BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS019D10

Length=438
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006366590.1|  PREDICTED: aconitate hydratase 2, mitochondr...    178   2e-48   Solanum tuberosum [potatoes]
ref|XP_004243472.1|  PREDICTED: aconitate hydratase, cytoplasmic        177   2e-48   Solanum lycopersicum
ref|XP_009770911.1|  PREDICTED: aconitate hydratase, cytoplasmic        174   3e-47   Nicotiana sylvestris
gb|KDP22711.1|  hypothetical protein JCGZ_01813                         173   8e-47   Jatropha curcas
dbj|BAG16527.1|  putative aconitase                                     172   2e-46   Capsicum chinense [bonnet pepper]
ref|XP_009601350.1|  PREDICTED: aconitate hydratase, cytoplasmic        170   1e-45   Nicotiana tomentosiformis
ref|XP_002524184.1|  aconitase, putative                                169   1e-45   Ricinus communis
ref|XP_006376779.1|  aconitate hydratase family protein                 169   2e-45   Populus trichocarpa [western balsam poplar]
ref|XP_011048785.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    166   2e-44   Populus euphratica
ref|XP_011047264.1|  PREDICTED: aconitate hydratase, cytoplasmic        166   3e-44   Populus euphratica
emb|CDP10817.1|  unnamed protein product                                166   4e-44   Coffea canephora [robusta coffee]
ref|XP_011095404.1|  PREDICTED: putative aconitate hydratase, cyt...    164   1e-43   Sesamum indicum [beniseed]
ref|XP_010276105.1|  PREDICTED: aconitate hydratase, cytoplasmic        164   2e-43   Nelumbo nucifera [Indian lotus]
emb|CDP05740.1|  unnamed protein product                                163   3e-43   Coffea canephora [robusta coffee]
ref|XP_002321126.2|  hypothetical protein POPTR_0014s15170g             162   4e-43   Populus trichocarpa [western balsam poplar]
gb|KDO62733.1|  hypothetical protein CISIN_1g001863mg                   162   6e-43   Citrus sinensis [apfelsine]
ref|XP_006452377.1|  hypothetical protein CICLE_v10007338mg             159   5e-42   Citrus clementina [clementine]
ref|XP_010046497.1|  PREDICTED: aconitate hydratase, cytoplasmic        159   7e-42   Eucalyptus grandis [rose gum]
ref|XP_006351962.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    158   1e-41   Solanum tuberosum [potatoes]
gb|EPS60517.1|  hypothetical protein M569_14286                         157   3e-41   Genlisea aurea
gb|KDO54659.1|  hypothetical protein CISIN_1g001917mg                   154   3e-40   Citrus sinensis [apfelsine]
gb|KDO54661.1|  hypothetical protein CISIN_1g001917mg                   154   3e-40   Citrus sinensis [apfelsine]
ref|XP_006447556.1|  hypothetical protein CICLE_v10014140mg             154   4e-40   
gb|KDO54656.1|  hypothetical protein CISIN_1g001917mg                   154   4e-40   Citrus sinensis [apfelsine]
gb|KDO54660.1|  hypothetical protein CISIN_1g001917mg                   154   4e-40   Citrus sinensis [apfelsine]
gb|KDO54657.1|  hypothetical protein CISIN_1g001917mg                   154   4e-40   Citrus sinensis [apfelsine]
ref|XP_006447555.1|  hypothetical protein CICLE_v10014140mg             154   4e-40   Citrus clementina [clementine]
ref|XP_009598331.1|  PREDICTED: aconitate hydratase 2, mitochondr...    151   2e-39   Nicotiana tomentosiformis
ref|XP_010278679.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    152   3e-39   Nelumbo nucifera [Indian lotus]
ref|XP_009598330.1|  PREDICTED: aconitate hydratase, cytoplasmic ...    152   3e-39   Nicotiana tomentosiformis
ref|XP_002278138.1|  PREDICTED: aconitate hydratase, cytoplasmic        150   1e-38   Vitis vinifera
gb|EYU27339.1|  hypothetical protein MIMGU_mgv1a000710mg                149   4e-38   Erythranthe guttata [common monkey flower]
ref|XP_009787326.1|  PREDICTED: aconitate hydratase 2, mitochondr...    146   2e-37   Nicotiana sylvestris
ref|XP_003543388.1|  PREDICTED: aconitate hydratase 2, mitochondr...    146   3e-37   Glycine max [soybeans]
ref|XP_009787319.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    146   4e-37   Nicotiana sylvestris
ref|XP_004251517.2|  PREDICTED: aconitate hydratase, cytoplasmic        145   6e-37   Solanum lycopersicum
gb|KHN36531.1|  Aconitate hydratase, cytoplasmic                        145   8e-37   Glycine soja [wild soybean]
gb|KJB60836.1|  hypothetical protein B456_009G327800                    144   9e-37   Gossypium raimondii
gb|KJB60837.1|  hypothetical protein B456_009G327800                    144   9e-37   Gossypium raimondii
gb|KJB60835.1|  hypothetical protein B456_009G327800                    144   1e-36   Gossypium raimondii
ref|XP_007045642.1|  Aconitase 3                                        144   2e-36   
gb|EYU24785.1|  hypothetical protein MIMGU_mgv1a000742mg                142   4e-36   Erythranthe guttata [common monkey flower]
gb|KDP39136.1|  hypothetical protein JCGZ_00893                         142   7e-36   Jatropha curcas
ref|XP_003540302.1|  PREDICTED: aconitate hydratase 2, mitochondr...    142   8e-36   Glycine max [soybeans]
gb|KJB50479.1|  hypothetical protein B456_008G173400                    141   1e-35   Gossypium raimondii
ref|XP_011100304.1|  PREDICTED: aconitate hydratase, cytoplasmic        141   2e-35   Sesamum indicum [beniseed]
ref|XP_006346211.1|  PREDICTED: aconitate hydratase 2, mitochondr...    140   4e-35   Solanum tuberosum [potatoes]
gb|KHG15607.1|  Aconitate hydratase 2, mitochondrial -like protein      138   5e-35   Gossypium arboreum [tree cotton]
ref|XP_007149973.1|  hypothetical protein PHAVU_005G115100g             138   1e-34   Phaseolus vulgaris [French bean]
ref|XP_010445106.1|  PREDICTED: aconitate hydratase 3, mitochondr...    134   2e-34   
gb|KHG18502.1|  Aconitate hydratase 2, mitochondrial -like protein      137   3e-34   Gossypium arboreum [tree cotton]
ref|XP_009599619.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    137   4e-34   Nicotiana tomentosiformis
ref|XP_009769027.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    137   4e-34   Nicotiana sylvestris
gb|KJB62848.1|  hypothetical protein B456_009G440000                    137   4e-34   Gossypium raimondii
gb|KJB62847.1|  hypothetical protein B456_009G440000                    137   5e-34   Gossypium raimondii
ref|XP_003596988.1|  Aconitate hydratase                                137   5e-34   Medicago truncatula
ref|XP_010448188.1|  PREDICTED: aconitate hydratase 3, mitochondr...    136   6e-34   Camelina sativa [gold-of-pleasure]
ref|XP_004487412.1|  PREDICTED: aconitate hydratase 2, mitochondr...    136   6e-34   Cicer arietinum [garbanzo]
ref|XP_006283068.1|  hypothetical protein CARUB_v10004061mg             136   7e-34   Capsella rubella
ref|XP_008379632.1|  PREDICTED: aconitate hydratase, cytoplasmic        136   8e-34   
ref|XP_004159202.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    136   8e-34   
ref|XP_008455442.1|  PREDICTED: aconitate hydratase, cytoplasmic        136   9e-34   Cucumis melo [Oriental melon]
ref|XP_009353280.1|  PREDICTED: aconitate hydratase, cytoplasmic        135   1e-33   Pyrus x bretschneideri [bai li]
ref|XP_006413121.1|  hypothetical protein EUTSA_v10024309mg             135   2e-33   Eutrema salsugineum [saltwater cress]
ref|XP_004144496.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    135   2e-33   Cucumis sativus [cucumbers]
ref|XP_003527493.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    134   4e-33   Glycine max [soybeans]
ref|NP_567763.2|  aconitase 2                                           134   4e-33   Arabidopsis thaliana [mouse-ear cress]
gb|AAK91447.1|  AT4g26970/F10M23_310                                    134   5e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006592372.1|  PREDICTED: aconitate hydratase 2, mitochondr...    134   5e-33   Glycine max [soybeans]
ref|XP_003539865.1|  PREDICTED: aconitate hydratase 2, mitochondr...    134   6e-33   Glycine max [soybeans]
ref|XP_002869584.1|  hypothetical protein ARALYDRAFT_492099             134   7e-33   
ref|XP_008230066.1|  PREDICTED: aconitate hydratase, cytoplasmic        133   8e-33   Prunus mume [ume]
ref|XP_010433420.1|  PREDICTED: aconitate hydratase 3, mitochondrial    133   9e-33   Camelina sativa [gold-of-pleasure]
ref|XP_007217144.1|  hypothetical protein PRUPE_ppa000812mg             133   1e-32   Prunus persica
emb|CDY14291.1|  BnaA08g14220D                                          133   1e-32   Brassica napus [oilseed rape]
emb|CDY66424.1|  BnaAnng22230D                                          133   1e-32   Brassica napus [oilseed rape]
ref|XP_010467089.1|  PREDICTED: aconitate hydratase 2, mitochondr...    132   1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_009109156.1|  PREDICTED: aconitate hydratase 3, mitochondrial    131   3e-32   Brassica rapa
ref|XP_002883704.1|  hypothetical protein ARALYDRAFT_480186             131   4e-32   
ref|XP_010675721.1|  PREDICTED: putative aconitate hydratase, cyt...    131   4e-32   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG08190.1|  Aconitate hydratase 2, mitochondrial                    131   6e-32   Gossypium arboreum [tree cotton]
gb|KJB30566.1|  hypothetical protein B456_005G149700                    130   1e-31   Gossypium raimondii
gb|KJB30569.1|  hypothetical protein B456_005G149700                    130   2e-31   Gossypium raimondii
ref|XP_008342002.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    129   2e-31   
ref|XP_010488774.1|  PREDICTED: aconitate hydratase 2, mitochondrial    128   4e-31   Camelina sativa [gold-of-pleasure]
ref|XP_006296904.1|  hypothetical protein CARUB_v10012896mg             128   6e-31   Capsella rubella
gb|KFK29204.1|  hypothetical protein AALP_AA7G102800                    127   1e-30   Arabis alpina [alpine rockcress]
ref|XP_009148490.1|  PREDICTED: aconitate hydratase 2, mitochondrial    127   2e-30   Brassica rapa
emb|CDX97969.1|  BnaA06g07200D                                          126   2e-30   
ref|XP_010412716.1|  PREDICTED: aconitate hydratase 2, mitochondr...    126   3e-30   
ref|XP_010929878.1|  PREDICTED: putative aconitate hydratase, cyt...    125   5e-30   Elaeis guineensis
emb|CDY50945.1|  BnaC03g74450D                                          124   9e-30   Brassica napus [oilseed rape]
ref|NP_178634.2|  aconitate hydratase 3                                 124   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010443085.1|  PREDICTED: aconitate hydratase 3, mitochondr...    123   3e-29   Camelina sativa [gold-of-pleasure]
ref|XP_008804304.1|  PREDICTED: putative aconitate hydratase, cyt...    122   4e-29   Phoenix dactylifera
gb|KFK39331.1|  hypothetical protein AALP_AA3G230700                    122   5e-29   Arabis alpina [alpine rockcress]
emb|CDX93088.1|  BnaA03g38100D                                          122   5e-29   
gb|KHG02134.1|  hypothetical protein F383_25649                         122   5e-29   Gossypium arboreum [tree cotton]
emb|CDY18054.1|  BnaC07g04160D                                          122   6e-29   Brassica napus [oilseed rape]
ref|XP_009136177.1|  PREDICTED: aconitate hydratase 2, mitochondrial    122   7e-29   Brassica rapa
ref|XP_003605929.1|  Aconitate hydratase                                120   3e-28   Medicago truncatula
ref|XP_002279260.1|  PREDICTED: aconitate hydratase, cytoplasmic        120   4e-28   Vitis vinifera
ref|XP_010450391.1|  PREDICTED: aconitate hydratase 2, mitochondr...    120   4e-28   Camelina sativa [gold-of-pleasure]
ref|XP_002870438.1|  predicted protein                                  119   5e-28   Arabidopsis lyrata subsp. lyrata
ref|XP_006396145.1|  hypothetical protein EUTSA_v10002387mg             119   7e-28   Eutrema salsugineum [saltwater cress]
ref|XP_004287944.1|  PREDICTED: aconitate hydratase, cytoplasmic        117   3e-27   Fragaria vesca subsp. vesca
ref|XP_010440740.1|  PREDICTED: aconitate hydratase 2, mitochondr...    117   4e-27   Camelina sativa [gold-of-pleasure]
ref|XP_007132546.1|  hypothetical protein PHAVU_011G1037001g            115   1e-26   Phaseolus vulgaris [French bean]
emb|CDY56501.1|  BnaAnng14360D                                          114   3e-26   Brassica napus [oilseed rape]
ref|XP_010533007.1|  PREDICTED: aconitate hydratase, cytoplasmic ...    114   3e-26   Tarenaya hassleriana [spider flower]
ref|XP_004517086.1|  PREDICTED: aconitate hydratase 2, mitochondr...    114   4e-26   Cicer arietinum [garbanzo]
ref|XP_002532564.1|  aconitase, putative                                114   6e-26   
ref|XP_010482909.1|  PREDICTED: putative aconitate hydratase, cyt...    111   4e-25   
ref|XP_008800034.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    110   1e-24   Phoenix dactylifera
ref|XP_008785050.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    109   2e-24   Phoenix dactylifera
ref|XP_010918136.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    109   2e-24   Elaeis guineensis
ref|XP_010943467.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    108   3e-24   Elaeis guineensis
ref|XP_009419582.1|  PREDICTED: putative aconitate hydratase, cyt...    107   2e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399225.1|  PREDICTED: putative aconitate hydratase, cyt...    103   2e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006828850.1|  hypothetical protein AMTR_s00001p00156400          102   8e-22   Amborella trichopoda
ref|XP_009382046.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    101   1e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC83022.1|  hypothetical protein OsI_28099                        98.6    1e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_009384004.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    100   2e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004974379.1|  PREDICTED: putative aconitate hydratase, cyt...  99.8    5e-21   
ref|XP_007020811.1|  Aconitase 3                                      99.4    6e-21   
ref|XP_002445174.1|  hypothetical protein SORBIDRAFT_07g005390        99.4    7e-21   Sorghum bicolor [broomcorn]
ref|XP_008676648.1|  PREDICTED: uncharacterized protein LOC100216...  99.0    9e-21   
gb|AAD25640.1|  cytoplasmic aconitate hydratase                       95.9    1e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AAP30039.1|  aconitase                                             94.4    4e-19   Solanum pennellii
gb|AAO62410.1|  aconitase                                             94.0    5e-19   Solanum pennellii
ref|XP_003573387.2|  PREDICTED: putative aconitate hydratase, cyt...  91.7    3e-18   Brachypodium distachyon [annual false brome]
gb|AAG28426.1|AF194945_1  cytosolic aconitase                         90.5    8e-18   Nicotiana tabacum [American tobacco]
gb|AAC26045.1|  aconitase-iron regulated protein 1                    90.1    9e-18   Citrus limon [lemon]
gb|KHG08189.1|  hypothetical protein F383_11434                       90.1    1e-17   Gossypium arboreum [tree cotton]
gb|ADM34980.1|  cytosolic aconitase                                   90.1    1e-17   Pyrus pyrifolia [sha li]
emb|CBE71057.1|  aconitate hydratase 3                                90.1    1e-17   Citrus clementina [clementine]
emb|CBE71058.1|  aconitate hydratase 2                                89.7    1e-17   Citrus clementina [clementine]
sp|Q6YZX6.1|ACOC_ORYSJ  RecName: Full=Putative aconitate hydratas...  89.4    2e-17   Oryza sativa Japonica Group [Japonica rice]
gb|KHN41224.1|  Aconitate hydratase, cytoplasmic                      89.0    3e-17   Glycine soja [wild soybean]
gb|KJB30565.1|  hypothetical protein B456_005G149700                  87.8    7e-17   Gossypium raimondii
sp|P49608.1|ACOC_CUCMA  RecName: Full=Aconitate hydratase, cytopl...  87.4    9e-17   Cucurbita maxima [Boston marrow]
ref|XP_011097878.1|  PREDICTED: putative aconitate hydratase, cyt...  86.7    1e-16   
ref|XP_007020807.1|  Aconitase 3                                      84.7    6e-16   
gb|KFK30197.1|  hypothetical protein AALP_AA7G230700                  83.6    2e-15   Arabis alpina [alpine rockcress]
dbj|BAJ85661.1|  predicted protein                                    83.6    2e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006413195.1|  hypothetical protein EUTSA_v10024325mg           83.2    3e-15   
emb|CAA58046.1|  aconitase                                            83.2    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008363093.1|  PREDICTED: aconitate hydratase 1-like            77.0    4e-15   
ref|XP_004287770.1|  PREDICTED: aconitate hydratase 1                 82.4    5e-15   Fragaria vesca subsp. vesca
emb|CDX69174.1|  BnaC01g02790D                                        82.0    6e-15   
ref|XP_002445994.1|  hypothetical protein SORBIDRAFT_06g000200        76.6    7e-15   
ref|NP_195308.1|  aconitate hydratase 1                               81.6    8e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010526818.1|  PREDICTED: aconitate hydratase 1                 81.3    9e-15   Tarenaya hassleriana [spider flower]
ref|XP_010437416.1|  PREDICTED: aconitate hydratase 1-like            81.3    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_006285963.1|  hypothetical protein CARUB_v10007484mg           81.3    1e-14   Capsella rubella
ref|XP_010446873.1|  PREDICTED: aconitate hydratase 1                 81.3    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_009109264.1|  PREDICTED: aconitate hydratase 1-like            81.3    1e-14   Brassica rapa
ref|XP_009150005.1|  PREDICTED: aconitate hydratase 1                 81.3    1e-14   Brassica rapa
ref|XP_007046597.1|  Aconitase 1                                      80.9    1e-14   
gb|KDO71343.1|  hypothetical protein CISIN_1g002610mg                 80.9    2e-14   Citrus sinensis [apfelsine]
emb|CBE71056.1|  aconitate hydratase 1                                80.9    2e-14   Citrus clementina [clementine]
ref|XP_006467022.1|  PREDICTED: aconitate hydratase 1                 80.9    2e-14   Citrus sinensis [apfelsine]
gb|KDO71342.1|  hypothetical protein CISIN_1g002610mg                 80.9    2e-14   Citrus sinensis [apfelsine]
gb|KDO71344.1|  hypothetical protein CISIN_1g002610mg                 80.5    2e-14   Citrus sinensis [apfelsine]
gb|KDO71346.1|  hypothetical protein CISIN_1g002610mg                 80.5    2e-14   Citrus sinensis [apfelsine]
emb|CAB36543.1|  putative aconitase                                   80.5    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006412056.1|  hypothetical protein EUTSA_v10024358mg           80.1    2e-14   Eutrema salsugineum [saltwater cress]
ref|XP_010432222.1|  PREDICTED: aconitate hydratase 1-like            80.1    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_006412054.1|  hypothetical protein EUTSA_v10024358mg           79.7    3e-14   
ref|XP_006425366.1|  hypothetical protein CICLE_v10024840mg           79.7    4e-14   Citrus clementina [clementine]
gb|KHN41868.1|  Aconitate hydratase 1                                 79.3    4e-14   Glycine soja [wild soybean]
emb|CDX75532.1|  BnaA01g01700D                                        79.3    5e-14   
emb|CDY41626.1|  BnaC03g62580D                                        79.0    6e-14   Brassica napus [oilseed rape]
ref|XP_010113288.1|  Aconitate hydratase 1                            79.0    7e-14   
ref|XP_009363442.1|  PREDICTED: aconitate hydratase 1-like            79.0    7e-14   Pyrus x bretschneideri [bai li]
ref|XP_009337075.1|  PREDICTED: aconitate hydratase 1-like            78.6    8e-14   Pyrus x bretschneideri [bai li]
ref|XP_007203240.1|  hypothetical protein PRUPE_ppa001138mg           78.6    8e-14   Prunus persica
ref|XP_008242011.1|  PREDICTED: aconitate hydratase 1                 78.6    8e-14   Prunus mume [ume]
ref|XP_009344825.1|  PREDICTED: aconitate hydratase 1                 78.6    8e-14   Pyrus x bretschneideri [bai li]
gb|EMS45933.1|  Putative aconitate hydratase, cytoplasmic             78.6    8e-14   Triticum urartu
ref|XP_008337967.1|  PREDICTED: aconitate hydratase 1                 78.6    9e-14   
ref|XP_002460765.1|  hypothetical protein SORBIDRAFT_02g034590        78.6    1e-13   Sorghum bicolor [broomcorn]
gb|AAL13084.1|  putative aconitase                                    78.6    1e-13   Prunus avium [gean]
gb|KHG25175.1|  Aconitate hydratase, cytoplasmic                      78.6    1e-13   Gossypium arboreum [tree cotton]
gb|KHG25176.1|  Aconitate hydratase, cytoplasmic                      78.6    1e-13   Gossypium arboreum [tree cotton]
gb|KJB48278.1|  hypothetical protein B456_008G061900                  78.2    1e-13   Gossypium raimondii
ref|XP_008669746.1|  PREDICTED: putative aconitate hydratase, cyt...  78.2    1e-13   Zea mays [maize]
emb|CBI24446.3|  unnamed protein product                              77.8    1e-13   Vitis vinifera
gb|KDP23953.1|  hypothetical protein JCGZ_25341                       77.8    2e-13   Jatropha curcas
ref|XP_002263337.1|  PREDICTED: aconitate hydratase 1                 77.8    2e-13   Vitis vinifera
ref|XP_006380559.1|  hypothetical protein POPTR_0007s09260g           77.4    2e-13   Populus trichocarpa [western balsam poplar]
gb|AES61065.2|  cytoplasmic-like aconitate hydratase                  77.4    2e-13   Medicago truncatula
ref|XP_003517155.1|  PREDICTED: aconitate hydratase 1                 77.4    2e-13   Glycine max [soybeans]
ref|XP_007157870.1|  hypothetical protein PHAVU_002G105000g           77.0    3e-13   Phaseolus vulgaris [French bean]
gb|EMT33022.1|  Putative aconitate hydratase, cytoplasmic             77.0    3e-13   
ref|XP_010266897.1|  PREDICTED: aconitate hydratase 1                 76.6    4e-13   Nelumbo nucifera [Indian lotus]
ref|XP_008440877.1|  PREDICTED: aconitate hydratase                   76.3    6e-13   Cucumis melo [Oriental melon]
ref|XP_008669747.1|  PREDICTED: putative aconitate hydratase, cyt...  76.3    6e-13   Zea mays [maize]
ref|XP_011022256.1|  PREDICTED: aconitate hydratase 1                 75.9    7e-13   Populus euphratica
ref|XP_006383042.1|  aconitate hydratase family protein               75.9    8e-13   Populus trichocarpa [western balsam poplar]
ref|NP_001147431.1|  aconitase2                                       75.9    8e-13   Zea mays [maize]
dbj|BAJ92965.1|  predicted protein                                    75.9    8e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003537655.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  75.5    9e-13   Glycine max [soybeans]
ref|XP_010529315.1|  PREDICTED: aconitate hydratase 1-like            75.1    1e-12   Tarenaya hassleriana [spider flower]
ref|NP_001048898.1|  Os03g0136900                                     75.1    1e-12   
emb|CDY24823.1|  BnaA08g14870D                                        75.1    1e-12   Brassica napus [oilseed rape]
gb|EEC74472.1|  hypothetical protein OsI_09921                        75.1    1e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_004985790.1|  PREDICTED: putative aconitate hydratase, cyt...  75.1    1e-12   Setaria italica
ref|XP_008661884.1|  PREDICTED: aconitase2 isoform X1                 75.1    2e-12   
ref|XP_003612247.1|  Aconitate hydratase                              74.7    2e-12   Medicago truncatula
gb|KCW56576.1|  hypothetical protein EUGRSUZ_I02307                   74.7    2e-12   Eucalyptus grandis [rose gum]
ref|XP_010029634.1|  PREDICTED: aconitate hydratase 1                 74.7    2e-12   Eucalyptus grandis [rose gum]
ref|XP_004512178.1|  PREDICTED: aconitate hydratase 1-like            74.3    2e-12   Cicer arietinum [garbanzo]
ref|XP_004166975.1|  PREDICTED: aconitate hydratase 1-like            73.2    3e-12   
emb|CAN83844.1|  hypothetical protein VITISV_003004                   73.6    4e-12   Vitis vinifera
ref|XP_008658754.1|  PREDICTED: uncharacterized protein LOC100304...  73.6    4e-12   
ref|XP_001779205.1|  predicted protein                                73.2    5e-12   
ref|XP_008670444.1|  PREDICTED: putative aconitate hydratase, cyt...  73.2    6e-12   Zea mays [maize]
ref|XP_008670445.1|  PREDICTED: putative aconitate hydratase, cyt...  73.2    6e-12   Zea mays [maize]
ref|XP_002530635.1|  aconitase, putative                              73.2    7e-12   Ricinus communis
ref|XP_003590814.1|  Aconitate hydratase                              72.4    1e-11   
ref|XP_004134842.1|  PREDICTED: aconitate hydratase 1-like            72.4    1e-11   Cucumis sativus [cucumbers]
ref|XP_003558862.1|  PREDICTED: putative aconitate hydratase, cyt...  72.4    1e-11   Brachypodium distachyon [annual false brome]
gb|KGN48958.1|  Aconitase                                             72.4    1e-11   Cucumis sativus [cucumbers]
gb|KJB17578.1|  hypothetical protein B456_003G006000                  72.4    1e-11   Gossypium raimondii
ref|XP_002465901.1|  hypothetical protein SORBIDRAFT_01g047850        71.2    2e-11   Sorghum bicolor [broomcorn]
ref|XP_006651017.1|  PREDICTED: putative aconitate hydratase, cyt...  70.5    4e-11   
ref|XP_002976825.1|  hypothetical protein SELMODRAFT_443331           70.1    7e-11   
ref|XP_002980554.1|  hypothetical protein SELMODRAFT_444572           70.1    7e-11   
gb|EMS48231.1|  Putative aconitate hydratase, cytoplasmic             68.9    1e-10   Triticum urartu
ref|XP_010033531.1|  PREDICTED: aconitate hydratase 1-like            68.9    2e-10   Eucalyptus grandis [rose gum]
gb|EMT24311.1|  Putative aconitate hydratase, cytoplasmic             68.6    2e-10   
gb|EMT03129.1|  Putative aconitate hydratase, cytoplasmic             68.2    3e-10   
gb|KCW53221.1|  hypothetical protein EUGRSUZ_J02488                   67.4    5e-10   Eucalyptus grandis [rose gum]
gb|EEE58288.1|  hypothetical protein OsJ_09326                        67.4    6e-10   Oryza sativa Japonica Group [Japonica rice]
gb|ADZ57218.1|  aconitase protein                                     66.6    1e-09   Litchi chinensis [litchi]
gb|KHN36000.1|  Aconitate hydratase, cytoplasmic                      65.9    2e-09   Glycine soja [wild soybean]
ref|XP_001770969.1|  predicted protein                                65.9    2e-09   
gb|KDO71345.1|  hypothetical protein CISIN_1g002610mg                 64.7    4e-09   Citrus sinensis [apfelsine]
ref|XP_010100637.1|  Aconitate hydratase                              63.9    7e-09   
emb|CDY44621.1|  BnaC04g06410D                                        58.9    2e-08   Brassica napus [oilseed rape]
ref|XP_002867051.1|  aconitate hydratase, cytoplasmic                 60.8    8e-08   
emb|CDX91508.1|  BnaC04g06420D                                        54.3    5e-07   
gb|KHN21232.1|  Aconitate hydratase, cytoplasmic                      57.8    8e-07   Glycine soja [wild soybean]
ref|XP_002991716.1|  hypothetical protein SELMODRAFT_133937           52.8    3e-05   
ref|XP_002991024.1|  hypothetical protein SELMODRAFT_132907           52.8    3e-05   
gb|EJY70620.1|  Aconitate hydratase 1 family protein                  51.2    1e-04   Oxytricha trifallax
ref|XP_004030259.1|  hypothetical protein IMG5_164920                 49.3    4e-04   Ichthyophthirius multifiliis
emb|CDW89012.1|  aconitate hydratase 1 family protein                 48.9    5e-04   Stylonychia lemnae



>ref|XP_006366590.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=997

 Score =   178 bits (451),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 81/95 (85%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +1

Query  154  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  333
            ++S  RSLRCSVPRWSHGVDWKSP SLTAQIR+AAP LN FHRK+ATMA+ENPFKGI T 
Sbjct  53   YSSTLRSLRCSVPRWSHGVDWKSPISLTAQIRTAAPALNGFHRKLATMAAENPFKGILTG  112

Query  334  LPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            LPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  113  LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  147



>ref|XP_004243472.1| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=995

 Score =   177 bits (450),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 81/95 (85%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +1

Query  154  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  333
            ++S  RSLRCSVPRWSHGVDWKSP SLTAQIR+AAP LN FHRK+ATMA+ENPFKGI T 
Sbjct  51   YSSTLRSLRCSVPRWSHGVDWKSPISLTAQIRTAAPALNGFHRKLATMAAENPFKGILTG  110

Query  334  LPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            LPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  111  LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  145



>ref|XP_009770911.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana sylvestris]
Length=996

 Score =   174 bits (442),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 78/95 (82%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +1

Query  154  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  333
            F+S FRS+RCSVPRWSHG+DWKSP SLTAQIR+AAP LN FHRK++TMA +NPFK I T+
Sbjct  52   FSSTFRSVRCSVPRWSHGIDWKSPISLTAQIRTAAPALNSFHRKLSTMAEKNPFKEILTA  111

Query  334  LPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            LPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  112  LPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLE  146



>gb|KDP22711.1| hypothetical protein JCGZ_01813 [Jatropha curcas]
Length=998

 Score =   173 bits (438),  Expect = 8e-47, Method: Composition-based stats.
 Identities = 79/99 (80%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R L+F +A RS RCSVPRWSHGVDW+SP SL +QIRSAAPV+  F RKIATMA+E+PFKG
Sbjct  50   RSLSFTAAVRSFRCSVPRWSHGVDWRSPVSLRSQIRSAAPVIEQFQRKIATMAAEHPFKG  109

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            I T+LPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  110  IVTALPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  148



>dbj|BAG16527.1| putative aconitase [Capsicum chinense]
Length=995

 Score =   172 bits (436),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 80/99 (81%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R   ++S  RSL CSV RWSHGVDWKSP SLTAQIR+AAP LN FHRK+ATMA+ENPFKG
Sbjct  47   RCYYYSSTLRSLGCSVTRWSHGVDWKSPISLTAQIRTAAPALNSFHRKLATMAAENPFKG  106

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            I T+LPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  107  ILTALPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  145



>ref|XP_009601350.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana tomentosiformis]
Length=997

 Score =   170 bits (430),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 76/95 (80%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +1

Query  154  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  333
            F+S  RS+RCSVPRWSHGVDWKSP SLTAQIR+AAP  N FH+K++TMA +NPFK I T+
Sbjct  53   FSSTLRSVRCSVPRWSHGVDWKSPISLTAQIRTAAPAFNSFHKKLSTMAEKNPFKEILTA  112

Query  334  LPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            LPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  113  LPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLE  147



>ref|XP_002524184.1| aconitase, putative [Ricinus communis]
 gb|EEF38199.1| aconitase, putative [Ricinus communis]
Length=997

 Score =   169 bits (429),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 77/99 (78%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R L+F++A RSLRCSVPRWSHGVDW+SP SL +QIR+A+PV+  F RKI+TMA+E+PFKG
Sbjct  48   RSLSFSAAVRSLRCSVPRWSHGVDWRSPVSLRSQIRTASPVIERFQRKISTMAAEHPFKG  107

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            I T LPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  108  IVTPLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  146



>ref|XP_006376779.1| aconitate hydratase family protein [Populus trichocarpa]
 gb|ERP54576.1| aconitate hydratase family protein [Populus trichocarpa]
Length=995

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R L+F+SA RSLRCS PRWSHGVDW+SPA+L  QIR+ APV+  F RKIATMA E+PFKG
Sbjct  47   RSLSFSSAVRSLRCSYPRWSHGVDWRSPATLRHQIRAVAPVVERFQRKIATMAHEHPFKG  106

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            IFTSLPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  107  IFTSLPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLE  145



>ref|XP_011048785.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Populus euphratica]
Length=995

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R  +F SA RSLRCS PRWSHGVDW+SPA+L  QIR+ APV+  F RKIATMA E+PFKG
Sbjct  47   RSSSFTSAVRSLRCSYPRWSHGVDWRSPATLRHQIRAVAPVVERFQRKIATMAHEHPFKG  106

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            IFTSLPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  107  IFTSLPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLE  145



>ref|XP_011047264.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047265.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047266.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
Length=1001

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R L+F+SAFRSLRCS PRWSHGVDW+SPA+L  QIR+ +P +  F RKIATM  E+PFKG
Sbjct  53   RSLSFSSAFRSLRCSYPRWSHGVDWRSPATLRHQIRAVSPFVERFQRKIATMVPEHPFKG  112

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            IFTSLPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  113  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  151



>emb|CDP10817.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R L+++SA RS+R SVPRWSHGVDWKSP+SL +QIR+ +P  N F+RK+ATMASENPFKG
Sbjct  62   RLLSYSSALRSVRSSVPRWSHGVDWKSPSSLCSQIRTTSPACNGFYRKMATMASENPFKG  121

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
              TSLPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  122  TLTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  160



>ref|XP_011095404.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum 
indicum]
Length=1011

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R L+F+SA RS+RCS PRWSHGVDW+SP SL AQIR+A+PVL  F RKIATMASE+PF G
Sbjct  63   RSLSFSSALRSIRCSAPRWSHGVDWRSPVSLRAQIRTASPVLERFERKIATMASEHPFSG  122

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            I + LPKPGGGEFGKFYSLPAL DPRI  LPYSIRILLE
Sbjct  123  ILSGLPKPGGGEFGKFYSLPALKDPRIDKLPYSIRILLE  161



>ref|XP_010276105.1| PREDICTED: aconitate hydratase, cytoplasmic [Nelumbo nucifera]
Length=992

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R L+F+SAFRSLR S PRWSHG DW+SP SL AQIR+AAPV+  F RKIATMASEN FKG
Sbjct  44   RSLSFSSAFRSLRSSPPRWSHGYDWRSPLSLRAQIRTAAPVIERFQRKIATMASENAFKG  103

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            I TSLPKPGGGEFGKFYSLPA+NDPRI  LPYSI+ILLE
Sbjct  104  ILTSLPKPGGGEFGKFYSLPAINDPRIDKLPYSIKILLE  142



>emb|CDP05740.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +1

Query  157  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSL  336
            +SA RSLRCSVPRWSHGVDW+SP SL AQIR+AAPV+  F RKIATMA E+P+KGI TSL
Sbjct  68   SSAVRSLRCSVPRWSHGVDWRSPVSLRAQIRTAAPVIERFERKIATMAPEHPYKGILTSL  127

Query  337  PKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            PKPGGG+FGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  128  PKPGGGDFGKFYSLPALNDPRIDKLPYSIRILLE  161



>ref|XP_002321126.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
 gb|EEE99441.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
Length=999

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R L+F+SA RSLRCS  RWSHGVDW+SPA+L  QIR+ AP +  F RKIATMA E+PFKG
Sbjct  51   RSLSFSSAVRSLRCSYRRWSHGVDWRSPATLRHQIRAVAPFVERFQRKIATMAPEHPFKG  110

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            IFTSLPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  111  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  149



>gb|KDO62733.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=875

 Score =   162 bits (409),  Expect = 6e-43, Method: Composition-based stats.
 Identities = 76/99 (77%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R L+F+SA R++RCS PRWSHGV+W+SP SL AQ R AAPVL  F RKIA+MA EN FKG
Sbjct  54   RSLSFSSALRTVRCSAPRWSHGVNWRSPVSLRAQSRIAAPVLERFQRKIASMAPENAFKG  113

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            I TSLPKPGGGEFGKF+SLPALNDPRI  LPYSIRILLE
Sbjct  114  ILTSLPKPGGGEFGKFFSLPALNDPRIDRLPYSIRILLE  152



>ref|XP_006452377.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 ref|XP_006475065.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Citrus 
sinensis]
 gb|ESR65617.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 gb|KDO62731.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=1002

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R L+F+SA R++RCS PRWSHGV+W+SP SL AQ R AAPVL  F RKIA+MA EN FKG
Sbjct  54   RSLSFSSALRTVRCSAPRWSHGVNWRSPVSLRAQSRIAAPVLERFQRKIASMAPENAFKG  113

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            I TSLPKPGGGEFGKF+SLPALNDPRI  LPYSIRILLE
Sbjct  114  ILTSLPKPGGGEFGKFFSLPALNDPRIDRLPYSIRILLE  152



>ref|XP_010046497.1| PREDICTED: aconitate hydratase, cytoplasmic [Eucalyptus grandis]
Length=996

 Score =   159 bits (402),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R L+F+SAFRSLR SVPRWSHGVDW+SPASL  QIR+ APV+    RK ATMASENPFK 
Sbjct  48   RSLSFSSAFRSLRSSVPRWSHGVDWRSPASLRPQIRAVAPVIERLQRKFATMASENPFKE  107

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            I T+LPK GGG FGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  108  ILTTLPKAGGGHFGKFYSLPALNDPRIDKLPYSIRILLE  146



>ref|XP_006351962.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Solanum tuberosum]
Length=981

 Score =   158 bits (400),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 78/99 (79%), Positives = 84/99 (85%), Gaps = 7/99 (7%)
 Frame = +1

Query  148  LTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAA--PVLNDFHRKIATMASENPFKG  321
            L F+S FRS     PRWS+GVDWKSP SL AQIR+AA  PVLN+FHRK+ TMASENPFKG
Sbjct  38   LGFSSTFRS-----PRWSYGVDWKSPISLKAQIRTAAVTPVLNNFHRKLTTMASENPFKG  92

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            I TSLPKPGGGEFGK+YSLPALNDPRI  LPYSIRILLE
Sbjct  93   ILTSLPKPGGGEFGKYYSLPALNDPRIDKLPYSIRILLE  131



>gb|EPS60517.1| hypothetical protein M569_14286, partial [Genlisea aurea]
Length=862

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R L+F+SA RSLR S PRWSHGVDW+ P SL +QI + +PVL  FHRKIATMASE+PF G
Sbjct  17   RSLSFSSAIRSLRISAPRWSHGVDWRYPVSLRSQIGTVSPVLERFHRKIATMASEHPFSG  76

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            +  +LPKPGGGEFGK+YSLPALNDPRI  LPYSIRILLE
Sbjct  77   LLQTLPKPGGGEFGKYYSLPALNDPRIEKLPYSIRILLE  115



>gb|KDO54659.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=896

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            I T+LPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  108  ILTALPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLE  146



>gb|KDO54661.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=876

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            I T+LPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  108  ILTALPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLE  146



>ref|XP_006447556.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
 gb|ESR60796.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
Length=888

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  52   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  111

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            I T+LPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  112  ILTALPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLE  150



>gb|KDO54656.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            I T+LPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  108  ILTALPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLE  146



>gb|KDO54660.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=902

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            I T+LPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  108  ILTALPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLE  146



>gb|KDO54657.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            I T+LPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  108  ILTALPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLE  146



>ref|XP_006447555.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
 ref|XP_006469685.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Citrus sinensis]
 ref|XP_006469686.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Citrus sinensis]
 gb|ESR60795.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
Length=1000

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  52   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  111

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            I T+LPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  112  ILTALPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLE  150



>ref|XP_009598331.1| PREDICTED: aconitate hydratase 2, mitochondrial isoform X2 [Nicotiana 
tomentosiformis]
Length=865

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R  +F+SA  SLR SVPRWSHGVDW+SP SL AQ+R+A+P +    R IATMASE+PF+G
Sbjct  116  RSFSFSSALPSLRYSVPRWSHGVDWRSPISLRAQVRTASPDIEPLDRNIATMASEHPFRG  175

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            IFTSLPKPGGGEFGKFYSL ALNDPRI  LP+SIRILLE
Sbjct  176  IFTSLPKPGGGEFGKFYSLTALNDPRIDKLPFSIRILLE  214



>ref|XP_010278679.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nelumbo nucifera]
Length=997

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +1

Query  178  RCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGE  357
            R S PRWSHG DWKSP SL AQIR+AAPV+  F RKIATMASEN FKGI TSLPKPGGGE
Sbjct  61   RSSAPRWSHGFDWKSPLSLRAQIRTAAPVIERFQRKIATMASENAFKGILTSLPKPGGGE  120

Query  358  FGKFYSLPALNDPRIX*LPYSIRILLE  438
            FGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  121  FGKFYSLPALNDPRIDKLPYSIRILLE  147



>ref|XP_009598330.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Nicotiana 
tomentosiformis]
Length=1063

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R  +F+SA  SLR SVPRWSHGVDW+SP SL AQ+R+A+P +    R IATMASE+PF+G
Sbjct  116  RSFSFSSALPSLRYSVPRWSHGVDWRSPISLRAQVRTASPDIEPLDRNIATMASEHPFRG  175

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            IFTSLPKPGGGEFGKFYSL ALNDPRI  LP+SIRILLE
Sbjct  176  IFTSLPKPGGGEFGKFYSLTALNDPRIDKLPFSIRILLE  214



>ref|XP_002278138.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI26642.3| unnamed protein product [Vitis vinifera]
Length=1009

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 82/99 (83%), Gaps = 5/99 (5%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R L F SAFRS R     WSHGVDW+SP SL AQIR+AAPV+  F RK+AT+ASE+PFKG
Sbjct  66   RSLGFLSAFRSRR-----WSHGVDWRSPVSLRAQIRAAAPVIERFERKMATIASEHPFKG  120

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            I TS+PKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  121  ILTSVPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  159



>gb|EYU27339.1| hypothetical protein MIMGU_mgv1a000710mg [Erythranthe guttata]
Length=1010

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 82/100 (82%), Gaps = 1/100 (1%)
 Frame = +1

Query  142  RPLTFASAFRSLR-CSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFK  318
            R L+F+SA RS+R  S  RWSHG DW+SP SL AQIRS++PVL  F RKIATMASE+PF 
Sbjct  61   RSLSFSSALRSIRYSSSQRWSHGADWRSPVSLRAQIRSSSPVLERFERKIATMASEHPFN  120

Query  319  GIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            GI + LPKP GGEFGKFYSLPALNDPRI  LPYSI+ILLE
Sbjct  121  GILSGLPKPEGGEFGKFYSLPALNDPRIDKLPYSIKILLE  160



>ref|XP_009787326.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Nicotiana sylvestris]
Length=818

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +1

Query  154  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  333
            F+SA  SL  S PRWSHGVDW+SP SL AQIR+A+P +    R IATMASE+PF+GIFTS
Sbjct  73   FSSALPSLSYSTPRWSHGVDWRSPISLRAQIRTASPDIERLDRNIATMASEHPFRGIFTS  132

Query  334  LPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            LPKPGGGEFGKFYSL ALNDPRI  LP+SIRILLE
Sbjct  133  LPKPGGGEFGKFYSLTALNDPRIDKLPFSIRILLE  167



>ref|XP_003543388.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +1

Query  145  PLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGI  324
            P + ++A RS   +VPRWSHGVDW+SP  L  QIR+AAP++  FHR+IAT A++NPFKG 
Sbjct  37   PGSSSAATRSFGSAVPRWSHGVDWRSPLGLRPQIRAAAPLIERFHRRIATSATDNPFKGN  96

Query  325  FTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
             TSLPKPGGGEFGKFYSLP+LNDPRI  LPYSIRILLE
Sbjct  97   LTSLPKPGGGEFGKFYSLPSLNDPRIDRLPYSIRILLE  134



>ref|XP_009787319.1| PREDICTED: aconitate hydratase, cytoplasmic-like isoform X1 [Nicotiana 
sylvestris]
Length=1017

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +1

Query  154  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  333
            F+SA  SL  S PRWSHGVDW+SP SL AQIR+A+P +    R IATMASE+PF+GIFTS
Sbjct  73   FSSALPSLSYSTPRWSHGVDWRSPISLRAQIRTASPDIERLDRNIATMASEHPFRGIFTS  132

Query  334  LPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            LPKPGGGEFGKFYSL ALNDPRI  LP+SIRILLE
Sbjct  133  LPKPGGGEFGKFYSLTALNDPRIDKLPFSIRILLE  167



>ref|XP_004251517.2| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=981

 Score =   145 bits (366),  Expect = 6e-37, Method: Composition-based stats.
 Identities = 72/93 (77%), Positives = 78/93 (84%), Gaps = 7/93 (8%)
 Frame = +1

Query  166  FRSLRCSVPRWSHGVDWKSPASLTAQIRSAA--PVLNDFHRKIATMASENPFKGIFTSLP  339
            FRSLR     W +GVDWKSP SLT+QIR+AA  PVLN+F RK+ TMAS NPFKGI TSLP
Sbjct  44   FRSLR-----WRYGVDWKSPISLTSQIRTAAVTPVLNNFRRKLTTMASGNPFKGILTSLP  98

Query  340  KPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            KPGGGEFGK+YSLPALNDPRI  LPYSIRILLE
Sbjct  99   KPGGGEFGKYYSLPALNDPRIDKLPYSIRILLE  131



>gb|KHN36531.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=984

 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +1

Query  145  PLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGI  324
            P + ++A RS   +VPRWSHGVDW+SP  L  QIR+AAP++  FHR+IAT A++NPFKG 
Sbjct  37   PGSSSAATRSFGSAVPRWSHGVDWRSPLGLRPQIRAAAPLIERFHRRIATSATDNPFKGN  96

Query  325  FTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
             TSLP+PGGGEFGKFYSLP+LNDPRI  LPYSIRILLE
Sbjct  97   LTSLPRPGGGEFGKFYSLPSLNDPRIDRLPYSIRILLE  134



>gb|KJB60836.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=860

 Score =   144 bits (363),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +1

Query  157  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSL  336
            ++A RS  CSVPRWSH +DW+SP SL AQIR+  PV+    RK +TMA+E+PFK + TSL
Sbjct  47   SAAVRSFHCSVPRWSHRLDWRSPFSLRAQIRAVNPVIERLERKFSTMAAEHPFKAVLTSL  106

Query  337  PKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            PKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  107  PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  140



>gb|KJB60837.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=865

 Score =   144 bits (363),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +1

Query  157  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSL  336
            ++A RS  CSVPRWSH +DW+SP SL AQIR+  PV+    RK +TMA+E+PFK + TSL
Sbjct  47   SAAVRSFHCSVPRWSHRLDWRSPFSLRAQIRAVNPVIERLERKFSTMAAEHPFKAVLTSL  106

Query  337  PKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            PKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  107  PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  140



>gb|KJB60835.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=990

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +1

Query  157  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSL  336
            ++A RS  CSVPRWSH +DW+SP SL AQIR+  PV+    RK +TMA+E+PFK + TSL
Sbjct  47   SAAVRSFHCSVPRWSHRLDWRSPFSLRAQIRAVNPVIERLERKFSTMAAEHPFKAVLTSL  106

Query  337  PKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            PKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  107  PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  140



>ref|XP_007045642.1| Aconitase 3 [Theobroma cacao]
 gb|EOY01474.1| Aconitase 3 [Theobroma cacao]
Length=995

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R LT ++A RS   SVPRWSH +DW+SP SL AQIR+  PV+    RK ATMASE+PFK 
Sbjct  48   RSLT-SAAVRSFHGSVPRWSHRLDWRSPLSLRAQIRAVTPVIERLERKFATMASEHPFKA  106

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            + TSLPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  107  VLTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  145



>gb|EYU24785.1| hypothetical protein MIMGU_mgv1a000742mg [Erythranthe guttata]
Length=997

 Score =   142 bits (359),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 71/86 (83%), Positives = 73/86 (85%), Gaps = 1/86 (1%)
 Frame = +1

Query  184  SVPRWSHGVDWKSPASLTAQIR-SAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEF  360
            S  RWSHGVDWKSPASL +QIR S+A      HRKIATMASEN FKGIFTSLPKPGGGEF
Sbjct  60   SAARWSHGVDWKSPASLASQIRISSAFSDTLLHRKIATMASENAFKGIFTSLPKPGGGEF  119

Query  361  GKFYSLPALNDPRIX*LPYSIRILLE  438
            GKFYSLPALNDPRI  LPYSIRILLE
Sbjct  120  GKFYSLPALNDPRIDKLPYSIRILLE  145



>gb|KDP39136.1| hypothetical protein JCGZ_00893 [Jatropha curcas]
Length=1002

 Score =   142 bits (358),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 69/99 (70%), Positives = 80/99 (81%), Gaps = 6/99 (6%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R L+F+   RSLRCS P WSHGVDW SP SL AQ R ++PV+    R+++TM SE+PFKG
Sbjct  57   RYLSFS---RSLRCSAPLWSHGVDWHSPISLRAQARVSSPVV---ERRLSTMTSEHPFKG  110

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            I T+LPKPGGGEFGKFY+LPALNDPRI  LPYSIRILLE
Sbjct  111  ILTNLPKPGGGEFGKFYNLPALNDPRIDRLPYSIRILLE  149



>ref|XP_003540302.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score =   142 bits (357),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +1

Query  145  PLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGI  324
            P + A+A RS   +VPRWS GVDW+SP  L   IR+AAP++  FHR+IAT A+ENPFKG 
Sbjct  37   PGSSAAATRSFGSAVPRWSRGVDWRSPLGLRPHIRAAAPLIERFHRRIATSATENPFKGN  96

Query  325  FTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
             TSLP+PGGGEFGKFYSLP+LNDPRI  LPYSIRILLE
Sbjct  97   LTSLPRPGGGEFGKFYSLPSLNDPRIDRLPYSIRILLE  134



>gb|KJB50479.1| hypothetical protein B456_008G173400 [Gossypium raimondii]
Length=996

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 80/99 (81%), Gaps = 1/99 (1%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R LT ++A RS  CSVPRWSH +DW+SP +L ++IR+  P++    RK ATMA+E+PFK 
Sbjct  49   RSLT-SAAVRSFHCSVPRWSHRLDWRSPLNLRSEIRAFNPIIEQLQRKFATMAAEHPFKA  107

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            + TSLP+PGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  108  VLTSLPRPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  146



>ref|XP_011100304.1| PREDICTED: aconitate hydratase, cytoplasmic [Sesamum indicum]
Length=1001

 Score =   141 bits (355),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 74/94 (79%), Positives = 77/94 (82%), Gaps = 4/94 (4%)
 Frame = +1

Query  166  FRSLR-CSVPRWSHGVDWKSPASLTAQIRSAAPVLND--FHRKIATMASENPFKGIFTSL  336
             RSL   S  RWSHGVDWKSP SL AQIR A+ V +D   HRKIATMA+ENPFKGIFTSL
Sbjct  55   LRSLSYLSAARWSHGVDWKSPPSLAAQIRIAS-VSSDTLLHRKIATMAAENPFKGIFTSL  113

Query  337  PKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            PK GGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  114  PKSGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  147



>ref|XP_006346211.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=980

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 82/96 (85%), Gaps = 4/96 (4%)
 Frame = +1

Query  154  FASAFRSLRCSVPRWS-HGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  330
            FA+ +RS+RCSVPRWS +GV+ + P SL AQIR+A+ V+    R +ATMASE+PFKGIFT
Sbjct  38   FATTYRSIRCSVPRWSNYGVNRRFPISLKAQIRTASQVV---ERNVATMASEHPFKGIFT  94

Query  331  SLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            SLPKPGGGEFGKFYSLPALNDPRI  LP+SIRILLE
Sbjct  95   SLPKPGGGEFGKFYSLPALNDPRINKLPFSIRILLE  130



>gb|KHG15607.1| Aconitate hydratase 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=668

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R LT ++A RS  CSVPRWS  +DW+SP +L ++IR+  P++    RK ATMA+E+PFK 
Sbjct  49   RSLT-STAVRSFHCSVPRWSPRLDWRSPLNLRSEIRAFNPIIEQLQRKFATMAAEHPFKA  107

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            + TSLPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  108  VLTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  146



>ref|XP_007149973.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
 gb|ESW21967.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
Length=983

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  184  SVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFG  363
            +VPRWSHGVDW+SP  L  QIR+ AP++  FHR+IAT A +NPFKG  TSLPKPGGGEFG
Sbjct  49   AVPRWSHGVDWRSPLGLRHQIRAVAPLIERFHRRIATSALDNPFKGNLTSLPKPGGGEFG  108

Query  364  KFYSLPALNDPRIX*LPYSIRILLE  438
            KFYSLP+LNDPRI  LPYSIRILLE
Sbjct  109  KFYSLPSLNDPRIDRLPYSIRILLE  133



>ref|XP_010445106.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=383

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 79/101 (78%), Gaps = 2/101 (2%)
 Frame = +1

Query  142  RPLTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  315
            R  +F+SA RS R CS   RWSHG  W+ PASL AQ R++APV+  F RK AT+ASE+ +
Sbjct  47   RSKSFSSALRSFRVCSASTRWSHGGSWRYPASLRAQSRNSAPVMEKFERKYATIASEHAY  106

Query  316  KGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            K I TSLPKPGGGE+G++YSLPALNDPR+  LPYS+RILLE
Sbjct  107  KDILTSLPKPGGGEYGQYYSLPALNDPRVDKLPYSVRILLE  147



>gb|KHG18502.1| Aconitate hydratase 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=933

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 76/94 (81%), Gaps = 1/94 (1%)
 Frame = +1

Query  157  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSL  336
            ++A RS  CS PRWSH +DW+SP SL AQ+R+  PV+    RK +TMA+E+PFK + TSL
Sbjct  47   SAAVRSFHCS-PRWSHRLDWRSPFSLRAQVRAVNPVIERLERKFSTMAAEHPFKAVLTSL  105

Query  337  PKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            PKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  106  PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  139



>ref|XP_009599619.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana tomentosiformis]
Length=985

 Score =   137 bits (345),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 71/101 (70%), Positives = 78/101 (77%), Gaps = 11/101 (11%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAA--PVLNDFHRKIATMASENPF  315
            R L F+SA RSLR     W    +WKSP  L AQIR+ A  PVLN FHRK++TMA+ENPF
Sbjct  44   RSLNFSSAVRSLR-----W----NWKSPIILKAQIRTTATTPVLNSFHRKLSTMAAENPF  94

Query  316  KGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            KGI T LPKPGGGEFGK+YSLPALNDPRI  LPYSIRILLE
Sbjct  95   KGILTVLPKPGGGEFGKYYSLPALNDPRIDKLPYSIRILLE  135



>ref|XP_009769027.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana sylvestris]
Length=989

 Score =   137 bits (345),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 71/101 (70%), Positives = 79/101 (78%), Gaps = 11/101 (11%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAA--PVLNDFHRKIATMASENPF  315
            R L+F+SA RSLR     W    +WKSP SL AQIR+ A  PVLN  HRK++TMA+ENPF
Sbjct  48   RSLSFSSAVRSLR-----W----NWKSPISLKAQIRTTATTPVLNSSHRKLSTMAAENPF  98

Query  316  KGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            KGI T LPKPGGGEFGK+YSLPALNDPRI  LPYSIRILLE
Sbjct  99   KGILTVLPKPGGGEFGKYYSLPALNDPRIDKLPYSIRILLE  139



>gb|KJB62848.1| hypothetical protein B456_009G440000 [Gossypium raimondii]
Length=864

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 78/99 (79%), Gaps = 4/99 (4%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R L+F+ + RSLRCS PR    + W+SP SL    R++ PV+  FHR+IAT ASE+PFKG
Sbjct  49   RSLSFSYSLRSLRCSAPR----LHWRSPESLRVLARTSVPVVERFHRRIATTASEHPFKG  104

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            + TSLPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  105  VMTSLPKPGGGEFGKFYSLPALNDPRIDRLPYSIRILLE  143



>gb|KJB62847.1| hypothetical protein B456_009G440000 [Gossypium raimondii]
Length=993

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 78/99 (79%), Gaps = 4/99 (4%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R L+F+ + RSLRCS PR    + W+SP SL    R++ PV+  FHR+IAT ASE+PFKG
Sbjct  49   RSLSFSYSLRSLRCSAPR----LHWRSPESLRVLARTSVPVVERFHRRIATTASEHPFKG  104

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            + TSLPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  105  VMTSLPKPGGGEFGKFYSLPALNDPRIDRLPYSIRILLE  143



>ref|XP_003596988.1| Aconitate hydratase [Medicago truncatula]
 gb|AES67239.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +1

Query  148  LTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  327
             T ++   + R +V RWSHGV W+SP SL  QIR+ AP +  +HRKIAT A ENPFKG  
Sbjct  33   FTSSAVANAARSTVNRWSHGVLWRSPFSLRPQIRAVAPFIEQYHRKIATSAGENPFKGNL  92

Query  328  TSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            TSLPKPGGGEFGKFYSLP+LNDPRI  LPYSIRILLE
Sbjct  93   TSLPKPGGGEFGKFYSLPSLNDPRIDRLPYSIRILLE  129



>ref|XP_010448188.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=998

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 80/101 (79%), Gaps = 2/101 (2%)
 Frame = +1

Query  142  RPLTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  315
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R++APV+  F RK ATMASE+ +
Sbjct  48   RSKSFSSALRSFRVCSASTRWSHGGSWRSPASLRAQSRNSAPVMEKFERKYATMASEHAY  107

Query  316  KGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            K I TSLPKPGGGE+G++YSLPALNDPR+  LPYS+RILLE
Sbjct  108  KDILTSLPKPGGGEYGQYYSLPALNDPRVDKLPYSVRILLE  148



>ref|XP_004487412.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=984

 Score =   136 bits (343),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 63/84 (75%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +1

Query  187  VPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGK  366
            V RWSHGV W+SP SL  QIR+ AP +  FHRKIAT A ENPFKG   +LPKPGGGEFGK
Sbjct  52   VNRWSHGVHWRSPFSLRPQIRAVAPFIERFHRKIATSAGENPFKGNLATLPKPGGGEFGK  111

Query  367  FYSLPALNDPRIX*LPYSIRILLE  438
            FYSLP+LNDPRI  LPYSIRILLE
Sbjct  112  FYSLPSLNDPRIDRLPYSIRILLE  135



>ref|XP_006283068.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
 gb|EOA15966.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
Length=995

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 79/101 (78%), Gaps = 2/101 (2%)
 Frame = +1

Query  142  RPLTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  315
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+  F RK ATMASE+ +
Sbjct  45   RSKSFSSALRSFRVCSASTRWSHGGSWRSPASLRAQSRISAPVMEKFERKYATMASEHAY  104

Query  316  KGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            K I TSLPKPGGGE+GK+YSLPALNDPR+  LPYS+RILLE
Sbjct  105  KDILTSLPKPGGGEYGKYYSLPALNDPRVDKLPYSVRILLE  145



>ref|XP_008379632.1| PREDICTED: aconitate hydratase, cytoplasmic [Malus domestica]
Length=994

 Score =   136 bits (342),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 78/98 (80%), Gaps = 2/98 (2%)
 Frame = +1

Query  148  LTFASAFRSLRCSVPRWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGI  324
            L F SA  + R S PRWSHG V W+SP +L +QIR+ APV+  F RKIA+MASENPFK  
Sbjct  48   LRFLSASSAAR-SFPRWSHGGVHWRSPYTLRSQIRAVAPVIEQFQRKIASMASENPFKAN  106

Query  325  FTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
             TSLPKPGGGEFGKFYSLP+LNDPRI  LPYSIRILLE
Sbjct  107  LTSLPKPGGGEFGKFYSLPSLNDPRIDKLPYSIRILLE  144



>ref|XP_004159202.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Cucumis sativus]
Length=989

 Score =   136 bits (342),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 77/99 (78%), Gaps = 4/99 (4%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R L+ +SAFRS      RWSHGV W+SP SL AQIR+ AP +   HRK ++MA+ENPFK 
Sbjct  45   RSLSASSAFRS----TARWSHGVGWRSPLSLRAQIRAVAPAIERLHRKFSSMAAENPFKE  100

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
              TSLPKPGGGEFGK+YSLP+LNDPRI  LPYSIRILLE
Sbjct  101  NLTSLPKPGGGEFGKYYSLPSLNDPRIDKLPYSIRILLE  139



>ref|XP_008455442.1| PREDICTED: aconitate hydratase, cytoplasmic [Cucumis melo]
Length=989

 Score =   136 bits (342),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 77/99 (78%), Gaps = 4/99 (4%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R L+ +SAFRS      RWSHGV W+SP SL AQIR+ AP +   HRK ++MA+ENPFK 
Sbjct  45   RSLSASSAFRS----TTRWSHGVGWRSPLSLRAQIRAVAPAIERLHRKFSSMAAENPFKE  100

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
              TSLPKPGGGEFGK+YSLP+LNDPRI  LPYSIRILLE
Sbjct  101  NLTSLPKPGGGEFGKYYSLPSLNDPRIDKLPYSIRILLE  139



>ref|XP_009353280.1| PREDICTED: aconitate hydratase, cytoplasmic [Pyrus x bretschneideri]
Length=994

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 79/100 (79%), Gaps = 5/100 (5%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFK  318
            R L+ +SA RS     PRWSHG V W+SP +L +QIR+ APV+  F RKIA+MASENPFK
Sbjct  49   RFLSSSSAARSF----PRWSHGGVHWRSPYTLRSQIRAVAPVIEQFQRKIASMASENPFK  104

Query  319  GIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
               TSLPKPGGGEFGKFYSLP+LNDPRI  LPYSIRILLE
Sbjct  105  ANLTSLPKPGGGEFGKFYSLPSLNDPRIDKLPYSIRILLE  144



>ref|XP_006413121.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
 gb|ESQ54574.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
Length=999

 Score =   135 bits (340),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 65/101 (64%), Positives = 79/101 (78%), Gaps = 2/101 (2%)
 Frame = +1

Query  142  RPLTFASAFRSLRC--SVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  315
            R  +F+SA RS R   +  RWS+G +W+SPASL AQ R++APV+  F RK ATMASE+ +
Sbjct  48   RSKSFSSALRSFRVGSASTRWSYGGNWRSPASLRAQTRNSAPVMERFERKYATMASEHAY  107

Query  316  KGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            K I TSLPKP GGE+GK+YSLPALNDPRI  LPYS+RILLE
Sbjct  108  KDILTSLPKPDGGEYGKYYSLPALNDPRIDRLPYSVRILLE  148



>ref|XP_004144496.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Cucumis sativus]
 gb|KGN43521.1| hypothetical protein Csa_7G043630 [Cucumis sativus]
Length=989

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 77/99 (78%), Gaps = 4/99 (4%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R L+ +SAFRS      RWSHGV W+SP SL AQIR+ AP +   HRK ++MA+ENPFK 
Sbjct  45   RSLSASSAFRS----TARWSHGVGWRSPLSLRAQIRAVAPAIERLHRKFSSMAAENPFKE  100

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
              TSLPKPGGGE+GK+YSLP+LNDPRI  LPYSIRILLE
Sbjct  101  NLTSLPKPGGGEYGKYYSLPSLNDPRIDKLPYSIRILLE  139



>ref|XP_003527493.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Glycine max]
Length=979

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R  +F++A   LRCSVPRWSH +   SP S    I + APV+  FHR+IATMA+ENPFKG
Sbjct  31   RTSSFSAAPSLLRCSVPRWSHRLHSTSPLSPRPPITAVAPVVERFHRQIATMANENPFKG  90

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
              TSLPKPGGGEFGKFYSLP+LNDPRI  LPYSIRILLE
Sbjct  91   NLTSLPKPGGGEFGKFYSLPSLNDPRIDRLPYSIRILLE  129



>ref|NP_567763.2| aconitase 2 [Arabidopsis thaliana]
 sp|Q94A28.3|ACO3M_ARATH RecName: Full=Aconitate hydratase 3, mitochondrial; Short=Aconitase 
3; AltName: Full=Citrate hydro-lyase 3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE85279.1| aconitase 2 [Arabidopsis thaliana]
Length=995

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 78/101 (77%), Gaps = 2/101 (2%)
 Frame = +1

Query  142  RPLTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  315
            R  +F+SA RS R CS   RWSHG  W SPASL AQ R++ PV+  F RK ATMASE+ +
Sbjct  45   RSKSFSSALRSFRVCSASTRWSHGGSWGSPASLRAQARNSTPVMEKFERKYATMASEHSY  104

Query  316  KGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            K I TSLPKPGGGE+GK+YSLPALNDPRI  LP+S+RILLE
Sbjct  105  KDILTSLPKPGGGEYGKYYSLPALNDPRIDKLPFSVRILLE  145



>gb|AAK91447.1| AT4g26970/F10M23_310 [Arabidopsis thaliana]
 gb|AAN18061.1| At4g26970/F10M23_310 [Arabidopsis thaliana]
Length=995

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 78/101 (77%), Gaps = 2/101 (2%)
 Frame = +1

Query  142  RPLTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  315
            R  +F+SA RS R CS   RWSHG  W SPASL AQ R++ PV+  F RK ATMASE+ +
Sbjct  45   RSKSFSSALRSFRVCSASTRWSHGGSWGSPASLRAQARNSTPVMEKFERKYATMASEHSY  104

Query  316  KGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            K I TSLPKPGGGE+GK+YSLPALNDPRI  LP+S+RILLE
Sbjct  105  KDILTSLPKPGGGEYGKYYSLPALNDPRIDKLPFSVRILLE  145



>ref|XP_006592372.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Glycine max]
Length=890

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +1

Query  151  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  330
            +F++  RSL CSVPRWSH +   SP +   +I + AP++  FHR+IATMA+ENPFKG  T
Sbjct  39   SFSATARSLLCSVPRWSHRLHSASPLTPRPRISAVAPLVERFHREIATMANENPFKGNLT  98

Query  331  SLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            SLPKPGGGEFGKFYSLP+LNDPRI  LPYSIRILLE
Sbjct  99   SLPKPGGGEFGKFYSLPSLNDPRIDRLPYSIRILLE  134



>ref|XP_003539865.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Glycine max]
Length=984

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +1

Query  151  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  330
            +F++  RSL CSVPRWSH +   SP +   +I + AP++  FHR+IATMA+ENPFKG  T
Sbjct  39   SFSATARSLLCSVPRWSHRLHSASPLTPRPRISAVAPLVERFHREIATMANENPFKGNLT  98

Query  331  SLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            SLPKPGGGEFGKFYSLP+LNDPRI  LPYSIRILLE
Sbjct  99   SLPKPGGGEFGKFYSLPSLNDPRIDRLPYSIRILLE  134



>ref|XP_002869584.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45843.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
Length=995

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 78/101 (77%), Gaps = 2/101 (2%)
 Frame = +1

Query  142  RPLTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  315
            R  +F+SA RS R CS   RWSHGV W SPASL AQ R++APV+  F R  ATMASE+ +
Sbjct  45   RSKSFSSALRSFRVCSASTRWSHGVSWGSPASLRAQSRNSAPVMEKFERTYATMASEHAY  104

Query  316  KGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            K I TSLPKPGGGE+G +YSLPALNDPR+  LP+S+RILLE
Sbjct  105  KDILTSLPKPGGGEYGNYYSLPALNDPRVDKLPFSVRILLE  145



>ref|XP_008230066.1| PREDICTED: aconitate hydratase, cytoplasmic [Prunus mume]
Length=994

 Score =   133 bits (335),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 63/83 (76%), Positives = 70/83 (84%), Gaps = 1/83 (1%)
 Frame = +1

Query  193  RWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKF  369
            RWSHG V W+SP +L +QIR+ APV+  F RKIA+MASENPFK   TSLPKPGGGEFGKF
Sbjct  64   RWSHGGVHWRSPYTLRSQIRAIAPVIEQFQRKIASMASENPFKANLTSLPKPGGGEFGKF  123

Query  370  YSLPALNDPRIX*LPYSIRILLE  438
            YSLP+LNDPRI  LPYSIRILLE
Sbjct  124  YSLPSLNDPRIDRLPYSIRILLE  146



>ref|XP_010433420.1| PREDICTED: aconitate hydratase 3, mitochondrial [Camelina sativa]
Length=997

 Score =   133 bits (335),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 65/101 (64%), Positives = 77/101 (76%), Gaps = 2/101 (2%)
 Frame = +1

Query  142  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  315
            R  +F+SA RS R CS   RWSHG  W+SP SL AQ R++APV+  F RK ATM SE+ +
Sbjct  47   RSKSFSSALRSFRVCSASTRWSHGGSWRSPVSLRAQSRNSAPVMEKFERKYATMTSEHAY  106

Query  316  KGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            K I TSLPKPGGG +GK+YSLPALNDPR+  LPYS+RILLE
Sbjct  107  KDILTSLPKPGGGAYGKYYSLPALNDPRVDKLPYSVRILLE  147



>ref|XP_007217144.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
 gb|EMJ18343.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
Length=996

 Score =   133 bits (334),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 62/83 (75%), Positives = 70/83 (84%), Gaps = 1/83 (1%)
 Frame = +1

Query  193  RWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKF  369
            RWSHG V W+SP +L +QIR+ APV+  F RK+A+MASENPFK   TSLPKPGGGEFGKF
Sbjct  64   RWSHGGVHWRSPYTLRSQIRAVAPVIEQFQRKMASMASENPFKANLTSLPKPGGGEFGKF  123

Query  370  YSLPALNDPRIX*LPYSIRILLE  438
            YSLP+LNDPRI  LPYSIRILLE
Sbjct  124  YSLPSLNDPRIDRLPYSIRILLE  146



>emb|CDY14291.1| BnaA08g14220D [Brassica napus]
Length=995

 Score =   133 bits (334),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 65/101 (64%), Positives = 78/101 (77%), Gaps = 2/101 (2%)
 Frame = +1

Query  142  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  315
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+    R+ A+MASE+ +
Sbjct  45   RSRSFSSALRSYRVCSASTRWSHGGSWRSPASLRAQARVSAPVMERLERRYASMASEHAY  104

Query  316  KGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            K + TSLPKPGGGE+GK+YSLPALNDPRI  LPYS+RILLE
Sbjct  105  KDLLTSLPKPGGGEYGKYYSLPALNDPRIDKLPYSVRILLE  145



>emb|CDY66424.1| BnaAnng22230D [Brassica napus]
Length=995

 Score =   133 bits (334),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 65/101 (64%), Positives = 78/101 (77%), Gaps = 2/101 (2%)
 Frame = +1

Query  142  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  315
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+    R+ A+MASE+ +
Sbjct  45   RSRSFSSALRSYRVCSASTRWSHGGSWRSPASLRAQARVSAPVMERLERRYASMASEHAY  104

Query  316  KGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            K + TSLPKPGGGE+GK+YSLPALNDPRI  LPYS+RILLE
Sbjct  105  KDLLTSLPKPGGGEYGKYYSLPALNDPRIDKLPYSVRILLE  145



>ref|XP_010467089.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=994

 Score =   132 bits (333),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 77/97 (79%), Gaps = 5/97 (5%)
 Frame = +1

Query  151  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  327
            T + AFRSL    PRWSH    K SP SLT+QIR+ +PVL+   R  ++MASE+P+KGIF
Sbjct  52   TISPAFRSL----PRWSHCFHSKPSPFSLTSQIRAVSPVLDRLQRTFSSMASEHPYKGIF  107

Query  328  TSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            T+LPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  108  TTLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  144



>ref|XP_009109156.1| PREDICTED: aconitate hydratase 3, mitochondrial [Brassica rapa]
Length=995

 Score =   131 bits (330),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 64/98 (65%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +1

Query  151  TFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGI  324
            +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+    R+ A+MASE+ ++ I
Sbjct  48   SFSSALRSYRVCSASTRWSHGGSWRSPASLRAQARVSAPVMERLERRYASMASEHTYQDI  107

Query  325  FTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
             TSLPKPGGGE+GK+YSLPALNDPRI  LPYS+RILLE
Sbjct  108  LTSLPKPGGGEYGKYYSLPALNDPRIDKLPYSVRILLE  145



>ref|XP_002883704.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59963.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
Length=993

 Score =   131 bits (330),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 75/97 (77%), Gaps = 5/97 (5%)
 Frame = +1

Query  151  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  327
            T + AFRSL    PRWSH    K SP  LT QIR+ +PVL+   R  ++MASE+PFKGIF
Sbjct  51   TISPAFRSL----PRWSHCFHSKPSPFRLTTQIRAVSPVLDRLERTFSSMASEHPFKGIF  106

Query  328  TSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            T+LPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  107  TTLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  143



>ref|XP_010675721.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Beta vulgaris 
subsp. vulgaris]
Length=1015

 Score =   131 bits (330),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 60/79 (76%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +1

Query  202  HGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLP  381
            HGVDW+SP SL +QI ++ P++  F RKIATMASE+P+K IFTSLPKPGGGEFGKFYSLP
Sbjct  87   HGVDWRSPVSLRSQIAASPPLVERFQRKIATMASEHPYKEIFTSLPKPGGGEFGKFYSLP  146

Query  382  ALNDPRIX*LPYSIRILLE  438
            ALNDPR+  LPYSIRILLE
Sbjct  147  ALNDPRVEKLPYSIRILLE  165



>gb|KHG08190.1| Aconitate hydratase 2, mitochondrial [Gossypium arboreum]
Length=973

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +1

Query  151  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  330
            T +   RS   S  RW H +DW+SP SL AQIR+  PV   F ++ ATMA+E+PFK + T
Sbjct  47   TASVVVRSFHSSASRWCHRLDWRSPLSLRAQIRAFNPVTERFQKQFATMAAEHPFKEVLT  106

Query  331  SLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            SLPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  107  SLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  142



>gb|KJB30566.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
 gb|KJB30567.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=992

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +1

Query  151  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  330
            T +   RS   S  RW H +DW+SP SL AQIR+  PV+  F ++ ATMA+E+PFK + T
Sbjct  47   TASVVVRSFHSSASRWCHRLDWRSPFSLRAQIRALNPVIERFQKQFATMAAEHPFKEVLT  106

Query  331  SLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            SLPKPGGGEFGKFYSLPALNDPRI  LPYSI ILLE
Sbjct  107  SLPKPGGGEFGKFYSLPALNDPRIDKLPYSITILLE  142



>gb|KJB30569.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=985

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +1

Query  151  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  330
            T +   RS   S  RW H +DW+SP SL AQIR+  PV+  F ++ ATMA+E+PFK + T
Sbjct  47   TASVVVRSFHSSASRWCHRLDWRSPFSLRAQIRALNPVIERFQKQFATMAAEHPFKEVLT  106

Query  331  SLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            SLPKPGGGEFGKFYSLPALNDPRI  LPYSI ILLE
Sbjct  107  SLPKPGGGEFGKFYSLPALNDPRIDKLPYSITILLE  142



>ref|XP_008342002.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Malus domestica]
Length=992

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 70/84 (83%), Gaps = 1/84 (1%)
 Frame = +1

Query  190  PRWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGK  366
            PRWSHG V W+S  +L +QIR+ APV+  F RKIA+MASENPFK   TSLPKPGGGEFGK
Sbjct  59   PRWSHGGVHWRSSYTLRSQIRAVAPVIEQFQRKIASMASENPFKPNLTSLPKPGGGEFGK  118

Query  367  FYSLPALNDPRIX*LPYSIRILLE  438
            FYSLP+LNDPRI  LPYSIRILLE
Sbjct  119  FYSLPSLNDPRIDRLPYSIRILLE  142



>ref|XP_010488774.1| PREDICTED: aconitate hydratase 2, mitochondrial [Camelina sativa]
Length=991

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 77/97 (79%), Gaps = 5/97 (5%)
 Frame = +1

Query  151  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  327
            T + AFRSL    PRWSH    K SP SLT+QIR+ +PVL+   R  ++MASE+P+KGIF
Sbjct  49   TISPAFRSL----PRWSHCFHSKPSPFSLTSQIRAVSPVLDRLQRTFSSMASEHPYKGIF  104

Query  328  TSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            T+LPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  105  TTLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  141



>ref|XP_006296904.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
 gb|EOA29802.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
Length=988

 Score =   128 bits (321),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 63/93 (68%), Positives = 74/93 (80%), Gaps = 1/93 (1%)
 Frame = +1

Query  163  AFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLP  339
            +F S+  +  RWSH    K SP SLT+QIR+ +PVL+   R  ++MASE+PFKGIFT+LP
Sbjct  46   SFGSISPAFRRWSHCFHSKPSPISLTSQIRAVSPVLDRLQRTFSSMASEHPFKGIFTALP  105

Query  340  KPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            KPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  106  KPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  138



>gb|KFK29204.1| hypothetical protein AALP_AA7G102800 [Arabis alpina]
Length=999

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 78/103 (76%), Gaps = 4/103 (4%)
 Frame = +1

Query  142  RPLTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMAS--EN  309
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+  F RK AT+AS  E+
Sbjct  47   RSKSFSSALRSFRVCSASTRWSHGGSWRSPASLRAQARISAPVMERFERKYATIASDSEH  106

Query  310  PFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
             +K I TSLPKP GGE+GK+YSLPALNDPR+  LPYS+RILLE
Sbjct  107  AYKDILTSLPKPDGGEYGKYYSLPALNDPRVDKLPYSVRILLE  149



>ref|XP_009148490.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=991

 Score =   127 bits (318),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 64/97 (66%), Positives = 76/97 (78%), Gaps = 5/97 (5%)
 Frame = +1

Query  151  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  327
            T + AFRSL    PRWSH +  + SP  L++QIR+ +P L+   R  ++MASE+PFKGIF
Sbjct  49   TSSPAFRSL----PRWSHCLHSRPSPFRLSSQIRAVSPGLDRLERNFSSMASEHPFKGIF  104

Query  328  TSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            T+LPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  105  TTLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  141



>emb|CDX97969.1| BnaA06g07200D [Brassica napus]
Length=991

 Score =   126 bits (317),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 64/97 (66%), Positives = 76/97 (78%), Gaps = 5/97 (5%)
 Frame = +1

Query  151  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  327
            T + AFRSL    PRWSH +  + SP  L++QIR+ +P L+   R  ++MASE+PFKGIF
Sbjct  49   TSSPAFRSL----PRWSHCLHSRPSPFRLSSQIRAVSPGLDRLERNFSSMASEHPFKGIF  104

Query  328  TSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            T+LPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  105  TTLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  141



>ref|XP_010412716.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=991

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 76/97 (78%), Gaps = 5/97 (5%)
 Frame = +1

Query  151  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  327
            T + AFRSL    PRWSH    K SP SLT+QIR+ +PVL+   R  ++MASE+P+KGIF
Sbjct  49   TISPAFRSL----PRWSHCFHSKPSPFSLTSQIRAVSPVLDRLQRTFSSMASEHPYKGIF  104

Query  328  TSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            T+LPKP GGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  105  TTLPKPSGGEFGKFYSLPALNDPRIDKLPYSIRILLE  141



>ref|XP_010929878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Elaeis 
guineensis]
Length=1009

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 71/90 (79%), Gaps = 1/90 (1%)
 Frame = +1

Query  169  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPG  348
            R L  S   W HG +W+SP SL AQIRS+A V+  F RK+AT+A+ENPFK I TSLPKP 
Sbjct  69   RPLVRSFGTWRHG-NWRSPVSLRAQIRSSAVVIERFQRKMATLATENPFKNILTSLPKPR  127

Query  349  GGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            GGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  128  GGEFGKFYSLPALNDPRIDKLPYSIRILLE  157



>emb|CDY50945.1| BnaC03g74450D [Brassica napus]
Length=995

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 79/101 (78%), Gaps = 6/101 (6%)
 Frame = +1

Query  142  RPLTFAS-AFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPF  315
            RP   +S AFRSL    PRWSH +  + SP  L++QIR+ +P L+   RK ++MASE+PF
Sbjct  49   RPFATSSPAFRSL----PRWSHCLHSRLSPFRLSSQIRAVSPGLDRLERKFSSMASEHPF  104

Query  316  KGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            KGIFT+LPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  105  KGIFTTLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  145



>ref|NP_178634.2| aconitate hydratase 3 [Arabidopsis thaliana]
 sp|Q9SIB9.2|ACO2M_ARATH RecName: Full=Aconitate hydratase 2, mitochondrial; Short=Aconitase 
2; AltName: Full=Citrate hydro-lyase 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAM97080.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
 gb|AAP68248.1| At2g05710 [Arabidopsis thaliana]
 gb|AEC05964.1| aconitate hydratase 3 [Arabidopsis thaliana]
Length=990

 Score =   124 bits (311),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 62/97 (64%), Positives = 72/97 (74%), Gaps = 8/97 (8%)
 Frame = +1

Query  151  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  327
            T + AFR       RWSH    K SP   T+QIR+ +PVL+   R  ++MASE+PFKGIF
Sbjct  51   TISPAFR-------RWSHSFHSKPSPFRFTSQIRAVSPVLDRLQRTFSSMASEHPFKGIF  103

Query  328  TSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            T+LPKPGGGEFGKFYSLPALNDPR+  LPYSIRILLE
Sbjct  104  TTLPKPGGGEFGKFYSLPALNDPRVDKLPYSIRILLE  140



>ref|XP_010443085.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443086.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443087.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443088.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443089.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443090.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443091.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443092.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
Length=981

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +1

Query  148  LTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            + F  AFR  R CS   RWSHG +W+ PASL AQ R AAP L  F RK A++ASE+ +K 
Sbjct  38   VKFLLAFRLFRVCSAATRWSHGANWRLPASLQAQTRIAAPRLKKFERKFASIASEHAYKD  97

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            I T+L KP GGE+GKFYSLPALNDPRI  LPYS+RILLE
Sbjct  98   ILTTLHKPDGGEYGKFYSLPALNDPRIDRLPYSVRILLE  136



>ref|XP_008804304.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Phoenix 
dactylifera]
Length=1010

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 70/90 (78%), Gaps = 1/90 (1%)
 Frame = +1

Query  169  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPG  348
            R L  S   W HG   +SP SL AQIRS+A V+  F RK+ATMA+ENPFK I TSLPKPG
Sbjct  70   RPLVRSFGTWRHGSS-RSPVSLRAQIRSSAAVIERFQRKMATMATENPFKNILTSLPKPG  128

Query  349  GGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            GGEFGKFYSLPAL+DPRI  LPYSIRILLE
Sbjct  129  GGEFGKFYSLPALSDPRIDKLPYSIRILLE  158



>gb|KFK39331.1| hypothetical protein AALP_AA3G230700 [Arabis alpina]
Length=986

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 76/97 (78%), Gaps = 5/97 (5%)
 Frame = +1

Query  151  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  327
            +FA+ FRSL    PRWSH +  + S   L++QIR+ +PVL+   R  ++MASE+PFKGIF
Sbjct  44   SFATCFRSL----PRWSHCLHSRPSSFRLSSQIRAVSPVLDRLQRTFSSMASEHPFKGIF  99

Query  328  TSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            T+LPKP GGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  100  TTLPKPDGGEFGKFYSLPALNDPRIDKLPYSIRILLE  136



>emb|CDX93088.1| BnaA03g38100D [Brassica napus]
Length=994

 Score =   122 bits (307),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 63/97 (65%), Positives = 75/97 (77%), Gaps = 5/97 (5%)
 Frame = +1

Query  151  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  327
            T + AFRSL    PRWSH +  + S   L++QIR+ +P L+   R  ++MASE+PFKGIF
Sbjct  52   TSSPAFRSL----PRWSHCLHSRPSLFRLSSQIRAVSPGLDRLERNFSSMASEHPFKGIF  107

Query  328  TSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            T+LPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  108  TTLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  144



>gb|KHG02134.1| hypothetical protein F383_25649 [Gossypium arboreum]
Length=993

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 68/86 (79%), Gaps = 4/86 (5%)
 Frame = +1

Query  181  CSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEF  360
            CS PR    + W+SP SL    R++ PV+  FHR+IAT ASE+PFKG+ TSLPKPGGGEF
Sbjct  62   CSAPR----LHWRSPESLRILARTSVPVVERFHRRIATTASEHPFKGVMTSLPKPGGGEF  117

Query  361  GKFYSLPALNDPRIX*LPYSIRILLE  438
            GKFYSLPALNDPRI  LPYSIRILLE
Sbjct  118  GKFYSLPALNDPRIDRLPYSIRILLE  143



>emb|CDY18054.1| BnaC07g04160D [Brassica napus]
Length=986

 Score =   122 bits (306),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 61/97 (63%), Positives = 76/97 (78%), Gaps = 5/97 (5%)
 Frame = +1

Query  151  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  327
            T++ AFRSL     RWSH +  + SP  L++QIR+A+PVL+   +  ++MASE+PFKGI 
Sbjct  44   TYSPAFRSL----ARWSHCLHSRPSPFRLSSQIRTASPVLDRLEKNFSSMASEHPFKGIL  99

Query  328  TSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            T+LPKPGGGEFGKFYSLPALND RI  LPY+IRILLE
Sbjct  100  TTLPKPGGGEFGKFYSLPALNDSRIDKLPYTIRILLE  136



>ref|XP_009136177.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=995

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 76/97 (78%), Gaps = 5/97 (5%)
 Frame = +1

Query  151  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  327
            T + AFRSL    PRWSH +  + SP  L++QIR+ +P L+   R  ++MASE+PFKGIF
Sbjct  53   TSSPAFRSL----PRWSHCLHSRPSPFRLSSQIRAVSPGLDRLERNFSSMASEHPFKGIF  108

Query  328  TSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            T+LPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  109  TTLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  145



>ref|XP_003605929.1| Aconitate hydratase [Medicago truncatula]
 gb|AES88126.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = +1

Query  169  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPG  348
            RS   S+PR++      S  SL  QI + AP++  FHRKIATMASENPFKG  TSLPKPG
Sbjct  40   RSFFYSLPRFNRRFHSSSHLSLRPQITAVAPLVERFHRKIATMASENPFKGNLTSLPKPG  99

Query  349  GGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            GGEFGKFYSLP+LNDPRI  LPYSIRILLE
Sbjct  100  GGEFGKFYSLPSLNDPRIDKLPYSIRILLE  129



>ref|XP_002279260.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI28935.3| unnamed protein product [Vitis vinifera]
Length=987

 Score =   120 bits (300),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 63/100 (63%), Positives = 72/100 (72%), Gaps = 9/100 (9%)
 Frame = +1

Query  142  RPLTFAS-AFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFK  318
            R L F+S AFRSLR         V+++ P SL AQI +A PV+  F R+IATMA EN FK
Sbjct  46   RSLRFSSSAFRSLR--------SVNFRPPMSLRAQIGAAVPVVEQFQRRIATMAPENAFK  97

Query  319  GIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            GI T LPK  GGEFGK+YSLPALNDPR+  LPYSIRILLE
Sbjct  98   GILTGLPKASGGEFGKYYSLPALNDPRVDKLPYSIRILLE  137



>ref|XP_010450391.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=980

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 71/91 (78%), Gaps = 1/91 (1%)
 Frame = +1

Query  169  RSLRCSVPRWSHGVDWKS-PASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKP  345
            RS   S+PR SH +  KS    L +QIR+ +PVL+   R  ++MASE+PFKGIFT+LPKP
Sbjct  40   RSFLTSLPRLSHCLHSKSFQIRLGSQIRAVSPVLDRLQRTFSSMASEHPFKGIFTTLPKP  99

Query  346  GGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            GGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  100  GGGEFGKFYSLPALNDPRIDKLPYSIRILLE  130



>ref|XP_002870438.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46697.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=977

 Score =   119 bits (299),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 58/90 (64%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = +1

Query  169  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPG  348
            RS   S+PR SH   +  P  + +QIR+ +PVL+   R  ++MASE+P+KGIFT+LPKPG
Sbjct  40   RSFVTSLPRLSHSKPF--PLRIGSQIRAVSPVLDRLQRTFSSMASEHPYKGIFTTLPKPG  97

Query  349  GGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            GGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  98   GGEFGKFYSLPALNDPRIDKLPYSIRILLE  127



>ref|XP_006396145.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
 gb|ESQ36924.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
Length=995

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 78/98 (80%), Gaps = 4/98 (4%)
 Frame = +1

Query  151  TFASAFRSLRCSVPRWSHGVDWKSPASL--TAQIRSAAPVLNDFHRKIATMASENPFKGI  324
            +FA++  + R S+PRWSH +  + P S   ++QIR+ +PVL+   R  ++MASE+PFKGI
Sbjct  50   SFATSSPTFR-SLPRWSHCLHSR-PYSFRFSSQIRAVSPVLDRLERNFSSMASEHPFKGI  107

Query  325  FTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            FTSLPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  108  FTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  145



>ref|XP_004287944.1| PREDICTED: aconitate hydratase, cytoplasmic [Fragaria vesca subsp. 
vesca]
Length=990

 Score =   117 bits (293),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 58/99 (59%), Positives = 71/99 (72%), Gaps = 1/99 (1%)
 Frame = +1

Query  145  PLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASEN-PFKG  321
            P +F +       +  RWSHGV W++P +L +QIR+ APV+    R+IATMA E+ PFK 
Sbjct  42   PRSFTAQRLLSSSAATRWSHGVHWRAPYTLRSQIRAIAPVVERVQRRIATMAPESHPFKE  101

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
              TSLPKPGGGE+GKFYSL +L DPRI  LPYSIRILLE
Sbjct  102  HLTSLPKPGGGEYGKFYSLTSLKDPRIDRLPYSIRILLE  140



>ref|XP_010440740.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010440741.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Camelina sativa]
Length=981

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 70/91 (77%), Gaps = 1/91 (1%)
 Frame = +1

Query  169  RSLRCSVPRWSHGVDWKS-PASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKP  345
            RS   S+PR SH +  K     L +QIR+ +PVL+   R  ++MASE+PFKGIFT+LPKP
Sbjct  41   RSFLTSLPRLSHCLHSKPFQIRLGSQIRAVSPVLDRLQRTFSSMASEHPFKGIFTTLPKP  100

Query  346  GGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            GGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  101  GGGEFGKFYSLPALNDPRIDKLPYSIRILLE  131



>ref|XP_007132546.1| hypothetical protein PHAVU_011G1037001g, partial [Phaseolus vulgaris]
 gb|ESW04540.1| hypothetical protein PHAVU_011G1037001g, partial [Phaseolus vulgaris]
Length=846

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = +1

Query  190  PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKF  369
            P+WSH +   SP +L   IR+ AP +  FHR+IA  A ENPFKG  TSLPKPGGGEFGKF
Sbjct  50   PQWSHRLRRVSPLTLRRPIRAVAPPVERFHREIAATAKENPFKGNLTSLPKPGGGEFGKF  109

Query  370  YSLPALNDPRIX*LPYSIRILLE  438
            YSLP+LNDPRI  LPYSIRILLE
Sbjct  110  YSLPSLNDPRIDRLPYSIRILLE  132



>emb|CDY56501.1| BnaAnng14360D [Brassica napus]
Length=973

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 75/98 (77%), Gaps = 6/98 (6%)
 Frame = +1

Query  151  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASEN-PFKGI  324
            T + AFRSL    PRWSH +  + S   L++ IR+A+PVL+   R  ++MASE+ PFKGI
Sbjct  42   TSSPAFRSL----PRWSHCLHSRPSLFRLSSHIRTASPVLDRLERNFSSMASEHHPFKGI  97

Query  325  FTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            FT+LPKPGGGEFGKFYSLPALNDPRI  LPY IRILLE
Sbjct  98   FTTLPKPGGGEFGKFYSLPALNDPRIDKLPYYIRILLE  135



>ref|XP_010533007.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Tarenaya 
hassleriana]
Length=998

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 70/93 (75%), Gaps = 6/93 (6%)
 Frame = +1

Query  163  AFRSLRCSVPRWSHGVDWKS-PASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLP  339
             FRSL    PRWSH +  +S P  +  QIR+ +PVL    +  +TMA E+PFKGIFTSLP
Sbjct  61   GFRSL----PRWSHCLHRRSIPLRVGPQIRAVSPVLERLEKTFSTMA-EHPFKGIFTSLP  115

Query  340  KPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            KPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  116  KPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  148



>ref|XP_004517086.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=979

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = +1

Query  169  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPG  348
            RS   S+PR++    + S  SL   I +  P +  FHR IATM++ENPFKG  TSLPKPG
Sbjct  40   RSFFSSIPRFNRRFHYTSYRSLRPHISAVTPGIERFHRTIATMSNENPFKGNLTSLPKPG  99

Query  349  GGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            GGEFGKFYSLP+LNDPRI  LPYSIRILLE
Sbjct  100  GGEFGKFYSLPSLNDPRIEKLPYSIRILLE  129



>ref|XP_002532564.1| aconitase, putative [Ricinus communis]
 gb|EEF29825.1| aconitase, putative [Ricinus communis]
Length=990

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 73/99 (74%), Gaps = 9/99 (9%)
 Frame = +1

Query  142  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  321
            R  +F+SA RSL C+V RWSH VDW+SP SL AQ  +A+PV+    RK++T+ASE+P   
Sbjct  51   RSFSFSSALRSLPCAVSRWSHRVDWRSPISLRAQAPAASPVI---ERKLSTIASEHP---  104

Query  322  IFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
                  KPGGGEFGKFYSL AL+DPRI  LPYSI+ILLE
Sbjct  105  ---XXXKPGGGEFGKFYSLTALDDPRIDRLPYSIKILLE  140



>ref|XP_010482909.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Camelina 
sativa]
Length=997

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 66/95 (69%), Gaps = 2/95 (2%)
 Frame = +1

Query  160  SAFRSLRC--SVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  333
            SAFR  R   S  RWS   +W+ P S  AQ R AAP L  F RK A++ASE+ +K I T+
Sbjct  42   SAFRLFRVCSSATRWSQHANWRLPESFRAQTRIAAPRLEKFQRKFASIASEHAYKDILTT  101

Query  334  LPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            L KP  GE+GKFYSLPALNDPRI  LPYS+RILLE
Sbjct  102  LHKPDVGEYGKFYSLPALNDPRIDRLPYSVRILLE  136



>ref|XP_008800034.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Phoenix dactylifera]
Length=997

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +1

Query  202  HGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLP  381
            H  DW+SP S  AQIRS+A V   F R+ ATMA+ N ++ I TSL KPGGGEFGK+YSLP
Sbjct  67   HFGDWRSPLSHRAQIRSSAAVAERFERRFATMATRNSYESILTSLSKPGGGEFGKYYSLP  126

Query  382  ALNDPRIX*LPYSIRILLE  438
            ALNDPRI  LPYSIRILLE
Sbjct  127  ALNDPRIDRLPYSIRILLE  145



>ref|XP_008785050.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Phoenix dactylifera]
Length=998

 Score =   109 bits (273),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +1

Query  211  DWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALN  390
            DW+SP S  AQIR +A V   F R   TMA+ N ++ I TSLPKPGGGEFGK+YSLPALN
Sbjct  69   DWRSPLSHRAQIRYSATVAERFERHFTTMATRNAYESILTSLPKPGGGEFGKYYSLPALN  128

Query  391  DPRIX*LPYSIRILLE  438
            DPRI  LPYSIRILLE
Sbjct  129  DPRIDRLPYSIRILLE  144



>ref|XP_010918136.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Elaeis guineensis]
Length=992

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +1

Query  202  HGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLP  381
            H  DW+SP S  AQIRS+A V + F R+ ATMA+ N ++ I +SL KPGGGEFGK+YSLP
Sbjct  62   HFGDWRSPLSHRAQIRSSAAVADRFERRFATMATRNSYESILSSLSKPGGGEFGKYYSLP  121

Query  382  ALNDPRIX*LPYSIRILLE  438
            ALNDPRI  LPYSIRILLE
Sbjct  122  ALNDPRIDRLPYSIRILLE  140



>ref|XP_010943467.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Elaeis guineensis]
Length=995

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  211  DWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALN  390
            DW+SP S  AQIR +A V   F R  ATMA+ N ++ I TSLPKPGGGEFGK+YSLPALN
Sbjct  68   DWRSPLSHRAQIRYSAAVAERFERYFATMATRNAYESILTSLPKPGGGEFGKYYSLPALN  127

Query  391  DPRIX*LPYSIRILLE  438
            DPRI  LPYSIRILLE
Sbjct  128  DPRIDRLPYSIRILLE  143



>ref|XP_009419582.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=1003

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 66/92 (72%), Gaps = 2/92 (2%)
 Frame = +1

Query  169  RSLRCSVP--RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPK  342
            RS    +P  R      W+SP    A+IRS+A V+  F RK+AT+A+EN FK + TSLPK
Sbjct  60   RSCSSYIPGSRVGLSTSWRSPIGPRARIRSSAAVIERFDRKMATVATENVFKDVLTSLPK  119

Query  343  PGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
             GGGE+GK+YSLPALNDPRI  LPYSIRILLE
Sbjct  120  TGGGEYGKYYSLPALNDPRIDRLPYSIRILLE  151



>ref|XP_009399225.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=993

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +1

Query  205  GVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPA  384
            G DW+SP     +IRS++ V+  F RK+ T A+EN FK + TSLPKP GGE+GK+YSLPA
Sbjct  64   GSDWRSPIGPRPRIRSSSTVIQLFDRKMTTTATENVFKDVLTSLPKPEGGEYGKYYSLPA  123

Query  385  LNDPRIX*LPYSIRILLE  438
            LNDPRI  LPYSIRILLE
Sbjct  124  LNDPRIDRLPYSIRILLE  141



>ref|XP_006828850.1| hypothetical protein AMTR_s00001p00156400 [Amborella trichopoda]
 gb|ERM96266.1| hypothetical protein AMTR_s00001p00156400 [Amborella trichopoda]
Length=977

 Score =   102 bits (253),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = +1

Query  214  WKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALND  393
            W+SP S  A IRS+   L+ F R++ATMA++N ++ I TSLPKP GGEFGK+YSLP+LND
Sbjct  51   WRSPLSHRAFIRSSTINLDRFERRLATMATQNVYESILTSLPKPSGGEFGKYYSLPSLND  110

Query  394  PRIX*LPYSIRILLE  438
            PRI  LPYSIRILLE
Sbjct  111  PRIDKLPYSIRILLE  125



>ref|XP_009382046.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=986

 Score =   101 bits (252),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 50/83 (60%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +1

Query  190  PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKF  369
            P   H  D +SP S  A +RS+A V + F R+ ATMAS+N ++ I T+L KPGGGEFGK+
Sbjct  52   PPARHLADLRSPISHRALVRSSAAVADRFERRFATMASKNSYESILTTLSKPGGGEFGKY  111

Query  370  YSLPALNDPRIX*LPYSIRILLE  438
            Y LPAL DPRI  LPYSIRILLE
Sbjct  112  YCLPALTDPRIDRLPYSIRILLE  134



>gb|EEC83022.1| hypothetical protein OsI_28099 [Oryza sativa Indica Group]
Length=396

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 56/68 (82%), Gaps = 1/68 (1%)
 Frame = +1

Query  238  AQIRSAAPVLNDFHRKIA-TMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LP  414
            AQI + AP +   HR++A T A+E+PFK I T+LPKPGGGE+GKFYSLPALNDPRI  LP
Sbjct  74   AQIGAVAPAVERVHRRMAATAAAEHPFKNILTTLPKPGGGEYGKFYSLPALNDPRIDKLP  133

Query  415  YSIRILLE  438
            YSIRILLE
Sbjct  134  YSIRILLE  141



>ref|XP_009384004.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384006.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=977

 Score =   100 bits (249),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 52/84 (62%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = +1

Query  187  VPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGK  366
            VPR SH  D +SP S  A +RS A V   F R+ ATMA+ N ++ I T+L KPGGG+FGK
Sbjct  43   VPR-SHLSDGRSPISHRALVRSYAAVAYRFERRFATMATRNSYESILTTLRKPGGGDFGK  101

Query  367  FYSLPALNDPRIX*LPYSIRILLE  438
            +YSLPAL DPRI  LPYSIRILLE
Sbjct  102  YYSLPALTDPRIERLPYSIRILLE  125



>ref|XP_004974379.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Setaria 
italica]
Length=892

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  226  ASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX  405
            A   AQI +A P +    R++AT A+E+ FK I TSLPKPGGGE+GKFYSLPALNDPRI 
Sbjct  63   AGARAQIGAAVPAVERLQRRMATQATEHAFKNILTSLPKPGGGEYGKFYSLPALNDPRIE  122

Query  406  *LPYSIRILLE  438
             LPYSIRILLE
Sbjct  123  KLPYSIRILLE  133



>ref|XP_007020811.1| Aconitase 3 [Theobroma cacao]
 gb|EOY12336.1| Aconitase 3 [Theobroma cacao]
Length=951

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 58/83 (70%), Gaps = 7/83 (8%)
 Frame = +1

Query  190  PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKF  369
            PRWSHGVDW SP SL AQ+R A PV+  F R+IAT+ S +     +       G E+G+F
Sbjct  67   PRWSHGVDWNSPGSLRAQVRIAVPVMERFRRRIATIGSVDKSSQAW-------GREYGRF  119

Query  370  YSLPALNDPRIX*LPYSIRILLE  438
            YSLPALNDPRI  LPYSIRILLE
Sbjct  120  YSLPALNDPRIDRLPYSIRILLE  142



>ref|XP_002445174.1| hypothetical protein SORBIDRAFT_07g005390 [Sorghum bicolor]
 gb|EES14669.1| hypothetical protein SORBIDRAFT_07g005390 [Sorghum bicolor]
Length=996

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 50/72 (69%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = +1

Query  226  ASLTAQIRSAA-PVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRI  402
            A   AQI +AA P +  F R++AT A+E+ FK I TSLPKPGGGE+GKFYSLPALNDPRI
Sbjct  73   AGARAQIGAAAVPAVERFQRRMATQATEHAFKDILTSLPKPGGGEYGKFYSLPALNDPRI  132

Query  403  X*LPYSIRILLE  438
              LPYSIRILLE
Sbjct  133  DKLPYSIRILLE  144



>ref|XP_008676648.1| PREDICTED: uncharacterized protein LOC100216599 isoform X1 [Zea 
mays]
Length=987

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  226  ASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX  405
            A   AQI +A P +  F R++AT A+ + FK I TSLPKPGGGE+GKFYSLPALNDPRI 
Sbjct  65   AGARAQIGAAVPAVEQFQRRMATQATVHAFKDILTSLPKPGGGEYGKFYSLPALNDPRID  124

Query  406  *LPYSIRILLE  438
             LPYS+RILLE
Sbjct  125  KLPYSVRILLE  135



>gb|AAD25640.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
Length=898

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MASE+PFKGIFT+LPKPGGGEFGKFYSLPALNDPR+  LPYSIRILLE
Sbjct  1    MASEHPFKGIFTTLPKPGGGEFGKFYSLPALNDPRVDKLPYSIRILLE  48



>gb|AAP30039.1| aconitase [Solanum pennellii]
Length=898

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+ENPFKGI T LPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  1    MAAENPFKGILTVLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  48



>gb|AAO62410.1| aconitase [Solanum pennellii]
Length=898

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+ENPFKGI T LPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  1    MAAENPFKGILTVLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  48



>ref|XP_003573387.2| PREDICTED: putative aconitate hydratase, cytoplasmic [Brachypodium 
distachyon]
Length=987

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 56/70 (80%), Gaps = 3/70 (4%)
 Frame = +1

Query  238  AQIRS-AAPVL-NDFHRK-IATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*  408
            AQI + AAP     FHR+ +AT A+E+ FK I TSLPKPGGGEFGKFYSLPALNDPRI  
Sbjct  66   AQIGAVAAPAAGTSFHRRRMATSATEHAFKNILTSLPKPGGGEFGKFYSLPALNDPRIDK  125

Query  409  LPYSIRILLE  438
            LPYSIRILLE
Sbjct  126  LPYSIRILLE  135



>gb|AAG28426.1|AF194945_1 cytosolic aconitase [Nicotiana tabacum]
Length=898

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+ENPFKGI T LPKPGGGEFGK+YSLPALNDPRI  LPYS RILLE
Sbjct  1    MAAENPFKGILTVLPKPGGGEFGKYYSLPALNDPRIDKLPYSSRILLE  48



>gb|AAC26045.1| aconitase-iron regulated protein 1 [Citrus limon]
Length=898

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA EN FKGI TSLPKPGGGEFGKF+SLPALNDPRI  LPYSIRILLE
Sbjct  1    MAPENAFKGILTSLPKPGGGEFGKFFSLPALNDPRIDRLPYSIRILLE  48



>gb|KHG08189.1| hypothetical protein F383_11434 [Gossypium arboreum]
Length=879

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+E+PFK + TSLPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  1    MAAEHPFKEVLTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  48



>gb|ADM34980.1| cytosolic aconitase [Pyrus pyrifolia]
Length=898

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MASENPFK   TSLPKPGGGEFGKFYSLP+LNDPRI  LPYSIRILLE
Sbjct  1    MASENPFKPNLTSLPKPGGGEFGKFYSLPSLNDPRIDRLPYSIRILLE  48



>emb|CBE71057.1| aconitate hydratase 3 [Citrus clementina]
Length=898

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA EN FKGI TSLPKPGGGEFGKF+SLPALNDPRI  LPYSIRILLE
Sbjct  1    MAPENAFKGILTSLPKPGGGEFGKFFSLPALNDPRIDRLPYSIRILLE  48



>emb|CBE71058.1| aconitate hydratase 2 [Citrus clementina]
Length=898

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+E+PFK I T+LPKPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  1    MAAEHPFKEILTALPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLE  48



>sp|Q6YZX6.1|ACOC_ORYSJ RecName: Full=Putative aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase [Oryza sativa 
Japonica Group]
 dbj|BAD05751.1| putative Aconitate hydratase [Oryza sativa Japonica Group]
Length=898

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+E+PFK I T+LPKPGGGE+GKFYSLPALNDPRI  LPYSIRILLE
Sbjct  1    MAAEHPFKNILTTLPKPGGGEYGKFYSLPALNDPRIDKLPYSIRILLE  48



>gb|KHN41224.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=903

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            + +ENPFKG  TSLPKPGGGEFGKFYSLP+LNDPRI  LPYSIRILLE
Sbjct  6    LTNENPFKGNLTSLPKPGGGEFGKFYSLPSLNDPRIDRLPYSIRILLE  53



>gb|KJB30565.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
 gb|KJB30568.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=898

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+E+PFK + TSLPKPGGGEFGKFYSLPALNDPRI  LPYSI ILLE
Sbjct  1    MAAEHPFKEVLTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSITILLE  48



>sp|P49608.1|ACOC_CUCMA RecName: Full=Aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase [Cucurbita maxima]
 pir||T10101 aconitate hydratase (EC 4.2.1.3) - cucurbit
 dbj|BAA06108.1| aconitase [Cucurbita cv. Kurokawa Amakuri]
Length=898

 Score = 87.4 bits (215),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+ENPFK   TSLPKPGGGEFGK+YSLP+LNDPRI  LPYSIRILLE
Sbjct  1    MAAENPFKENLTSLPKPGGGEFGKYYSLPSLNDPRIDRLPYSIRILLE  48



>ref|XP_011097878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum 
indicum]
Length=898

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MASE+PFK I T L KPGGGEFGKFYSLPALNDPRI  LPYSIRILLE
Sbjct  1    MASEHPFKEILTGLSKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  48



>ref|XP_007020807.1| Aconitase 3 [Theobroma cacao]
 gb|EOY12332.1| Aconitase 3 [Theobroma cacao]
Length=883

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 46/64 (72%), Gaps = 5/64 (8%)
 Frame = +1

Query  247  RSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIR  426
            R  AP LN     +    SE+ FK I TSLPKPGG EFGKFYSLPALNDPRI  LPYSIR
Sbjct  11   RLMAPQLN-----LGMKCSEHAFKAILTSLPKPGGEEFGKFYSLPALNDPRIDRLPYSIR  65

Query  427  ILLE  438
            ILLE
Sbjct  66   ILLE  69



>gb|KFK30197.1| hypothetical protein AALP_AA7G230700 [Arabis alpina]
Length=898

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MASENPF+ IF +L KP GGEFG +YSLPALNDPRI  LPYSIRILLE
Sbjct  1    MASENPFRSIFKALEKPDGGEFGNYYSLPALNDPRIDRLPYSIRILLE  48



>dbj|BAJ85661.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=984

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = +1

Query  220  SPASLTAQIR-SAAPVLN-DFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALND  393
            SP+S   + R S AP       R++A   +E+ +  I TSLPKPGGGE+GKFYSLPALND
Sbjct  58   SPSSAAVRGRGSVAPAAQRSQQRRMAASGTEHAYSNILTSLPKPGGGEYGKFYSLPALND  117

Query  394  PRIX*LPYSIRILLE  438
            PRI  LPYSIRILLE
Sbjct  118  PRIDKLPYSIRILLE  132



>ref|XP_006413195.1| hypothetical protein EUTSA_v10024325mg [Eutrema salsugineum]
 gb|ESQ54648.1| hypothetical protein EUTSA_v10024325mg [Eutrema salsugineum]
Length=962

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  298  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            ASE+ +K I TSLPKPGGGE+GK+YSLPALNDPRI  LPYSIRILLE
Sbjct  97   ASEHAYKDILTSLPKPGGGEYGKYYSLPALNDPRIDRLPYSIRILLE  143



>emb|CAA58046.1| aconitase [Arabidopsis thaliana]
Length=919

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  286  IATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            +++MASENPF+ I  +L KP GGEFG +YSLPALNDPRI  LPYSIRILLE
Sbjct  20   LSSMASENPFRSILKALEKPDGGEFGNYYSLPALNDPRIDKLPYSIRILLE  70



>ref|XP_008363093.1| PREDICTED: aconitate hydratase 1-like [Malus domestica]
Length=107

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDPRI  LP+SI+ILLE
Sbjct  1    MAAANPFQKILTALEKPDGGEFGKYYSLPALNDPRIEKLPFSIKILLE  48



>ref|XP_004287770.1| PREDICTED: aconitate hydratase 1 [Fragaria vesca subsp. vesca]
Length=898

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+ENPFK I  SL KP GGEFGK+YSLPALNDPR+  LPYSI+ILLE
Sbjct  1    MAAENPFKSILKSLEKPDGGEFGKYYSLPALNDPRVDKLPYSIKILLE  48



>emb|CDX69174.1| BnaC01g02790D [Brassica napus]
Length=901

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +1

Query  298  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            ASENPF+ I  +L KPGGGEFG +YSLPALNDPRI  LPYSIRILLE
Sbjct  5    ASENPFRSILKALEKPGGGEFGNYYSLPALNDPRIDKLPYSIRILLE  51



>ref|XP_002445994.1| hypothetical protein SORBIDRAFT_06g000200 [Sorghum bicolor]
 gb|EES10322.1| hypothetical protein SORBIDRAFT_06g000200 [Sorghum bicolor]
Length=106

 Score = 76.6 bits (187),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +1

Query  298  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            A+++ FK I  SLPKPGGGE+GKF+SLPALNDPRI  LPYSIR+LLE
Sbjct  6    ATKHAFKSILASLPKPGGGEYGKFFSLPALNDPRIDRLPYSIRVLLE  52



>ref|NP_195308.1| aconitate hydratase 1 [Arabidopsis thaliana]
 sp|Q42560.2|ACO1_ARATH RecName: Full=Aconitate hydratase 1; Short=Aconitase 1; AltName: 
Full=Citrate hydro-lyase 1 [Arabidopsis thaliana]
 emb|CAA21469.1| cytoplasmatic aconitate hydratase (citrate hydro-lyase)(aconitase)(EC 
4.2.1.3) [Arabidopsis thaliana]
 emb|CAB81492.1| cytoplasmatic aconitate hydratase (citrate hydro-lyase)(aconitase)(EC 
4.2.1.3) [Arabidopsis thaliana]
 gb|AAL32850.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE86576.1| aconitate hydratase 1 [Arabidopsis thaliana]
Length=898

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MASENPF+ I  +L KP GGEFG +YSLPALNDPRI  LPYSIRILLE
Sbjct  1    MASENPFRSILKALEKPDGGEFGNYYSLPALNDPRIDKLPYSIRILLE  48



>ref|XP_010526818.1| PREDICTED: aconitate hydratase 1 [Tarenaya hassleriana]
Length=899

 Score = 81.3 bits (199),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MASENPF  IF +L +P GGEFGK+YSLP LNDPRI  LPYSIRILLE
Sbjct  1    MASENPFHSIFKTLERPDGGEFGKYYSLPDLNDPRIDKLPYSIRILLE  48



>ref|XP_010437416.1| PREDICTED: aconitate hydratase 1-like [Camelina sativa]
Length=898

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MASENPF+ I  +L KP GGEFG +YSLPALNDPRI  LPYSIRILLE
Sbjct  1    MASENPFRSILKALEKPDGGEFGNYYSLPALNDPRIDKLPYSIRILLE  48



>ref|XP_006285963.1| hypothetical protein CARUB_v10007484mg [Capsella rubella]
 gb|EOA18861.1| hypothetical protein CARUB_v10007484mg [Capsella rubella]
Length=898

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MASENPF+ I  +L KP GGEFG +YSLPALNDPRI  LPYSIRILLE
Sbjct  1    MASENPFRSILKALEKPDGGEFGNYYSLPALNDPRIDKLPYSIRILLE  48



>ref|XP_010446873.1| PREDICTED: aconitate hydratase 1 [Camelina sativa]
 ref|XP_010446874.1| PREDICTED: aconitate hydratase 1 [Camelina sativa]
Length=898

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MASENPF+ I  +L KP GGEFG +YSLPALNDPRI  LPYSIRILLE
Sbjct  1    MASENPFRSILKALEKPDGGEFGNYYSLPALNDPRIDKLPYSIRILLE  48



>ref|XP_009109264.1| PREDICTED: aconitate hydratase 1-like [Brassica rapa]
Length=898

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MASENPF+ I  +L KP GGEFG +YSLPALNDPRI  LPYSIRILLE
Sbjct  1    MASENPFRSILKTLEKPDGGEFGNYYSLPALNDPRIDKLPYSIRILLE  48



>ref|XP_009150005.1| PREDICTED: aconitate hydratase 1 [Brassica rapa]
Length=898

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MASENPF+ I  +L KP GGEFG +YSLPALNDPRI  LPYSIRILLE
Sbjct  1    MASENPFRSILKALEKPDGGEFGNYYSLPALNDPRIDKLPYSIRILLE  48



>ref|XP_007046597.1| Aconitase 1 [Theobroma cacao]
 gb|EOX90754.1| Aconitase 1 [Theobroma cacao]
Length=900

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+ENPF  I  +L KPGGGEFGK+YSLPAL+DPRI  LPYSI+ILLE
Sbjct  1    MATENPFNSILKTLEKPGGGEFGKYYSLPALDDPRIDKLPYSIKILLE  48



>gb|KDO71343.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=898

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDPRI  LPYSI+ILLE
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDPRIDKLPYSIKILLE  48



>emb|CBE71056.1| aconitate hydratase 1 [Citrus clementina]
Length=900

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDPRI  LPYSI+ILLE
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDPRIGKLPYSIKILLE  48



>ref|XP_006467022.1| PREDICTED: aconitate hydratase 1 [Citrus sinensis]
Length=900

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDPRI  LPYSI+ILLE
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDPRIGKLPYSIKILLE  48



>gb|KDO71342.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=900

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDPRI  LPYSI+ILLE
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDPRIDKLPYSIKILLE  48



>gb|KDO71344.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=881

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDPRI  LPYSI+ILLE
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDPRIDKLPYSIKILLE  48



>gb|KDO71346.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=807

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDPRI  LPYSI+ILLE
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDPRIDKLPYSIKILLE  48



>emb|CAB36543.1| putative aconitase [Arabidopsis thaliana]
 emb|CAB79552.1| putative aconitase [Arabidopsis thaliana]
Length=907

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  286  IATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            +   ASE+ +K I TSLPKPGGGE+GK+YSLPALNDPRI  LP+S+RILLE
Sbjct  7    VKNAASEHSYKDILTSLPKPGGGEYGKYYSLPALNDPRIDKLPFSVRILLE  57



>ref|XP_006412056.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 gb|ESQ53509.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
Length=898

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MASENPF+ I  +L KPGGGEFG +YSL ALNDPRI  LPYSIRILLE
Sbjct  1    MASENPFRCILKTLQKPGGGEFGNYYSLAALNDPRIDKLPYSIRILLE  48



>ref|XP_010432222.1| PREDICTED: aconitate hydratase 1-like [Camelina sativa]
Length=898

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MAS+NPF+ I  +L KP GGEFG +YSLPALNDPRI  LPYSIRILLE
Sbjct  1    MASDNPFRSILKALEKPDGGEFGNYYSLPALNDPRIDKLPYSIRILLE  48



>ref|XP_006412054.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 ref|XP_006412055.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 gb|ESQ53507.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 gb|ESQ53508.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
Length=763

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MASENPF+ I  +L KPGGGEFG +YSL ALNDPRI  LPYSIRILLE
Sbjct  1    MASENPFRCILKTLQKPGGGEFGNYYSLAALNDPRIDKLPYSIRILLE  48



>ref|XP_006425366.1| hypothetical protein CICLE_v10024840mg [Citrus clementina]
 gb|ESR38606.1| hypothetical protein CICLE_v10024840mg [Citrus clementina]
Length=900

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+ENPFK I  +L  P GGEFGK+YSLPALNDPRI  LPYSI+ILLE
Sbjct  1    MATENPFKSILKTLQSPDGGEFGKYYSLPALNDPRIGKLPYSIKILLE  48



>gb|KHN41868.1| Aconitate hydratase 1 [Glycine soja]
Length=901

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGG-GEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+ENPF  I T+L KPGG GEFGK++SLPALNDPRI  LPYS+RILLE
Sbjct  1    MATENPFNSILTTLEKPGGAGEFGKYFSLPALNDPRIDRLPYSVRILLE  49



>emb|CDX75532.1| BnaA01g01700D [Brassica napus]
Length=925

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  286  IATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            +   ASENPF+ I  +L KP GGEFG +YSLPALNDPRI  LPYSIRILLE
Sbjct  25   VCVSASENPFRSILKALEKPDGGEFGSYYSLPALNDPRIDKLPYSIRILLE  75



>emb|CDY41626.1| BnaC03g62580D [Brassica napus]
Length=905

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            ++SENPF+ I  +L KP GGEFG +YSLPALNDPRI  LPYSIRILLE
Sbjct  8    LSSENPFRSILKTLEKPDGGEFGNYYSLPALNDPRIDKLPYSIRILLE  55



>ref|XP_010113288.1| Aconitate hydratase 1 [Morus notabilis]
 gb|EXC35295.1| Aconitate hydratase 1 [Morus notabilis]
Length=977

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 36/45 (80%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  304  ENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            ENPFK I  +L KP GGEFGK+YSLPALNDPRI  LPYSIRILLE
Sbjct  64   ENPFKSILKTLEKPDGGEFGKYYSLPALNDPRIEKLPYSIRILLE  108



>ref|XP_009363442.1| PREDICTED: aconitate hydratase 1-like [Pyrus x bretschneideri]
Length=898

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDPRI  LP+SI+ILLE
Sbjct  1    MAAANPFQKILTALEKPDGGEFGKYYSLPALNDPRIEKLPFSIKILLE  48



>ref|XP_009337075.1| PREDICTED: aconitate hydratase 1-like [Pyrus x bretschneideri]
Length=898

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDPRI  LP+SI+ILLE
Sbjct  1    MAAANPFQKILTALEKPDGGEFGKYYSLPALNDPRIEKLPFSIKILLE  48



>ref|XP_007203240.1| hypothetical protein PRUPE_ppa001138mg [Prunus persica]
 gb|EMJ04439.1| hypothetical protein PRUPE_ppa001138mg [Prunus persica]
Length=898

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDPRI  LP+SI+ILLE
Sbjct  1    MATANPFQKILTALEKPDGGEFGKYYSLPALNDPRIDKLPFSIKILLE  48



>ref|XP_008242011.1| PREDICTED: aconitate hydratase 1 [Prunus mume]
Length=898

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDPRI  LP+SI+ILLE
Sbjct  1    MATANPFQKILTALEKPDGGEFGKYYSLPALNDPRIDKLPFSIKILLE  48



>ref|XP_009344825.1| PREDICTED: aconitate hydratase 1 [Pyrus x bretschneideri]
Length=898

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MAS NPF+ I T+L +P GGEFGK+YSLPALNDPRI  LP+SI+ILLE
Sbjct  1    MASANPFQKILTALERPDGGEFGKYYSLPALNDPRIEKLPFSIKILLE  48



>gb|EMS45933.1| Putative aconitate hydratase, cytoplasmic [Triticum urartu]
Length=858

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +1

Query  286  IATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            +A   +E+ +  I TSLPKP GGE+GKFYSLPALNDPRI  LPYSIRILLE
Sbjct  1    MAASGTEHAYNNILTSLPKPEGGEYGKFYSLPALNDPRIDKLPYSIRILLE  51



>ref|XP_008337967.1| PREDICTED: aconitate hydratase 1 [Malus domestica]
Length=898

 Score = 78.6 bits (192),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDPRI  LP+SI+ILLE
Sbjct  1    MAAANPFQKILTALEKPDGGEFGKYYSLPALNDPRIEKLPFSIKILLE  48



>ref|XP_002460765.1| hypothetical protein SORBIDRAFT_02g034590 [Sorghum bicolor]
 gb|EER97286.1| hypothetical protein SORBIDRAFT_02g034590 [Sorghum bicolor]
Length=979

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = +1

Query  280  RKIATMASENP-FKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            R +ATMA  N  F  + TSLPKPGGGE+GK+YSLPALNDPRI  LPYSIR LLE
Sbjct  72   RGLATMADGNSRFGHVLTSLPKPGGGEYGKYYSLPALNDPRIERLPYSIRYLLE  125



>gb|AAL13084.1| putative aconitase [Prunus avium]
Length=902

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDPRI  LP+SI+ILLE
Sbjct  1    MATANPFQKILTALEKPDGGEFGKYYSLPALNDPRIDKLPFSIKILLE  48



>gb|KHG25175.1| Aconitate hydratase, cytoplasmic [Gossypium arboreum]
Length=900

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MAS NPF  I  +L KP GGEFGK+YSLPALNDPRI  LPYSI+ILLE
Sbjct  1    MASANPFNSILKTLEKPQGGEFGKYYSLPALNDPRIDKLPYSIKILLE  48



>gb|KHG25176.1| Aconitate hydratase, cytoplasmic [Gossypium arboreum]
Length=929

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MAS NPF  I  +L KP GGEFGK+YSLPALNDPRI  LPYSI+ILLE
Sbjct  1    MASANPFNSILKTLEKPQGGEFGKYYSLPALNDPRIDKLPYSIKILLE  48



>gb|KJB48278.1| hypothetical protein B456_008G061900 [Gossypium raimondii]
Length=900

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MAS NPF  I  +L KP GGEFGK+YSLPALNDPRI  LPYSI+ILLE
Sbjct  1    MASANPFNSILKTLEKPQGGEFGKYYSLPALNDPRIDKLPYSIKILLE  48



>ref|XP_008669746.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X1 [Zea mays]
 tpg|DAA38797.1| TPA: hypothetical protein ZEAMMB73_641300 [Zea mays]
Length=975

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 53/75 (71%), Gaps = 4/75 (5%)
 Frame = +1

Query  226  ASLTAQIRSAA---PVLNDFHR-KIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALND  393
            A L   + ++A   P  +  HR ++   A+++ FK I TSL KPGGGE+GKF+SLPALND
Sbjct  49   ARLVPDVTTSAKLQPRDDALHRIRVGVGATKHAFKRILTSLIKPGGGEYGKFFSLPALND  108

Query  394  PRIX*LPYSIRILLE  438
            PRI  LPYSIR+LLE
Sbjct  109  PRIDKLPYSIRVLLE  123



>emb|CBI24446.3| unnamed protein product [Vitis vinifera]
Length=918

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/57 (63%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  268  NDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            ++F ++    AS NPF  I  +L KP GGEFGK+YSLPAL DPRI  LPYSIRILLE
Sbjct  10   SNFSKRKNNYASSNPFASILKTLEKPAGGEFGKYYSLPALGDPRIDRLPYSIRILLE  66



>gb|KDP23953.1| hypothetical protein JCGZ_25341 [Jatropha curcas]
Length=900

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            M +ENPF  I  +L KP GGEFGK+YSLPALNDPRI  LPYSI+ILLE
Sbjct  1    MVNENPFTSILKTLEKPDGGEFGKYYSLPALNDPRIDKLPYSIKILLE  48



>ref|XP_002263337.1| PREDICTED: aconitate hydratase 1 [Vitis vinifera]
Length=900

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MAS NPF  I  +L KP GGEFGK+YSLPAL DPRI  LPYSIRILLE
Sbjct  1    MASSNPFASILKTLEKPAGGEFGKYYSLPALGDPRIDRLPYSIRILLE  48



>ref|XP_006380559.1| hypothetical protein POPTR_0007s09260g [Populus trichocarpa]
 gb|ERP58356.1| hypothetical protein POPTR_0007s09260g [Populus trichocarpa]
Length=899

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+ENPFK I  +L KPGG EFGK+YSLPALNDPRI  LPYSI+ILLE
Sbjct  1    MANENPFKSILKTLEKPGG-EFGKYYSLPALNDPRIDRLPYSIKILLE  47



>gb|AES61065.2| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=895

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = +1

Query  286  IATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIX*LPYSIRILLE  438
            +AT+ SE+ FKGI T LPKPGGG E+GKF+SLP LND RI  LPYSIRIL+E
Sbjct  1    MATLTSEHVFKGILTGLPKPGGGDEYGKFFSLPLLNDSRIERLPYSIRILVE  52



>ref|XP_003517155.1| PREDICTED: aconitate hydratase 1 [Glycine max]
Length=901

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGG-GEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+ENPF  I  +L KPGG GEFGK++SLPALNDPRI  LPYS+RILLE
Sbjct  1    MATENPFNSILRTLEKPGGAGEFGKYFSLPALNDPRIDRLPYSVRILLE  49



>ref|XP_007157870.1| hypothetical protein PHAVU_002G105000g [Phaseolus vulgaris]
 gb|ESW29864.1| hypothetical protein PHAVU_002G105000g [Phaseolus vulgaris]
Length=901

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 40/49 (82%), Gaps = 1/49 (2%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIX*LPYSIRILLE  438
            M +ENPF  I  +L KPGGG EFGK+YSLPALNDPRI  LPYS+RILLE
Sbjct  1    MVTENPFSSILRTLEKPGGGGEFGKYYSLPALNDPRIDRLPYSVRILLE  49



>gb|EMT33022.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=937

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +1

Query  301  SENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            +E+ +  I TSLPKP GGE+GKFYSLPALNDPRI  LPYSIRILLE
Sbjct  40   TEHAYSNILTSLPKPEGGEYGKFYSLPALNDPRIDKLPYSIRILLE  85



>ref|XP_010266897.1| PREDICTED: aconitate hydratase 1 [Nelumbo nucifera]
Length=900

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+ N ++ I  +L KPGGGEFGK+YSLPALNDPRI  LPYSIRILLE
Sbjct  1    MATRNVYESILKTLEKPGGGEFGKYYSLPALNDPRIDKLPYSIRILLE  48



>ref|XP_008440877.1| PREDICTED: aconitate hydratase [Cucumis melo]
Length=900

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+ENPF  I  +L  P GG FGK+YSLPALNDPRI  LPYSIRILLE
Sbjct  1    MATENPFNSILKTLENPEGGVFGKYYSLPALNDPRIERLPYSIRILLE  48



>ref|XP_008669747.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X2 [Zea mays]
 tpg|DAA38798.1| TPA: hypothetical protein ZEAMMB73_641300 [Zea mays]
Length=905

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +1

Query  292  TMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            + A+++ FK I TSL KPGGGE+GKF+SLPALNDPRI  LPYSIR+LLE
Sbjct  5    STATKHAFKRILTSLIKPGGGEYGKFFSLPALNDPRIDKLPYSIRVLLE  53



>ref|XP_011022256.1| PREDICTED: aconitate hydratase 1 [Populus euphratica]
Length=899

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            M +ENPFK I  +L KPGG EFGK+YSLPALNDPRI  LPYSI+ILLE
Sbjct  1    MVNENPFKSILKTLEKPGG-EFGKYYSLPALNDPRIDRLPYSIKILLE  47



>ref|XP_006383042.1| aconitate hydratase family protein [Populus trichocarpa]
 gb|ERP60839.1| aconitate hydratase family protein [Populus trichocarpa]
Length=899

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            M +ENPFK I  +L KPGG EFGK+YSLPALNDPRI  LPYSI+ILLE
Sbjct  1    MVNENPFKSILKTLEKPGG-EFGKYYSLPALNDPRIDRLPYSIKILLE  47



>ref|NP_001147431.1| aconitase2 [Zea mays]
 gb|ACG27495.1| aconitate hydratase, cytoplasmic [Zea mays]
 gb|ACN28210.1| unknown [Zea mays]
 gb|AFW57775.1| aconitate hydratase, cytoplasmic [Zea mays]
Length=905

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +1

Query  298  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            A+++ FK I TSL KPGGGE+GKF+SLPALNDPRI  LPYSIR+LLE
Sbjct  6    ATKHAFKRILTSLLKPGGGEYGKFFSLPALNDPRIDKLPYSIRVLLE  52



>dbj|BAJ92965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=999

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 44/56 (79%), Gaps = 1/56 (2%)
 Frame = +1

Query  274  FHRKIATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIX*LPYSIRILLE  438
            F R+ A+ A++N +  I TSL KPGGG +FGK+YSLPAL DPRI  LPYSIRILLE
Sbjct  93   FERRFASAATKNSYDEILTSLAKPGGGADFGKYYSLPALADPRIDRLPYSIRILLE  148



>ref|XP_003537655.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Glycine max]
Length=901

 Score = 75.5 bits (184),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGG-GEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+ENPF  I T+L KPGG GEFGK++SLPALND RI  LPYS+RILLE
Sbjct  1    MATENPFNSILTTLEKPGGAGEFGKYFSLPALNDRRIDRLPYSVRILLE  49



>ref|XP_010529315.1| PREDICTED: aconitate hydratase 1-like [Tarenaya hassleriana]
Length=901

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            M  ENPF+ I  +L +P GGE+GKF+SLP+LNDPRI  LPYSIRILLE
Sbjct  1    MDCENPFRRILKTLERPDGGEYGKFFSLPSLNDPRIEKLPYSIRILLE  48



>ref|NP_001048898.1| Os03g0136900 [Oryza sativa Japonica Group]
 gb|ABF93861.1| Aconitate hydratase, cytoplasmic, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF10812.1| Os03g0136900 [Oryza sativa Japonica Group]
Length=986

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 44/56 (79%), Gaps = 1/56 (2%)
 Frame = +1

Query  274  FHRKIATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIX*LPYSIRILLE  438
            F R+ A+ A++N +  I T L KPGGG EFGK+YSLPAL+DPRI  LPYSIRILLE
Sbjct  81   FERRFASAAAKNSYDEILTGLAKPGGGAEFGKYYSLPALSDPRIERLPYSIRILLE  136



>emb|CDY24823.1| BnaA08g14870D [Brassica napus]
Length=922

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  280  RKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            +++    SENPF+ I  +L KP GGEFG +YSL ALNDPRI  LPYSIRILLE
Sbjct  20   QELRIFTSENPFRSILKTLEKPDGGEFGNYYSLAALNDPRIDKLPYSIRILLE  72



>gb|EEC74472.1| hypothetical protein OsI_09921 [Oryza sativa Indica Group]
Length=986

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 44/56 (79%), Gaps = 1/56 (2%)
 Frame = +1

Query  274  FHRKIATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIX*LPYSIRILLE  438
            F R+ A+ A++N +  I T L KPGGG EFGK+YSLPAL+DPRI  LPYSIRILLE
Sbjct  81   FERRFASAAAKNSYDEILTGLAKPGGGAEFGKYYSLPALSDPRIERLPYSIRILLE  136



>ref|XP_004985790.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Setaria 
italica]
Length=986

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 44/56 (79%), Gaps = 1/56 (2%)
 Frame = +1

Query  274  FHRKIATMASENPFKGIFTSLPKPGGGE-FGKFYSLPALNDPRIX*LPYSIRILLE  438
            F R+ A+ A++N +  I T L KPGGGE FGK+YSLPAL+DPRI  LPYSIRILLE
Sbjct  81   FERRFASAATKNSYDEILTGLGKPGGGEEFGKYYSLPALSDPRIDRLPYSIRILLE  136



>ref|XP_008661884.1| PREDICTED: aconitase2 isoform X1 [Zea mays]
Length=949

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +1

Query  298  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            A+++ FK I TSL KPGGGE+GKF+SLPALNDPRI  LPYSIR+LLE
Sbjct  67   ATKHAFKRILTSLLKPGGGEYGKFFSLPALNDPRIDKLPYSIRVLLE  113



>ref|XP_003612247.1| Aconitate hydratase [Medicago truncatula]
 gb|AES95205.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=901

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 40/49 (82%), Gaps = 1/49 (2%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA++NPF  I  +L KPGGG EFGK+YSLPALND RI  LPYSIRILLE
Sbjct  1    MATQNPFNNILKTLEKPGGGGEFGKYYSLPALNDSRIDALPYSIRILLE  49



>gb|KCW56576.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=898

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA ENPFK I  +L +PGGGEFG ++SLPAL D RI  LPYSIRILLE
Sbjct  1    MACENPFKSILKTLERPGGGEFGTYFSLPALGDSRIDRLPYSIRILLE  48



>ref|XP_010029634.1| PREDICTED: aconitate hydratase 1 [Eucalyptus grandis]
 gb|KCW56577.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=900

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA ENPFK I  +L +PGGGEFG ++SLPAL D RI  LPYSIRILLE
Sbjct  1    MACENPFKSILKTLERPGGGEFGTYFSLPALGDSRIDRLPYSIRILLE  48



>ref|XP_004512178.1| PREDICTED: aconitate hydratase 1-like [Cicer arietinum]
Length=901

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGG-GEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+ENPFK I  +L KPGG G FG +YSLPALND RI  LPYSIRILLE
Sbjct  1    MATENPFKSILKTLEKPGGDGHFGNYYSLPALNDSRIDELPYSIRILLE  49



>ref|XP_004166975.1| PREDICTED: aconitate hydratase 1-like, partial [Cucumis sativus]
Length=466

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+ENPF  I  +L    GG FGK+YSLPALNDPRI  LPYSIRILLE
Sbjct  1    MATENPFNSILKTLENHEGGVFGKYYSLPALNDPRIERLPYSIRILLE  48



>emb|CAN83844.1| hypothetical protein VITISV_003004 [Vitis vinifera]
Length=885

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +1

Query  301  SENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            S NPF  I  +L KP GGEFGK+YSLPAL DPRI  LPYSIRILLE
Sbjct  6    SSNPFASILKTLEKPXGGEFGKYYSLPALGDPRIDRLPYSIRILLE  51



>ref|XP_008658754.1| PREDICTED: uncharacterized protein LOC100304315 isoform X1 [Zea 
mays]
Length=989

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 43/56 (77%), Gaps = 1/56 (2%)
 Frame = +1

Query  274  FHRKIATMASENPFKGIFTSLPKPGGGE-FGKFYSLPALNDPRIX*LPYSIRILLE  438
            F R+ A+ A+ N +  I T L +PGGGE FGK+YSLPAL+DPRI  LPYSIRILLE
Sbjct  84   FERRFASAATRNSYDEILTGLGRPGGGEEFGKYYSLPALSDPRIDRLPYSIRILLE  139



>ref|XP_001779205.1| predicted protein [Physcomitrella patens]
 gb|EDQ55968.1| predicted protein, partial [Physcomitrella patens]
Length=896

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  298  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            ASENPF  + T LPKP GG +GKFYSL  LNDPR+  LPYSIR LLE
Sbjct  1    ASENPFSSLITDLPKPDGGSYGKFYSLVKLNDPRVDSLPYSIRYLLE  47



>ref|XP_008670444.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X1 [Zea mays]
Length=982

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +1

Query  280  RKIATMASENP-FKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            R +ATMA  +  F  + TSLPKPGGGE+GK+YSLPALND RI  LPYSIR LLE
Sbjct  74   RGVATMADGSSRFGHVLTSLPKPGGGEYGKYYSLPALNDRRIERLPYSIRYLLE  127



>ref|XP_008670445.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X2 [Zea mays]
 tpg|DAA40969.1| TPA: hypothetical protein ZEAMMB73_742994 [Zea mays]
Length=980

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +1

Query  280  RKIATMASENP-FKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            R +ATMA  +  F  + TSLPKPGGGE+GK+YSLPALND RI  LPYSIR LLE
Sbjct  74   RGVATMADGSSRFGHVLTSLPKPGGGEYGKYYSLPALNDRRIERLPYSIRYLLE  127



>ref|XP_002530635.1| aconitase, putative [Ricinus communis]
 gb|EEF31743.1| aconitase, putative [Ricinus communis]
Length=900

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            M +E+PFK I  +L K  GG FGK+YSLPALNDPRI  LPYSIRILLE
Sbjct  1    MVNESPFKSILKTLEKADGGAFGKYYSLPALNDPRIDRLPYSIRILLE  48



>ref|XP_003590814.1| Aconitate hydratase [Medicago truncatula]
Length=924

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 39/47 (83%), Gaps = 1/47 (2%)
 Frame = +1

Query  301  SENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIX*LPYSIRILLE  438
            SE+ FKGI T LPKPGGG E+GKF+SLP LND RI  LPYSIRIL+E
Sbjct  35   SEHVFKGILTGLPKPGGGDEYGKFFSLPLLNDSRIERLPYSIRILVE  81



>ref|XP_004134842.1| PREDICTED: aconitate hydratase 1-like [Cucumis sativus]
Length=900

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+ENPF  I  +L    GG FGK+YSLPALNDPRI  LPYSIRILLE
Sbjct  1    MATENPFNSILKTLENHEGGVFGKYYSLPALNDPRIERLPYSIRILLE  48



>ref|XP_003558862.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Brachypodium 
distachyon]
Length=994

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 43/56 (77%), Gaps = 1/56 (2%)
 Frame = +1

Query  274  FHRKIATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIX*LPYSIRILLE  438
            F R+ A+ A++N +  I TSL KPGGG +FGK+YSLP L DPRI  LPYSIRILLE
Sbjct  88   FERRFASAATKNSYDEILTSLAKPGGGADFGKYYSLPRLADPRIDRLPYSIRILLE  143



>gb|KGN48958.1| Aconitase [Cucumis sativus]
Length=881

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+ENPF  I  +L    GG FGK+YSLPALNDPRI  LPYSIRILLE
Sbjct  1    MATENPFNSILKTLENHEGGVFGKYYSLPALNDPRIERLPYSIRILLE  48



>gb|KJB17578.1| hypothetical protein B456_003G006000 [Gossypium raimondii]
Length=896

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            MA+EN F  I  +L KP GGEFGK+Y LPALNDPRI  LPY I+ILLE
Sbjct  1    MAAENAFNTILKTLEKPDGGEFGKYYCLPALNDPRIDKLPYCIKILLE  48



>ref|XP_002465901.1| hypothetical protein SORBIDRAFT_01g047850 [Sorghum bicolor]
 gb|ABE77202.1| putative aconitate hydratase 1 [Sorghum bicolor]
 gb|EER92899.1| hypothetical protein SORBIDRAFT_01g047850 [Sorghum bicolor]
Length=991

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = +1

Query  274  FHRKIATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIX*LPYSIRILLE  438
            F R+ A+ A+ N +  I T L +PG G EFGK+YSLPAL+DPRI  LPYSIRILLE
Sbjct  86   FERRFASAATRNTYDEILTGLKRPGAGDEFGKYYSLPALSDPRIDRLPYSIRILLE  141



>ref|XP_006651017.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Oryza 
brachyantha]
Length=906

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = +1

Query  286  IATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIX*LPYSIRILLE  438
            +   A+ N +  I TSL KPGGG EFGK+YSLPAL+DPRI  LPYSIRILLE
Sbjct  5    VVLAATRNSYDEILTSLAKPGGGPEFGKYYSLPALSDPRIERLPYSIRILLE  56



>ref|XP_002976825.1| hypothetical protein SELMODRAFT_443331 [Selaginella moellendorffii]
 gb|EFJ21935.1| hypothetical protein SELMODRAFT_443331 [Selaginella moellendorffii]
Length=949

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  277  HRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
             R+   M S +PF+ I TSL K  GGE+GK+YSLP L+DPRI  LPYSI+ILLE
Sbjct  45   QRQEIAMVSGHPFESILTSLSKDDGGEYGKYYSLPDLHDPRIEKLPYSIKILLE  98



>ref|XP_002980554.1| hypothetical protein SELMODRAFT_444572 [Selaginella moellendorffii]
 gb|EFJ18205.1| hypothetical protein SELMODRAFT_444572 [Selaginella moellendorffii]
Length=949

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  277  HRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
             R+   M S +PF+ I TSL K  GGE+GK+YSLP L+DPRI  LPYSI+ILLE
Sbjct  45   QRQEIAMVSGHPFESILTSLSKDDGGEYGKYYSLPDLHDPRIEKLPYSIKILLE  98



>gb|EMS48231.1| Putative aconitate hydratase, cytoplasmic [Triticum urartu]
Length=860

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +1

Query  298  ASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIX*LPYSIRILLE  438
            A++N +  I TSL KPGGG +FGK+YSLPAL DPRI  LPYSIRILLE
Sbjct  14   ATKNSYDEILTSLAKPGGGADFGKYYSLPALADPRIDRLPYSIRILLE  61



>ref|XP_010033531.1| PREDICTED: aconitate hydratase 1-like [Eucalyptus grandis]
Length=903

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/49 (67%), Positives = 38/49 (78%), Gaps = 1/49 (2%)
 Frame = +1

Query  295  MASENPF-KGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            M SENPF K I  +L KP GGEFGK+Y LPAL+DPRI  LP SI++LLE
Sbjct  1    MGSENPFEKSILRTLEKPDGGEFGKYYYLPALDDPRIDRLPISIKVLLE  49



>gb|EMT24311.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=1009

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  313  FKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            F    T LPKPGGGE+GKFYS+PALNDP+I  LPY IRILLE
Sbjct  120  FAKTLTILPKPGGGEYGKFYSIPALNDPKIDKLPYCIRILLE  161



>gb|EMT03129.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=1967

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +1

Query  298   ASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIX*LPYSIRILLE  438
             A++N +  I TSL KPGGG +FGK+YSLPAL DPRI  LPYSIRILLE
Sbjct  1069  ATKNSYDEILTSLAKPGGGADFGKYYSLPALADPRIDRLPYSIRILLE  1116



>gb|KCW53221.1| hypothetical protein EUGRSUZ_J02488 [Eucalyptus grandis]
Length=930

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = +1

Query  289  ATMASENPF-KGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            A   SENPF K I  +L KP GGEFGK+Y LPAL+DPRI  LP SI++LLE
Sbjct  26   AEQRSENPFEKSILRTLEKPDGGEFGKYYYLPALDDPRIDRLPISIKVLLE  76



>gb|EEE58288.1| hypothetical protein OsJ_09326 [Oryza sativa Japonica Group]
Length=907

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 1/47 (2%)
 Frame = +1

Query  301  SENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIX*LPYSIRILLE  438
            ++N +  I T L KPGGG EFGK+YSLPAL+DPRI  LPYSIRILLE
Sbjct  11   AKNSYDEILTGLAKPGGGAEFGKYYSLPALSDPRIERLPYSIRILLE  57



>gb|ADZ57218.1| aconitase protein [Litchi chinensis]
Length=883

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/33 (91%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  340  KPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            KPGGGEFGKFY LPALNDPRI  LPYSIRILLE
Sbjct  1    KPGGGEFGKFYRLPALNDPRIDKLPYSIRILLE  33



>gb|KHN36000.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=908

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 1/40 (3%)
 Frame = +1

Query  322  IFTSLPKPGG-GEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            I T+L KPGG GEFGK++SLPALNDPRI  LPYS+RILLE
Sbjct  17   ILTTLEKPGGAGEFGKYFSLPALNDPRIDRLPYSVRILLE  56



>ref|XP_001770969.1| predicted protein [Physcomitrella patens]
 gb|EDQ64299.1| predicted protein [Physcomitrella patens]
Length=898

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  289  ATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            ++ AS+NPF  + T LPK  GG +G++YSL  LNDPR+  LPYSIR LLE
Sbjct  3    SSPASKNPFSNLVTDLPKASGGSYGQYYSLVKLNDPRVDELPYSIRYLLE  52



>gb|KDO71345.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=889

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRI  402
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDPRI
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDPRI  36



>ref|XP_010100637.1| Aconitate hydratase [Morus notabilis]
 gb|EXB83385.1| Aconitate hydratase [Morus notabilis]
Length=938

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 3/49 (6%)
 Frame = +1

Query  160  SAFRSLRC---SVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATM  297
            +A+RSL     SVPRWSHGV W SP +L +QIR+ APV+  F RKIA+M
Sbjct  50   AAYRSLSSAVRSVPRWSHGVHWNSPYTLRSQIRAVAPVIQQFQRKIASM  98



>emb|CDY44621.1| BnaC04g06410D [Brassica napus]
Length=99

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 34/46 (74%), Gaps = 2/46 (4%)
 Frame = +1

Query  301  SENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            SENPF+ I  +L    GG+FG +YSL ALND RI  LPYSIRILLE
Sbjct  10   SENPFRSILKTLD--DGGKFGNYYSLRALNDSRIDKLPYSIRILLE  53



>ref|XP_002867051.1| aconitate hydratase, cytoplasmic [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43310.1| aconitate hydratase, cytoplasmic [Arabidopsis lyrata subsp. lyrata]
Length=868

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRI  402
            MASENPF+GI  +L KP  GEFG +YSLPALND RI
Sbjct  1    MASENPFRGILKALEKPDSGEFGNYYSLPALNDARI  36



>emb|CDX91508.1| BnaC04g06420D [Brassica napus]
Length=82

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  334  LPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            L KP GG+FG +YSL ALND RI  LPYSIRILLE
Sbjct  2    LEKPDGGKFGNYYSLRALNDSRIDKLPYSIRILLE  36



>gb|KHN21232.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=918

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  352  GEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            GEFGKFYSLP+LNDPRI  LPYSIRILLE
Sbjct  20   GEFGKFYSLPSLNDPRIDRLPYSIRILLE  48



>ref|XP_002991716.1| hypothetical protein SELMODRAFT_133937 [Selaginella moellendorffii]
 gb|EFJ07287.1| hypothetical protein SELMODRAFT_133937 [Selaginella moellendorffii]
Length=907

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 5/46 (11%)
 Frame = +1

Query  301  SENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            + NP+K    +L KP  G  GK+YSLPALNDPR+  LPYSI+ILLE
Sbjct  16   AANPYK----NLVKPLEGH-GKYYSLPALNDPRVEKLPYSIKILLE  56



>ref|XP_002991024.1| hypothetical protein SELMODRAFT_132907 [Selaginella moellendorffii]
 gb|EFJ07832.1| hypothetical protein SELMODRAFT_132907 [Selaginella moellendorffii]
Length=907

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 5/46 (11%)
 Frame = +1

Query  301  SENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            + NP+K    +L KP  G  GK+YSLPALNDPR+  LPYSI+ILLE
Sbjct  16   AANPYK----NLVKPLEGH-GKYYSLPALNDPRVDKLPYSIKILLE  56



>gb|EJY70620.1| Aconitate hydratase 1 family protein [Oxytricha trifallax]
Length=892

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 2/48 (4%)
 Frame = +1

Query  295  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            M   NPF+ +   L   G  +  K+YSLPALNDPR+  LP+S+R+LLE
Sbjct  1    MEKANPFQNVLQELQVEG--QSYKYYSLPALNDPRVEKLPFSVRVLLE  46



>ref|XP_004030259.1| hypothetical protein IMG5_164920 [Ichthyophthirius multifiliis]
 gb|EGR29023.1| hypothetical protein IMG5_164920 [Ichthyophthirius multifiliis]
Length=698

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 30/47 (64%), Gaps = 3/47 (6%)
 Frame = +1

Query  298  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            A  NPF  IF  +P   G +  K YSL +LND R+  LPYSIRILLE
Sbjct  3    AKANPFNKIFQEVP---GLQGYKMYSLKSLNDARVSELPYSIRILLE  46



>emb|CDW89012.1| aconitate hydratase 1 family protein [Stylonychia lemnae]
Length=921

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 26/60 (43%), Positives = 37/60 (62%), Gaps = 3/60 (5%)
 Frame = +1

Query  262  VLNDFH-RKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIX*LPYSIRILLE  438
            +LN  H R  +T   +NP+  + ++L    G +   FY+LPAL D RI  LPYS+R+LLE
Sbjct  17   LLNKTHQRSFSTGPQKNPYASVLSNLTV--GNQKYSFYNLPALQDQRIQRLPYSVRVLLE  74



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562388334840