132 (11%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKK---------TNCLASSSEM  322
            MGTEL S CVK+E  ++ ++PPGFES A+FTL++++ +E           T+  AS+SE+
Sbjct  1    MGTELMSLCVKEENDEIPSVPPGFESFAAFTLKRMQKSENHESQDVISCSTSATASTSEL  60

Query  323  QLQRAKVEPDLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDS---EQKVSFRPQLPKG  490
            Q  + +VE D+    D K+ +S+RRR  +NYGQ++N+  DESDS    Q +S RP LPKG
Sbjct  61   QSVKMEVESDV--CSDTKITRSLRRRAWINYGQLDNNLEDESDSAKLNQNLSLRPPLPKG  118

Query  491  VIRGCEECVNCQ  526
            VIRGC +C+NCQ
Sbjct  119  VIRGCAQCINCQ  130



>ref|XP_007143964.1| hypothetical protein PHAVU_007G117400g [Phaseolus vulgaris]
 ref|XP_007143965.1| hypothetical protein PHAVU_007G117400g [Phaseolus vulgaris]
 gb|ESW15958.1| hypothetical protein PHAVU_007G117400g [Phaseolus vulgaris]
 gb|ESW15959.1| hypothetical protein PHAVU_007G117400g [Phaseolus vulgaris]
Length=1256

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 87/129 (67%), Gaps = 9/129 (7%)
 Frame = +2

Query  167  IMGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKK-----TNCLASSSEMQLQ  331
            +MGTEL   CVK++  D  ++PPGFES  SF+L++V++NEK+     T C AS+S  +  
Sbjct  1    MMGTELMRICVKEDNDDFPSVPPGFESYTSFSLKRVENNEKQDDKNMTTCSASTSASESP  60

Query  332  RAKVEPDLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDSE---QKVSFRPQLPKGVIR  499
              +VE D++  E AK+ +S+RRRP +NYGQ EN S ++SD E   Q  S R  LP+GVIR
Sbjct  61   SIQVENDVQVRETAKVPRSLRRRPWINYGQYENHSDEDSDCERLDQNFSSRACLPQGVIR  120

Query  500  GCEECVNCQ  526
            GC +C NCQ
Sbjct  121  GCPDCSNCQ  129



>ref|XP_011101609.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Sesamum 
indicum]
 ref|XP_011101610.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Sesamum 
indicum]
 ref|XP_011101611.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Sesamum 
indicum]
 ref|XP_011101612.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Sesamum 
indicum]
 ref|XP_011101613.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Sesamum 
indicum]
 ref|XP_011101615.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Sesamum 
indicum]
Length=1258

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 86/120 (72%), Gaps = 2/120 (2%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGTEL   CVK++++++ +IPPGFESL  F L++ +DN+  +   +S+S ++    K+E 
Sbjct  1    MGTELVGPCVKEDSMEIPSIPPGFESLVPFNLKRTEDNQV-SGYSSSASAVESLTVKLEK  59

Query  350  DLEGVEDAK-LKSIRRRPCMNYGQVENSSGDESDSEQKVSFRPQLPKGVIRGCEECVNCQ  526
            +++  +D+K +KS+RRR  + Y Q +NSSGDE +SEQ +  R QLPKGV+RGCE C NCQ
Sbjct  60   EVDSNDDSKTVKSLRRRLGIKYNQFDNSSGDEHESEQHMFLRHQLPKGVVRGCEACSNCQ  119



>ref|XP_010262342.1| PREDICTED: lysine-specific demethylase JMJ18 [Nelumbo nucifera]
Length=1315

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 85/124 (69%), Gaps = 9/124 (7%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASS-SEMQLQRAKVE  346
            MGTE    CVK E I++ T+PPGF S  SFTL+++ D++  T+C+ASS SE Q     +E
Sbjct  1    MGTECIRACVKGEKIEIPTVPPGFVSFTSFTLKRIDDSDVMTSCMASSASEQQPNHMDME  60

Query  347  PDLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDSE---QKVSFRPQLPKGVIRGCEEC  514
             D   ++  KL + +R+RP +NY Q +NSS DESDSE   Q +S RP+LP+G+IRGC EC
Sbjct  61   GD---IDKPKLTRCLRQRPWINYSQFDNSS-DESDSEQFDQNLSARPRLPRGIIRGCSEC  116

Query  515  VNCQ  526
             NCQ
Sbjct  117  KNCQ  120



>emb|CBI22382.3| unnamed protein product [Vitis vinifera]
Length=1178

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 89/124 (72%), Gaps = 8/124 (6%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGTEL   CVK+E +D   +PPGFESL SFTL++V+DNE  T CLAS+S  + Q  K+E 
Sbjct  1    MGTELIRACVKEENLD---VPPGFESLTSFTLKRVEDNEITTPCLASTSGSESQSIKMET  57

Query  350  DLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDS---EQKVSF-RPQLPKGVIRGCEEC  514
            + +  + A + +S+RRRP +NYGQ +NSS DESDS    Q + F RP LPKGVIRGC EC
Sbjct  58   EFDISDAANISRSLRRRPWINYGQFDNSSDDESDSEHLNQNLPFRRPCLPKGVIRGCLEC  117

Query  515  VNCQ  526
            ++CQ
Sbjct  118  IHCQ  121



>ref|XP_002266063.2| PREDICTED: putative lysine-specific demethylase JMJ16 [Vitis 
vinifera]
 ref|XP_010660215.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Vitis 
vinifera]
 ref|XP_010660216.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Vitis 
vinifera]
 ref|XP_010660217.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Vitis 
vinifera]
 ref|XP_010660219.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Vitis 
vinifera]
 ref|XP_010660220.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Vitis 
vinifera]
 ref|XP_010660221.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Vitis 
vinifera]
 ref|XP_010660222.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Vitis 
vinifera]
 ref|XP_010660223.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Vitis 
vinifera]
 ref|XP_010660224.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Vitis 
vinifera]
Length=1271

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 89/124 (72%), Gaps = 8/124 (6%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGTEL   CVK+E +D   +PPGFESL SFTL++V+DNE  T CLAS+S  + Q  K+E 
Sbjct  1    MGTELIRACVKEENLD---VPPGFESLTSFTLKRVEDNEITTPCLASTSGSESQSIKMET  57

Query  350  DLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDS---EQKVSF-RPQLPKGVIRGCEEC  514
            + +  + A + +S+RRRP +NYGQ +NSS DESDS    Q + F RP LPKGVIRGC EC
Sbjct  58   EFDISDAANISRSLRRRPWINYGQFDNSSDDESDSEHLNQNLPFRRPCLPKGVIRGCLEC  117

Query  515  VNCQ  526
            ++CQ
Sbjct  118  IHCQ  121



>gb|EYU19891.1| hypothetical protein MIMGU_mgv1a026881mg [Erythranthe guttata]
Length=1188

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 81/120 (68%), Gaps = 1/120 (1%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKT-NCLASSSEMQLQRAKVE  346
            MGTEL   C+K++++++ +IPPGFES   FT+++ +DN+  + +  A   E Q  + + E
Sbjct  1    MGTELVGPCMKEDSMEIPSIPPGFESFVPFTVKRAEDNQVGSYSSSARVVESQTVKLETE  60

Query  347  PDLEGVEDAKLKSIRRRPCMNYGQVENSSGDESDSEQKVSFRPQLPKGVIRGCEECVNCQ  526
             D    +   +K++RRRP + Y QV+NSS DE++SEQ +  R QLPKGVIRGCE C NCQ
Sbjct  61   FDCNNDDSQTMKTLRRRPGVKYSQVDNSSCDENESEQHMFLRHQLPKGVIRGCEACSNCQ  120



>ref|XP_007030413.1| Transcription factor jumonji family protein / zinc finger family 
protein isoform 1 [Theobroma cacao]
 ref|XP_007030414.1| Transcription factor jumonji family protein / zinc finger family 
protein isoform 1 [Theobroma cacao]
 gb|EOY10915.1| Transcription factor jumonji family protein / zinc finger family 
protein isoform 1 [Theobroma cacao]
 gb|EOY10916.1| Transcription factor jumonji family protein / zinc finger family 
protein isoform 1 [Theobroma cacao]
Length=1260

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 83/128 (65%), Gaps = 9/128 (7%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTN-----CLASSSEMQLQR  334
            MGTEL   CVK+E  D+ ++PPGFES ASFTL++ +D EK+ +     C A +S  +   
Sbjct  1    MGTELMRVCVKEENDDIPSVPPGFESYASFTLKRAQDTEKQESDNVMCCSAPASTSETSP  60

Query  335  AKVEPDLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDS---EQKVSFRPQLPKGVIRG  502
             K E +L    +AK+ +S+RRRP +NYG+ +NSS +E D    +Q +  R  LPKGVIRG
Sbjct  61   VKKETELGNRGNAKITRSLRRRPWINYGRYDNSSEEEPDCGKLDQNLRLRLNLPKGVIRG  120

Query  503  CEECVNCQ  526
            C EC +CQ
Sbjct  121  CPECNDCQ  128



>ref|XP_011036303.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Populus 
euphratica]
 ref|XP_011036304.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Populus 
euphratica]
 ref|XP_011036306.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Populus 
euphratica]
 ref|XP_011036307.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Populus 
euphratica]
Length=1267

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 84/128 (66%), Gaps = 10/128 (8%)
 Frame = +2

Query  167  IMGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKK----TNCLASSSEMQLQR  334
            +MGTELF   VK+E  D+ ++PPGFES A+F L +V+D EK+     +C A+ S  +   
Sbjct  1    MMGTELFGVRVKEENDDIPSVPPGFESFAAFNLNRVQDGEKQESNVVSCSATVSASESLP  60

Query  335  AKVEPDLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDS---EQKVSFRPQLPKGVIRG  502
             K+E   E  ++AK+ +S+RRRP + YG ++  S DESDS    Q +S R QLPKGV+RG
Sbjct  61   VKMETGFE--DEAKVTRSLRRRPWIKYGHLDGCSEDESDSAKLNQNLSSRSQLPKGVLRG  118

Query  503  CEECVNCQ  526
            C +C NCQ
Sbjct  119  CPQCSNCQ  126



>ref|XP_006371089.1| hypothetical protein POPTR_0019s03550g [Populus trichocarpa]
 gb|ERP48886.1| hypothetical protein POPTR_0019s03550g [Populus trichocarpa]
Length=1067

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 84/128 (66%), Gaps = 10/128 (8%)
 Frame = +2

Query  167  IMGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKK----TNCLASSSEMQLQR  334
            +MGTEL    VK+E  D+ ++PPGFES A+F L +V+D EK+     +C A++S  +   
Sbjct  1    MMGTELIRVRVKEENDDIPSVPPGFESFAAFNLNRVQDGEKQESNIISCSATASASESLP  60

Query  335  AKVEPDLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDS---EQKVSFRPQLPKGVIRG  502
             K+E   E  ++AK+ +S+RRRP + YG ++  S DESDS    Q +S R QLPKGVIRG
Sbjct  61   VKMETGFE--DEAKVTRSLRRRPWIKYGHLDGCSEDESDSAKLNQNLSSRSQLPKGVIRG  118

Query  503  CEECVNCQ  526
            C +C NCQ
Sbjct  119  CPQCSNCQ  126



>ref|XP_002325772.2| hypothetical protein POPTR_0019s03550g [Populus trichocarpa]
 gb|EEF00154.2| hypothetical protein POPTR_0019s03550g [Populus trichocarpa]
Length=1267

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 84/128 (66%), Gaps = 10/128 (8%)
 Frame = +2

Query  167  IMGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKK----TNCLASSSEMQLQR  334
            +MGTEL    VK+E  D+ ++PPGFES A+F L +V+D EK+     +C A++S  +   
Sbjct  1    MMGTELIRVRVKEENDDIPSVPPGFESFAAFNLNRVQDGEKQESNIISCSATASASESLP  60

Query  335  AKVEPDLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDS---EQKVSFRPQLPKGVIRG  502
             K+E   E  ++AK+ +S+RRRP + YG ++  S DESDS    Q +S R QLPKGVIRG
Sbjct  61   VKMETGFE--DEAKVTRSLRRRPWIKYGHLDGCSEDESDSAKLNQNLSSRSQLPKGVIRG  118

Query  503  CEECVNCQ  526
            C +C NCQ
Sbjct  119  CPQCSNCQ  126



>ref|XP_006375851.1| hypothetical protein POPTR_0013s04370g [Populus trichocarpa]
 gb|ERP53648.1| hypothetical protein POPTR_0013s04370g [Populus trichocarpa]
Length=1239

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 88/128 (69%), Gaps = 11/128 (9%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKK----TNCLASSSEMQLQRA  337
            MGTEL    VK+E  D+ ++PPGFES A++TL++V D EK+    T+C A++S  + Q  
Sbjct  1    MGTELIRVHVKEENDDIPSVPPGFESFAAYTLKRVPDGEKQESNVTSCSATTSASESQSV  60

Query  338  KVEPDLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDS----EQKVSFRPQLPKGVIRG  502
            K++ + E  ++AK+ +S+RRRP + +  +++ S DESDS    +Q +S R +LPKGVIRG
Sbjct  61   KMDTEFE--DEAKVTRSLRRRPWIKFEHLDSCSEDESDSVKLNQQNLSLRSRLPKGVIRG  118

Query  503  CEECVNCQ  526
            C +C NCQ
Sbjct  119  CPQCSNCQ  126



>ref|XP_011038513.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X1 [Populus euphratica]
Length=1264

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 86/128 (67%), Gaps = 11/128 (9%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKK----TNCLASSSEMQLQRA  337
            MGTEL    VK+E  D+ ++PPGFES A+F L +V+D EK+    T+C A++S  + Q  
Sbjct  1    MGTELMRVHVKEENDDIPSVPPGFESFAAFNLNRVQDGEKQESNVTSCSATTSASESQSV  60

Query  338  KVEPDLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDS----EQKVSFRPQLPKGVIRG  502
            K++ + E  ++AK+ +S+RRRP + +  +++ S DESDS    +Q +S R  LPKGVIRG
Sbjct  61   KMDTEFE--DEAKVTRSLRRRPWIKFEHLDSCSEDESDSVKLNQQNLSLRSHLPKGVIRG  118

Query  503  CEECVNCQ  526
            C +C NCQ
Sbjct  119  CPQCSNCQ  126



>ref|XP_011038514.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X2 [Populus euphratica]
Length=1263

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 85/127 (67%), Gaps = 10/127 (8%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKK----TNCLASSSEMQLQRA  337
            MGTEL    VK+E  D+ ++PPGFES A+F L +V+D EK+    T+C A++S  + Q  
Sbjct  1    MGTELMRVHVKEENDDIPSVPPGFESFAAFNLNRVQDGEKQESNVTSCSATTSASESQSV  60

Query  338  KVEPDLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDS---EQKVSFRPQLPKGVIRGC  505
            K++ + E  ++AK+ +S+RRRP + +  +++ S DESDS    Q +S R  LPKGVIRGC
Sbjct  61   KMDTEFE--DEAKVTRSLRRRPWIKFEHLDSCSEDESDSVKLNQNLSLRSHLPKGVIRGC  118

Query  506  EECVNCQ  526
             +C NCQ
Sbjct  119  PQCSNCQ  125



>ref|XP_003555549.2| PREDICTED: probable lysine-specific demethylase JMJ14-like isoform 
X1 [Glycine max]
 ref|XP_006606422.1| PREDICTED: probable lysine-specific demethylase JMJ14-like isoform 
X2 [Glycine max]
 ref|XP_006606423.1| PREDICTED: probable lysine-specific demethylase JMJ14-like isoform 
X3 [Glycine max]
 ref|XP_006606424.1| PREDICTED: probable lysine-specific demethylase JMJ14-like isoform 
X4 [Glycine max]
 gb|KHN04988.1| Putative lysine-specific demethylase JMJ14 [Glycine soja]
Length=1258

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 86/129 (67%), Gaps = 9/129 (7%)
 Frame = +2

Query  167  IMGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTN-----CLASSSEMQLQ  331
            +MGTEL   CVK++  D  ++PPGFES  SF+L+KV++NEK+ +     C AS+S  +  
Sbjct  1    MMGTELMRICVKEDNDDFPSVPPGFESYTSFSLKKVENNEKQDDKNMTSCSASTSASESP  60

Query  332  RAKVEPDLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDSE---QKVSFRPQLPKGVIR  499
              + E D++  + AK+ +S+RRRP +NYGQ EN S ++ D E   Q  S RP LP+GVIR
Sbjct  61   STQAENDVQVGDTAKVPRSLRRRPWINYGQYENISDEDPDCERHDQNFSSRPCLPRGVIR  120

Query  500  GCEECVNCQ  526
            GC +C NCQ
Sbjct  121  GCPDCSNCQ  129



>gb|KHN14767.1| Putative lysine-specific demethylase JMJ14 [Glycine soja]
Length=1258

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 86/129 (67%), Gaps = 9/129 (7%)
 Frame = +2

Query  167  IMGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTN-----CLASSSEMQLQ  331
            +MGTEL   CVK++  D  ++PPGFES  SF+L++V+ NEK+ +     C AS+S  +  
Sbjct  1    MMGTELMRICVKEDNDDFPSVPPGFESYTSFSLKRVESNEKQDDKNMTSCSASTSASESP  60

Query  332  RAKVEPDLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDSE---QKVSFRPQLPKGVIR  499
              +VE D++G +  K+ +S+RRRP +NYGQ EN S ++ D E   Q  S RP LP+GVIR
Sbjct  61   STQVENDVQGGDTRKVPRSLRRRPWINYGQYENISDEDPDCEQLDQNFSSRPCLPRGVIR  120

Query  500  GCEECVNCQ  526
            GC +C +CQ
Sbjct  121  GCPDCSHCQ  129



>ref|XP_006589229.1| PREDICTED: probable lysine-specific demethylase JMJ14-like isoform 
X2 [Glycine max]
 ref|XP_006589230.1| PREDICTED: probable lysine-specific demethylase JMJ14-like isoform 
X3 [Glycine max]
 ref|XP_003535393.2| PREDICTED: probable lysine-specific demethylase JMJ14-like isoform 
X1 [Glycine max]
Length=1258

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 86/129 (67%), Gaps = 9/129 (7%)
 Frame = +2

Query  167  IMGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTN-----CLASSSEMQLQ  331
            +MGTEL   CVK++  D  ++PPGFES  SF+L++V+ NEK+ +     C AS+S  +  
Sbjct  1    MMGTELMRICVKEDNDDFPSVPPGFESYTSFSLKRVESNEKQDDKNMTSCSASTSASESP  60

Query  332  RAKVEPDLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDSE---QKVSFRPQLPKGVIR  499
              +VE D++G +  K+ +S+RRRP +NYGQ EN S ++ D E   Q  S RP LP+GVIR
Sbjct  61   STQVENDVQGGDTRKVPRSLRRRPWINYGQYENISDEDPDCEQLDQNFSSRPCLPRGVIR  120

Query  500  GCEECVNCQ  526
            GC +C +CQ
Sbjct  121  GCPDCSHCQ  129



>ref|XP_002521976.1| transcription factor, putative [Ricinus communis]
 gb|EEF40380.1| transcription factor, putative [Ricinus communis]
Length=1202

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 84/121 (69%), Gaps = 11/121 (9%)
 Frame = +2

Query  194  CVKDETIDMSTIPPGFESLASFTLEKVKDNEK-------KTNCLASSSEMQLQRAKVEPD  352
            C+K+E+ ++ ++PPGFES A+FTL++V+D+E        + +  +S+SE Q  + ++E D
Sbjct  4    CIKEESDEIPSVPPGFESFAAFTLKRVQDSENHESQNIVRFSSSSSASESQPVKMEMESD  63

Query  353  LEGVEDAKLKSIRRRPCMNYGQVENSSGDESDS---EQKVSFRPQLPKGVIRGCEECVNC  523
            +  V  A  +S+RRR  +NYGQ+EN SGDESDS    Q ++ R  LPKGVIRGC +C+NC
Sbjct  64   IGTVTKAT-RSLRRRAWINYGQLENCSGDESDSGKLNQDLTLRSHLPKGVIRGCAQCMNC  122

Query  524  Q  526
            Q
Sbjct  123  Q  123



>ref|XP_009379753.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Pyrus 
x bretschneideri]
 ref|XP_009379754.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Pyrus 
x bretschneideri]
 ref|XP_009379755.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Pyrus 
x bretschneideri]
Length=1236

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 81/127 (64%), Gaps = 10/127 (8%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKV-----KDNEKKTNCLASSSEMQLQR  334
            MGTEL   C+KD+  +  ++PPGFES ASF+L++      KD E + +C  ++S    Q 
Sbjct  1    MGTELMRVCIKDDNEEFPSVPPGFESFASFSLKRTNESAKKDIENRISCSVTASPSNSQS  60

Query  335  AKVEPDLEGVEDAKLKSIRRRPCMNYGQVENSSGDESDS---EQKVSFRPQLPKGVIRGC  505
             ++E D++  E AK +S+RRR C+N+G+  N S DESDS   EQ    R  LPKGV+RGC
Sbjct  61   VQMETDVDNGEVAK-RSVRRRQCINHGR-NNKSEDESDSDRLEQNCLPRSVLPKGVVRGC  118

Query  506  EECVNCQ  526
             +C NCQ
Sbjct  119  PQCSNCQ  125



>ref|XP_009364440.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Pyrus 
x bretschneideri]
 ref|XP_009364441.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Pyrus 
x bretschneideri]
Length=1236

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 80/127 (63%), Gaps = 10/127 (8%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKV-----KDNEKKTNCLASSSEMQLQR  334
            MGTEL   C+KD+  +  ++PPGFES ASF+L++      KD E + +C  ++S    Q 
Sbjct  1    MGTELMRVCIKDDNEEFPSVPPGFESFASFSLKRTNESAKKDIENRISCSVTASPSNSQS  60

Query  335  AKVEPDLEGVEDAKLKSIRRRPCMNYGQVENSSGDESDS---EQKVSFRPQLPKGVIRGC  505
             ++E D++  E AK +S+RRR C+N+G+  N S DESDS   EQ    R  LPKG +RGC
Sbjct  61   VQMETDVDNGEVAK-RSVRRRQCINHGR-NNKSEDESDSDRLEQNCPPRSALPKGAVRGC  118

Query  506  EECVNCQ  526
             +C NCQ
Sbjct  119  PQCSNCQ  125



>ref|XP_008388726.1| PREDICTED: probable lysine-specific demethylase JMJ14 isoform 
X2 [Malus domestica]
Length=1236

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 81/127 (64%), Gaps = 10/127 (8%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKK-----TNCLASSSEMQLQR  334
            MGTEL   C+KD+  +  ++PPGFES A F+L+++ ++EKK      +C  ++S    Q 
Sbjct  1    MGTELMRVCIKDDNEEFPSVPPGFESFAPFSLKRINESEKKDIENRISCSVTASPSNSQS  60

Query  335  AKVEPDLEGVEDAKLKSIRRRPCMNYGQVENSSGDESDS---EQKVSFRPQLPKGVIRGC  505
             ++E D++  E AK +S+RRR C+N+G+  N S DESDS   E     R  LPKGV+RGC
Sbjct  61   VQMETDVDNGEVAK-RSVRRRQCINHGR-NNKSEDESDSDRLEHNCPPRSVLPKGVVRGC  118

Query  506  EECVNCQ  526
             +C NCQ
Sbjct  119  PQCSNCQ  125



>ref|XP_008388723.1| PREDICTED: probable lysine-specific demethylase JMJ14 isoform 
X1 [Malus domestica]
 ref|XP_008388724.1| PREDICTED: probable lysine-specific demethylase JMJ14 isoform 
X1 [Malus domestica]
 ref|XP_008388725.1| PREDICTED: probable lysine-specific demethylase JMJ14 isoform 
X1 [Malus domestica]
Length=1237

 Score =   100 bits (249),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 82/128 (64%), Gaps = 11/128 (9%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKK-----TNCLASSSEMQLQR  334
            MGTEL   C+KD+  +  ++PPGFES A F+L+++ ++EKK      +C  ++S    Q 
Sbjct  1    MGTELMRVCIKDDNEEFPSVPPGFESFAPFSLKRINESEKKDIENRISCSVTASPSNSQS  60

Query  335  AKVEPDLEGVEDAKLKSIRRRPCMNYGQVENSSGDESDSE----QKVSFRPQLPKGVIRG  502
             ++E D++  E AK +S+RRR C+N+G+  N S DESDS+    Q    R  LPKGV+RG
Sbjct  61   VQMETDVDNGEVAK-RSVRRRQCINHGR-NNKSEDESDSDRLEHQNCPPRSVLPKGVVRG  118

Query  503  CEECVNCQ  526
            C +C NCQ
Sbjct  119  CPQCSNCQ  126



>gb|KJB44858.1| hypothetical protein B456_007G276200 [Gossypium raimondii]
Length=1265

 Score =   100 bits (249),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 83/137 (61%), Gaps = 13/137 (9%)
 Frame = +2

Query  155  TCIYI-MGTELFSHCVKDETIDMSTIPPGFESLASFTL-----EKVK-DNEKKTNCLASS  313
            +C+ I MGTEL   CVK+E  D+  +PPGFES ASFTL     E VK +N+    C AS+
Sbjct  10   SCVAILMGTELMRVCVKEENDDIPPVPPGFESYASFTLTRGAQENVKHENDNVKYCSASA  69

Query  314  SEMQLQRAKV--EPDLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDSE---QKVSFRP  475
            + +    + V  E +L   E  K+ +S+RRRP +NYG+ +NS  DE D E   Q    R 
Sbjct  70   TTISSVASPVQKETELGNGESTKITRSVRRRPWINYGRYDNSPEDELDCEKLDQNQRLRH  129

Query  476  QLPKGVIRGCEECVNCQ  526
             LPKGVIRGC EC +CQ
Sbjct  130  NLPKGVIRGCPECNDCQ  146



>gb|KJB44857.1| hypothetical protein B456_007G276200 [Gossypium raimondii]
Length=1040

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 79/131 (60%), Gaps = 12/131 (9%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTL-----EKVK-DNEKKTNCLASSSEMQLQ  331
            MGTEL   CVK+E  D+  +PPGFES ASFTL     E VK +N+    C AS++ +   
Sbjct  1    MGTELMRVCVKEENDDIPPVPPGFESYASFTLTRGAQENVKHENDNVKYCSASATTISSV  60

Query  332  RAKV--EPDLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDSE---QKVSFRPQLPKGV  493
             + V  E +L   E  K+ +S+RRRP +NYG+ +NS  DE D E   Q    R  LPKGV
Sbjct  61   ASPVQKETELGNGESTKITRSVRRRPWINYGRYDNSPEDELDCEKLDQNQRLRHNLPKGV  120

Query  494  IRGCEECVNCQ  526
            IRGC EC +CQ
Sbjct  121  IRGCPECNDCQ  131



>gb|KJB44853.1| hypothetical protein B456_007G276200 [Gossypium raimondii]
 gb|KJB44854.1| hypothetical protein B456_007G276200 [Gossypium raimondii]
 gb|KJB44855.1| hypothetical protein B456_007G276200 [Gossypium raimondii]
 gb|KJB44856.1| hypothetical protein B456_007G276200 [Gossypium raimondii]
Length=1250

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 79/131 (60%), Gaps = 12/131 (9%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTL-----EKVK-DNEKKTNCLASSSEMQLQ  331
            MGTEL   CVK+E  D+  +PPGFES ASFTL     E VK +N+    C AS++ +   
Sbjct  1    MGTELMRVCVKEENDDIPPVPPGFESYASFTLTRGAQENVKHENDNVKYCSASATTISSV  60

Query  332  RAKV--EPDLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDSE---QKVSFRPQLPKGV  493
             + V  E +L   E  K+ +S+RRRP +NYG+ +NS  DE D E   Q    R  LPKGV
Sbjct  61   ASPVQKETELGNGESTKITRSVRRRPWINYGRYDNSPEDELDCEKLDQNQRLRHNLPKGV  120

Query  494  IRGCEECVNCQ  526
            IRGC EC +CQ
Sbjct  121  IRGCPECNDCQ  131



>ref|XP_004495524.1| PREDICTED: probable lysine-specific demethylase JMJ14-like isoform 
X1 [Cicer arietinum]
 ref|XP_004495525.1| PREDICTED: probable lysine-specific demethylase JMJ14-like isoform 
X2 [Cicer arietinum]
 ref|XP_004495526.1| PREDICTED: probable lysine-specific demethylase JMJ14-like isoform 
X3 [Cicer arietinum]
Length=1263

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 78/127 (61%), Gaps = 7/127 (6%)
 Frame = +2

Query  167  IMGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVE  346
            +MGTEL   CVK++  D  ++PPGFES  SF+L++V++NEK  +   +SS      ++  
Sbjct  4    LMGTELMRICVKEDNDDFPSVPPGFESYTSFSLKRVEENEKHNDTNLTSSSTSASESQSN  63

Query  347  PDLEGVEDAKL----KSIRRRPCMNYGQVENSSGDESDSE---QKVSFRPQLPKGVIRGC  505
                GV+ A      +S+RRRP +N+GQ EN   ++SD E   Q  S R  LPKGVIRGC
Sbjct  64   QIGNGVQFADTSKVSRSLRRRPWINHGQCENGLEEDSDCERHDQNFSSRSCLPKGVIRGC  123

Query  506  EECVNCQ  526
             +C NCQ
Sbjct  124  PDCSNCQ  130



>gb|KDO44525.1| hypothetical protein CISIN_1g0443881mg, partial [Citrus sinensis]
Length=583

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 75/127 (59%), Gaps = 8/127 (6%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGTEL   C+K+E  ++ ++PPGFES ASFTL++V+D EK    + S S        +  
Sbjct  1    MGTELMRVCIKEENDEVPSVPPGFESFASFTLKRVQDTEKHDCDITSCSASASASESLSV  60

Query  350  DLE-----GVEDAKLKSIRRRPCMNYGQVENSSGDESDS---EQKVSFRPQLPKGVIRGC  505
             +E            + +RRRP +NYG +++SS DESDS    Q  + RP LPKGVIRGC
Sbjct  61   HMETEVKVADAAKAARPLRRRPGINYGLLDHSSEDESDSGKLGQNFTARPCLPKGVIRGC  120

Query  506  EECVNCQ  526
              C +CQ
Sbjct  121  PTCSDCQ  127



>ref|XP_010695040.1| PREDICTED: lysine-specific demethylase JMJ18 [Beta vulgaris subsp. 
vulgaris]
Length=1197

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 74/125 (59%), Gaps = 8/125 (6%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASS--SEMQLQRAKV  343
            MGTE    CVK+E +D   +PPGFES +SF L+KV++ + +  C  SS  S  +    K 
Sbjct  1    MGTEFLRACVKEEDLDFLAVPPGFESFSSFKLKKVENADSEPCCSVSSNLSRQEPSPVKS  60

Query  344  EPDLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDSE---QKVSFRPQLPKGVIRGCEE  511
            E  L G    K+ +S+RR+P +NYG+    S +ESD E   Q     P LPKGVIRGC E
Sbjct  61   EAGLGG--GGKISRSLRRKPSINYGRYNQCSDEESDCEQLDQNFPTTPGLPKGVIRGCSE  118

Query  512  CVNCQ  526
            C NCQ
Sbjct  119  CQNCQ  123



>ref|XP_008218326.1| PREDICTED: probable lysine-specific demethylase JMJ14 [Prunus 
mume]
Length=1227

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 81/127 (64%), Gaps = 9/127 (7%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKV-----KDNEKKTNCLASSSEMQLQR  334
            MGTEL   C+K++  +  ++PPGFES  SF+L++V     +D+E + +C  ++S  + Q 
Sbjct  1    MGTELMRVCIKEDNDEFPSVPPGFESFTSFSLKRVNESEKQDSENRISCSETASVSESQS  60

Query  335  AKVEPDLEGVEDAKLKSIRRRPCMNYGQVENSSGDESDS---EQKVSFRPQLPKGVIRGC  505
             ++E ++   E AK +S+RRRP +N+ Q +N   DE +S   EQ  + +  LPKGVIRGC
Sbjct  61   VQMETNIATDEVAK-RSLRRRPWINHRQHDNKPEDEFNSERLEQNFALKSLLPKGVIRGC  119

Query  506  EECVNCQ  526
             +C NCQ
Sbjct  120  PQCSNCQ  126



>ref|XP_010043290.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X2 [Eucalyptus grandis]
 gb|KCW85302.1| hypothetical protein EUGRSUZ_B02147 [Eucalyptus grandis]
Length=1256

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 79/132 (60%), Gaps = 15/132 (11%)
 Frame = +2

Query  167  IMGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNC------------LAS  310
            +MGT L   CVK+E  +  +IPPGFE+ +SFTL  V+DN K  +C             AS
Sbjct  1    MMGT-LMRVCVKEENDEFPSIPPGFEAFSSFTLMGVQDN-KNEDCKQDGESLISCSASAS  58

Query  311  SSEMQLQRAKVEPDLEGVEDAKLKSIRRRPCMNYGQVENSSGDESDSEQKVSFRPQLPKG  490
            +SE+Q  + K E D + V+    +S+RRR    Y Q  NSS DESD E+  S RP LPKG
Sbjct  59   ASELQSVKLKTEVDSDDVKKVT-RSLRRRSWSKYNQRSNSSDDESDCEKSFSARPSLPKG  117

Query  491  VIRGCEECVNCQ  526
            VIRGC +C NCQ
Sbjct  118  VIRGCPKCRNCQ  129



>ref|XP_010043289.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X1 [Eucalyptus grandis]
Length=1263

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 79/132 (60%), Gaps = 15/132 (11%)
 Frame = +2

Query  167  IMGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNC------------LAS  310
            +MGT L   CVK+E  +  +IPPGFE+ +SFTL  V+DN K  +C             AS
Sbjct  8    MMGT-LMRVCVKEENDEFPSIPPGFEAFSSFTLMGVQDN-KNEDCKQDGESLISCSASAS  65

Query  311  SSEMQLQRAKVEPDLEGVEDAKLKSIRRRPCMNYGQVENSSGDESDSEQKVSFRPQLPKG  490
            +SE+Q  + K E D + V+    +S+RRR    Y Q  NSS DESD E+  S RP LPKG
Sbjct  66   ASELQSVKLKTEVDSDDVKKVT-RSLRRRSWSKYNQRSNSSDDESDCEKSFSARPSLPKG  124

Query  491  VIRGCEECVNCQ  526
            VIRGC +C NCQ
Sbjct  125  VIRGCPKCRNCQ  136



>ref|XP_004152824.1| PREDICTED: probable lysine-specific demethylase JMJ14-like [Cucumis 
sativus]
 ref|XP_004167216.1| PREDICTED: probable lysine-specific demethylase JMJ14-like [Cucumis 
sativus]
 gb|KGN61269.1| hypothetical protein Csa_2G074790 [Cucumis sativus]
Length=1235

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 81/127 (64%), Gaps = 8/127 (6%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKK---TNCLASSSEMQLQRAK  340
            MGTEL   CV+D++ D  ++PPGFES  SF+L KV + EK+      ++  +  + Q AK
Sbjct  1    MGTELIRVCVEDDSDDFPSVPPGFESYISFSLGKVHNLEKQDIHAPPVSLPTVSEPQPAK  60

Query  341  VEPDLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDS----EQKVSFRPQLPKGVIRGC  505
            V  ++E  + AK+ +S+RR+PC+NY Q +  S DE +S    +Q  S RP L KGVIRGC
Sbjct  61   VGSEVEVPKVAKVTRSLRRKPCINYKQYDYCSDDEINSTNCLDQNSSSRPSLSKGVIRGC  120

Query  506  EECVNCQ  526
             +C NCQ
Sbjct  121  PQCNNCQ  127



>ref|XP_006487711.1| PREDICTED: probable lysine-specific demethylase JMJ14-like isoform 
X1 [Citrus sinensis]
 ref|XP_006487712.1| PREDICTED: probable lysine-specific demethylase JMJ14-like isoform 
X2 [Citrus sinensis]
 ref|XP_006487713.1| PREDICTED: probable lysine-specific demethylase JMJ14-like isoform 
X3 [Citrus sinensis]
Length=1259

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 75/127 (59%), Gaps = 8/127 (6%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGTEL   C+K+E  ++ ++PPGFES ASFTL++V+D EK    + S S        +  
Sbjct  1    MGTELMRVCIKEENDEVPSVPPGFESFASFTLKRVQDTEKHDCDITSCSASASASESLSV  60

Query  350  DLE-----GVEDAKLKSIRRRPCMNYGQVENSSGDESDS---EQKVSFRPQLPKGVIRGC  505
             +E            + +RRRP +NYG +++SS DESDS    Q  + RP LPKGVIRGC
Sbjct  61   HMETEVKVADAAKAARPLRRRPGINYGLLDHSSEDESDSGKLGQNFTARPCLPKGVIRGC  120

Query  506  EECVNCQ  526
              C +CQ
Sbjct  121  PTCSDCQ  127



>ref|XP_007208130.1| hypothetical protein PRUPE_ppa000401mg [Prunus persica]
 gb|EMJ09329.1| hypothetical protein PRUPE_ppa000401mg [Prunus persica]
Length=1206

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 80/127 (63%), Gaps = 9/127 (7%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKV-----KDNEKKTNCLASSSEMQLQR  334
            MGTEL   C+K++  +  ++PPGFES  SF+L++V     +D+E + +C  ++S  + Q 
Sbjct  1    MGTELMRVCIKEDNDEFPSVPPGFESFTSFSLKRVNESEKQDSENRISCSETASVSESQS  60

Query  335  AKVEPDLEGVEDAKLKSIRRRPCMNYGQVENSSGDESDS---EQKVSFRPQLPKGVIRGC  505
             ++E ++   E AK +S+RRRP +N+ Q +N   DE +S   EQ  +    LPKGVIRGC
Sbjct  61   VQMETNIATDEVAK-RSLRRRPWINHRQHDNKPEDEFNSERLEQNFALNSLLPKGVIRGC  119

Query  506  EECVNCQ  526
             +C NCQ
Sbjct  120  PQCSNCQ  126



>ref|XP_006442674.1| hypothetical protein CICLE_v10018536mg [Citrus clementina]
 gb|ESR55914.1| hypothetical protein CICLE_v10018536mg [Citrus clementina]
Length=1259

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 75/127 (59%), Gaps = 8/127 (6%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGTEL   C+K+E  ++ ++PPGFES ASFTL++V+D EK    + S S        +  
Sbjct  1    MGTELMRVCIKEENDEVPSVPPGFESFASFTLKRVQDTEKHDCDITSCSASASASESLSV  60

Query  350  DLE-----GVEDAKLKSIRRRPCMNYGQVENSSGDESDS---EQKVSFRPQLPKGVIRGC  505
             +E            + +RRRP +NYG +++SS DESDS    Q  + RP LPKGVIRGC
Sbjct  61   HMETEVKVADAAKAARPLRRRPGINYGLLDHSSEDESDSGKLGQNFTARPCLPKGVIRGC  120

Query  506  EECVNCQ  526
              C +CQ
Sbjct  121  PTCSDCQ  127



>ref|XP_008441838.1| PREDICTED: probable lysine-specific demethylase JMJ14 [Cucumis 
melo]
 ref|XP_008441840.1| PREDICTED: probable lysine-specific demethylase JMJ14 [Cucumis 
melo]
 ref|XP_008441841.1| PREDICTED: probable lysine-specific demethylase JMJ14 [Cucumis 
melo]
 ref|XP_008441842.1| PREDICTED: probable lysine-specific demethylase JMJ14 [Cucumis 
melo]
 ref|XP_008441843.1| PREDICTED: probable lysine-specific demethylase JMJ14 [Cucumis 
melo]
 ref|XP_008441844.1| PREDICTED: probable lysine-specific demethylase JMJ14 [Cucumis 
melo]
 ref|XP_008441845.1| PREDICTED: probable lysine-specific demethylase JMJ14 [Cucumis 
melo]
 ref|XP_008441846.1| PREDICTED: probable lysine-specific demethylase JMJ14 [Cucumis 
melo]
 ref|XP_008441847.1| PREDICTED: probable lysine-specific demethylase JMJ14 [Cucumis 
melo]
 ref|XP_008441848.1| PREDICTED: probable lysine-specific demethylase JMJ14 [Cucumis 
melo]
Length=1234

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 81/129 (63%), Gaps = 12/129 (9%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTN-----CLASSSEMQLQR  334
            MGTEL   CV+D++ D  ++PPGFES  SF+L KV + EK+ +      L + SE   Q 
Sbjct  1    MGTELIRVCVEDDSDDFPSVPPGFESYISFSLGKVHNLEKQDSHAPPVSLPTVSES--QP  58

Query  335  AKVEPDLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDS----EQKVSFRPQLPKGVIR  499
             KV  ++E  + AK+ +S+RR+PC+NY Q +  S DE +S    +Q  S RP L KGVIR
Sbjct  59   VKVGSEVEVPKVAKVTRSLRRKPCVNYKQYDYCSDDEINSIKCLDQNSSSRPSLSKGVIR  118

Query  500  GCEECVNCQ  526
            GC +C NCQ
Sbjct  119  GCPQCNNCQ  127



>ref|XP_010102231.1| putative lysine-specific demethylase [Morus notabilis]
 gb|EXB93174.1| putative lysine-specific demethylase [Morus notabilis]
Length=1294

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 76/126 (60%), Gaps = 7/126 (6%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKK-----TNCLASSSEMQLQR  334
            MGTEL   CVK++  D   +PPGFES  SF L++V D E +       C AS    +   
Sbjct  1    MGTELMRVCVKEDNDDFPPVPPGFESFTSFNLKRVNDAESQDSKNMLGCFASVGACEPHT  60

Query  335  AKVEPDLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDSEQ-KVSFRPQLPKGVIRGCE  508
             K+E +++  + AK+ +S+RR+P +NYG+ +    D+ DSE+ + +F  +L KGV RGC 
Sbjct  61   IKMETNVDASDAAKVTRSLRRKPWINYGRQDCDPEDDCDSERLEQNFPTRLSKGVFRGCS  120

Query  509  ECVNCQ  526
            EC NCQ
Sbjct  121  ECSNCQ  126



>ref|XP_008370740.1| PREDICTED: probable lysine-specific demethylase JMJ14 [Malus 
domestica]
 ref|XP_008370741.1| PREDICTED: probable lysine-specific demethylase JMJ14 [Malus 
domestica]
 ref|XP_008370743.1| PREDICTED: probable lysine-specific demethylase JMJ14 [Malus 
domestica]
 ref|XP_008370744.1| PREDICTED: probable lysine-specific demethylase JMJ14 [Malus 
domestica]
Length=1215

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 81/127 (64%), Gaps = 10/127 (8%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKV-----KDNEKKTNCLASSSEMQLQR  334
            MGTEL   C++++  +  ++PPGFES ASF+L++      +D+E + +  A++S  + Q 
Sbjct  1    MGTELMRVCMQEDNDEFPSVPPGFESFASFSLQRANESEKQDSENRISSSATASPSKSQS  60

Query  335  AKVEPDLEGVEDAKLKSIRRRPCMNYGQVENSSGDESDS---EQKVSFRPQLPKGVIRGC  505
             ++E D++    AK +S+RRR C+N+G+  N S DESD    EQ    R  LPKGVIRGC
Sbjct  61   VQMETDIDTGGVAK-RSVRRRQCINHGR-NNKSEDESDWEQLEQNCPPRSVLPKGVIRGC  118

Query  506  EECVNCQ  526
             +C NCQ
Sbjct  119  PQCSNCQ  125



>ref|XP_009343755.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Pyrus 
x bretschneideri]
 ref|XP_009343756.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Pyrus 
x bretschneideri]
 ref|XP_009343757.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Pyrus 
x bretschneideri]
Length=1239

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 81/127 (64%), Gaps = 10/127 (8%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKT--NCLASSSEMQ---LQR  334
            MGTEL   C++++  +  ++PPGFES ASF+L++  ++EK+   N ++SS+       Q 
Sbjct  1    MGTELMRVCIQEDNDEFPSVPPGFESFASFSLKRANESEKQDSENTISSSATASPSVSQS  60

Query  335  AKVEPDLEGVEDAKLKSIRRRPCMNYGQVENSSGDESDS---EQKVSFRPQLPKGVIRGC  505
             ++E D++  E A+ +S+R R C+N+G+  N S DESD    EQ    R  LPKGVIRGC
Sbjct  61   VQMETDIDTGEVAR-RSVRHRQCINHGR-NNKSEDESDWEQLEQNCPPRSVLPKGVIRGC  118

Query  506  EECVNCQ  526
             +C NCQ
Sbjct  119  PQCSNCQ  125



>ref|XP_004302095.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466003.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Fragaria 
vesca subsp. vesca]
Length=1218

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 72/127 (57%), Gaps = 9/127 (7%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKK-----TNCLASSSEMQLQR  334
            MGTEL   C+K++  +  ++PPGFES  SF+L++V D+EK+       C A++S    Q 
Sbjct  1    MGTELMRVCLKEDNDEFPSVPPGFESFTSFSLKRVNDSEKQDSENLITCNATTSTSGSQS  60

Query  335  AKVEPDLEGVEDAKLKSIRRRPCMNYGQVENSSGDESDSE---QKVSFRPQLPKGVIRGC  505
              +E     V D   +S RRRP +N  +  N + DESD E   Q    R  LPKGVIRGC
Sbjct  61   VPMETG-NDVADVAKRSQRRRPGINNRRYNNYAEDESDYESLDQSFLQRSLLPKGVIRGC  119

Query  506  EECVNCQ  526
             EC  CQ
Sbjct  120  PECSTCQ  126



>ref|XP_008785239.1| PREDICTED: probable lysine-specific demethylase JMJ14 [Phoenix 
dactylifera]
Length=1302

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 10/124 (8%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGTE    C+KD++  M ++PPGF SL SFTL++V++N   + C+++  +     A VE 
Sbjct  1    MGTECLGACLKDDSDGMPSVPPGFVSLTSFTLQRVQENALASACVSNPIQ-----APVET  55

Query  350  DLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDS----EQKVSFRPQLPKGVIRGCEEC  514
            +   +ED K  KS+R RP +NY Q + SS +E       EQ +     LPKGV+RGC EC
Sbjct  56   ESSIIEDKKFRKSLRHRPWINYRQFDYSSEEEESDSELFEQDIPSVNGLPKGVLRGCSEC  115

Query  515  VNCQ  526
             NCQ
Sbjct  116  QNCQ  119



>gb|KEH42922.1| transcription factor jumonji family protein [Medicago truncatula]
Length=1069

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 83/129 (64%), Gaps = 10/129 (8%)
 Frame = +2

Query  167  IMGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTN-----CLASSSEMQLQ  331
            +MGTEL   CVK++  D  ++PPGFES  SF L++V++NEK  +        ++S  + Q
Sbjct  4    LMGTELMRICVKEDD-DFPSVPPGFESYTSFALKRVEENEKNNDKNPTSSSTTTSASESQ  62

Query  332  RAKVEPDLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDSE---QKVSFRPQLPKGVIR  499
              +V   ++  + AK+ +S+RRR  +N+G+ E+SS +++D E   Q  S RP LPKGV+R
Sbjct  63   STQVGNGVQLSDSAKVSRSLRRRRWINHGKCESSSEEDADCERHDQNFSSRPCLPKGVLR  122

Query  500  GCEECVNCQ  526
            GC +C NCQ
Sbjct  123  GCPDCRNCQ  131



>gb|KEH42923.1| transcription factor jumonji family protein [Medicago truncatula]
Length=1231

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 83/129 (64%), Gaps = 10/129 (8%)
 Frame = +2

Query  167  IMGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTN-----CLASSSEMQLQ  331
            +MGTEL   CVK++  D  ++PPGFES  SF L++V++NEK  +        ++S  + Q
Sbjct  4    LMGTELMRICVKEDD-DFPSVPPGFESYTSFALKRVEENEKNNDKNPTSSSTTTSASESQ  62

Query  332  RAKVEPDLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDSE---QKVSFRPQLPKGVIR  499
              +V   ++  + AK+ +S+RRR  +N+G+ E+SS +++D E   Q  S RP LPKGV+R
Sbjct  63   STQVGNGVQLSDSAKVSRSLRRRRWINHGKCESSSEEDADCERHDQNFSSRPCLPKGVLR  122

Query  500  GCEECVNCQ  526
            GC +C NCQ
Sbjct  123  GCPDCRNCQ  131



>emb|CDX97499.1| BnaC08g13640D, partial [Brassica napus]
Length=533

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 71/119 (60%), Gaps = 7/119 (6%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGTEL   CVK+E+ ++ ++PPGFES A+FTL++V  +        SS   Q      E 
Sbjct  1    MGTELMRICVKEESDELPSVPPGFESYATFTLKRVVPDPGAAMESVSSVSNQ-----GEM  55

Query  350  DLEGVEDAKLKSIRRRPCMNYGQVENSSGDESDSEQKVSFRPQLPKGVIRGCEECVNCQ  526
            ++E  E    +S+RRRP +NY   ++++G   + +Q    +P LPKGV RGC EC +CQ
Sbjct  56   EIESDEAKAARSLRRRPWINYD--DDNNGLSQNLDQTCGVKPSLPKGVTRGCAECNDCQ  112



>ref|XP_010935913.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X1 [Elaeis guineensis]
Length=1303

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 73/123 (59%), Gaps = 9/123 (7%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGT+     V D+   +S +PPGF S ASFTL++V+D+   + C + S+  QL R   E 
Sbjct  1    MGTKYIEADVTDDPDGISPVPPGFTSPASFTLQRVQDDVMVSTCASDST--QLGR---ET  55

Query  350  DLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDSEQKVSFRPQ---LPKGVIRGCEECV  517
            D   + D  L KS+R +P +NY Q ++SS +ESD+E      P    LPKGVIRGC  C 
Sbjct  56   DCSVLGDKTLRKSLRHKPWVNYSQFDDSSEEESDAELYKQNAPSIRCLPKGVIRGCAVCR  115

Query  518  NCQ  526
            NCQ
Sbjct  116  NCQ  118



>ref|XP_010935914.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X2 [Elaeis guineensis]
Length=1227

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 73/123 (59%), Gaps = 9/123 (7%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGT+     V D+   +S +PPGF S ASFTL++V+D+   + C + S+  QL R   E 
Sbjct  1    MGTKYIEADVTDDPDGISPVPPGFTSPASFTLQRVQDDVMVSTCASDST--QLGR---ET  55

Query  350  DLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDSEQKVSFRPQ---LPKGVIRGCEECV  517
            D   + D  L KS+R +P +NY Q ++SS +ESD+E      P    LPKGVIRGC  C 
Sbjct  56   DCSVLGDKTLRKSLRHKPWVNYSQFDDSSEEESDAELYKQNAPSIRCLPKGVIRGCAVCR  115

Query  518  NCQ  526
            NCQ
Sbjct  116  NCQ  118



>emb|CDY31135.1| BnaA08g26850D [Brassica napus]
Length=1136

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 72/120 (60%), Gaps = 9/120 (8%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEK-VKDNEKKTNCLASSSEMQLQRAKVE  346
            MGTEL   CVK+E+ ++ ++PPGFES A+FTL++ V D       +AS S       + E
Sbjct  1    MGTELMRICVKEESDELPSVPPGFESYATFTLKRVVPDPGAAMESVASVSN------QGE  54

Query  347  PDLEGVEDAKLKSIRRRPCMNYGQVENSSGDESDSEQKVSFRPQLPKGVIRGCEECVNCQ  526
             ++E  E    +S+RRRP +NY   ++S+    + +Q    +P LPKGV RGC EC +CQ
Sbjct  55   MEIESDEAKAARSLRRRPWINYD--DDSNALSQNLDQNCGVKPSLPKGVTRGCAECNDCQ  112



>ref|XP_006417665.1| hypothetical protein EUTSA_v10006592mg [Eutrema salsugineum]
 ref|XP_006417666.1| hypothetical protein EUTSA_v10006592mg [Eutrema salsugineum]
 gb|ESQ36018.1| hypothetical protein EUTSA_v10006592mg [Eutrema salsugineum]
 gb|ESQ36019.1| hypothetical protein EUTSA_v10006592mg [Eutrema salsugineum]
Length=1203

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 75/127 (59%), Gaps = 12/127 (9%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEK-VKDNEKKTNCLASSSEMQLQRAKVE  346
            MGTEL   CVK+E+ ++ ++PPGFES A+FTL++ V  N+K    + S+S  +  + ++E
Sbjct  1    MGTELMRICVKEESDEVPSVPPGFESYATFTLKRVVPGNDKSKTPMESASVTEPAKMEIE  60

Query  347  PDLEGVEDAKLKSIRRRPCMNYG------QVENSSGDESDSEQKVSFRP-QLPKGVIRGC  505
             D    E    +S+RRRP +NYG         N +    + +Q    +P  LPKGV RGC
Sbjct  61   SD----EAKAARSLRRRPWINYGGCDDDDSPNNDNASSQNLDQNCVVKPSSLPKGVTRGC  116

Query  506  EECVNCQ  526
            EEC +CQ
Sbjct  117  EECKDCQ  123



>ref|XP_009110879.1| PREDICTED: probable lysine-specific demethylase JMJ14 [Brassica 
rapa]
 ref|XP_009110880.1| PREDICTED: probable lysine-specific demethylase JMJ14 [Brassica 
rapa]
 ref|XP_009110881.1| PREDICTED: probable lysine-specific demethylase JMJ14 [Brassica 
rapa]
 ref|XP_009110883.1| PREDICTED: probable lysine-specific demethylase JMJ14 [Brassica 
rapa]
Length=1145

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 70/119 (59%), Gaps = 7/119 (6%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGTEL   CVK+E+ ++ ++PPGFES A+FTL++V  +        SS   Q      E 
Sbjct  1    MGTELMRICVKEESDELPSVPPGFESYATFTLKRVVPDPGAAMESVSSVSNQ-----GEM  55

Query  350  DLEGVEDAKLKSIRRRPCMNYGQVENSSGDESDSEQKVSFRPQLPKGVIRGCEECVNCQ  526
            ++E  E    +S+RRRP +NY   ++S+    + +Q    +P LPKGV RGC EC +CQ
Sbjct  56   EIESDEAKAARSLRRRPWINYD--DDSNALSQNLDQTCGVKPSLPKGVTRGCAECNDCQ  112



>ref|XP_010652378.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X1 [Vitis vinifera]
Length=902

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 72/123 (59%), Gaps = 5/123 (4%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MG E  S C     +D  ++PPGF SL SFTL++++D+E+  N +A  S  Q   A ++ 
Sbjct  4    MGQEYVSICSTGNQVDDLSVPPGFASLTSFTLKRMEDSEETCNSMAFGSAFQPDPANMDA  63

Query  350  DLEGVEDAKLK-SIRRRPCMNYGQVENSSGDESDSEQ---KVSFRPQLPKGVIRGCEECV  517
              + ++ A+ K S+R RP + Y Q ++   D SD +Q    +  +  LPKGVIRGC +C 
Sbjct  64   ACDPIDIAEFKRSLRHRPWILYDQCDHEEED-SDPKQIDANLHSKTYLPKGVIRGCSDCS  122

Query  518  NCQ  526
            NCQ
Sbjct  123  NCQ  125



>ref|XP_010652379.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X2 [Vitis vinifera]
 ref|XP_010652380.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X2 [Vitis vinifera]
 ref|XP_010652381.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X2 [Vitis vinifera]
Length=899

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 72/123 (59%), Gaps = 5/123 (4%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MG E  S C     +D  ++PPGF SL SFTL++++D+E+  N +A  S  Q   A ++ 
Sbjct  1    MGQEYVSICSTGNQVDDLSVPPGFASLTSFTLKRMEDSEETCNSMAFGSAFQPDPANMDA  60

Query  350  DLEGVEDAKLK-SIRRRPCMNYGQVENSSGDESDSEQ---KVSFRPQLPKGVIRGCEECV  517
              + ++ A+ K S+R RP + Y Q ++   D SD +Q    +  +  LPKGVIRGC +C 
Sbjct  61   ACDPIDIAEFKRSLRHRPWILYDQCDHEEED-SDPKQIDANLHSKTYLPKGVIRGCSDCS  119

Query  518  NCQ  526
            NCQ
Sbjct  120  NCQ  122



>ref|XP_010528755.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010528756.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X2 [Tarenaya hassleriana]
Length=1210

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 78/133 (59%), Gaps = 17/133 (13%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEK-VKDNEK-KTNC----LASSSEMQLQ  331
            MGTEL   CVK+E  ++ +IPPGFES ASFTL+K V   EK KTN     L + S   ++
Sbjct  1    MGTELMRVCVKEENDELPSIPPGFESYASFTLKKAVPGGEKAKTNSVTCGLPAESATAIK  60

Query  332  RAKVEPDLEGVEDAK--LKSIRRRPCMNYGQVENSSGDESDSE------QKVSFRPQLPK  487
              K+E D   + DA    +S+R+RP +N+  V     DE++        + V  +P LPK
Sbjct  61   SVKMETD-SNLSDASKPARSLRQRPWINF--VGCDDDDENNKPTCPKLGENVIPKPSLPK  117

Query  488  GVIRGCEECVNCQ  526
            GVIRGC EC +CQ
Sbjct  118  GVIRGCAECTDCQ  130



>emb|CDX95046.1| BnaC05g06250D [Brassica napus]
Length=1132

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 74/131 (56%), Gaps = 14/131 (11%)
 Frame = +2

Query  164  YIMGTELFSHCVKDETIDMSTIPPGFESLASFTLEK------VKDNEKKTNCLASSSEMQ  325
            Y+MGTEL   C+K+E+ ++ ++PPGFES ASFTL++          + KT   +S +E  
Sbjct  11   YVMGTELMRVCMKEESDELPSVPPGFESYASFTLKRPLPDPGAAAAKTKTPVESSVTEQA  70

Query  326  LQRAKVEPDLEGVEDAKLKSIRRRPCMNYGQVENS----SGDESDSEQKVSFRPQLPKGV  493
             +  ++E D    E    +S+RRRP +NY   ++     + D +  +     +P LPKGV
Sbjct  71   NKMEEIESD----ELKAARSLRRRPWINYAGCDDDDTAPNNDNASPQNLDQKKPSLPKGV  126

Query  494  IRGCEECVNCQ  526
             RGC EC +CQ
Sbjct  127  TRGCAECNDCQ  137



>ref|XP_010934317.1| PREDICTED: lysine-specific demethylase JMJ18-like isoform X1 
[Elaeis guineensis]
Length=1295

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 72/124 (58%), Gaps = 12/124 (10%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGTE    C+KD++  M ++PPGF SL SFTL++V++N      +++         +VE 
Sbjct  1    MGTECLGACLKDDSDGMPSVPPGFASLTSFTLQRVQENALAPAHVSNP-------IQVET  53

Query  350  DLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDS----EQKVSFRPQLPKGVIRGCEEC  514
            +   +ED K  KS+R RP +NY Q + SS +E       EQ +     LPKGV+RGC EC
Sbjct  54   ESGIIEDKKFRKSLRHRPWINYRQFDYSSEEEESDSELFEQDIPSVNTLPKGVLRGCSEC  113

Query  515  VNCQ  526
             NCQ
Sbjct  114  QNCQ  117



>ref|XP_010934318.1| PREDICTED: lysine-specific demethylase JMJ18-like isoform X2 
[Elaeis guineensis]
Length=1268

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 72/124 (58%), Gaps = 12/124 (10%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGTE    C+KD++  M ++PPGF SL SFTL++V++N      +++         +VE 
Sbjct  1    MGTECLGACLKDDSDGMPSVPPGFASLTSFTLQRVQENALAPAHVSNP-------IQVET  53

Query  350  DLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDS----EQKVSFRPQLPKGVIRGCEEC  514
            +   +ED K  KS+R RP +NY Q + SS +E       EQ +     LPKGV+RGC EC
Sbjct  54   ESGIIEDKKFRKSLRHRPWINYRQFDYSSEEEESDSELFEQDIPSVNTLPKGVLRGCSEC  113

Query  515  VNCQ  526
             NCQ
Sbjct  114  QNCQ  117



>ref|XP_010475668.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Camelina 
sativa]
Length=1206

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 76/127 (60%), Gaps = 12/127 (9%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKV---KDNEKKTNCLASSSEMQLQRAK  340
            MGTEL   CVKDE+ D+ ++PPGFES A+FTL+++     ++ K   + +    +  + +
Sbjct  1    MGTELMRICVKDESDDLPSVPPGFESYATFTLKRLPPGSSDKAKPPPIETVPVTEQPKME  60

Query  341  VEPDLEGVEDAKLKSIRR-RPCMNYGQVENSSGDESDSEQKVS----FRPQLPKGVIRGC  505
            VE D    E    +S+RR RP +NY   + ++ D + S+Q +       P LPKGV+RGC
Sbjct  61   VESD----ESNAARSLRRNRPWINYDDDDVANNDNAASQQHLDQNSVVEPSLPKGVVRGC  116

Query  506  EECVNCQ  526
            EEC +CQ
Sbjct  117  EECKDCQ  123



>gb|AAF99757.1|AC003981_7 F22O13.10 [Arabidopsis thaliana]
Length=1239

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 76/132 (58%), Gaps = 16/132 (12%)
 Frame = +2

Query  167  IMGTELFSHCVKDETIDMSTIPPGFESLASFTLEKV----KDNEKKTNCLASSSEMQLQR  334
            +MGTEL   CVK+++ D+ ++PPGFES A+FTL++V      ++ KT  + S S  +  +
Sbjct  14   VMGTELMRICVKEDSDDLPSVPPGFESYATFTLKRVVPATTSDKAKTPAIESVSATEQAK  73

Query  335  AKVEPDLEGVEDAKLKSIRRRPCMNYG--------QVENSSGDESDSEQKVSFRPQLPKG  490
             +VE D    E    +++RRRP +N+            N +    + +Q    +P LPKG
Sbjct  74   MEVESD----EAKAARALRRRPWINHSGCDDDGDCAANNDNAASQNPDQNCDVKPALPKG  129

Query  491  VIRGCEECVNCQ  526
            V+RGCEEC +CQ
Sbjct  130  VVRGCEECKDCQ  141



>ref|XP_010458105.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Camelina 
sativa]
Length=1208

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 73/128 (57%), Gaps = 13/128 (10%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVK--DNEKKTNCLASSSEMQLQRAKV  343
            MGTEL   CVKDE+ D+ ++PPGFES A+FTL+++    ++K    + +    +  + +V
Sbjct  1    MGTELMRICVKDESDDLPSVPPGFESYATFTLKRLPPGSSDKAMTPIETVPVTEQPKMEV  60

Query  344  EPDLEGVEDAKLKSIRR-RPCMNY------GQVENSSGDESDSEQKVSFRPQLPKGVIRG  502
            E D    E    +S+RR RP +NY          +++  +   +Q     P LPKGV+RG
Sbjct  61   ETD----ESKAARSLRRNRPWINYDDDDDDVANNDNAASQQHLDQNSKVEPSLPKGVVRG  116

Query  503  CEECVNCQ  526
            CEEC +CQ
Sbjct  117  CEECKDCQ  124



>ref|XP_010906801.1| PREDICTED: lysine-specific demethylase JMJ18-like isoform X2 
[Elaeis guineensis]
Length=1222

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 74/126 (59%), Gaps = 14/126 (11%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGTE    C+KD++  M ++PPGF SL SFTL++V++N   +  LAS+S   +Q A+   
Sbjct  1    MGTECLGACLKDDSDGMPSVPPGFVSLTSFTLQRVQENAVAS-ALASNS---IQAAE---  53

Query  350  DLEG--VEDAKL-KSIRRRPCMNYGQVE----NSSGDESDSEQKVSFRPQLPKGVIRGCE  508
            D E   ++D K  KS+R RP +NY Q +        D    EQ++     LPKGVIRGC 
Sbjct  54   DTESGVIDDKKFRKSLRHRPWVNYRQFDYSSEEEESDSELLEQEIHSVHCLPKGVIRGCS  113

Query  509  ECVNCQ  526
            EC  CQ
Sbjct  114  ECQTCQ  119



>ref|NP_172338.4| transcription factor PKDM7D [Arabidopsis thaliana]
 ref|NP_001184940.1| transcription factor PKDM7D [Arabidopsis thaliana]
 sp|C0SUT9.1|JMJ16_ARATH RecName: Full=Putative lysine-specific demethylase JMJ16; AltName: 
Full=Jumonji domain-containing protein 16; AltName: Full=Lysine-specific 
histone demethylase JMJ16; AltName: Full=Protein 
JUMONJI 16 [Arabidopsis thaliana]
 dbj|BAH30280.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE28318.1| transcription factor jumonji and C5HC2 type zinc finger domain-containing 
protein [Arabidopsis thaliana]
 gb|AEE28319.1| transcription factor jumonji and C5HC2 type zinc finger domain-containing 
protein [Arabidopsis thaliana]
Length=1209

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 75/131 (57%), Gaps = 16/131 (12%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKV----KDNEKKTNCLASSSEMQLQRA  337
            MGTEL   CVK+++ D+ ++PPGFES A+FTL++V      ++ KT  + S S  +  + 
Sbjct  1    MGTELMRICVKEDSDDLPSVPPGFESYATFTLKRVVPATTSDKAKTPAIESVSATEQAKM  60

Query  338  KVEPDLEGVEDAKLKSIRRRPCMNYG--------QVENSSGDESDSEQKVSFRPQLPKGV  493
            +VE D    E    +++RRRP +N+            N +    + +Q    +P LPKGV
Sbjct  61   EVESD----EAKAARALRRRPWINHSGCDDDGDCAANNDNAASQNPDQNCDVKPALPKGV  116

Query  494  IRGCEECVNCQ  526
            +RGCEEC +CQ
Sbjct  117  VRGCEECKDCQ  127



>ref|XP_010906800.1| PREDICTED: lysine-specific demethylase JMJ18-like isoform X1 
[Elaeis guineensis]
Length=1288

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 74/126 (59%), Gaps = 14/126 (11%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGTE    C+KD++  M ++PPGF SL SFTL++V++N   +  LAS+S   +Q A+   
Sbjct  1    MGTECLGACLKDDSDGMPSVPPGFVSLTSFTLQRVQENAVAS-ALASNS---IQAAE---  53

Query  350  DLEG--VEDAKL-KSIRRRPCMNYGQVE----NSSGDESDSEQKVSFRPQLPKGVIRGCE  508
            D E   ++D K  KS+R RP +NY Q +        D    EQ++     LPKGVIRGC 
Sbjct  54   DTESGVIDDKKFRKSLRHRPWVNYRQFDYSSEEEESDSELLEQEIHSVHCLPKGVIRGCS  113

Query  509  ECVNCQ  526
            EC  CQ
Sbjct  114  ECQTCQ  119



>emb|CDX93549.1| BnaA06g04990D [Brassica napus]
Length=1086

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 72/119 (61%), Gaps = 10/119 (8%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGTEL   C+K+E+ ++ ++PPGFES A+FTL++   +    +    SS  + Q  K+E 
Sbjct  1    MGTELMRVCMKEESDELPSVPPGFESYATFTLKRPLPSAAAADKTMESSVTE-QANKME-  58

Query  350  DLEGVEDAKLKSIRRRPCMNYGQVENSSGDESDSEQKVSFRPQLPKGVIRGCEECVNCQ  526
            ++E  E    +S+RRRP +NY   +N+S    D +     +P LPKGV RGC +C +CQ
Sbjct  59   EIESDEVKAARSLRRRPWINY---DNASPQNLDQK-----KPSLPKGVTRGCADCNDCQ  109



>ref|XP_006365897.1| PREDICTED: probable lysine-specific demethylase JMJ14-like isoform 
X1 [Solanum tuberosum]
Length=806

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 64/103 (62%), Gaps = 2/103 (2%)
 Frame = +2

Query  224  TIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEPDLEGVEDAKLK-SIRRRP  400
            ++PPGFESL SFTL+KV++NE+  N +A  +E +    +V      +   KLK S+RRRP
Sbjct  19   SVPPGFESLTSFTLQKVENNEEACNSVAVGNESEQGPIQVASTSTIISTGKLKSSVRRRP  78

Query  401  CMNYGQVENSSGD-ESDSEQKVSFRPQLPKGVIRGCEECVNCQ  526
             +    V++   D E ++++  S R  LPKGVIRGC  C NCQ
Sbjct  79   WILDDHVDHMEEDFECEADKGSSSRAYLPKGVIRGCSSCHNCQ  121



>ref|XP_009148114.1| PREDICTED: probable lysine-specific demethylase JMJ14 [Brassica 
rapa]
Length=1110

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 72/119 (61%), Gaps = 10/119 (8%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGTEL   C+K+E+ ++ ++PPGFES A+FTL++   +    +    SS  + Q  K+E 
Sbjct  1    MGTELMRVCMKEESDELPSVPPGFESYATFTLKRPLPSAAAADKTMESSVTE-QANKME-  58

Query  350  DLEGVEDAKLKSIRRRPCMNYGQVENSSGDESDSEQKVSFRPQLPKGVIRGCEECVNCQ  526
            ++E  E    +S+RRRP +NY   +N+S    D +     +P LPKGV RGC +C +CQ
Sbjct  59   EIESDELKAARSLRRRPWINY---DNASPQNLDQK-----KPSLPKGVTRGCADCNDCQ  109



>ref|XP_008810597.1| PREDICTED: probable lysine-specific demethylase JMJ14 isoform 
X5 [Phoenix dactylifera]
Length=1274

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 74/123 (60%), Gaps = 10/123 (8%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGT+     V D+   +  +PPGF SLASFTL++V+D+   +     +S+  LQR   E 
Sbjct  1    MGTKYIEADVTDDPDVIPPVPPGFTSLASFTLQRVQDDVMVS---TGASDSILQR---ET  54

Query  350  DLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDSEQKVSFRPQ---LPKGVIRGCEECV  517
            D   + D KL KS+R +P +NY Q +NSS +ESD+E      P    LPKGVIRGC EC 
Sbjct  55   DCSILGDKKLRKSLRHKPWVNYSQYDNSSEEESDAELYEQNAPAICCLPKGVIRGCAECR  114

Query  518  NCQ  526
            NCQ
Sbjct  115  NCQ  117



>ref|XP_006303885.1| hypothetical protein CARUB_v10008112mg [Capsella rubella]
 ref|XP_006303886.1| hypothetical protein CARUB_v10008112mg [Capsella rubella]
 gb|EOA36783.1| hypothetical protein CARUB_v10008112mg [Capsella rubella]
 gb|EOA36784.1| hypothetical protein CARUB_v10008112mg [Capsella rubella]
Length=1223

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 74/141 (52%), Gaps = 22/141 (16%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEK---VKDNEKKTNCLASSSEM-QLQRA  337
            MGTEL   CVK+E+ D+ ++PPGFES A+FTL+K      ++K T  + + S   Q + A
Sbjct  1    MGTELMRICVKEESDDVPSVPPGFESYATFTLKKRVVPASSDKPTTAIDTVSVTDQPKTA  60

Query  338  KVEP---------DLEGVEDAKLKSIRR-RPCMNY--------GQVENSSGDESDSEQKV  463
             VE          D+E  E    +S+RR RP +NY            N +      +Q  
Sbjct  61   AVEAVPVTEHAKMDMESDEAIAARSLRRNRPWINYVGCDDDDDDVANNDNAASQHLDQNS  120

Query  464  SFRPQLPKGVIRGCEECVNCQ  526
               P LPKGV+RGCEEC +CQ
Sbjct  121  VVEPSLPKGVVRGCEECKDCQ  141



>ref|XP_002532040.1| transcription factor, putative [Ricinus communis]
 gb|EEF30356.1| transcription factor, putative [Ricinus communis]
Length=803

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 73/124 (59%), Gaps = 8/124 (6%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGT+      + E +D  ++PPGF SL SF L KV+++++  N + S+S  +  + +++ 
Sbjct  1    MGTKRTRTAPQTENVDQLSVPPGFVSLTSFRLRKVENSDQTCNSMGSASATKGDQIQMDA  60

Query  350  DLEGVEDAKLK-SIRRRPCM-NYGQVENSSGDESDSEQKVSF----RPQLPKGVIRGCEE  511
             L  +E A LK SIR RP M +Y +++N   +ESDSE  V      R  LP+GV  GC +
Sbjct  61   ALNEIEVASLKRSIRHRPWMLDYQKMQNQ--EESDSEPVVMVNRPSRTSLPRGVSHGCPD  118

Query  512  CVNC  523
            C NC
Sbjct  119  CSNC  122



>ref|XP_002889706.1| transcription factor jumonji family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH65965.1| transcription factor jumonji family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=1209

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 78/132 (59%), Gaps = 19/132 (14%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKV---KDNEKKTNCLASSSEMQLQRAK  340
            MGTEL   CVK+++ D+ ++PPGFES A+FTL++V     ++ KT  + S S  +  + +
Sbjct  1    MGTELMRICVKEDSDDLPSVPPGFESYATFTLKRVVPGTSDKAKTAAIESVSATEQAKME  60

Query  341  VEPDLEGVEDAKLKSIRRRPCMNY----------GQVENSSGDESDSEQKVSFRPQLPKG  490
            VE D    E    +++RRRP +N+           +++N++    D  Q  + +  LPKG
Sbjct  61   VESD----EAKAARAVRRRPWINHSGCDDDDDDGAKIDNAASQNPD--QSCAVKLSLPKG  114

Query  491  VIRGCEECVNCQ  526
            V+RGCEEC +CQ
Sbjct  115  VVRGCEECKDCQ  126



>ref|XP_010321827.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X2 [Solanum lycopersicum]
Length=752

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 63/103 (61%), Gaps = 2/103 (2%)
 Frame = +2

Query  224  TIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEPDLEGVEDAKLK-SIRRRP  400
            ++PPGFESL SFTL+KV++NE+  N +A  +E +    +V      +   KLK S+RRRP
Sbjct  19   SVPPGFESLTSFTLQKVENNEEACNSVAVGNESEQGPVQVASTATIISTGKLKSSVRRRP  78

Query  401  CMNYGQVENSSGD-ESDSEQKVSFRPQLPKGVIRGCEECVNCQ  526
             +    V++   + E +S++  S    LP+GVIRGC  C NCQ
Sbjct  79   WILDDHVDHMEENFECESDKGSSSHAYLPRGVIRGCSSCHNCQ  121



>ref|XP_004240500.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X1 [Solanum lycopersicum]
Length=805

 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 63/103 (61%), Gaps = 2/103 (2%)
 Frame = +2

Query  224  TIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEPDLEGVEDAKLK-SIRRRP  400
            ++PPGFESL SFTL+KV++NE+  N +A  +E +    +V      +   KLK S+RRRP
Sbjct  19   SVPPGFESLTSFTLQKVENNEEACNSVAVGNESEQGPVQVASTATIISTGKLKSSVRRRP  78

Query  401  CMNYGQVENSSGD-ESDSEQKVSFRPQLPKGVIRGCEECVNCQ  526
             +    V++   + E +S++  S    LP+GVIRGC  C NCQ
Sbjct  79   WILDDHVDHMEENFECESDKGSSSHAYLPRGVIRGCSSCHNCQ  121



>ref|XP_008802145.1| PREDICTED: probable lysine-specific demethylase JMJ14 [Phoenix 
dactylifera]
 ref|XP_008802146.1| PREDICTED: probable lysine-specific demethylase JMJ14 [Phoenix 
dactylifera]
Length=1294

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 69/124 (56%), Gaps = 10/124 (8%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGTE    C+KD++  M ++PPGF SL  FTL++V++N   + C ++S +     A  + 
Sbjct  1    MGTECLGACLKDDSDGMPSVPPGFASLTPFTLQRVQENALASACASNSIQ-----APEDT  55

Query  350  DLEGVEDAKL-KSIRRRPCMNYGQVE----NSSGDESDSEQKVSFRPQLPKGVIRGCEEC  514
            +   ++D K  KS+R R  +NY Q +        D    EQ++     LPKGVIRGC EC
Sbjct  56   ESGIIDDKKFRKSLRHRSWVNYRQFDYSSEEEESDSELLEQEIHSVHCLPKGVIRGCSEC  115

Query  515  VNCQ  526
              CQ
Sbjct  116  QTCQ  119



>gb|KDO60470.1| hypothetical protein CISIN_1g039459mg, partial [Citrus sinensis]
Length=727

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 70/122 (57%), Gaps = 5/122 (4%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGT+     + +E +D  + PPGF SL SF L+KV+++E+  N +A +S    +      
Sbjct  1    MGTKRMRANLGNEDLDKLSAPPGFMSLTSFLLKKVENSEESCNSVAFASASAQEPVCANA  60

Query  350  DLEGVEDAKLK-SIRRRPCMNYGQVENSSGDESDSEQKV---SFRPQLPKGVIRGCEECV  517
              + V+   LK S+R RP + Y Q +N+   ES+ EQ V   S R  LPKGVIRGC +C 
Sbjct  61   PSDMVDAGTLKRSLRNRPWILYEQSDNNQ-KESNFEQPVEELSSRATLPKGVIRGCPDCS  119

Query  518  NC  523
            NC
Sbjct  120  NC  121



>ref|XP_010553771.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X1 [Tarenaya hassleriana]
Length=1177

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 76/134 (57%), Gaps = 16/134 (12%)
 Frame = +2

Query  167  IMGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNC------LASSSEMQL  328
            +MGTEL   CVK+ET ++ ++PPGFES +S TL++V    +KT        L + + +  
Sbjct  6    LMGTELMRVCVKEETDELPSVPPGFESYSSLTLQRVAPGGEKTKINNVTCGLPAGNALAT  65

Query  329  QRAKVEPDLEGVEDAK-LKSIRRRPCMNYGQVENSSGDESDS-------EQKVSFRPQLP  484
            +R K E      + +K  +  RRRP +NY  V     D+++S       +Q V  +P LP
Sbjct  66   ERVKTETGSNLSDTSKPARPPRRRPWINY--VGCDDDDDANSKPMCQKLDQNVIAKPSLP  123

Query  485  KGVIRGCEECVNCQ  526
            KGVIRGC EC +CQ
Sbjct  124  KGVIRGCAECPDCQ  137



>ref|XP_010553773.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X3 [Tarenaya hassleriana]
Length=1019

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 76/134 (57%), Gaps = 16/134 (12%)
 Frame = +2

Query  167  IMGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNC------LASSSEMQL  328
            +MGTEL   CVK+ET ++ ++PPGFES +S TL++V    +KT        L + + +  
Sbjct  6    LMGTELMRVCVKEETDELPSVPPGFESYSSLTLQRVAPGGEKTKINNVTCGLPAGNALAT  65

Query  329  QRAKVEPDLEGVEDAK-LKSIRRRPCMNYGQVENSSGDESDS-------EQKVSFRPQLP  484
            +R K E      + +K  +  RRRP +NY  V     D+++S       +Q V  +P LP
Sbjct  66   ERVKTETGSNLSDTSKPARPPRRRPWINY--VGCDDDDDANSKPMCQKLDQNVIAKPSLP  123

Query  485  KGVIRGCEECVNCQ  526
            KGVIRGC EC +CQ
Sbjct  124  KGVIRGCAECPDCQ  137



>ref|XP_010489147.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X3 [Camelina sativa]
Length=1208

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 67/125 (54%), Gaps = 7/125 (6%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGTEL   CVKDE+ D+ ++PPGFES A+FTL+++         +    E      + + 
Sbjct  1    MGTELMRICVKDESDDLPSVPPGFESYATFTLKRLPPGSSD-KAMPPPIETVPVTEQPKM  59

Query  350  DLEGVEDAKLKSIRR-RPCMNY-----GQVENSSGDESDSEQKVSFRPQLPKGVIRGCEE  511
            ++E  E     S+RR RP +N          +++  +   +Q     P LPKGV+RGCEE
Sbjct  60   EIESDESKAAPSLRRIRPWINIDDDDDVANNDNAASQQHLDQNSVVEPSLPKGVVRGCEE  119

Query  512  CVNCQ  526
            C +CQ
Sbjct  120  CKDCQ  124



>ref|XP_010489113.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X1 [Camelina sativa]
 ref|XP_010489120.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X2 [Camelina sativa]
 ref|XP_010489127.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X1 [Camelina sativa]
 ref|XP_010489133.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X1 [Camelina sativa]
 ref|XP_010489140.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X1 [Camelina sativa]
 ref|XP_010489157.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X1 [Camelina sativa]
 ref|XP_010489164.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X1 [Camelina sativa]
 ref|XP_010489172.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X1 [Camelina sativa]
Length=1208

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 67/125 (54%), Gaps = 7/125 (6%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGTEL   CVKDE+ D+ ++PPGFES A+FTL+++         +    E      + + 
Sbjct  1    MGTELMRICVKDESDDLPSVPPGFESYATFTLKRLPPGSSD-KAMPPPIETVPVTEQPKM  59

Query  350  DLEGVEDAKLKSIRR-RPCMNY-----GQVENSSGDESDSEQKVSFRPQLPKGVIRGCEE  511
            ++E  E     S+RR RP +N          +++  +   +Q     P LPKGV+RGCEE
Sbjct  60   EIESDESKAAPSLRRIRPWINIDDDDDVANNDNAASQQHLDQNSVVEPSLPKGVVRGCEE  119

Query  512  CVNCQ  526
            C +CQ
Sbjct  120  CKDCQ  124



>ref|XP_009391986.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009391994.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=1294

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 63/125 (50%), Gaps = 29/125 (23%)
 Frame = +2

Query  185  FSHCVKDETID-MSTIPPGFESLASFTLEKVKDNEK-------KTNCLASSSEMQLQRAK  340
            FS     + ID +  +PPGF SL SFTL++V+D  K       + +C+ S          
Sbjct  81   FSSAHVSKAIDGIPPVPPGFSSLTSFTLKRVQDGVKASANASCRVHCMIS----------  130

Query  341  VEPDLEGVEDAKLKSIRRRPCMNYGQVENSSGDESDSE---QKVSFRPQLPKGVIRGCEE  511
                    ++   K++R RP +NY + +N SG E D E   Q +   P LPKGVIRGC E
Sbjct  131  --------DEKSRKNLRYRPWVNYSEFDNGSGKECDYEAFEQDIPSTPCLPKGVIRGCTE  182

Query  512  CVNCQ  526
            C  CQ
Sbjct  183  CKTCQ  187



>ref|XP_009392003.1| PREDICTED: lysine-specific demethylase JMJ703-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=1191

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 63/125 (50%), Gaps = 29/125 (23%)
 Frame = +2

Query  185  FSHCVKDETID-MSTIPPGFESLASFTLEKVKDNEK-------KTNCLASSSEMQLQRAK  340
            FS     + ID +  +PPGF SL SFTL++V+D  K       + +C+ S          
Sbjct  81   FSSAHVSKAIDGIPPVPPGFSSLTSFTLKRVQDGVKASANASCRVHCMIS----------  130

Query  341  VEPDLEGVEDAKLKSIRRRPCMNYGQVENSSGDESDSE---QKVSFRPQLPKGVIRGCEE  511
                    ++   K++R RP +NY + +N SG E D E   Q +   P LPKGVIRGC E
Sbjct  131  --------DEKSRKNLRYRPWVNYSEFDNGSGKECDYEAFEQDIPSTPCLPKGVIRGCTE  182

Query  512  CVNCQ  526
            C  CQ
Sbjct  183  CKTCQ  187



>ref|XP_009392011.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=1128

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 63/125 (50%), Gaps = 29/125 (23%)
 Frame = +2

Query  185  FSHCVKDETID-MSTIPPGFESLASFTLEKVKDNEK-------KTNCLASSSEMQLQRAK  340
            FS     + ID +  +PPGF SL SFTL++V+D  K       + +C+ S          
Sbjct  81   FSSAHVSKAIDGIPPVPPGFSSLTSFTLKRVQDGVKASANASCRVHCMIS----------  130

Query  341  VEPDLEGVEDAKLKSIRRRPCMNYGQVENSSGDESDSE---QKVSFRPQLPKGVIRGCEE  511
                    ++   K++R RP +NY + +N SG E D E   Q +   P LPKGVIRGC E
Sbjct  131  --------DEKSRKNLRYRPWVNYSEFDNGSGKECDYEAFEQDIPSTPCLPKGVIRGCTE  182

Query  512  CVNCQ  526
            C  CQ
Sbjct  183  CKTCQ  187



>ref|XP_009803913.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Nicotiana 
sylvestris]
 ref|XP_009803914.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Nicotiana 
sylvestris]
Length=786

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 60/103 (58%), Gaps = 2/103 (2%)
 Frame = +2

Query  224  TIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEPDLEGVEDAKLK-SIRRRP  400
            ++PPGFESL SFTL+KVK++E+  N +A  S      + V      +   KLK S+R RP
Sbjct  19   SVPPGFESLMSFTLKKVKNSEEACNSVALGSGFAQGPSLVAATSTIISTGKLKSSVRHRP  78

Query  401  CMNYGQVENSSGD-ESDSEQKVSFRPQLPKGVIRGCEECVNCQ  526
             +    V++   D E + ++ +S    LPKGVIRGC  C NCQ
Sbjct  79   WILDDHVDHIEDDSEFEDDKSLSSSAFLPKGVIRGCSSCHNCQ  121



>ref|XP_010553772.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X2 [Tarenaya hassleriana]
Length=1171

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 75/133 (56%), Gaps = 16/133 (12%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNC------LASSSEMQLQ  331
            MGTEL   CVK+ET ++ ++PPGFES +S TL++V    +KT        L + + +  +
Sbjct  1    MGTELMRVCVKEETDELPSVPPGFESYSSLTLQRVAPGGEKTKINNVTCGLPAGNALATE  60

Query  332  RAKVEPDLEGVEDAK-LKSIRRRPCMNYGQVENSSGDESDS-------EQKVSFRPQLPK  487
            R K E      + +K  +  RRRP +NY  V     D+++S       +Q V  +P LPK
Sbjct  61   RVKTETGSNLSDTSKPARPPRRRPWINY--VGCDDDDDANSKPMCQKLDQNVIAKPSLPK  118

Query  488  GVIRGCEECVNCQ  526
            GVIRGC EC +CQ
Sbjct  119  GVIRGCAECPDCQ  131



>emb|CDP03753.1| unnamed protein product [Coffea canephora]
Length=773

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 67/113 (59%), Gaps = 8/113 (7%)
 Frame = +2

Query  203  DETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKV--EPDLEGVEDAK  376
            ++ ++  ++PPGF SL+SFTL+ +  NE   + +A     Q + + V   P ++ +  A 
Sbjct  10   NDKVEKLSVPPGFVSLSSFTLKNLSSNEVACSSMAVGDAFQTELSPVGFTPTMDNI--AM  67

Query  377  LKS-IRRRPCMNYGQVENSSGDESDSEQKVSF--RPQLPKGVIRGCEECVNCQ  526
             KS +  RP + Y Q +  S +ESDSE +++F  R  LPKGV+RGC  C NCQ
Sbjct  68   FKSNLSHRPWILYNQFDYKS-NESDSELEMNFPLRACLPKGVVRGCSSCPNCQ  119



>ref|XP_006443821.1| hypothetical protein CICLE_v10018924mg [Citrus clementina]
 ref|XP_006443822.1| hypothetical protein CICLE_v10018924mg [Citrus clementina]
 ref|XP_006479522.1| PREDICTED: probable lysine-specific demethylase JMJ14-like isoform 
X1 [Citrus sinensis]
 ref|XP_006479523.1| PREDICTED: probable lysine-specific demethylase JMJ14-like isoform 
X2 [Citrus sinensis]
 ref|XP_006479524.1| PREDICTED: probable lysine-specific demethylase JMJ14-like isoform 
X3 [Citrus sinensis]
 ref|XP_006479525.1| PREDICTED: probable lysine-specific demethylase JMJ14-like isoform 
X4 [Citrus sinensis]
 ref|XP_006479526.1| PREDICTED: probable lysine-specific demethylase JMJ14-like isoform 
X5 [Citrus sinensis]
 gb|ESR57061.1| hypothetical protein CICLE_v10018924mg [Citrus clementina]
 gb|ESR57062.1| hypothetical protein CICLE_v10018924mg [Citrus clementina]
Length=789

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 69/123 (56%), Gaps = 7/123 (6%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTN--CLASSSEMQLQRAKV  343
            MGT+     + +E +D  + PPGF SL SF L+KV+++E+  N    AS+S  +      
Sbjct  1    MGTKRMRANLGNEDLDKLSAPPGFMSLTSFLLKKVENSEESCNSVAFASASAQEPVCTNA  60

Query  344  EPDLEGVEDAKLKSIRRRPCMNYGQVENSSGDESDSEQKV---SFRPQLPKGVIRGCEEC  514
              D+     +K +S R RP + Y Q +N+   ES+ EQ V   S R  LPKGVIRGC +C
Sbjct  61   PSDMVDAGTSK-RSPRNRPWILYEQSDNNQ-KESNFEQPVEELSSRATLPKGVIRGCPDC  118

Query  515  VNC  523
             NC
Sbjct  119  SNC  121



>ref|XP_009420230.1| PREDICTED: lysine-specific demethylase JMJ703-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009420302.1| PREDICTED: lysine-specific demethylase JMJ703-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009420382.1| PREDICTED: lysine-specific demethylase JMJ703-like [Musa acuminata 
subsp. malaccensis]
Length=1295

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 63/141 (45%), Gaps = 22/141 (16%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MG E     +KD+   +  +PPGF  +  F L+KV  + K     +   E  ++      
Sbjct  1    MGAECIGSQIKDDLDGIPPVPPGFAPITLFNLQKVHSDLKAPANASDMIECIVRVDNSRN  60

Query  350  DLEGVED-------------------AKLKSIRRRPCMNYGQVENSSGDESDSEQKVSFR  472
             LE V+D                      KS+R RP +NY Q +NSS +ESD E      
Sbjct  61   TLENVQDDVKDIINPSDPVQCTIRDEKSRKSLRHRPSVNYRQFDNSSDEESDYEPFERAV  120

Query  473  PQ---LPKGVIRGCEECVNCQ  526
            P    LPKGV RGC EC NCQ
Sbjct  121  PSVRCLPKGVFRGCSECENCQ  141



>gb|EYU33161.1| hypothetical protein MIMGU_mgv1a000700mg [Erythranthe guttata]
Length=1012

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 65/120 (54%), Gaps = 10/120 (8%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGTE     VK++ I + +IP GF+S   FT  K  D  +     +S S  Q Q++ +E 
Sbjct  1    MGTEFVGPFVKEDNIKIPSIPLGFDSRVPFT-RKRPDGNQLNKYSSSGSASQTQKSCLET  59

Query  350  DLEGVEDAKL-KSIRRRPCMNYGQVENSSGDESDSEQKVSFRPQLPKGVIRGCEECVNCQ  526
            + +   D+K  KS+R RP       E+S  D+  SEQ  S    LPKGVIRGCE C NCQ
Sbjct  60   EYDCNNDSKTAKSLRHRP------RESSFDDDVKSEQFGS--NWLPKGVIRGCESCDNCQ  111



>ref|XP_002454748.1| hypothetical protein SORBIDRAFT_04g036630 [Sorghum bicolor]
 gb|EES07724.1| hypothetical protein SORBIDRAFT_04g036630 [Sorghum bicolor]
Length=1221

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 60/124 (48%), Gaps = 26/124 (21%)
 Frame = +2

Query  224  TIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEPDLEGVEDAKL--------  379
            +IPPGF    +  L+ ++DN K  +  A SS  Q  + K E D++ VE            
Sbjct  18   SIPPGFGPFVALALQGIRDNVKSGD--AHSSSAQAVQCK-EKDVDIVEHGSANSRSGTPA  74

Query  380  ---------KSIRRRPCMNYGQVENSSGDESDSEQ------KVSFRPQLPKGVIRGCEEC  514
                     +S+R RP ++Y Q +    DESD E        V  R QLPKGV+RGC EC
Sbjct  75   STSGTHSCRRSLRNRPPIDYSQFDLIWDDESDVESAEKGVGSVRHRRQLPKGVLRGCAEC  134

Query  515  VNCQ  526
             +CQ
Sbjct  135  ADCQ  138



>gb|KJB72100.1| hypothetical protein B456_011G159200 [Gossypium raimondii]
Length=146

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 57/96 (59%), Gaps = 6/96 (6%)
 Frame = +2

Query  179  ELFSHCVKDETIDMSTIPPGFESLASFTLE-KVKDNEKKTN-----CLASSSEMQLQRAK  340
            EL   C++++  D+S++PPGFE  A FTL+ K +D ++        C AS+  + +++  
Sbjct  2    ELVRVCLEEKNDDISSVPPGFEPRALFTLKSKAQDTKRHERDNLICCSASTRAILVEKGT  61

Query  341  VEPDLEGVEDAKLKSIRRRPCMNYGQVENSSGDESD  448
               + E  +  +  S+RRRP +NYGQ +NSS DE D
Sbjct  62   GLANDESSKITRSMSMRRRPWINYGQYDNSSEDEPD  97



>gb|KJB82261.1| hypothetical protein B456_013G185400 [Gossypium raimondii]
Length=174

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 60/105 (57%), Gaps = 8/105 (8%)
 Frame = +2

Query  179  ELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTN------CLASSSEMQLQRAK  340
            EL   C++++  D+S++PPGFE  A FTL+    + K+        C AS+  + +++  
Sbjct  2    ELVRVCLEEKNDDISSVPPGFEPRALFTLKSEAQDTKRHERDNLICCSASTRAILVEKGT  61

Query  341  VEPDLEGVEDAKLKSIRRRPCMNYGQVENSSGDESDSEQ--KVSF  469
               + E  +  +  S+RRRP +NYGQ +NSS DE D  +  +VSF
Sbjct  62   GLANDESSKITRSMSMRRRPWINYGQYDNSSEDEPDHGKLNQVSF  106



>gb|EPS64275.1| hypothetical protein M569_10506, partial [Genlisea aurea]
Length=1153

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 55/98 (56%), Gaps = 7/98 (7%)
 Frame = +2

Query  221  STIPPGFESLASFTLEKVKDNEKKT--NCLASSSEMQLQRAKVEPDLEGVEDAKLKSIRR  394
            STIPPGFESL    L+K ++N+  +  + +  S    L+ A    D        +K++R 
Sbjct  1    STIPPGFESLVPINLKKAENNKFSSPASSIVDSVSHMLETASNSKD-----STMMKTLRL  55

Query  395  RPCMNYGQVENSSGDESDSEQKVSFRPQLPKGVIRGCE  508
               M     +NSSGDE +S+Q  + R +LPKGVIRGCE
Sbjct  56   HRGMKSSPCDNSSGDEYESDQLSASRNRLPKGVIRGCE  93



>ref|XP_008679195.1| PREDICTED: LOW QUALITY PROTEIN: probable lysine-specific demethylase 
JMJ14 [Zea mays]
Length=1272

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 62/125 (50%), Gaps = 28/125 (22%)
 Frame = +2

Query  224  TIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAK-VEPDLEGVEDAKL-------  379
            +IPPGF    +  L+ +++N K  +  +SS+    Q A  +E D+E +E           
Sbjct  63   SIPPGFGPFVALALQGIQNNAKSADAHSSSA----QAAHCMEKDVEVLEHGSAHGWSDTP  118

Query  380  ----------KSIRRRPCMNYGQVENSSGDESDSEQK------VSFRPQLPKGVIRGCEE  511
                      +S+R RP ++Y Q +  S +ESD E        V  R QLPKGV+RGC +
Sbjct  119  ASTSGTHSCRRSLRNRPPIDYSQFDLISDEESDVESAEKGVGLVRHRRQLPKGVLRGCAQ  178

Query  512  CVNCQ  526
            C +CQ
Sbjct  179  CADCQ  183



>gb|AFW64061.1| hypothetical protein ZEAMMB73_080311 [Zea mays]
Length=1232

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 62/125 (50%), Gaps = 28/125 (22%)
 Frame = +2

Query  224  TIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAK-VEPDLEGVEDAKL-------  379
            +IPPGF    +  L+ +++N K  +  +SS+    Q A  +E D+E +E           
Sbjct  48   SIPPGFGPFVALALQGIQNNAKSADAHSSSA----QAAHCMEKDVEVLEHGSAHGWSDTP  103

Query  380  ----------KSIRRRPCMNYGQVENSSGDESDSEQK------VSFRPQLPKGVIRGCEE  511
                      +S+R RP ++Y Q +  S +ESD E        V  R QLPKGV+RGC +
Sbjct  104  ASTSGTHSCRRSLRNRPPIDYSQFDLISDEESDVESAEKGVGLVRHRRQLPKGVLRGCAQ  163

Query  512  CVNCQ  526
            C +CQ
Sbjct  164  CADCQ  168



>gb|KJB82296.1| hypothetical protein B456_013G187600 [Gossypium raimondii]
Length=1157

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 62/110 (56%), Gaps = 10/110 (9%)
 Frame = +2

Query  179  ELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTN------CLASSSEMQLQRAK  340
            EL   C++++  D+S++PPGFE  ASFTL+    + K+        C AS+  + +++  
Sbjct  2    ELVRVCLEEKNDDISSVPPGFEPRASFTLKTEAQDTKRHERDNLICCSASTRAILVEKGT  61

Query  341  VEPDLEGVEDAKLKSIRRRPCMNYGQVENSSGDESD----SEQKVSFRPQ  478
               + E  +  +  S+RRRP +NYGQ +NSS DE D    ++    +RP+
Sbjct  62   GLANDESSKITRSMSMRRRPWINYGQYDNSSEDEPDHGKLNQVTARWRPE  111



>gb|KJB82295.1| hypothetical protein B456_013G187600 [Gossypium raimondii]
Length=1179

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 56/96 (58%), Gaps = 6/96 (6%)
 Frame = +2

Query  179  ELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTN------CLASSSEMQLQRAK  340
            EL   C++++  D+S++PPGFE  ASFTL+    + K+        C AS+  + +++  
Sbjct  2    ELVRVCLEEKNDDISSVPPGFEPRASFTLKTEAQDTKRHERDNLICCSASTRAILVEKGT  61

Query  341  VEPDLEGVEDAKLKSIRRRPCMNYGQVENSSGDESD  448
               + E  +  +  S+RRRP +NYGQ +NSS DE D
Sbjct  62   GLANDESSKITRSMSMRRRPWINYGQYDNSSEDEPD  97



>ref|XP_008677535.1| PREDICTED: uncharacterized protein LOC100381880 isoform X2 [Zea 
mays]
Length=1247

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 62/125 (50%), Gaps = 28/125 (22%)
 Frame = +2

Query  224  TIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAK-VEPDLEGVEDAKL-------  379
            +IPPGF    +  L+ +++N K  +  +SS+    Q A  +E D+E +E           
Sbjct  48   SIPPGFGPFVALALQGIQNNAKSADAHSSSA----QAAHCMEKDVEVLEHGSAHGWSDTP  103

Query  380  ----------KSIRRRPCMNYGQVENSSGDESDSEQK------VSFRPQLPKGVIRGCEE  511
                      +S+R RP ++Y Q +  S +ESD E        V  R QLPKGV+RGC +
Sbjct  104  ASTSGTHSCRRSLRNRPPIDYSQFDLISDEESDVESAEKGVGLVRRRRQLPKGVLRGCAQ  163

Query  512  CVNCQ  526
            C +CQ
Sbjct  164  CADCQ  168



>ref|XP_008679190.1| PREDICTED: probable lysine-specific demethylase JMJ14 isoform 
X1 [Zea mays]
Length=1272

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 62/125 (50%), Gaps = 28/125 (22%)
 Frame = +2

Query  224  TIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAK-VEPDLEGVEDAKL-------  379
            +IPPGF    +  L+ +++N K  +  +SS+    Q A  +E D+E +E           
Sbjct  63   SIPPGFGPFVALALQGIQNNAKSADAHSSSA----QAAHCMEKDVEVLEHGSAHGWSDTP  118

Query  380  ----------KSIRRRPCMNYGQVENSSGDESDSEQK------VSFRPQLPKGVIRGCEE  511
                      +S+R RP ++Y Q +  S +ESD E        V  R QLPKGV+RGC +
Sbjct  119  ASTSGTHSCRRSLRNRPPIDYSQFDLISDEESDVESAEKGVGLVRRRRQLPKGVLRGCAQ  178

Query  512  CVNCQ  526
            C +CQ
Sbjct  179  CADCQ  183



>ref|XP_008677534.1| PREDICTED: uncharacterized protein LOC100381880 isoform X1 [Zea 
mays]
Length=1262

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 62/125 (50%), Gaps = 28/125 (22%)
 Frame = +2

Query  224  TIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAK-VEPDLEGVEDAKL-------  379
            +IPPGF    +  L+ +++N K  +  +SS+    Q A  +E D+E +E           
Sbjct  63   SIPPGFGPFVALALQGIQNNAKSADAHSSSA----QAAHCMEKDVEVLEHGSAHGWSDTP  118

Query  380  ----------KSIRRRPCMNYGQVENSSGDESDSEQK------VSFRPQLPKGVIRGCEE  511
                      +S+R RP ++Y Q +  S +ESD E        V  R QLPKGV+RGC +
Sbjct  119  ASTSGTHSCRRSLRNRPPIDYSQFDLISDEESDVESAEKGVGLVRRRRQLPKGVLRGCAQ  178

Query  512  CVNCQ  526
            C +CQ
Sbjct  179  CADCQ  183



>ref|XP_008679191.1| PREDICTED: probable lysine-specific demethylase JMJ14 isoform 
X2 [Zea mays]
 gb|AFW64058.1| hypothetical protein ZEAMMB73_612811 [Zea mays]
Length=1257

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 62/125 (50%), Gaps = 28/125 (22%)
 Frame = +2

Query  224  TIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAK-VEPDLEGVEDAKL-------  379
            +IPPGF    +  L+ +++N K  +  +SS+    Q A  +E D+E +E           
Sbjct  48   SIPPGFGPFVALALQGIQNNAKSADAHSSSA----QAAHCMEKDVEVLEHGSAHGWSDTP  103

Query  380  ----------KSIRRRPCMNYGQVENSSGDESDSEQK------VSFRPQLPKGVIRGCEE  511
                      +S+R RP ++Y Q +  S +ESD E        V  R QLPKGV+RGC +
Sbjct  104  ASTSGTHSCRRSLRNRPPIDYSQFDLISDEESDVESAEKGVGLVRRRRQLPKGVLRGCAQ  163

Query  512  CVNCQ  526
            C +CQ
Sbjct  164  CADCQ  168



>ref|XP_003567797.1| PREDICTED: lysine-specific demethylase JMJ703 [Brachypodium distachyon]
Length=1237

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 44/142 (31%), Positives = 70/142 (49%), Gaps = 24/142 (17%)
 Frame = +2

Query  167  IMGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASS------SEMQL  328
            +MGTE  +  + ++     +IPPGF   A+  L+ ++ + K  +  +SS      SE  +
Sbjct  1    MMGTECITASLGEDP--EPSIPPGFGPFAALALQGIQKDVKPADAHSSSVHVFQSSEKHV  58

Query  329  QRAKVEPDLEGVEDAKL----------KSIRRRPCMNYGQVENSSGDESDSE------QK  460
            +  + +P      +  L          KS+R RP ++Y + +N S ++SD E        
Sbjct  59   ESLECQPYSAQSRNDTLCSTSGSHTCRKSLRNRPPIDYSRFDNISDEDSDVEVAEKGVTS  118

Query  461  VSFRPQLPKGVIRGCEECVNCQ  526
            V  R QLPKGVIRGC  C +CQ
Sbjct  119  VRRRQQLPKGVIRGCAACSDCQ  140



>gb|AFW64059.1| hypothetical protein ZEAMMB73_612811 [Zea mays]
Length=465

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 62/125 (50%), Gaps = 28/125 (22%)
 Frame = +2

Query  224  TIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAK-VEPDLEGVEDAKL-------  379
            +IPPGF    +  L+ +++N K  +  +SS+    Q A  +E D+E +E           
Sbjct  48   SIPPGFGPFVALALQGIQNNAKSADAHSSSA----QAAHCMEKDVEVLEHGSAHGWSDTP  103

Query  380  ----------KSIRRRPCMNYGQVENSSGDESDSEQK------VSFRPQLPKGVIRGCEE  511
                      +S+R RP ++Y Q +  S +ESD E        V  R QLPKGV+RGC +
Sbjct  104  ASTSGTHSCRRSLRNRPPIDYSQFDLISDEESDVESAEKGVGLVRRRRQLPKGVLRGCAQ  163

Query  512  CVNCQ  526
            C +CQ
Sbjct  164  CADCQ  168



>gb|AFW64065.1| hypothetical protein ZEAMMB73_911522 [Zea mays]
Length=465

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 62/125 (50%), Gaps = 28/125 (22%)
 Frame = +2

Query  224  TIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAK-VEPDLEGVEDAKL-------  379
            +IPPGF    +  L+ +++N K  +  +SS+    Q A  +E D+E +E           
Sbjct  48   SIPPGFGPFVALALQGIQNNAKSADAHSSSA----QAAHCMEKDVEVLEHGSAHGWSDTP  103

Query  380  ----------KSIRRRPCMNYGQVENSSGDESDSEQK------VSFRPQLPKGVIRGCEE  511
                      +S+R RP ++Y Q +  S +ESD E        V  R QLPKGV+RGC +
Sbjct  104  ASTSGTHSCRRSLRNRPPIDYSQFDLISDEESDVESAEKGVGLVRRRRQLPKGVLRGCAQ  163

Query  512  CVNCQ  526
            C +CQ
Sbjct  164  CADCQ  168



>ref|XP_010652383.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X4 [Vitis vinifera]
Length=877

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 59/106 (56%), Gaps = 3/106 (3%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MG E  S C     +D  ++PPGF SL SFTL++++D+E+  N +A  S  Q   A ++ 
Sbjct  4    MGQEYVSICSTGNQVDDLSVPPGFASLTSFTLKRMEDSEETCNSMAFGSAFQPDPANMDA  63

Query  350  DLEGVEDAKLK-SIRRRPCMNYGQVENSSGDESDSEQKVS--FRPQ  478
              + ++ A+ K S+R RP + Y Q ++   D    +  VS  +RP+
Sbjct  64   ACDPIDIAEFKRSLRHRPWILYDQCDHEEEDSDPKQIDVSARWRPE  109



>gb|AFW64064.1| hypothetical protein ZEAMMB73_911522 [Zea mays]
Length=785

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 62/125 (50%), Gaps = 28/125 (22%)
 Frame = +2

Query  224  TIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAK-VEPDLEGVEDAKL-------  379
            +IPPGF    +  L+ +++N K  +  +SS+    Q A  +E D+E +E           
Sbjct  48   SIPPGFGPFVALALQGIQNNAKSADAHSSSA----QAAHCMEKDVEVLEHGSAHGWSDTP  103

Query  380  ----------KSIRRRPCMNYGQVENSSGDESDSEQK------VSFRPQLPKGVIRGCEE  511
                      +S+R RP ++Y Q +  S +ESD E        V  R QLPKGV+RGC +
Sbjct  104  ASTSGTHSCRRSLRNRPPIDYSQFDLISDEESDVESAEKGVGLVRRRRQLPKGVLRGCAQ  163

Query  512  CVNCQ  526
            C +CQ
Sbjct  164  CADCQ  168



>gb|AFW64063.1| hypothetical protein ZEAMMB73_354748 [Zea mays]
Length=502

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 61/124 (49%), Gaps = 26/124 (21%)
 Frame = +2

Query  224  TIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEPDLEGVEDAKL--------  379
            +IPPGF    +  L+ +++N K  +  +SS++       +E D+E +E            
Sbjct  172  SIPPGFGPFVALALQGIQNNAKSADAHSSSAQAA---HCMEKDVEVLEHGSAHGWSDTPA  228

Query  380  ---------KSIRRRPCMNYGQVENSSGDESDSEQK------VSFRPQLPKGVIRGCEEC  514
                     +S+R RP ++Y Q +  S +ESD E        V  R QLPKGV+RGC +C
Sbjct  229  STSGTHSCRRSLRNRPPIDYSQFDLISDEESDVESAEKGVGLVRRRRQLPKGVLRGCAQC  288

Query  515  VNCQ  526
             +CQ
Sbjct  289  ADCQ  292



>ref|XP_010652382.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X3 [Vitis vinifera]
Length=878

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 57/98 (58%), Gaps = 4/98 (4%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MG E  S C     +D  ++PPGF SL SFTL++++D+E+  N +A  S  Q   A ++ 
Sbjct  4    MGQEYVSICSTGNQVDDLSVPPGFASLTSFTLKRMEDSEETCNSMAFGSAFQPDPANMDA  63

Query  350  DLEGVEDAKLK-SIRRRPCMNYGQVENSSGDESDSEQK  460
              + ++ A+ K S+R RP + Y Q ++   +E DS+ K
Sbjct  64   ACDPIDIAEFKRSLRHRPWILYDQCDH---EEEDSDPK  98



>ref|XP_006654139.1| PREDICTED: probable lysine-specific demethylase JMJ14-like [Oryza 
brachyantha]
Length=1238

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 69/139 (50%), Gaps = 21/139 (15%)
 Frame = +2

Query  167  IMGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASS-----------  313
            +MGTE  +  + ++  +  +IPPGF   A+  L ++  + K  +  ++S           
Sbjct  1    MMGTECITATLNED--NEPSIPPGFGPFAALPLWEIHTDAKPADTHSTSVQAIQGIRTES  58

Query  314  SEMQLQRAKVEPDL---EGVEDAKLKSIRRRPCMNYGQVENSSGDESDSE---QKVSF--  469
             E Q   A    D      V     KS+R RP ++Y + E+ S ++SD E   + VS   
Sbjct  59   EEFQSSSAASRSDTPCSTSVSQTCRKSLRNRPPIDYSRFEHISDEDSDVEIVEKDVSSTR  118

Query  470  RPQLPKGVIRGCEECVNCQ  526
            R QLPKGV+RGC EC +CQ
Sbjct  119  RRQLPKGVLRGCAECSDCQ  137



>ref|XP_011080061.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X3 [Sesamum indicum]
Length=573

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 65/120 (54%), Gaps = 4/120 (3%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGT+     V D T +  ++PPGF SL SFTL++   +++  + +A + E   +   +  
Sbjct  1    MGTKRSISYVTDNTEENLSVPPGFVSLTSFTLKRKVTDQEAADPMAVAGES--RSVLISG  58

Query  350  DLEGVEDAKLK-SIRRRPCMNYGQV-ENSSGDESDSEQKVSFRPQLPKGVIRGCEECVNC  523
             L  V+  KLK S  ++P + + QV +    +E++ E K      LPKGVIRGC  C +C
Sbjct  59   PLSNVDIEKLKTSFTQKPWICHDQVPQKYDCEETEVEMKDPISAFLPKGVIRGCANCNDC  118



>ref|XP_011080056.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X1 [Sesamum indicum]
 ref|XP_011080057.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X1 [Sesamum indicum]
 ref|XP_011080058.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X1 [Sesamum indicum]
 ref|XP_011080059.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X1 [Sesamum indicum]
Length=809

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 65/120 (54%), Gaps = 4/120 (3%)
 Frame = +2

Query  170  MGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEP  349
            MGT+     V D T +  ++PPGF SL SFTL++   +++  + +A + E   +   +  
Sbjct  1    MGTKRSISYVTDNTEENLSVPPGFVSLTSFTLKRKVTDQEAADPMAVAGES--RSVLISG  58

Query  350  DLEGVEDAKLK-SIRRRPCMNYGQV-ENSSGDESDSEQKVSFRPQLPKGVIRGCEECVNC  523
             L  V+  KLK S  ++P + + QV +    +E++ E K      LPKGVIRGC  C +C
Sbjct  59   PLSNVDIEKLKTSFTQKPWICHDQVPQKYDCEETEVEMKDPISAFLPKGVIRGCANCNDC  118



>gb|KJB76741.1| hypothetical protein B456_012G104500 [Gossypium raimondii]
Length=175

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 60/110 (55%), Gaps = 10/110 (9%)
 Frame = +2

Query  179  ELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTN------CLASSSEMQLQRAK  340
            EL   C++++  D+S++PPGFE  A FTL+    + K+        C AS+  + +++  
Sbjct  2    ELVRVCLEEKNDDISSVPPGFEPRALFTLKSEAQDTKRHERDNLICCSASARVILVEKGT  61

Query  341  VEPDLEGVEDAKLKSIRRRPCMNYGQVENSSGDESD----SEQKVSFRPQ  478
               + E  +     S+RRRP +NYGQ +NSS DE +    ++    +RP+
Sbjct  62   GLANDESSKITMSMSMRRRPWINYGQYDNSSEDEPNHGKLNQVTARWRPE  111



>gb|KJB76742.1| hypothetical protein B456_012G104500 [Gossypium raimondii]
Length=197

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 53/94 (56%), Gaps = 6/94 (6%)
 Frame = +2

Query  179  ELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTN------CLASSSEMQLQRAK  340
            EL   C++++  D+S++PPGFE  A FTL+    + K+        C AS+  + +++  
Sbjct  2    ELVRVCLEEKNDDISSVPPGFEPRALFTLKSEAQDTKRHERDNLICCSASARVILVEKGT  61

Query  341  VEPDLEGVEDAKLKSIRRRPCMNYGQVENSSGDE  442
               + E  +     S+RRRP +NYGQ +NSS DE
Sbjct  62   GLANDESSKITMSMSMRRRPWINYGQYDNSSEDE  95



>ref|XP_006857306.1| hypothetical protein AMTR_s00067p00062020 [Amborella trichopoda]
 gb|ERN18773.1| hypothetical protein AMTR_s00067p00062020 [Amborella trichopoda]
Length=1275

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 54/100 (54%), Gaps = 11/100 (11%)
 Frame = +2

Query  245  SLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEPDLEGVEDAKL---KSIRRRPCMNYG  415
            S  SFTL+++ D       + +S+  Q+       D +   D  +   +S+RRR  +NYG
Sbjct  21   SCTSFTLKRIHDPMSSVQSMDASALPQIHM-----DGQSCADDDIDISRSLRRRTSVNYG  75

Query  416  QVENSSGDESDSEQKVSFRPQ---LPKGVIRGCEECVNCQ  526
              + SSG+ESD+E+ +  +     LPKGV RGC  C +CQ
Sbjct  76   MFDGSSGEESDTEEFIKVQSSQRCLPKGVTRGCINCTDCQ  115



>ref|XP_011028819.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X1 [Populus euphratica]
 ref|XP_011028820.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X1 [Populus euphratica]
 ref|XP_011028821.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X1 [Populus euphratica]
 ref|XP_011028822.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X1 [Populus euphratica]
Length=805

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 64/113 (57%), Gaps = 5/113 (4%)
 Frame = +2

Query  197  VKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEPDLEGVEDAK  376
            +++E  +  ++PPGF SL SF L+KV+ + +  N   S+S  + +  +++   + ++ A 
Sbjct  10   LRNENAEKLSVPPGFASLTSFRLKKVETSVQNGNSTPSTSVSKGKTIQMDDTTDMIDVAT  69

Query  377  LKSI-RRRPCMNYGQVENSSGDESDSEQ---KVSFRPQLPKGVIRGCEECVNC  523
            LK   + RP + +GQ +N +  ES+ EQ    +     LPKGV  GC +C NC
Sbjct  70   LKRFFQHRPSILHGQ-KNQNLVESNFEQVDMDIPSETSLPKGVAYGCADCSNC  121



>ref|XP_011028823.1| PREDICTED: putative lysine-specific demethylase JMJ16 isoform 
X2 [Populus euphratica]
Length=770

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 64/113 (57%), Gaps = 5/113 (4%)
 Frame = +2

Query  197  VKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEPDLEGVEDAK  376
            +++E  +  ++PPGF SL SF L+KV+ + +  N   S+S  + +  +++   + ++ A 
Sbjct  10   LRNENAEKLSVPPGFASLTSFRLKKVETSVQNGNSTPSTSVSKGKTIQMDDTTDMIDVAT  69

Query  377  LKSI-RRRPCMNYGQVENSSGDESDSEQ---KVSFRPQLPKGVIRGCEECVNC  523
            LK   + RP + +GQ +N +  ES+ EQ    +     LPKGV  GC +C NC
Sbjct  70   LKRFFQHRPSILHGQ-KNQNLVESNFEQVDMDIPSETSLPKGVAYGCADCSNC  121



>ref|XP_004954297.1| PREDICTED: probable lysine-specific demethylase JMJ14-like isoform 
X1 [Setaria italica]
 ref|XP_004954298.1| PREDICTED: probable lysine-specific demethylase JMJ14-like isoform 
X2 [Setaria italica]
Length=1237

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 66/143 (46%), Gaps = 28/143 (20%)
 Frame = +2

Query  167  IMGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVE  346
            IMGTE     +  +     + PPGFE      L  ++D+ K  +  +SS ++       E
Sbjct  27   IMGTECIMATLNADP--EPSFPPGFEPFIDLALRGIQDDAKPDDTHSSSVQVV---QSTE  81

Query  347  PDLEGVEDAKL-----------------KSIRRRPCMNYGQVENSSGDESDSE------Q  457
             D+E +E +                   KS+R RP ++Y   +  S +ES+ E      +
Sbjct  82   KDVEILEPSSAHCRSGTPASTSGSHGCRKSLRNRPPIDYSLFDLISDEESEVELAEKGVR  141

Query  458  KVSFRPQLPKGVIRGCEECVNCQ  526
             +  R QLPKGV+RGC EC +CQ
Sbjct  142  PMRRRQQLPKGVLRGCAECADCQ  164



>gb|AFW76914.1| hypothetical protein ZEAMMB73_798608 [Zea mays]
Length=1187

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 70/145 (48%), Gaps = 30/145 (21%)
 Frame = +2

Query  167  IMGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVE  346
            +MG E  +  V ++     +IPPGF   A+     ++++ K  +   SSS + LQ   ++
Sbjct  1    MMGIEGIAATVTEDP--EPSIPPGFGPFAASASWGIQNDVKPADD-HSSSVLALQ--SID  55

Query  347  PDLEGVE-------------------DAKLKSIRRRPCMNYGQVENSSGDESDSE-----  454
             D+E +E                   +   KS+R RP ++Y + +  + ++SD+E     
Sbjct  56   DDVEILEYLSSSVDHQSDTGCCISGSNTCRKSLRNRPPIDYSRFDQIADEDSDAEVADKG  115

Query  455  -QKVSFRPQLPKGVIRGCEECVNCQ  526
               V  R Q PKGV+RGC EC NCQ
Sbjct  116  VNAVKHRQQFPKGVLRGCPECANCQ  140



>ref|XP_004965199.1| PREDICTED: probable lysine-specific demethylase JMJ14-like [Setaria 
italica]
Length=1262

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 67/145 (46%), Gaps = 30/145 (21%)
 Frame = +2

Query  167  IMGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVE  346
            +MGTE  +  V ++     +IPPGF    +      +D+ K  +   SS  + LQ   V+
Sbjct  1    MMGTEGIAATVIEDP--EPSIPPGFGPFVASASWATQDDIKPVDA-HSSPVVALQ--SVD  55

Query  347  PDLEGVE-------------------DAKLKSIRRRPCMNYGQVENSSGDESDSE-----  454
             D+E +E                   D   KS+R RP ++Y + +  + D+SD+E     
Sbjct  56   NDVEILEYLSSSVNRQSDTTCSTSGSDTCRKSLRNRPPIDYSRFDLVADDDSDAEVAEKG  115

Query  455  -QKVSFRPQLPKGVIRGCEECVNCQ  526
                  R Q PKGV+RGC +C NCQ
Sbjct  116  ASSARHRQQFPKGVLRGCPDCANCQ  140



>gb|AFW76913.1| hypothetical protein ZEAMMB73_798608 [Zea mays]
 gb|AIB05479.1| Jumonji transcription factor, partial [Zea mays]
Length=1235

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 70/145 (48%), Gaps = 30/145 (21%)
 Frame = +2

Query  167  IMGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVE  346
            +MG E  +  V ++     +IPPGF   A+     ++++ K  +   SSS + LQ   ++
Sbjct  1    MMGIEGIAATVTEDP--EPSIPPGFGPFAASASWGIQNDVKPADD-HSSSVLALQ--SID  55

Query  347  PDLEGVE-------------------DAKLKSIRRRPCMNYGQVENSSGDESDSE-----  454
             D+E +E                   +   KS+R RP ++Y + +  + ++SD+E     
Sbjct  56   DDVEILEYLSSSVDHQSDTGCCISGSNTCRKSLRNRPPIDYSRFDQIADEDSDAEVADKG  115

Query  455  -QKVSFRPQLPKGVIRGCEECVNCQ  526
               V  R Q PKGV+RGC EC NCQ
Sbjct  116  VNAVKHRQQFPKGVLRGCPECANCQ  140



>ref|XP_008648146.1| PREDICTED: uncharacterized protein LOC100383891 isoform X1 [Zea 
mays]
 ref|XP_008648147.1| PREDICTED: uncharacterized protein LOC100383891 isoform X1 [Zea 
mays]
 ref|XP_008648148.1| PREDICTED: uncharacterized protein LOC100383891 isoform X1 [Zea 
mays]
Length=1239

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 70/145 (48%), Gaps = 30/145 (21%)
 Frame = +2

Query  167  IMGTELFSHCVKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVE  346
            +MG E  +  V ++     +IPPGF   A+     ++++ K  +   SSS + LQ   ++
Sbjct  5    MMGIEGIAATVTEDP--EPSIPPGFGPFAASASWGIQNDVKPADD-HSSSVLALQ--SID  59

Query  347  PDLEGVE-------------------DAKLKSIRRRPCMNYGQVENSSGDESDSE-----  454
             D+E +E                   +   KS+R RP ++Y + +  + ++SD+E     
Sbjct  60   DDVEILEYLSSSVDHQSDTGCCISGSNTCRKSLRNRPPIDYSRFDQIADEDSDAEVADKG  119

Query  455  -QKVSFRPQLPKGVIRGCEECVNCQ  526
               V  R Q PKGV+RGC EC NCQ
Sbjct  120  VNAVKHRQQFPKGVLRGCPECANCQ  144



>ref|XP_002300773.2| hypothetical protein POPTR_0002s03840g [Populus trichocarpa]
 gb|EEE80046.2| hypothetical protein POPTR_0002s03840g [Populus trichocarpa]
Length=771

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 64/113 (57%), Gaps = 5/113 (4%)
 Frame = +2

Query  197  VKDETIDMSTIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEPDLEGVEDAK  376
            +++E  +  ++PPGF SL SF L+KV+ + +  +   S+S  + +  +++   + ++ A 
Sbjct  10   LRNENAEKLSVPPGFASLTSFRLKKVETSVQNGDSTPSTSVSKGKTIQMDDTTDTIDVAT  69

Query  377  LKSI-RRRPCMNYGQVENSSGDESDSEQKVSFRPQ---LPKGVIRGCEECVNC  523
            LK   + RP + +GQ +N +  ES+ EQ     P    LPKGV  GC +C NC
Sbjct  70   LKRFFQHRPGILHGQ-KNQNLVESNFEQVDMDLPSETSLPKGVAYGCADCSNC  121



>ref|XP_004954299.1| PREDICTED: probable lysine-specific demethylase JMJ14-like isoform 
X3 [Setaria italica]
 ref|XP_004954300.1| PREDICTED: probable lysine-specific demethylase JMJ14-like isoform 
X4 [Setaria italica]
 ref|XP_004954301.1| PREDICTED: probable lysine-specific demethylase JMJ14-like isoform 
X5 [Setaria italica]
 ref|XP_004954302.1| PREDICTED: probable lysine-specific demethylase JMJ14-like isoform 
X6 [Setaria italica]
Length=1210

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 61/124 (49%), Gaps = 26/124 (21%)
 Frame = +2

Query  224  TIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEPDLEGVEDAKL--------  379
            + PPGFE      L  ++D+ K  +    SS +Q+ ++  E D+E +E +          
Sbjct  17   SFPPGFEPFIDLALRGIQDDAKPDD--THSSSVQVVQS-TEKDVEILEPSSAHCRSGTPA  73

Query  380  ---------KSIRRRPCMNYGQVENSSGDESDSE------QKVSFRPQLPKGVIRGCEEC  514
                     KS+R RP ++Y   +  S +ES+ E      + +  R QLPKGV+RGC EC
Sbjct  74   STSGSHGCRKSLRNRPPIDYSLFDLISDEESEVELAEKGVRPMRRRQQLPKGVLRGCAEC  133

Query  515  VNCQ  526
             +CQ
Sbjct  134  ADCQ  137



>gb|EEC78664.1| hypothetical protein OsI_18782 [Oryza sativa Indica Group]
 gb|EEE62643.1| hypothetical protein OsJ_17446 [Oryza sativa Japonica Group]
Length=1237

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 56/123 (46%), Gaps = 24/123 (20%)
 Frame = +2

Query  224  TIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQ----------------RAKVEPDL  355
            +IPPGF   A+  L  +  N+ K     S+    LQ                R+      
Sbjct  14   SIPPGFGPFATLPLWGIH-NDAKPAVTHSTPVQALQSIRKDSEECQPSAAVSRSDTPCST  72

Query  356  EGVEDAKLKSIRRRPCMNYGQVENSSGDESDSE------QKVSFRPQLPKGVIRGCEECV  517
             G +  + KS+R RP ++Y + E+ S ++SD E           R QLPKGV+RGC EC 
Sbjct  73   SGTQTCR-KSLRNRPPIDYSRFEHISDEDSDVEIVEKDVSSTRRRQQLPKGVLRGCAECS  131

Query  518  NCQ  526
            +CQ
Sbjct  132  DCQ  134



>ref|NP_001054867.1| Os05g0196500 [Oryza sativa Japonica Group]
 sp|Q53WJ1.1|JM703_ORYSJ RecName: Full=Lysine-specific demethylase JMJ703; AltName: Full=Jumonji 
domain-containing protein 703; AltName: Full=Lysine-specific 
histone demethylase JMJ703; AltName: Full=Protein 
JUMONJI 703 [Oryza sativa Japonica Group]
 gb|AAV59453.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16781.1| Os05g0196500 [Oryza sativa Japonica Group]
 dbj|BAH00458.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1238

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 56/123 (46%), Gaps = 24/123 (20%)
 Frame = +2

Query  224  TIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQ----------------RAKVEPDL  355
            +IPPGF   A+  L  +  N+ K     S+    LQ                R+      
Sbjct  15   SIPPGFGPFATLPLWGIH-NDAKPAVTHSTPVQALQSIRKDSEECQPSAAVSRSDTPCST  73

Query  356  EGVEDAKLKSIRRRPCMNYGQVENSSGDESDSE------QKVSFRPQLPKGVIRGCEECV  517
             G +  + KS+R RP ++Y + E+ S ++SD E           R QLPKGV+RGC EC 
Sbjct  74   SGTQTCR-KSLRNRPPIDYSRFEHISDEDSDVEIVEKDVSSTRRRQQLPKGVLRGCAECS  132

Query  518  NCQ  526
            +CQ
Sbjct  133  DCQ  135



>ref|XP_009369472.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Pyrus 
x bretschneideri]
Length=887

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 57/104 (55%), Gaps = 8/104 (8%)
 Frame = +2

Query  221  STIPPGFESLASFTLEKVKDNEKKTNCLASSSEMQLQRAKVEPDLEGVEDAKLKSIRRRP  400
            +++PPGF    SF L+KVK  E+  N    +S  +  +     DL  ++  KLK  R+RP
Sbjct  4    NSVPPGFVCRTSFVLKKVKTVEETKNAFVDASTEEPVQMDTMSDLTDMD--KLK--RQRP  59

Query  401  CMNYGQVENSSGDESDSEQ---KVSFRPQLPKGVIRGCEECVNC  523
             + + Q + +S +ESD EQ   + + +  LPKGV  GC +C  C
Sbjct  60   WILFDQSDLNS-EESDCEQFNTEPTTKYCLPKGVTHGCPDCSGC  102



>ref|XP_007162550.1| hypothetical protein PHAVU_001G161600g [Phaseolus vulgaris]
 ref|XP_007162551.1| hypothetical protein PHAVU_001G161600g [Phaseolus vulgaris]
 gb|ESW34544.1| hypothetical protein PHAVU_001G161600g [Phaseolus vulgaris]
 gb|ESW34545.1| hypothetical protein PHAVU_001G161600g [Phaseolus vulgaris]
Length=862

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 54/117 (46%), Gaps = 19/117 (16%)
 Frame = +2

Query  194  CVKDETIDMSTIPPGFESLASFTLEKV----KDNEKKTNCLASSSEMQLQRAKVEPDLEG  361
            C K +     ++PPGF SL+SF L +V    K+++  T C+           K + +  G
Sbjct  8    CPKYQEYKNHSVPPGFVSLSSFILRRVGNVKKNDKSSTICM-----------KTKLETNG  56

Query  362  VEDAKLKSIRRRPCMNYGQVENSSGDESDSEQ---KVSFRPQLPKGVIRGCEECVNC  523
            + +A  + +  RP +N     +   +ES ++     +      PKG IRGC  C NC
Sbjct  57   I-NAYSQGLMHRPWINMDMCNHHKPEESHTKHLPMNLPLNAGRPKGTIRGCPNCSNC  112



>ref|XP_006604493.1| PREDICTED: probable lysine-specific demethylase JMJ14-like isoform 
X1 [Glycine max]
Length=895

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 61/128 (48%), Gaps = 10/128 (8%)
 Frame = +2

Query  161  IYIMGTELFSHCVKDETIDMSTIPPGFESLASFTLEK---VKDNEKKTNCLASSSEMQLQ  331
            + IM  +    C K E  +  ++PPGF SL SF L++   VK ++K T     +SE +  
Sbjct  13   LVIMEADYGKDCTKSENRENLSVPPGFTSLTSFILKRDGNVKKSDKST-AFQIASEQEPI  71

Query  332  RAKVEPDLEGVEDAKLKSIRRRPCMNYGQVENSSGDESDSEQKVSFRPQL----PKGVIR  499
              +  P++  +  A  + +  RP +   Q  +   +ES  +  +   P L    PKG+I 
Sbjct  72   FMETIPEMNDI-SAYRQVLMHRPWIIADQSNHHKLEESHIKH-LPMDPPLNDGRPKGIIH  129

Query  500  GCEECVNC  523
            GC  C NC
Sbjct  130  GCPNCSNC  137



>ref|XP_008680638.1| PREDICTED: probable lysine-specific demethylase JMJ14 [Zea mays]
Length=307

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 6/55 (11%)
 Frame = +2

Query  380  KSIRRRPCMNYGQVENSSGDESDSEQK------VSFRPQLPKGVIRGCEECVNCQ  526
            +S+R RP ++Y Q +  S +ESD E        V  R QLPKGV+RGC +C +CQ
Sbjct  31   RSLRNRPPIDYSQFDLISDEESDVESAEKGVGLVRRRRQLPKGVLRGCAQCADCQ  85



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561572122600