BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS019C11

Length=594
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP00977.1|  unnamed protein product                                287   6e-93   Coffea canephora [robusta coffee]
ref|XP_010108239.1|  Phosphoenolpyruvate carboxylase, housekeepin...    302   2e-91   
ref|XP_011098224.1|  PREDICTED: phosphoenolpyruvate carboxylase         298   2e-91   Sesamum indicum [beniseed]
ref|XP_008386247.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    296   1e-90   Malus domestica [apple tree]
ref|XP_009340037.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    296   1e-90   Pyrus x bretschneideri [bai li]
ref|XP_009604678.1|  PREDICTED: phosphoenolpyruvate carboxylase         296   1e-90   Nicotiana tomentosiformis
ref|XP_009783765.1|  PREDICTED: phosphoenolpyruvate carboxylase         296   2e-90   Nicotiana sylvestris
ref|XP_002316861.1|  phosphoenolpyruvate carboxylase family protein     296   2e-90   
ref|XP_011082759.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    294   1e-89   Sesamum indicum [beniseed]
gb|KDO63366.1|  hypothetical protein CISIN_1g002112mg                   290   1e-89   Citrus sinensis [apfelsine]
sp|P27154.1|CAPP_TOBAC  RecName: Full=Phosphoenolpyruvate carboxy...    293   2e-89   Nicotiana tabacum [American tobacco]
ref|XP_006370158.1|  phosphoenolpyruvate carboxylase family protein     293   2e-89   Populus trichocarpa [western balsam poplar]
ref|XP_008463734.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    293   3e-89   Cucumis melo [Oriental melon]
ref|XP_002530381.1|  Phosphoenolpyruvate carboxylase, putative          293   3e-89   Ricinus communis
gb|ABR29876.1|  phosphoenolpyruvate carboxylase                         293   3e-89   Ricinus communis
ref|XP_011029569.1|  PREDICTED: phosphoenolpyruvate carboxylase         292   6e-89   Populus euphratica
emb|CBI20195.3|  unnamed protein product                                291   6e-89   Vitis vinifera
ref|XP_009334045.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    292   7e-89   Pyrus x bretschneideri [bai li]
gb|EYU45020.1|  hypothetical protein MIMGU_mgv1a000847mg                291   8e-89   Erythranthe guttata [common monkey flower]
gb|KDO63365.1|  hypothetical protein CISIN_1g002112mg                   290   9e-89   Citrus sinensis [apfelsine]
ref|XP_010060690.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    291   1e-88   Eucalyptus grandis [rose gum]
ref|XP_007214986.1|  hypothetical protein PRUPE_ppa002020mg             287   1e-88   
ref|XP_002285441.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    291   1e-88   Vitis vinifera
ref|XP_011005507.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    291   1e-88   Populus euphratica
ref|XP_009607156.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    290   2e-88   Nicotiana tomentosiformis
ref|XP_006360045.1|  PREDICTED: phosphoenolpyruvate carboxylase-l...    290   2e-88   Solanum tuberosum [potatoes]
gb|KDO63363.1|  hypothetical protein CISIN_1g002112mg                   290   3e-88   Citrus sinensis [apfelsine]
ref|XP_006446789.1|  hypothetical protein CICLE_v10014164mg             290   3e-88   Citrus clementina [clementine]
ref|XP_009762944.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    290   3e-88   Nicotiana sylvestris
gb|AFN70425.1|  phosphoenolpyruvate carboxylase                         290   3e-88   Manihot esculenta subsp. flabellifolia
ref|XP_006469015.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    290   3e-88   
ref|XP_009766373.1|  PREDICTED: phosphoenolpyruvate carboxylase         290   3e-88   Nicotiana sylvestris
ref|XP_008367955.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    290   4e-88   
ref|NP_001267517.1|  phosphoenolpyruvate carboxylase, housekeepin...    289   5e-88   Cucumis sativus [cucumbers]
tpg|DAA61010.1|  TPA: phosphoenolpyruvate carboxylase4                  270   5e-88   
ref|XP_009598007.1|  PREDICTED: phosphoenolpyruvate carboxylase         289   6e-88   Nicotiana tomentosiformis
gb|AJP17168.1|  phosphoenolpyruvate carboxylase 2                       289   8e-88   Prunus sibirica [Siberian apricot]
ref|XP_008229092.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       288   1e-87   Prunus mume [ume]
ref|XP_007213682.1|  hypothetical protein PRUPE_ppa000910mg             288   2e-87   Prunus persica
emb|CDP06006.1|  unnamed protein product                                288   2e-87   Coffea canephora [robusta coffee]
gb|KJB27013.1|  hypothetical protein B456_004G272100                    284   3e-87   Gossypium raimondii
gb|ACC66283.1|  phosphoenolpyruvate carboxylase                         287   3e-87   Suaeda glauca
ref|XP_008226531.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    287   3e-87   Prunus mume [ume]
ref|XP_004303182.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       286   6e-87   Fragaria vesca subsp. vesca
sp|Q9FV65.1|CAPPC_FLATR  RecName: Full=Phosphoenolpyruvate carbox...    286   6e-87   Flaveria trinervia
gb|AFN70424.1|  phosphoenolpyruvate carboxylase                         286   1e-86   Manihot esculenta [manioc]
ref|NP_001237602.1|  phosphoenolpyruvate carboxylase, housekeepin...    285   1e-86   Glycine max [soybeans]
ref|XP_010104390.1|  Phosphoenolpyruvate carboxylase 2                  285   2e-86   Morus notabilis
ref|XP_010675388.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       285   2e-86   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004248242.1|  PREDICTED: phosphoenolpyruvate carboxylase         285   2e-86   Solanum lycopersicum
ref|XP_002518037.1|  Phosphoenolpyruvate carboxylase, putative          285   2e-86   
ref|XP_006582125.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    281   4e-86   Glycine max [soybeans]
gb|KHG25857.1|  Phosphoenolpyruvate carboxylase 2                       284   6e-86   Gossypium arboreum [tree cotton]
gb|KJB27012.1|  hypothetical protein B456_004G272100                    284   6e-86   Gossypium raimondii
gb|KHG02548.1|  Phosphoenolpyruvate carboxylase, housekeeping iso...    283   8e-86   Gossypium arboreum [tree cotton]
gb|EYU26325.1|  hypothetical protein MIMGU_mgv1a000844mg                283   1e-85   Erythranthe guttata [common monkey flower]
ref|XP_004294066.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       283   1e-85   Fragaria vesca subsp. vesca
ref|XP_007021728.1|  Phosphoenolpyruvate carboxylase 3 isoform 1        283   1e-85   
gb|KJB13196.1|  hypothetical protein B456_002G061400                    282   2e-85   Gossypium raimondii
emb|CAC28225.1|  phosphoenolpyruvate carboxylase                        282   3e-85   Sesbania rostrata
gb|KJB82054.1|  hypothetical protein B456_013G173500                    278   3e-85   Gossypium raimondii
ref|XP_008368627.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    280   3e-85   
gb|AJD81367.1|  phosphoenolpyruvate carboxylase isoform 1               281   4e-85   Egeria densa
gb|EPS69468.1|  hypothetical protein M569_05291                         281   5e-85   Genlisea aurea
gb|KHN48472.1|  Phosphoenolpyruvate carboxylase, housekeeping iso...    281   6e-85   Glycine soja [wild soybean]
ref|XP_003527207.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    281   6e-85   Glycine max [soybeans]
ref|XP_008342775.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    281   6e-85   
emb|CAA62469.1|  phosphoenolpyruvate carboxylase                        281   7e-85   Solanum tuberosum [potatoes]
ref|XP_006852422.1|  hypothetical protein AMTR_s00021p00059810          281   8e-85   Amborella trichopoda
ref|XP_006358941.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    280   2e-84   
sp|Q01647.1|CAPP1_FLAPR  RecName: Full=Phosphoenolpyruvate carbox...    280   2e-84   Flaveria pringlei
gb|KJB33217.1|  hypothetical protein B456_006G001300                    279   2e-84   Gossypium raimondii
emb|CAA88829.1|  phosphoenolpyruvate carboxylase                        280   2e-84   Flaveria pringlei
ref|NP_001274942.1|  phosphoenolpyruvate carboxylase                    279   3e-84   Solanum tuberosum [potatoes]
gb|KHG25331.1|  Phosphoenolpyruvate carboxylase 2                       279   3e-84   Gossypium arboreum [tree cotton]
gb|AAM14597.1|AF494192_1  phosphoenolpyruvate carboxylase FPUB966       279   3e-84   Flaveria pubescens
gb|KDP32538.1|  hypothetical protein JCGZ_14741                         279   3e-84   Jatropha curcas
ref|XP_004297535.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    279   4e-84   Fragaria vesca subsp. vesca
ref|XP_009354255.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       278   5e-84   Pyrus x bretschneideri [bai li]
gb|KJB82053.1|  hypothetical protein B456_013G173500                    278   6e-84   Gossypium raimondii
gb|AAB80714.1|  phosphoenolpyruvate carboxylase 1                       278   7e-84   Gossypium hirsutum [American cotton]
ref|XP_007133202.1|  hypothetical protein PHAVU_011G160200g             278   1e-83   Phaseolus vulgaris [French bean]
ref|XP_009357178.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    278   1e-83   Pyrus x bretschneideri [bai li]
ref|XP_010279120.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    277   1e-83   Nelumbo nucifera [Indian lotus]
ref|XP_004251893.1|  PREDICTED: phosphoenolpyruvate carboxylase         277   2e-83   Solanum lycopersicum
gb|KDP36288.1|  hypothetical protein JCGZ_09795                         277   2e-83   Jatropha curcas
ref|NP_001241357.1|  phosphoenolpyruvate carboxylase                    277   2e-83   Glycine max [soybeans]
gb|AAM14596.1|AF494191_1  phosphoenolpyruvate carboxylase FB966         277   2e-83   Flaveria brownii
ref|XP_010552117.1|  PREDICTED: phosphoenolpyruvate carboxylase 3       276   2e-83   Tarenaya hassleriana [spider flower]
gb|ABV80356.1|  phosphoenolpyruvate carboxylase                         276   3e-83   Gossypium hirsutum [American cotton]
gb|EEC83482.1|  hypothetical protein OsI_28999                          271   3e-83   Oryza sativa Indica Group [Indian rice]
sp|Q9FV66.1|CAPPB_FLATR  RecName: Full=Phosphoenolpyruvate carbox...    276   4e-83   Flaveria trinervia
gb|KEH19560.1|  phosphoenolpyruvate carboxylase                         275   4e-83   Medicago truncatula
ref|XP_002280569.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    276   4e-83   Vitis vinifera
sp|Q9AU12.1|CAPP_PHAVU  RecName: Full=Phosphoenolpyruvate carboxy...    276   6e-83   Phaseolus vulgaris [French bean]
emb|CBI21984.3|  unnamed protein product                                275   6e-83   Vitis vinifera
ref|XP_011012152.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    276   6e-83   Populus euphratica
ref|XP_004516076.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    276   6e-83   Cicer arietinum [garbanzo]
ref|XP_007149391.1|  hypothetical protein PHAVU_005G066400g             275   7e-83   Phaseolus vulgaris [French bean]
ref|XP_006306678.1|  hypothetical protein CARUB_v10008196mg             276   7e-83   
gb|AAU07997.1|  phosphoenolpyruvate carboxylase 2                       275   7e-83   Lupinus albus
gb|AJD81369.1|  phosphoenolpyruvate carboxylase isoform 3               275   8e-83   Egeria densa
gb|KEH19559.1|  phosphoenolpyruvate carboxylase                         275   9e-83   Medicago truncatula
gb|AJD81371.1|  phosphoenolpyruvate carboxylase isoform 5               275   1e-82   Egeria densa
ref|XP_006407030.1|  hypothetical protein EUTSA_v10019997mg             275   1e-82   Eutrema salsugineum [saltwater cress]
ref|XP_007048690.1|  Phosphoenolpyruvate carboxylase 3 isoform 1        275   1e-82   
ref|XP_010542308.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    275   1e-82   Tarenaya hassleriana [spider flower]
gb|ABU41519.1|  phosphoenolpyruvate carboxylase                         275   1e-82   Jatropha curcas
gb|ABR29878.1|  phosphoenolpyruvate carboxylase                         275   1e-82   Ricinus communis
gb|AJD81368.1|  phosphoenolpyruvate carboxylase isoform 2               274   2e-82   Egeria densa
gb|KJB48959.1|  hypothetical protein B456_008G095300                    274   2e-82   Gossypium raimondii
gb|KHG11000.1|  Phosphoenolpyruvate carboxylase, housekeeping iso...    274   2e-82   Gossypium arboreum [tree cotton]
ref|NP_001237394.1|  phosphoenolpyruvate carboxylase                    274   2e-82   Glycine max [soybeans]
ref|NP_001236741.1|  phosphoenolpyruvate carboxylase                    274   3e-82   
emb|CAA45504.1|  phosphoenolpyruvate carboxylase                        274   3e-82   Flaveria trinervia
ref|XP_006593478.1|  PREDICTED: phosphoenolpyruvate carboxylase i...    274   3e-82   
gb|KHN36882.1|  Phosphoenolpyruvate carboxylase                         273   3e-82   Glycine soja [wild soybean]
ref|XP_003543306.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    273   4e-82   Glycine max [soybeans]
gb|KFK38845.1|  phosphoenolpyruvate carboxylase                         273   5e-82   Arabis alpina [alpine rockcress]
gb|AAO15570.1|AF459644_1  phosphoenolpyruvate carboxylase               273   5e-82   Lupinus albus
gb|KHN36697.1|  Phosphoenolpyruvate carboxylase 2                       273   5e-82   Glycine soja [wild soybean]
ref|XP_002882904.1|  ATPPC3                                             273   5e-82   Arabidopsis lyrata subsp. lyrata
ref|XP_007149740.1|  hypothetical protein PHAVU_005G095300g             273   5e-82   Phaseolus vulgaris [French bean]
ref|XP_010479886.1|  PREDICTED: phosphoenolpyruvate carboxylase 1       273   7e-82   Camelina sativa [gold-of-pleasure]
ref|XP_002894435.1|  ATPPC1                                             273   7e-82   
ref|XP_010500970.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    273   7e-82   Camelina sativa [gold-of-pleasure]
ref|XP_002302820.2|  hypothetical protein POPTR_0002s22720g             273   7e-82   
ref|XP_008813762.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    273   7e-82   Phoenix dactylifera
ref|XP_007132856.1|  hypothetical protein PHAVU_011G130400g             273   8e-82   Phaseolus vulgaris [French bean]
ref|XP_010920051.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoenolp...    272   9e-82   
ref|XP_006296907.1|  hypothetical protein CARUB_v10012899mg             272   1e-81   Capsella rubella
emb|CAB65170.1|  phosphoenolpyruvate carboxylase 1                      272   1e-81   Solanum lycopersicum var. cerasiforme [cherry tomato]
ref|XP_006306679.1|  hypothetical protein CARUB_v10008196mg             272   2e-81   Capsella rubella
ref|XP_010925637.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    271   2e-81   
ref|XP_008793018.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    271   2e-81   Phoenix dactylifera
ref|NP_001061646.1|  Os08g0366000                                       271   2e-81   
ref|XP_006392801.1|  hypothetical protein EUTSA_v10011967mg             271   2e-81   
ref|NP_001275821.1|  phosphoenolpyruvate carboxylase                    271   2e-81   Citrus sinensis [apfelsine]
ref|XP_009406237.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    271   2e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006659319.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    271   2e-81   Oryza brachyantha
ref|NP_188112.1|  phosphoenolpyruvate carboxylase 3                     271   2e-81   Arabidopsis thaliana [mouse-ear cress]
gb|AAO42888.1|  At3g14940                                               271   3e-81   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ34480.1|  unnamed protein product                                271   3e-81   Eutrema halophilum
ref|XP_009146304.1|  PREDICTED: phosphoenolpyruvate carboxylase 3       271   3e-81   Brassica rapa
ref|XP_006487452.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    271   3e-81   Citrus sinensis [apfelsine]
ref|NP_175738.1|  phosphoenolpyruvate carboxylase 1                     271   3e-81   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19953.1|  AT1G53310                                              271   3e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006442514.1|  hypothetical protein CICLE_v10018719mg             271   3e-81   Citrus clementina [clementine]
pdb|3ZGB|A  Chain A, Greater Efficiency Of Photosynthetic Carbon ...    271   3e-81   Flaveria pringlei
ref|XP_003597124.1|  Phosphoenolpyruvate carboxylase                    271   4e-81   Medicago truncatula
ref|XP_008812088.1|  PREDICTED: SCAR-like protein 2                     275   4e-81   
emb|CAJ84247.1|  phosphoenolpyruvate carboxylase                        270   4e-81   Lupinus luteus
ref|XP_010052683.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       270   5e-81   Eucalyptus grandis [rose gum]
emb|CAA81072.1|  phosphoenolpyruvate carboxylase                        270   5e-81   Flaveria trinervia
sp|P30694.2|CAPPA_FLATR  RecName: Full=C4 phosphoenolpyruvate car...    270   6e-81   Flaveria trinervia
prf||1801241A  phosphoenolpyruvate carboxylase                          270   7e-81
pdb|4BXH|B  Chain B, Resolving The Activation Site Of Positive Re...    270   7e-81   Flaveria trinervia
pdb|3ZGE|A  Chain A, Greater Efficiency Of Photosynthetic Carbon ...    270   8e-81   Flaveria trinervia
emb|CAJ86550.1|  phosphoenolpyrovate carboxylase                        270   8e-81   Lupinus luteus
gb|ABR17346.1|  unknown                                                 270   9e-81   Picea sitchensis
ref|XP_009395707.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       269   1e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002444204.1|  hypothetical protein SORBIDRAFT_07g014960          269   1e-80   Sorghum bicolor [broomcorn]
ref|XP_004487157.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    269   1e-80   Cicer arietinum [garbanzo]
dbj|BAC41248.1|  phosphoenolpyruvate carboxylase                        269   1e-80   Glycine max [soybeans]
ref|XP_009135413.1|  PREDICTED: phosphoenolpyruvate carboxylase 3       269   2e-80   Brassica rapa
ref|XP_010915515.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    269   2e-80   Elaeis guineensis
gb|AAO25631.1|  phosphoenolpyruvate carboxylase                         268   3e-80   Oryza sativa Indica Group [Indian rice]
ref|XP_003527347.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    268   4e-80   Glycine max [soybeans]
gb|ABY87944.1|  phosphoenolpyruvate carboxylase                         268   4e-80   Arachis hypogaea [goober]
tpg|DAA61011.1|  TPA: phosphoenolpyruvate carboxylase4                  268   4e-80   
gb|ACN32213.1|  phosphoenolpyruvate carboxylase                         268   4e-80   Arachis hypogaea [goober]
ref|XP_002462179.1|  hypothetical protein SORBIDRAFT_02g021090          268   5e-80   Sorghum bicolor [broomcorn]
sp|P29194.1|CAPP2_SORBI  RecName: Full=Phosphoenolpyruvate carbox...    268   5e-80   Sorghum bicolor [broomcorn]
sp|P51063.1|CAPP_PICAB  RecName: Full=Phosphoenolpyruvate carboxy...    267   6e-80   Picea abies
ref|XP_010924612.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       267   6e-80   
gb|AAU07999.1|  phosphoenolpyruvate carboxylase 4                       267   7e-80   Lupinus albus
ref|XP_010277028.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    267   8e-80   Nelumbo nucifera [Indian lotus]
ref|XP_010465426.1|  PREDICTED: phosphoenolpyruvate carboxylase 3...    267   9e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010502354.1|  PREDICTED: phosphoenolpyruvate carboxylase 3       267   9e-80   
emb|CAC83481.1|  phosphoenolpyruvate carboxylase                        266   1e-79   Phalaenopsis equestris
emb|CAC83482.1|  phosphoenolpyruvate carboxylase                        266   1e-79   Phalaenopsis amabilis
gb|ACO48250.1|  phosphoenolpyruvate carboxylase                         266   1e-79   Arachis hypogaea [goober]
gb|AAU07998.1|  phosphoenolpyruvate carboxylase 3                       266   1e-79   Lupinus albus
emb|CDP15935.1|  unnamed protein product                                266   2e-79   Coffea canephora [robusta coffee]
emb|CDY45929.1|  BnaC06g09980D                                          264   3e-79   Brassica napus [oilseed rape]
gb|AAK58637.1|AF271163_1  phosphoenolpyruvate carboxylase isoform 3     266   3e-79   Hydrilla verticillata
gb|AAK58635.2|AF271161_1  phosphoenolpyruvate carboxylase isoform 1     266   3e-79   Hydrilla verticillata
gb|AAK58636.1|AF271162_1  phosphoenolpyruvate carboxylase isoform 2     265   3e-79   Hydrilla verticillata
ref|XP_003596385.1|  Phosphoenolpyruvate-carboxylase                    265   4e-79   Medicago truncatula
ref|NP_001105438.1|  phosphoenolpyruvate carboxylase 2                  265   4e-79   Zea mays [maize]
sp|Q02735.1|CAPP_MEDSA  RecName: Full=Phosphoenolpyruvate carboxy...    265   4e-79   Medicago sativa [alfalfa]
ref|XP_009795584.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    265   5e-79   Nicotiana sylvestris
ref|XP_004956559.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    265   5e-79   Setaria italica
emb|CDY25721.1|  BnaC03g69540D                                          264   5e-79   Brassica napus [oilseed rape]
emb|CAA11415.1|  phosphoenolpyruvate carboxylase                        264   8e-79   Brassica juncea [brown mustard]
ref|XP_004489030.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    264   8e-79   
ref|XP_009106983.1|  PREDICTED: phosphoenolpyruvate carboxylase 1       264   9e-79   Brassica rapa
ref|XP_009416509.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    264   9e-79   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAC20365.1|  phosphoenolpyruvate carboxylase                        264   9e-79   Lotus japonicus
gb|ACO48251.1|  phosphoenolpyruvate carboxylase                         264   1e-78   Arachis hypogaea [goober]
emb|CAA11414.1|  phosphoenolpyrovate carboxylase                        264   1e-78   Brassica juncea [brown mustard]
ref|XP_004505496.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    264   1e-78   Cicer arietinum [garbanzo]
ref|XP_006348868.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    264   1e-78   Solanum tuberosum [potatoes]
ref|XP_011100202.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    263   2e-78   Sesamum indicum [beniseed]
ref|XP_010527380.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    263   2e-78   Tarenaya hassleriana [spider flower]
ref|XP_003577980.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       263   2e-78   Brachypodium distachyon [annual false brome]
ref|XP_008781416.1|  PREDICTED: LOW QUALITY PROTEIN: SCAR-like pr...    268   2e-78   
ref|NP_001267665.1|  phosphoenolpyruvate carboxylase 2-like             263   2e-78   Cucumis sativus [cucumbers]
sp|P16097.1|CAPP2_MESCR  RecName: Full=Phosphoenolpyruvate carbox...    263   2e-78   Mesembryanthemum crystallinum
emb|CAB59571.1|  phosphoenolpyruvate carboxylase                        249   2e-78   Vanilla planifolia [cultivated vanilla]
ref|XP_009603289.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    263   3e-78   Nicotiana tomentosiformis
gb|EMT08272.1|  Phosphoenolpyruvate carboxylase 2                       263   4e-78   
dbj|BAJ85327.1|  predicted protein                                      262   4e-78   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ97144.1|  predicted protein                                      262   5e-78   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAA07610.1|  phospoenolpyruvate carboxylase                         262   5e-78   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008455304.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       261   7e-78   
gb|EPS65212.1|  hypothetical protein M569_09565                         246   8e-78   Genlisea aurea
ref|XP_004243288.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    260   2e-77   Solanum lycopersicum
ref|XP_003607582.1|  Phosphoenolpyruvate carboxylase                    260   2e-77   Medicago truncatula
ref|XP_009380945.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    260   2e-77   Musa acuminata subsp. malaccensis [pisang utan]
gb|AHF21553.1|  phosphoenolpyruvate carboxylase                         260   3e-77   Hylocereus undatus [dragon fruit]
ref|XP_006348299.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    260   3e-77   
ref|XP_010524060.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       259   4e-77   Tarenaya hassleriana [spider flower]
sp|P51062.1|CAPP_PEA  RecName: Full=Phosphoenolpyruvate carboxyla...    259   7e-77   Pisum sativum [garden pea]
gb|AAD45696.1|AF159051_1  phosphoenolpyruvate carboxylase               259   8e-77   Picea abies
ref|XP_004970018.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    259   8e-77   Setaria italica
emb|CAA09588.1|  phosphoenolpyruvate-carboxylase                        259   9e-77   Vicia faba [broad bean]
gb|EYU41129.1|  hypothetical protein MIMGU_mgv1a000842mg                259   9e-77   Erythranthe guttata [common monkey flower]
ref|XP_008655339.1|  PREDICTED: uncharacterized protein LOC100384...    258   1e-76   
sp|P29193.1|CAPP1_SACHY  RecName: Full=Phosphoenolpyruvate carbox...    258   2e-76   Saccharum sp.
emb|CAA09807.1|  ppc2                                                   257   3e-76   Solanum tuberosum [potatoes]
gb|AEG78834.1|  phosphoenolpyruvate carboxylase                         257   4e-76   Dendrobium officinale
ref|XP_006293629.1|  hypothetical protein CARUB_v10022582mg             256   8e-76   Capsella rubella
ref|NP_850373.4|  phosphoenolpyruvate carboxylase 2                     256   9e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881863.1|  phosphoenolpyruvate carboxylase                    256   9e-76   Arabidopsis lyrata subsp. lyrata
emb|CAD58726.1|  phosphoenolpyruvate carboxylase                        256   1e-75   Arabidopsis thaliana [mouse-ear cress]
gb|AAP43628.1|  phosphoenolpyruvate carboxylase                         256   1e-75   Arabidopsis thaliana [mouse-ear cress]
emb|CAA60627.1|  phosphoenolpyruvate-carboxylase                        255   1e-75   Vanilla planifolia [cultivated vanilla]
gb|AAD22994.1|  phosphoenolpyruvate carboxylase                         255   1e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006660531.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    255   2e-75   
ref|XP_010413019.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    254   2e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010508551.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       254   3e-75   Camelina sativa [gold-of-pleasure]
ref|XP_006644735.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    254   5e-75   Oryza brachyantha
gb|ABG01962.1|  phosphoenolpyruvate carboxylase                         254   6e-75   Sesuvium portulacastrum [sea-purslane]
dbj|BAD36412.1|  putative phosphoenolpyruvate carboxylase               254   6e-75   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ08566.1|  hypothetical protein OsI_30839                          253   7e-75   Oryza sativa Indica Group [Indian rice]
gb|EMS60171.1|  Phosphoenolpyruvate carboxylase 2                       252   2e-74   Triticum urartu
gb|KFK37112.1|  hypothetical protein AALP_AA4G214300                    252   2e-74   Arabis alpina [alpine rockcress]
gb|AAD31452.1|AF135371_1  phosphoenol pyruvate carboxylase              251   3e-74   Lotus corniculatus
gb|EEE55407.1|  hypothetical protein OsJ_03516                          251   4e-74   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ33978.1|  unnamed protein product                                249   4e-74   Eutrema halophilum
dbj|BAC20364.1|  phosphoenolpyruvate carboxylase                        251   4e-74   Lotus japonicus
dbj|BAC19851.1|  phosphoenolpyruvate carboxylase                        250   9e-74   Eleocharis vivipara
ref|XP_009404506.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    250   1e-73   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT32045.1|  Phosphoenolpyruvate carboxylase 1                       235   5e-73   
emb|CAC86034.1|  phosphoenolpyruvate carboxylase 2                      248   6e-73   Solanum lycopersicum
ref|XP_010324389.1|  PREDICTED: phosphoenolpyruvate carboxylase         248   6e-73   
emb|CAB65171.1|  phosphoenolpyruvate carboxylase 2                      248   6e-73   Solanum lycopersicum var. cerasiforme [cherry tomato]
ref|XP_010689827.1|  PREDICTED: phosphoenolpyruvate carboxylase 1       248   9e-73   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010232351.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoenolp...    246   3e-72   
ref|XP_010911773.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       225   1e-71   
dbj|BAD27731.1|  phosphoenolpyruvate carboxylase-like                   235   2e-71   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009142853.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       244   2e-71   Brassica rapa
emb|CDY51508.1|  BnaC04g02430D                                          244   2e-71   Brassica napus [oilseed rape]
emb|CDY55389.1|  BnaA05g34260D                                          244   2e-71   Brassica napus [oilseed rape]
gb|AAY28730.1|  phosphoenolpyruvate carboxylase                         243   3e-71   Alternanthera ficoidea [sanguinarea]
ref|XP_009142075.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       242   6e-71   Brassica rapa
emb|CDY47982.1|  BnaA04g24600D                                          242   6e-71   Brassica napus [oilseed rape]
emb|CDY14847.1|  BnaC04g48440D                                          242   6e-71   Brassica napus [oilseed rape]
emb|CBM56258.1|  C3 phosphoenolpyruvate carboxylase                     242   8e-71   Panicum bisulcatum [Japanese panicgrass]
sp|Q43299.1|CAPP_AMAHP  RecName: Full=Phosphoenolpyruvate carboxy...    242   8e-71   Amaranthus hypochondriacus [prince's feather]
gb|ABR24265.1|  PhtY                                                    242   8e-71   Microbacterium sp. CQ0110Y
ref|XP_002458521.1|  hypothetical protein SORBIDRAFT_03g035090          242   1e-70   
ref|XP_006411525.1|  hypothetical protein EUTSA_v10016192mg             239   1e-70   
gb|ADO15315.1|  C4 photosynthetic phosphoenolpyruvate                   241   1e-70   Amaranthus hypochondriacus [prince's feather]
gb|AIR93775.1|  phosphoenolpyruvate carboxylase                         241   2e-70   Kalanchoe fedtschenkoi [lavender-scallops]
gb|ABA33611.1|  phosphoenolpyruvate carboxylase                         223   3e-70   Zea mays [maize]
gb|AAY28731.1|  phosphoenolpyruvate carboxylase                         240   4e-70   Alternanthera sessilis
ref|XP_006411524.1|  hypothetical protein EUTSA_v10016192mg             239   1e-69   Eutrema salsugineum [saltwater cress]
gb|ABG20459.1|  phosphoenolpyruvate carboxylase                         238   2e-69   
emb|CAA62747.1|  phosphoenolpyruvate carboxylase                        238   2e-69   
gb|AAX98688.3|  C4 phosphoenolpyruvate carboxylase                      237   4e-69   
gb|AAG00180.1|AF271995_1  phosphoenolpyruvate carboxylase               236   1e-68   
gb|EEC72817.1|  hypothetical protein OsI_06526                          236   1e-68   
ref|NP_001046417.1|  Os02g0244700                                       236   1e-68   
emb|CAA60626.1|  phosphoenolpyruvate-carboxylase                        236   1e-68   
ref|NP_001267742.1|  phosphoenolpyruvate carboxylase 1                  235   2e-68   
ref|NP_001105503.1|  phosphoenolpyruvate carboxylase                    235   2e-68   
ref|XP_008676434.1|  PREDICTED: uncharacterized protein LOC100191...    235   2e-68   
ref|XP_003571949.1|  PREDICTED: phosphoenolpyruvate carboxylase 1       235   3e-68   
ref|XP_006647114.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    235   3e-68   
dbj|BAJ87123.1|  predicted protein                                      234   4e-68   
gb|AAP06951.1|  phosphoenolpyruvate carboxylase                         234   7e-68   
gb|AAG42288.1|  phosphoenolpyruvate carboxylase                         234   8e-68   
dbj|BAF80187.1|  phosphoenolpyruvate carboxylase                        233   9e-68   
ref|XP_002451855.1|  hypothetical protein SORBIDRAFT_04g008720          233   1e-67   
sp|P10490.1|CAPP1_MESCR  RecName: Full=Phosphoenolpyruvate carbox...    233   1e-67   
sp|P29195.1|CAPP1_SORBI  RecName: Full=Phosphoenolpyruvate carbox...    233   1e-67   
dbj|BAJ94338.1|  predicted protein                                      233   2e-67   
gb|AAY28729.1|  phosphoenolpyruvate carboxylase                         232   2e-67   
dbj|BAI78342.1|  phosphoenolpyruvate carboxylase                        231   4e-67   
ref|XP_003563811.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    231   8e-67   
gb|AAM95946.1|  phosphoenolpyruvate carboxylase                         230   1e-66   
ref|XP_008664266.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    213   9e-66   
ref|NP_001267758.1|  phosphoenolpyruvate carboxylase 1-like             227   1e-65   
emb|CAM83969.2|  phosphoenolpyruvate carboxylase                        226   2e-65   
gb|EMS57465.1|  Phosphoenolpyruvate carboxylase, housekeeping iso...    227   2e-65   
ref|XP_010553399.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    226   5e-65   
ref|NP_001105418.1|  phosphoenolpyruvate carboxylase 1                  222   9e-64   
emb|CAA33663.1|  P-pyruvate carboxylase                                 222   9e-64   
gb|ADW27477.1|  phosphoenolpyruvate carboxylase                         222   9e-64   
ref|NP_001154820.1|  uncharacterized protein LOC100191762               222   1e-63   
emb|CAD60555.1|  phosphoenolpyruvate carboxylase                        222   1e-63   
gb|ACJ38542.1|  phosphoenolpyruvate carboxylase                         222   1e-63   
ref|XP_008664106.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    205   3e-62   
emb|CBT21623.1|  C4 phosphoenolpyruvate carboxylase                     214   1e-60   
ref|XP_001760595.1|  predicted protein                                  213   2e-60   
dbj|BAA03094.1|  phosphoenolpyruvate carboxylase                        213   2e-60   
ref|XP_001757859.1|  predicted protein                                  211   8e-60   
ref|XP_008670284.1|  PREDICTED: MLO-like protein 4                      202   3e-59   
gb|EMT25785.1|  Phosphoenolpyruvate carboxylase 1                       208   4e-59   
ref|XP_001766239.1|  predicted protein                                  206   5e-58   
gb|ABY56044.1|  phosphoenolpyruvate carboxylase                         203   7e-57   
ref|XP_001782799.1|  predicted protein                                  202   1e-56   
emb|CAC08829.1|  putative C4 phosphoenolpyruvate carboxylase            202   1e-56   
gb|AAN15222.1|  putative C4 phosphoenolpyruvate carboxylase             201   2e-56   
sp|P15804.2|CAPP3_SORBI  RecName: Full=Phosphoenolpyruvate carbox...    201   3e-56   
ref|XP_002438521.1|  hypothetical protein SORBIDRAFT_10g021330          201   3e-56   
ref|XP_002990195.1|  hypothetical protein SELMODRAFT_447920             201   5e-56   
gb|ADV92634.1|  phosphoenolpyruvate carboxylase                         201   5e-56   
emb|CCA60995.1|  phosphoenolpyruvate carboxylase                        200   5e-56   
emb|CAC85930.1|  putative phosphoenolpyruvate carboxylase               197   6e-55   
ref|XP_002992495.1|  hypothetical protein SELMODRAFT_269944             196   2e-54   
gb|EMS68413.1|  Phosphoenolpyruvate carboxylase 1                       193   4e-54   
emb|CDX75798.1|  BnaC03g38810D                                          193   6e-54   
emb|CDX82457.1|  BnaA03g33640D                                          193   7e-54   
ref|XP_002513286.1|  2-alkenal reductase, putative                      182   1e-52   
dbj|BAK09197.1|  phosphoenolpyruvate carboxylase                        192   1e-52   
dbj|BAK09198.1|  phosphoenolpyruvate carboxylase                        192   1e-52   
emb|CDX97618.1|  BnaA05g24610D                                          190   1e-52   
dbj|BAK09196.1|  phosphoenolpyruvate carboxylase                        191   1e-52   
dbj|BAK09195.1|  phosphoenolpyruvate carboxylase                        191   1e-52   
ref|NP_001042358.1|  Os01g0208700                                       191   1e-52   
emb|CDY32330.1|  BnaC01g36490D                                          179   2e-52   
gb|EAY72974.1|  hypothetical protein OsI_00846                          191   2e-52   
emb|CDX98516.1|  BnaC05g38590D                                          190   2e-52   
ref|XP_006643893.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    191   3e-52   
emb|CAA27270.1|  PEPCase                                                183   8e-50   
gb|EEE56642.1|  hypothetical protein OsJ_06051                          181   3e-49   
emb|CAA96509.1|  phosphoenolpyruvate carboxylase                        166   4e-49   
ref|XP_001774499.1|  predicted protein                                  181   6e-49   
ref|XP_009342319.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    181   7e-49   
ref|XP_001773964.1|  predicted protein                                  178   8e-48   
emb|CCB84879.1|  phosphoenolpyruvate carboxylase                        176   3e-47   
ref|XP_004968594.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    175   9e-47   
emb|CAM83972.2|  phosphoenolpyruvate carboxylase                        169   1e-44   
ref|XP_008362419.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       168   2e-44   
ref|XP_002985372.1|  hypothetical protein SELMODRAFT_122213             166   2e-43   
ref|XP_002979664.1|  hypothetical protein SELMODRAFT_111216             166   2e-43   
ref|NP_001044301.1|  Os01g0758300                                       166   2e-43   
gb|EMS50355.1|  Phosphoenolpyruvate carboxylase 1                       153   1e-42   
emb|CDM82240.1|  unnamed protein product                                159   4e-41   
dbj|BAJ96977.1|  predicted protein                                      155   1e-39   
ref|XP_003565329.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    152   1e-38   
gb|AJD81370.1|  phosphoenolpyruvate carboxylase isoform 4               134   1e-32   
emb|CAA30158.1|  unnamed protein product                                115   2e-29   
dbj|BAA25129.1|  phosphoenolpyruvate carboxylase                        104   2e-25   
emb|CAA96504.1|  phosphoenolpyruvate carboxylase                        102   8e-25   
gb|EMT14603.1|  Phosphoenolpyruvate carboxylase 1                       110   3e-24   
gb|ACJ22779.1|  phosphoenolpyruvate carboxylase                         100   4e-24   
dbj|BAA23422.1|  phosphoenolpyruvate carboxylase                      99.0    2e-23   
ref|XP_007021730.1|  Phosphoenolpyruvate carboxylase 3 isoform 3        108   2e-23   
ref|XP_008813763.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    105   3e-22   
emb|CDM84220.1|  unnamed protein product                                101   5e-21   
gb|EAZ06755.1|  hypothetical protein OsI_29000                        90.1    7e-20   
gb|KDO44636.1|  hypothetical protein CISIN_1g002089mg                 94.4    1e-18   
gb|ADZ05827.1|  phosphoenolpyruvate carboxylase                       94.4    2e-18   
emb|CAA30159.1|  unnamed protein product                              85.9    2e-18   
ref|NP_683646.1|  phosphoenolpyruvate carboxylase-related protein     85.1    3e-18   
emb|CAA45347.1|  phosphoenolpyruvate carboxylase                      84.7    5e-18   
ref|XP_008377074.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...  85.5    6e-18   
gb|AAD13911.1|S60262_1  phosphoenolpyruvate carboxylase               84.0    1e-17   
gb|EMS62961.1|  SCAR-like protein 2                                   91.3    2e-17   
gb|EAY75884.1|  hypothetical protein OsI_03803                        90.1    3e-17   
emb|CAX83739.1|  PEP carboxylase                                      81.3    1e-16   
dbj|BAJ85848.1|  predicted protein                                    79.3    1e-13   
dbj|BAJ90026.1|  predicted protein                                    79.3    2e-13   
emb|CCA60994.1|  phosphoenolpyruvate carboxylase                      72.0    3e-11   
emb|CAM83970.2|  phosphoenolpyruvate carboxylase                      69.7    2e-10   
gb|ABG20460.1|  phosphoenolpyruvate carboxylase                       68.2    6e-10   
gb|AAD13912.1|S60264_1  phosphoenolpyruvate carboxylase               60.5    3e-09   
emb|CCA60991.1|  phosphoenolpyruvate carboxylase                      61.2    9e-08   
emb|CAA96507.1|  phosphoenolpyruvate carboxylase                      55.5    2e-07   
ref|XP_002949515.1|  hypothetical protein VOLCADRAFT_59445            57.4    2e-06   
sp|P81831.2|CAPP1_CHLRE  RecName: Full=Phosphoenolpyruvate carbox...  56.6    3e-06   
gb|AFW81519.1|  putative clathrin heavy chain family protein          48.9    1e-05   
ref|XP_001420862.1|  predicted protein                                54.3    2e-05   
gb|ABX79637.1|  phosphoenolpyruvate carboxylase                       50.1    2e-05   
gb|EHM03224.1|  phosphoenolpyruvate carboxykinase                     53.9    3e-05   
ref|XP_005652003.1|  PEPCase 1                                        53.5    4e-05   
gb|AAS88368.1|  phosphoenolpyruvate carboxylase                       48.1    7e-05   
gb|ADH01790.1|  phosphoenolpyruvate carboxylase                       48.1    8e-05   
emb|CCU61859.1|  Phosphoenolpyruvate carboxylase                      52.4    9e-05   
gb|AAS88349.1|  phosphoenolpyruvate carboxylase                       48.1    9e-05   
ref|WP_040851641.1|  phosphoenolpyruvate carboxylase                  52.0    9e-05   
dbj|BAD88208.1|  unknown protein                                      48.5    1e-04   
ref|WP_040289772.1|  phosphoenolpyruvate carboxylase                  51.6    2e-04   
gb|ADH01796.1|  phosphoenolpyruvate carboxylase                       47.4    2e-04   
gb|AAS88361.1|  phosphoenolpyruvate carboxylase                       47.0    2e-04   
gb|AAS88356.1|  phosphoenolpyruvate carboxylase                       47.0    2e-04   
gb|AAS88348.1|  phosphoenolpyruvate carboxylase                       47.0    2e-04   
gb|ABX79622.1|  phosphoenolpyruvate carboxylase                       46.6    4e-04   
emb|CEF99981.1|  Phosphoenolpyruvate carboxylase                      50.4    4e-04   
ref|XP_003082445.1|  phosphoenolpyruvate carboxylase 2; LaPEPC2 (...  50.1    5e-04   
gb|AAS88364.1|  phosphoenolpyruvate carboxylase                       46.2    5e-04   
gb|AAS88372.1|  phosphoenolpyruvate carboxylase                       45.8    6e-04   
ref|WP_038311255.1|  hypothetical protein                             47.4    7e-04   
ref|XP_011401423.1|  Phosphoenolpyruvate carboxylase 1                49.3    8e-04   
ref|WP_036211378.1|  phosphoenolpyruvate carboxylase                  49.3    9e-04   



>emb|CDP00977.1| unnamed protein product [Coffea canephora]
Length=344

 Score =   287 bits (734),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  123  RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYEL  302
            RNLEK+ASIDAQLRLLVP KVS+DDKLVEYDALLLDRFLDILQ LHGE+L+ETVQECYEL
Sbjct  5    RNLEKLASIDAQLRLLVPAKVSDDDKLVEYDALLLDRFLDILQYLHGEDLKETVQECYEL  64

Query  303  SAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKK  482
            SAEYEGR DPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR KLKK
Sbjct  65   SAEYEGRKDPKKLEELGHVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRNKLKK  124

Query  483  GDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            GDF DENSAITESDIEETL RLV+D+KKSPQEVFDAL
Sbjct  125  GDFADENSAITESDIEETLKRLVLDLKKSPQEVFDAL  161



>ref|XP_010108239.1| Phosphoenolpyruvate carboxylase, housekeeping isozyme [Morus 
notabilis]
 gb|EXC18479.1| Phosphoenolpyruvate carboxylase, housekeeping isozyme [Morus 
notabilis]
Length=1376

 Score =   302 bits (774),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDAQLRLLVPGKVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MANRNLEKMASIDAQLRLLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DENSA TESDIEETL RLV D+KKSPQEVFDAL
Sbjct  121  LKKGDFADENSATTESDIEETLKRLVGDLKKSPQEVFDAL  160



>ref|XP_011098224.1| PREDICTED: phosphoenolpyruvate carboxylase [Sesamum indicum]
Length=964

 Score =   298 bits (764),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA+RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQEC
Sbjct  1    MASRNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKL+ELGNVLTSLDPGDSIV+AK+FSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLDELGNVLTSLDPGDSIVVAKAFSHMLNLANLAEEVQIAYRRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
             KKGD+ DEN+A TESDIEET+ RLVVD+KKSPQEVFDAL
Sbjct  121  RKKGDYTDENNATTESDIEETIKRLVVDLKKSPQEVFDAL  160



>ref|XP_008386247.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Malus domestica]
Length=965

 Score =   296 bits (759),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ C
Sbjct  1    MANRNLEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQAC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKL ELGNVLTSLDPGDSIVIAKSF+HML+LANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEGKHDPKKLSELGNVLTSLDPGDSIVIAKSFAHMLSLANLAEEVQIAYRRRQK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DENSA TESDIEETL RLV D+KKSPQEVFDAL
Sbjct  121  LKKGDFADENSATTESDIEETLKRLVGDLKKSPQEVFDAL  160



>ref|XP_009340037.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Pyrus x bretschneideri]
Length=966

 Score =   296 bits (758),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ C
Sbjct  1    MANRNLEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQAC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKL ELGNVLTSLDPGDSIVIAKSF+HML+LANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEGKHDPKKLSELGNVLTSLDPGDSIVIAKSFAHMLSLANLAEEVQIAYRRRQK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DENSA TESDIEETL RLV D+KKSPQEVFDAL
Sbjct  121  LKKGDFADENSATTESDIEETLKRLVGDLKKSPQEVFDAL  160



>ref|XP_009604678.1| PREDICTED: phosphoenolpyruvate carboxylase [Nicotiana tomentosiformis]
 ref|XP_009604679.1| PREDICTED: phosphoenolpyruvate carboxylase [Nicotiana tomentosiformis]
 ref|XP_009604680.1| PREDICTED: phosphoenolpyruvate carboxylase [Nicotiana tomentosiformis]
Length=964

 Score =   296 bits (758),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEK+ASIDAQLR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MATRNLEKLASIDAQLRALVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DEN+A TESDIEET  +LV D+KKSPQEVFDAL
Sbjct  121  LKKGDFADENNATTESDIEETFKKLVGDLKKSPQEVFDAL  160



>ref|XP_009783765.1| PREDICTED: phosphoenolpyruvate carboxylase [Nicotiana sylvestris]
 ref|XP_009783766.1| PREDICTED: phosphoenolpyruvate carboxylase [Nicotiana sylvestris]
Length=964

 Score =   296 bits (757),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEK+ASIDAQLR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MATRNLEKLASIDAQLRALVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LK+GDF DEN+A TESDIEET  +LV D+KKSPQEVFDAL
Sbjct  121  LKRGDFADENNATTESDIEETFKKLVGDLKKSPQEVFDAL  160



>ref|XP_002316861.1| phosphoenolpyruvate carboxylase family protein [Populus trichocarpa]
 gb|EEE97473.1| phosphoenolpyruvate carboxylase family protein [Populus trichocarpa]
Length=966

 Score =   296 bits (757),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 153/157 (97%), Gaps = 0/157 (0%)
 Frame = +3

Query  123  RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYEL  302
            RNLEK+ASIDAQLRLLVPGKVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQECYEL
Sbjct  5    RNLEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQECYEL  64

Query  303  SAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKK  482
            SAEYEG+HDPKKLEELG+VLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR KLKK
Sbjct  65   SAEYEGKHDPKKLEELGSVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRNKLKK  124

Query  483  GDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            GDF DENSA TESDIEETL RLVVD+KKSP+EVFDAL
Sbjct  125  GDFADENSATTESDIEETLRRLVVDLKKSPEEVFDAL  161



>ref|XP_011082759.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Sesamum indicum]
Length=964

 Score =   294 bits (752),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MATRNLEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELGNVLTSLDPGDSIV+AK+FSHML+LANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVLAKAFSHMLSLANLAEEVQIAHRRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
             KKGD+ DENSA TESDIEETL RLVVD+KKSPQEVFDAL
Sbjct  121  KKKGDYTDENSATTESDIEETLKRLVVDLKKSPQEVFDAL  160



>gb|KDO63366.1| hypothetical protein CISIN_1g002112mg [Citrus sinensis]
Length=753

 Score =   290 bits (741),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MAARNLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+ D +KLEELGNVLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKRDSQKLEELGNVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDFVDENSA TESDIEETL RLVV +KKSP+EVFDAL
Sbjct  121  LKKGDFVDENSATTESDIEETLKRLVVQLKKSPEEVFDAL  160



>sp|P27154.1|CAPP_TOBAC RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Nicotiana tabacum]
 emb|CAA41758.1| phosphoenolpyruvate carboxylase [Nicotiana tabacum]
Length=964

 Score =   293 bits (751),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA R+LEK+ASIDAQLR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MATRSLEKLASIDAQLRALVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LK+GDF DEN+A TESDIEET  +LV D+KKSPQEVFDAL
Sbjct  121  LKRGDFADENNATTESDIEETFKKLVGDLKKSPQEVFDAL  160



>ref|XP_006370158.1| phosphoenolpyruvate carboxylase family protein [Populus trichocarpa]
 gb|ERP66727.1| phosphoenolpyruvate carboxylase family protein [Populus trichocarpa]
Length=968

 Score =   293 bits (750),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  120  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  299
            ARNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQECYE
Sbjct  6    ARNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQECYE  65

Query  300  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  479
            LSAEYEG+HDPKKLEELG+VLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR KLK
Sbjct  66   LSAEYEGKHDPKKLEELGSVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRNKLK  125

Query  480  KGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KGDF DEN+A TESDIEETL RLV +MKKSP+EVFDAL
Sbjct  126  KGDFADENNATTESDIEETLKRLVSEMKKSPEEVFDAL  163



>ref|XP_008463734.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Cucumis melo]
Length=965

 Score =   293 bits (750),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDAQLRLLVP +VSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MANRNLEKMASIDAQLRLLVPARVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+H+PKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHNPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DENSA TESDIEETL +LV ++KKSPQEVFDAL
Sbjct  121  LKKGDFADENSATTESDIEETLKKLVGELKKSPQEVFDAL  160



>ref|XP_002530381.1| Phosphoenolpyruvate carboxylase, putative [Ricinus communis]
 gb|EEF32001.1| Phosphoenolpyruvate carboxylase, putative [Ricinus communis]
Length=965

 Score =   293 bits (749),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            M  RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MQPRNLEKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDP+KL+ELGN+LTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPRKLDELGNLLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DENSA TESDIEET  RLV+D+KKSP+EVFDAL
Sbjct  121  LKKGDFADENSATTESDIEETFKRLVIDLKKSPEEVFDAL  160



>gb|ABR29876.1| phosphoenolpyruvate carboxylase [Ricinus communis]
Length=965

 Score =   293 bits (749),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            M  RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MQPRNLEKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDP+KL+ELGN+LTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPRKLDELGNLLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DENSA TESDIEET  RLV+D+KKSP+EVFDAL
Sbjct  121  LKKGDFADENSATTESDIEETFKRLVIDLKKSPEEVFDAL  160



>ref|XP_011029569.1| PREDICTED: phosphoenolpyruvate carboxylase [Populus euphratica]
Length=966

 Score =   292 bits (747),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  120  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  299
             RNLEK+ASIDAQLRLLVPGKVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQECYE
Sbjct  4    TRNLEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQECYE  63

Query  300  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  479
            LSAEYEG+HDPKKLEELG+VLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR KLK
Sbjct  64   LSAEYEGKHDPKKLEELGSVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRNKLK  123

Query  480  KGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KGDF DEN+A TESDIEETL RLV +MKKSP+EVFDAL
Sbjct  124  KGDFADENNATTESDIEETLKRLVSEMKKSPEEVFDAL  161



>emb|CBI20195.3| unnamed protein product [Vitis vinifera]
Length=930

 Score =   291 bits (745),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RN+EKMASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MANRNIEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELGNVLTSLD GDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDAGDSIVIAKSFSHMLNLANLAEEVQIAYRRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DEN+A TESDIEETL +LVV +KKSP+EVFDAL
Sbjct  121  LKKGDFADENNATTESDIEETLKKLVVQLKKSPEEVFDAL  160



>ref|XP_009334045.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Pyrus x bretschneideri]
Length=965

 Score =   292 bits (747),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ C
Sbjct  1    MANRNLEKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQAC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKL ELGNVLTSLDPGDSIV+AKSF+HML+LANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLSELGNVLTSLDPGDSIVVAKSFAHMLSLANLAEEVQIAYRRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DENSA TESDIEETL RLV D+KKSPQEVFDAL
Sbjct  121  LKKGDFADENSATTESDIEETLKRLVGDLKKSPQEVFDAL  160



>gb|EYU45020.1| hypothetical protein MIMGU_mgv1a000847mg [Erythranthe guttata]
Length=963

 Score =   291 bits (746),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEK+ASIDAQLRLLVPGKVS+DDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MATRNLEKLASIDAQLRLLVPGKVSDDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELGN+LTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
             KKGD+ DENSA TESDIEET  RLV D+KKSP+EVFDAL
Sbjct  121  KKKGDYTDENSATTESDIEETFKRLVFDLKKSPEEVFDAL  160



>gb|KDO63365.1| hypothetical protein CISIN_1g002112mg [Citrus sinensis]
Length=891

 Score =   290 bits (743),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MAARNLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+ D +KLEELGNVLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKRDSQKLEELGNVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDFVDENSA TESDIEETL RLVV +KKSP+EVFDAL
Sbjct  121  LKKGDFVDENSATTESDIEETLKRLVVQLKKSPEEVFDAL  160



>ref|XP_010060690.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Eucalyptus grandis]
 gb|KCW67501.1| hypothetical protein EUGRSUZ_F01229 [Eucalyptus grandis]
Length=965

 Score =   291 bits (745),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MANRNLEKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDP+KLEELGNVLTSLDPGDSIVIAKSFS+MLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPQKLEELGNVLTSLDPGDSIVIAKSFSNMLNLANLAEEVQIAYRRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DEN+A TESDIEETL RLVV +KKSP+EVFDAL
Sbjct  121  LKKGDFADENNATTESDIEETLKRLVVQLKKSPEEVFDAL  160



>ref|XP_007214986.1| hypothetical protein PRUPE_ppa002020mg [Prunus persica]
 gb|EMJ16185.1| hypothetical protein PRUPE_ppa002020mg [Prunus persica]
Length=728

 Score =   287 bits (734),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA+RNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQ+C
Sbjct  1    MASRNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGESLRETVQDC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYE + DPKKLEELG VLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYERKQDPKKLEELGKVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DE SA TESDIEETL RLV D+KKSP+EVFDAL
Sbjct  121  LKKGDFADEASATTESDIEETLKRLVGDLKKSPEEVFDAL  160



>ref|XP_002285441.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Vitis vinifera]
Length=963

 Score =   291 bits (745),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RN+EKMASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MANRNIEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELGNVLTSLD GDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDAGDSIVIAKSFSHMLNLANLAEEVQIAYRRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DEN+A TESDIEETL +LVV +KKSP+EVFDAL
Sbjct  121  LKKGDFADENNATTESDIEETLKKLVVQLKKSPEEVFDAL  160



>ref|XP_011005507.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Populus euphratica]
 ref|XP_011005508.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Populus euphratica]
 ref|XP_011005509.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Populus euphratica]
Length=968

 Score =   291 bits (745),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  120  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  299
            ARNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQ+CYE
Sbjct  6    ARNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQDCYE  65

Query  300  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  479
            LSAEYEG+HDPKKLEELG VLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR KLK
Sbjct  66   LSAEYEGKHDPKKLEELGRVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRNKLK  125

Query  480  KGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KGDF DEN+A TESDIEETL RLV +MKKSP+EVFDAL
Sbjct  126  KGDFADENNATTESDIEETLKRLVSEMKKSPEEVFDAL  163



>ref|XP_009607156.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Nicotiana tomentosiformis]
 ref|XP_009607157.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Nicotiana tomentosiformis]
Length=964

 Score =   290 bits (743),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE L+ETVQEC
Sbjct  1    MATRNLEKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEGLKETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYE + D KKLEELGNVLTSLDPGDSIV+AKS SHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYESKRDKKKLEELGNVLTSLDPGDSIVVAKSISHMLNLANLAEEVQIAYRRRQK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF+DEN+A+TESDIEETL RLVVD+KKSPQEVFDAL
Sbjct  121  LKKGDFLDENNAMTESDIEETLKRLVVDLKKSPQEVFDAL  160



>ref|XP_006360045.1| PREDICTED: phosphoenolpyruvate carboxylase-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006360046.1| PREDICTED: phosphoenolpyruvate carboxylase-like isoform X2 [Solanum 
tuberosum]
Length=964

 Score =   290 bits (743),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            M  RNLEK+ASIDAQLR LVPGKVSEDDKLVEYDALLLD FLDILQDLHGE+L+ETVQEC
Sbjct  1    MTTRNLEKLASIDAQLRALVPGKVSEDDKLVEYDALLLDSFLDILQDLHGEDLKETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DEN+A TESDIEET  +LV ++KKSPQEVFDAL
Sbjct  121  LKKGDFADENNATTESDIEETFKKLVEELKKSPQEVFDAL  160



>gb|KDO63363.1| hypothetical protein CISIN_1g002112mg [Citrus sinensis]
 gb|KDO63364.1| hypothetical protein CISIN_1g002112mg [Citrus sinensis]
Length=965

 Score =   290 bits (743),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MAARNLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+ D +KLEELGNVLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKRDSQKLEELGNVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDFVDENSA TESDIEETL RLVV +KKSP+EVFDAL
Sbjct  121  LKKGDFVDENSATTESDIEETLKRLVVQLKKSPEEVFDAL  160



>ref|XP_006446789.1| hypothetical protein CICLE_v10014164mg [Citrus clementina]
 gb|ESR60029.1| hypothetical protein CICLE_v10014164mg [Citrus clementina]
Length=965

 Score =   290 bits (742),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MAARNLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+ D +KLEELGNVLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKRDSQKLEELGNVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDFVDENSA TESDIEETL RLVV +KKSP+EVFDAL
Sbjct  121  LKKGDFVDENSATTESDIEETLKRLVVQLKKSPEEVFDAL  160



>ref|XP_009762944.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Nicotiana sylvestris]
Length=964

 Score =   290 bits (742),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE L+ETVQEC
Sbjct  1    MATRNLEKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEGLKETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYE + D KKLEELGNVLTSLDPGDSIV+AKS SHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYESKRDKKKLEELGNVLTSLDPGDSIVVAKSISHMLNLANLAEEVQIAYRRRQK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF+DEN+A+TESDIEETL RLVVD+KKSPQEVFDAL
Sbjct  121  LKKGDFLDENNAMTESDIEETLKRLVVDLKKSPQEVFDAL  160



>gb|AFN70425.1| phosphoenolpyruvate carboxylase [Manihot esculenta subsp. flabellifolia]
Length=965

 Score =   290 bits (742),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MAARNLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE +RETVQ+C
Sbjct  1    MAARNLEKMASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQDLHGEEIRETVQDC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDP+KLEELG VLTSLDPGDSIV+AKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPQKLEELGKVLTSLDPGDSIVVAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DENSA TESDIE+TL RLVV +KKSP+EVFDAL
Sbjct  121  LKKGDFADENSATTESDIEKTLKRLVVQLKKSPEEVFDAL  160



>ref|XP_006469015.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like isoform X1 
[Citrus sinensis]
 ref|XP_006469016.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like isoform X2 
[Citrus sinensis]
Length=965

 Score =   290 bits (742),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MAARNLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+ D +KLEELGNVLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKRDSQKLEELGNVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDFVDENSA TESDIEETL RLVV +KKSP+EVFDAL
Sbjct  121  LKKGDFVDENSATTESDIEETLKRLVVQLKKSPEEVFDAL  160



>ref|XP_009766373.1| PREDICTED: phosphoenolpyruvate carboxylase [Nicotiana sylvestris]
Length=966

 Score =   290 bits (742),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/161 (89%), Positives = 154/161 (96%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEK+ASIDAQLR LVPGKVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MANRNLEKLASIDAQLRQLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  474  LKK-GDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKK GDFVDE++A TESDIEET  +LV D+KKSPQEVFDAL
Sbjct  121  LKKTGDFVDESNATTESDIEETFKKLVGDLKKSPQEVFDAL  161



>ref|XP_008367955.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Malus domestica]
Length=965

 Score =   290 bits (741),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ C
Sbjct  1    MANRNLEKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQAC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKL ELG+VLTSLDPGDSIV+AKSF+HML+LANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLSELGDVLTSLDPGDSIVVAKSFAHMLSLANLAEEVQIAYRRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DENSA TESDIEETL RLV D+KKSPQEVFDAL
Sbjct  121  LKKGDFADENSATTESDIEETLKRLVGDLKKSPQEVFDAL  160



>ref|NP_001267517.1| phosphoenolpyruvate carboxylase, housekeeping isozyme-like [Cucumis 
sativus]
 ref|XP_004165409.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Cucumis sativus]
 gb|AFS33790.1| phosphoenolpyruvate carboxylase protein [Cucumis sativus]
 gb|KGN55071.1| hypothetical protein Csa_4G627210 [Cucumis sativus]
Length=965

 Score =   289 bits (740),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDAQLRLLVP +VSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MANRNLEKMASIDAQLRLLVPARVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+ +PKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKFNPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DENSA TESDIEETL +LV ++KKSPQEVFDAL
Sbjct  121  LKKGDFADENSATTESDIEETLKKLVGELKKSPQEVFDAL  160



>tpg|DAA61010.1| TPA: phosphoenolpyruvate carboxylase4 [Zea mays]
Length=222

 Score =   270 bits (690),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 150/162 (93%), Gaps = 2/162 (1%)
 Frame = +3

Query  114  MAA--RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQ  287
            MAA    +E+++SIDAQLR+LVPGKVSEDDKL+EYDALLLDRFLDILQDLHG++L+E VQ
Sbjct  1    MAALGAKMERLSSIDAQLRMLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGDDLKEMVQ  60

Query  288  ECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR  467
            ECYE++AEYE +HD +KL+ELG ++TSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR
Sbjct  61   ECYEVAAEYETKHDLQKLDELGKMITSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR  120

Query  468  QKLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
             KLKKGDF DENSAITESDIEETL RLVVD+KKSP EVFDAL
Sbjct  121  IKLKKGDFADENSAITESDIEETLKRLVVDLKKSPAEVFDAL  162



>ref|XP_009598007.1| PREDICTED: phosphoenolpyruvate carboxylase [Nicotiana tomentosiformis]
Length=966

 Score =   289 bits (740),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 144/161 (89%), Positives = 153/161 (95%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEK+ASIDAQLR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MANRNLEKLASIDAQLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELGNV TSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEGKHDPKKLEELGNVFTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  474  LKK-GDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKK GDFVDE++A TESDIEET  +LV D+KKSPQEVFDAL
Sbjct  121  LKKTGDFVDESNATTESDIEETFKKLVGDLKKSPQEVFDAL  161



>gb|AJP17168.1| phosphoenolpyruvate carboxylase 2 [Prunus sibirica]
Length=966

 Score =   289 bits (739),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA+RNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQ+C
Sbjct  1    MASRNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGESLRETVQDC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYE + DPKKLEELG VLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYERKQDPKKLEELGKVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DE SA TESDIEETL RLV D+KKSPQEVFDAL
Sbjct  121  LKKGDFADEASATTESDIEETLKRLVGDLKKSPQEVFDAL  160



>ref|XP_008229092.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Prunus mume]
Length=966

 Score =   288 bits (738),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA+RNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQ+C
Sbjct  1    MASRNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGESLRETVQDC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYE + DPKKLEELG VLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYERKQDPKKLEELGKVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DE SA TESDIEETL RLV D+KKSPQEVFDAL
Sbjct  121  LKKGDFADEASATTESDIEETLKRLVGDLKKSPQEVFDAL  160



>ref|XP_007213682.1| hypothetical protein PRUPE_ppa000910mg [Prunus persica]
 gb|EMJ14881.1| hypothetical protein PRUPE_ppa000910mg [Prunus persica]
Length=965

 Score =   288 bits (736),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ C
Sbjct  1    MANRNLEKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQAC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HD KKL ELGNVLTSLDPGDSIV+AKSFSHML+LANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDAKKLSELGNVLTSLDPGDSIVVAKSFSHMLSLANLAEEVQIAYRRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DENSA TESDIEETL RLV D+KKSPQEVF+AL
Sbjct  121  LKKGDFADENSATTESDIEETLKRLVGDLKKSPQEVFEAL  160



>emb|CDP06006.1| unnamed protein product [Coffea canephora]
Length=965

 Score =   288 bits (736),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  123  RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYEL  302
            RNLEK+ASIDAQLRLLVP KVS+DDKLVEYDALLLDRFLDILQ LHGE+L+ETVQECYEL
Sbjct  5    RNLEKLASIDAQLRLLVPAKVSDDDKLVEYDALLLDRFLDILQYLHGEDLKETVQECYEL  64

Query  303  SAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKK  482
            SAEYEGR DPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR KLKK
Sbjct  65   SAEYEGRKDPKKLEELGHVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRNKLKK  124

Query  483  GDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            GDF DENSAITESDIEETL RLV+D+KKSPQEVFDAL
Sbjct  125  GDFADENSAITESDIEETLKRLVLDLKKSPQEVFDAL  161



>gb|KJB27013.1| hypothetical protein B456_004G272100 [Gossypium raimondii]
Length=751

 Score =   284 bits (726),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 155/167 (93%), Gaps = 5/167 (3%)
 Frame = +3

Query  93   SGADSEKMAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENL  272
            S ++S KM     +K+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L
Sbjct  3    STSNSNKM-----QKLASIDAQLRLLVPSKVSEDDKLVEYDALLLDRFLDILQDLHGEDL  57

Query  273  RETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQI  452
            +ETVQECYELSAEYEG++DPKKLEELGNVLTSLDPGDSIV+AK+FSHMLNLANLAEEVQI
Sbjct  58   KETVQECYELSAEYEGKNDPKKLEELGNVLTSLDPGDSIVVAKAFSHMLNLANLAEEVQI  117

Query  453  AYRRRQKLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            AYRRR KLKKGDFVDENSA TESDIEETL RLVVD+ KSP+EVFDAL
Sbjct  118  AYRRRIKLKKGDFVDENSATTESDIEETLKRLVVDLNKSPEEVFDAL  164



>gb|ACC66283.1| phosphoenolpyruvate carboxylase [Suaeda glauca]
Length=966

 Score =   287 bits (735),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 151/159 (95%), Gaps = 1/159 (1%)
 Frame = +3

Query  120  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  299
            ARN+EKMASIDAQLRLLVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQECYE
Sbjct  2    ARNIEKMASIDAQLRLLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQECYE  61

Query  300  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-QKL  476
            LSAEYEG+ DPKKLEELGNVLTSLDPGDSIV+AKSFSHMLNLANLAEEVQIAYRRR +KL
Sbjct  62   LSAEYEGKRDPKKLEELGNVLTSLDPGDSIVLAKSFSHMLNLANLAEEVQIAYRRRIKKL  121

Query  477  KKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KKGDF+DENSA TESDIEET  RLV D+ KSPQEVFDAL
Sbjct  122  KKGDFIDENSATTESDIEETFKRLVGDLGKSPQEVFDAL  160



>ref|XP_008226531.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Prunus mume]
Length=965

 Score =   287 bits (735),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ C
Sbjct  1    MANRNLEKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQAC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HD KKL ELGNVLTSLDPGDSIV+AKSFSHML+LANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDAKKLSELGNVLTSLDPGDSIVVAKSFSHMLSLANLAEEVQIAYRRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DENSA TESDIEETL RLV D+KKSPQEVF+AL
Sbjct  121  LKKGDFADENSATTESDIEETLKRLVGDLKKSPQEVFEAL  160



>ref|XP_004303182.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011466957.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Fragaria vesca 
subsp. vesca]
Length=961

 Score =   286 bits (733),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA+RNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQ+C
Sbjct  1    MASRNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQDC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+ DPKKLEELGNV TSLDPGDSIV+AKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKQDPKKLEELGNVFTSLDPGDSIVVAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDFVDE +A TESDIEET  +LV  +KKSPQEVFD L
Sbjct  121  LKKGDFVDEANATTESDIEETFKKLVGQLKKSPQEVFDEL  160



>sp|Q9FV65.1|CAPPC_FLATR RecName: Full=Phosphoenolpyruvate carboxylase 2; Short=PEPC 2; 
Short=PEPCase 2; Short=ppcC [Flaveria trinervia]
 gb|AAG17619.1|AF248080_1 phosphoenolpyruvate carboxylase [Flaveria trinervia]
Length=967

 Score =   286 bits (733),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEK+ASIDAQLRLLVPGKVSEDDKL+EYDALLLD+FLDILQDLHGE L+ETVQEC
Sbjct  1    MANRNLEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDKFLDILQDLHGEGLKETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DE SA TESDIEET  +LV  +KKSP+EVFDAL
Sbjct  121  LKKGDFADEASATTESDIEETFKKLVHKLKKSPEEVFDAL  160



>gb|AFN70424.1| phosphoenolpyruvate carboxylase [Manihot esculenta]
Length=965

 Score =   286 bits (731),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MAARNLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDI QDLHGE +RETVQ+C
Sbjct  1    MAARNLEKMASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDISQDLHGEEIRETVQDC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDP+KLEELG VLTSLDPGDSIV+AKSFSHMLNLANLAEEVQIAY RR K
Sbjct  61   YELSAEYEGKHDPQKLEELGKVLTSLDPGDSIVVAKSFSHMLNLANLAEEVQIAYGRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DENSA TESDIEETL RLVV +KKSP+EVFDAL
Sbjct  121  LKKGDFADENSATTESDIEETLKRLVVQLKKSPEEVFDAL  160



>ref|NP_001237602.1| phosphoenolpyruvate carboxylase, housekeeping isozyme [Glycine 
max]
 sp|Q02909.1|CAPP1_SOYBN RecName: Full=Phosphoenolpyruvate carboxylase, housekeeping isozyme; 
Short=PEPCase; AltName: Full=PEPC 1 [Glycine max]
 dbj|BAA01560.1| phosphoenolpyruvate carboxylase [Glycine max]
Length=967

 Score =   285 bits (730),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+ RR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHSRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DEN+A TESDIEETL +LVVDMKKSPQEVFDAL
Sbjct  121  LKKGDFADENNATTESDIEETLKKLVVDMKKSPQEVFDAL  160



>ref|XP_010104390.1| Phosphoenolpyruvate carboxylase 2 [Morus notabilis]
 gb|EXC00235.1| Phosphoenolpyruvate carboxylase 2 [Morus notabilis]
Length=967

 Score =   285 bits (730),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/161 (89%), Positives = 151/161 (94%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            M++RNLEKMASIDAQLRLL P KVSEDDKL+EYDALL DRFLDILQDLHGE+LRETVQ+C
Sbjct  1    MSSRNLEKMASIDAQLRLLAPAKVSEDDKLIEYDALLCDRFLDILQDLHGEDLRETVQDC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYE   DPKKLEELGNVLTSLDPGDSIV+AKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYERNLDPKKLEELGNVLTSLDPGDSIVVAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  L-KKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            L KKGDFVDENSA TESDIEETL RLVVD+KKSPQEVFDAL
Sbjct  121  LKKKGDFVDENSATTESDIEETLKRLVVDLKKSPQEVFDAL  161



>ref|XP_010675388.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Beta vulgaris subsp. 
vulgaris]
Length=967

 Score =   285 bits (730),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 151/161 (94%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            M ARN+EKMASIDAQLRLLVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQEC
Sbjct  1    MMARNIEKMASIDAQLRLLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YELSAEYEG+ DPKKLEELGNVLTSLDPGDSIV+AKSFSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YELSAEYEGKRDPKKLEELGNVLTSLDPGDSIVVAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDFVDENSA TESDIEET  RLV  + K+P+E+FDAL
Sbjct  121  KLKKGDFVDENSATTESDIEETFKRLVGQLGKTPEEIFDAL  161



>ref|XP_004248242.1| PREDICTED: phosphoenolpyruvate carboxylase [Solanum lycopersicum]
Length=964

 Score =   285 bits (729),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            M  RNLEK+ASIDAQLR LVPGKVSEDDKLVEYDALLLD FLDILQDLHG +L+ETVQEC
Sbjct  1    MTTRNLEKLASIDAQLRALVPGKVSEDDKLVEYDALLLDSFLDILQDLHGVDLKETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            L+KGDF DEN+A TESDIEET  +LV ++KKSPQEVF+AL
Sbjct  121  LRKGDFADENNATTESDIEETFKKLVEELKKSPQEVFEAL  160



>ref|XP_002518037.1| Phosphoenolpyruvate carboxylase, putative [Ricinus communis]
 gb|EEF44555.1| Phosphoenolpyruvate carboxylase, putative [Ricinus communis]
Length=965

 Score =   285 bits (729),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQ+C
Sbjct  1    MAGRNLEKMASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQDC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+H+P+KL ELG VLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHNPQKLAELGKVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DENSA TESDIEETL RLVV +KKSP+EVFDAL
Sbjct  121  LKKGDFADENSATTESDIEETLKRLVVQLKKSPEEVFDAL  160



>ref|XP_006582125.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
isoform X2 [Glycine max]
Length=760

 Score =   281 bits (718),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+ RR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHSRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DEN+A TESDIEETL +LV DMKKSPQEVF+AL
Sbjct  121  LKKGDFADENNATTESDIEETLKKLVGDMKKSPQEVFNAL  160



>gb|KHG25857.1| Phosphoenolpyruvate carboxylase 2 [Gossypium arboreum]
Length=969

 Score =   284 bits (726),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  120  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  299
            +  L+K+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQECYE
Sbjct  7    SNKLQKLASIDAQLRLLVPSKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQECYE  66

Query  300  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  479
            LSAEYEG++DPKKLEELGNVLTSLDPGDSIV+AK+FSHMLNLANLAEEVQIAYRRR KLK
Sbjct  67   LSAEYEGKNDPKKLEELGNVLTSLDPGDSIVVAKAFSHMLNLANLAEEVQIAYRRRIKLK  126

Query  480  KGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KGDFVDENSA TESDIEETL RLVVD+ KSP+EVFDAL
Sbjct  127  KGDFVDENSATTESDIEETLKRLVVDLNKSPEEVFDAL  164



>gb|KJB27012.1| hypothetical protein B456_004G272100 [Gossypium raimondii]
Length=969

 Score =   284 bits (726),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 155/167 (93%), Gaps = 5/167 (3%)
 Frame = +3

Query  93   SGADSEKMAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENL  272
            S ++S KM     +K+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L
Sbjct  3    STSNSNKM-----QKLASIDAQLRLLVPSKVSEDDKLVEYDALLLDRFLDILQDLHGEDL  57

Query  273  RETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQI  452
            +ETVQECYELSAEYEG++DPKKLEELGNVLTSLDPGDSIV+AK+FSHMLNLANLAEEVQI
Sbjct  58   KETVQECYELSAEYEGKNDPKKLEELGNVLTSLDPGDSIVVAKAFSHMLNLANLAEEVQI  117

Query  453  AYRRRQKLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            AYRRR KLKKGDFVDENSA TESDIEETL RLVVD+ KSP+EVFDAL
Sbjct  118  AYRRRIKLKKGDFVDENSATTESDIEETLKRLVVDLNKSPEEVFDAL  164



>gb|KHG02548.1| Phosphoenolpyruvate carboxylase, housekeeping isozyme [Gossypium 
arboreum]
Length=969

 Score =   283 bits (725),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 151/164 (92%), Gaps = 4/164 (2%)
 Frame = +3

Query  114  MAARN----LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRET  281
            MA  N    LEK+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRET
Sbjct  1    MATNNNNSKLEKLASIDAQLRALVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRET  60

Query  282  VQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYR  461
            VQECYELSAEYEG+ +PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYR
Sbjct  61   VQECYELSAEYEGKSNPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYR  120

Query  462  RRQKLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            RR KLKKGDF DENSA TESDIEETL RLVVD+KKSP+EVFDAL
Sbjct  121  RRIKLKKGDFADENSATTESDIEETLKRLVVDLKKSPEEVFDAL  164



>gb|EYU26325.1| hypothetical protein MIMGU_mgv1a000844mg [Erythranthe guttata]
Length=964

 Score =   283 bits (724),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDAQLRLLVPGKVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQEC
Sbjct  1    MATRNLEKMASIDAQLRLLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYE + D KKLEELGNVLTSLDPGDSIV+AK+FSHMLNLANLAEEVQIA RRR K
Sbjct  61   YELSAEYESKRDAKKLEELGNVLTSLDPGDSIVVAKAFSHMLNLANLAEEVQIATRRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
             KKGD  DE++A TESDIEETL RLVVD+KKSPQEVFDAL
Sbjct  121  KKKGDITDESNATTESDIEETLKRLVVDLKKSPQEVFDAL  160



>ref|XP_004294066.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011460783.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Fragaria vesca 
subsp. vesca]
Length=965

 Score =   283 bits (724),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA R+LEK+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ C
Sbjct  1    MAYRSLEKLASIDAQLRALVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQSC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDP+KL ELGNVLTSLDPGDSIVIAKSF+HML+LANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPQKLAELGNVLTSLDPGDSIVIAKSFAHMLSLANLAEEVQIAYRRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DENSA TESDIEETL RLV + KKSP+EVFDAL
Sbjct  121  LKKGDFADENSATTESDIEETLKRLVGEFKKSPEEVFDAL  160



>ref|XP_007021728.1| Phosphoenolpyruvate carboxylase 3 isoform 1 [Theobroma cacao]
 ref|XP_007021729.1| Phosphoenolpyruvate carboxylase 3 isoform 1 [Theobroma cacao]
 gb|EOY13253.1| Phosphoenolpyruvate carboxylase 3 isoform 1 [Theobroma cacao]
 gb|EOY13254.1| Phosphoenolpyruvate carboxylase 3 isoform 1 [Theobroma cacao]
Length=972

 Score =   283 bits (724),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  129  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  308
            LEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQECYELSA
Sbjct  13   LEKLASIDAQLRLLVPSKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQECYELSA  72

Query  309  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  488
            EYEG+++PKKLEELGNVLTSLDPGDSIV+AK+FSHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct  73   EYEGKNNPKKLEELGNVLTSLDPGDSIVVAKAFSHMLNLANLAEEVQIAYRRRIKLKKGD  132

Query  489  FVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            F+DENSA TESDIEETL RLV D+KKSP+EVFDAL
Sbjct  133  FIDENSATTESDIEETLKRLVFDLKKSPEEVFDAL  167



>gb|KJB13196.1| hypothetical protein B456_002G061400 [Gossypium raimondii]
Length=969

 Score =   282 bits (722),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 150/164 (91%), Gaps = 4/164 (2%)
 Frame = +3

Query  114  MAARN----LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRET  281
            MA  N    LEK+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRET
Sbjct  1    MATNNNNSKLEKLASIDAQLRALVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRET  60

Query  282  VQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYR  461
            VQECYELSAEYEG+  PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYR
Sbjct  61   VQECYELSAEYEGKSTPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYR  120

Query  462  RRQKLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            RR KLKKGDF DENSA TESDIEETL RLVVD+KKSP+EVFDAL
Sbjct  121  RRIKLKKGDFADENSATTESDIEETLKRLVVDLKKSPEEVFDAL  164



>emb|CAC28225.1| phosphoenolpyruvate carboxylase [Sesbania rostrata]
Length=961

 Score =   282 bits (721),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DE++A TESDIEETL +LV +MKKSPQEVFDAL
Sbjct  121  LKKGDFADESNATTESDIEETLKKLVGEMKKSPQEVFDAL  160



>gb|KJB82054.1| hypothetical protein B456_013G173500 [Gossypium raimondii]
Length=750

 Score =   278 bits (711),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  129  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  308
             EK+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQECYELSA
Sbjct  12   FEKLASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQECYELSA  71

Query  309  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  488
            EYEG+++PKKLEELGNVLTSLDPGDSIV+AK+FSHMLNLANLAEEVQIA+RRR KLKKGD
Sbjct  72   EYEGKNNPKKLEELGNVLTSLDPGDSIVVAKAFSHMLNLANLAEEVQIAHRRRIKLKKGD  131

Query  489  FVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            FVDEN+A TESD+EETL RLVVD+KKSPQEVFDAL
Sbjct  132  FVDENNATTESDLEETLKRLVVDLKKSPQEVFDAL  166



>ref|XP_008368627.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Malus domestica]
Length=875

 Score =   280 bits (717),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 149/161 (93%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MAA+NLEKMASID QLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGENLRETVQ+C
Sbjct  1    MAAKNLEKMASIDVQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGENLRETVQDC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYE + DP+KL ELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYERKQDPQKLAELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  L-KKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            + KKGDF DE SA TESDIEETL RLV D+KKSP+EVFDAL
Sbjct  121  MKKKGDFADEASATTESDIEETLKRLVGDLKKSPEEVFDAL  161



>gb|AJD81367.1| phosphoenolpyruvate carboxylase isoform 1 [Egeria densa]
Length=968

 Score =   281 bits (720),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 148/160 (93%), Gaps = 2/160 (1%)
 Frame = +3

Query  120  ARN--LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            ARN  +EKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ C
Sbjct  4    ARNPSIEKMASIDAQLRLLAPSKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQRC  63

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEGR DP+KLEELGNVLTSLDPGDSIV+A SFSHMLNLANLAEEVQIA+RRR K
Sbjct  64   YELSAEYEGRLDPQKLEELGNVLTSLDPGDSIVVASSFSHMLNLANLAEEVQIAFRRRAK  123

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DENSA TESDIEETL RLVV +KKSPQEVFDAL
Sbjct  124  LKKGDFADENSATTESDIEETLKRLVVQLKKSPQEVFDAL  163



>gb|EPS69468.1| hypothetical protein M569_05291 [Genlisea aurea]
Length=965

 Score =   281 bits (719),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA+R LE M SIDAQLRLLVPGKVSEDD L+EYDALLLDRFLDILQDLHGE+LRETVQEC
Sbjct  1    MASRCLETMQSIDAQLRLLVPGKVSEDDHLIEYDALLLDRFLDILQDLHGEDLRETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDP+KLEELGNVLTSLDPGDSIV+AK+FSHML+LAN+AEEVQ AYRRR K
Sbjct  61   YELSAEYEGKHDPRKLEELGNVLTSLDPGDSIVVAKAFSHMLSLANMAEEVQNAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
             KKGD+ DEN+A TESDIEETL RLVVD+KKSP+EVFDAL
Sbjct  121  KKKGDYTDENNATTESDIEETLKRLVVDLKKSPEEVFDAL  160



>gb|KHN48472.1| Phosphoenolpyruvate carboxylase, housekeeping isozyme [Glycine 
soja]
Length=967

 Score =   281 bits (719),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+ RR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHSRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DEN+A TESDIEETL +LV DMKKSPQEVF+AL
Sbjct  121  LKKGDFADENNATTESDIEETLKKLVGDMKKSPQEVFNAL  160



>ref|XP_003527207.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
isoform X1 [Glycine max]
Length=967

 Score =   281 bits (719),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+ RR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHSRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DEN+A TESDIEETL +LV DMKKSPQEVF+AL
Sbjct  121  LKKGDFADENNATTESDIEETLKKLVGDMKKSPQEVFNAL  160



>ref|XP_008342775.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Malus domestica]
 ref|XP_008368623.1| PREDICTED: phosphoenolpyruvate carboxylase [Malus domestica]
Length=967

 Score =   281 bits (719),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 150/161 (93%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MAARNLEKMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ+C
Sbjct  1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGESLRETVQDC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYE + DP+KLEELG +LTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYERKQDPQKLEELGKMLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  L-KKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            L KKGDF DE SA TESDIEETL RLV D+KKSP+EVFDAL
Sbjct  121  LKKKGDFADEASATTESDIEETLKRLVGDLKKSPEEVFDAL  161



>emb|CAA62469.1| phosphoenolpyruvate carboxylase [Solanum tuberosum]
Length=965

 Score =   281 bits (718),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 150/161 (93%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            M  RNLEK+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MTTRNLEKLASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYE +HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEAKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  474  L-KKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            L KKGDF DE++A TESDIEET  +LV D+KKSPQEVFDA+
Sbjct  121  LKKKGDFGDESNATTESDIEETFKKLVGDLKKSPQEVFDAI  161



>ref|XP_006852422.1| hypothetical protein AMTR_s00021p00059810 [Amborella trichopoda]
 gb|ERN13889.1| hypothetical protein AMTR_s00021p00059810 [Amborella trichopoda]
Length=965

 Score =   281 bits (718),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            M+  +L K+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLD+LQDLHGE+LRETVQEC
Sbjct  1    MSKNSLVKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDVLQDLHGEDLRETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YE SAEYEG+HDP+KLEELG+VLTSLDPGDSIV+A SFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YEHSAEYEGKHDPRKLEELGSVLTSLDPGDSIVVASSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DENSA TESDIEETL RLVV +KKSP+EVFDAL
Sbjct  121  LKKGDFADENSATTESDIEETLKRLVVQLKKSPEEVFDAL  160



>ref|XP_006358941.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Solanum tuberosum]
Length=965

 Score =   280 bits (715),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/161 (86%), Positives = 150/161 (93%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            M  RNLEK+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQ+C
Sbjct  1    MTTRNLEKLASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQDC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYE +HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEAKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  474  L-KKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            L KKGDF DE++A TESDIEET  +LV D+KKSPQEVFDA+
Sbjct  121  LKKKGDFGDESNATTESDIEETFKKLVGDLKKSPQEVFDAI  161



>sp|Q01647.1|CAPP1_FLAPR RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Flaveria pringlei]
 emb|CAA45505.1| phosphoenolpyruvate carboxylase [Flaveria pringlei]
Length=967

 Score =   280 bits (715),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEK+ASIDAQLRLLVPGKVSEDDKL+EYDALLLD+FLDILQDLHGE+L+E VQEC
Sbjct  1    MANRNLEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDKFLDILQDLHGEDLKEAVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LK+GDF DE +A TESDIEET  +LV+ + KSP+EVFDAL
Sbjct  121  LKRGDFADEANATTESDIEETFKKLVLKLNKSPEEVFDAL  160



>gb|KJB33217.1| hypothetical protein B456_006G001300 [Gossypium raimondii]
Length=965

 Score =   279 bits (714),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA R +EKMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAGRKVEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPK LEELG VLTSLDPGDSIV+ KSFSHMLNL NLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKILEELGKVLTSLDPGDSIVVTKSFSHMLNLGNLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DE+SA TESDIEET  RLV  + KSP+EVFDAL
Sbjct  121  LKKGDFADESSATTESDIEETFKRLVGQLNKSPEEVFDAL  160



>emb|CAA88829.1| phosphoenolpyruvate carboxylase [Flaveria pringlei]
Length=966

 Score =   280 bits (715),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEK+ASIDAQLRLLVPGKVSEDDKL+EYDALLLD+FLDILQDLHGE+L+E VQEC
Sbjct  1    MANRNLEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDKFLDILQDLHGEDLKEAVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LK+GDF DE +A TESDIEET  +LV+ + KSP+EVFDAL
Sbjct  121  LKRGDFADEANATTESDIEETFKKLVLKLNKSPEEVFDAL  160



>ref|NP_001274942.1| phosphoenolpyruvate carboxylase [Solanum tuberosum]
 sp|P29196.2|CAPP_SOLTU RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Solanum tuberosum]
 emb|CAA47437.1| phosphoenolpyruvate carboxylase [Solanum tuberosum]
Length=965

 Score =   279 bits (714),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 139/161 (86%), Positives = 150/161 (93%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            M  RNL+K+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MTTRNLDKLASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYE +HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEAKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  474  L-KKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            L KKGDF DE++A TESDIEET  +LV D+KKSPQEVFDA+
Sbjct  121  LKKKGDFGDESNATTESDIEETFKKLVGDLKKSPQEVFDAI  161



>gb|KHG25331.1| Phosphoenolpyruvate carboxylase 2 [Gossypium arboreum]
Length=965

 Score =   279 bits (714),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA R +EKMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAGRKVEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPK LEELG VLTSLDPGDSIV+ KSFSHMLNL NLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKILEELGKVLTSLDPGDSIVVTKSFSHMLNLGNLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DE+SA TESDIEET  RLV  + KSP+EVFDAL
Sbjct  121  LKKGDFADESSATTESDIEETFKRLVGQLNKSPEEVFDAL  160



>gb|AAM14597.1|AF494192_1 phosphoenolpyruvate carboxylase FPUB966 [Flaveria pubescens]
Length=966

 Score =   279 bits (714),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEK+ASIDAQLRLLVPGKVSEDDKL+EYDALLLD+FLDILQDLHGE+L+E VQEC
Sbjct  1    MANRNLEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDKFLDILQDLHGEDLKEAVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LK+GDF DE +A TESDIEET  RLV  + KSP+EVFDAL
Sbjct  121  LKRGDFADEANATTESDIEETFKRLVHKLNKSPEEVFDAL  160



>gb|KDP32538.1| hypothetical protein JCGZ_14741 [Jatropha curcas]
Length=957

 Score =   279 bits (713),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = +3

Query  138  MASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAEYE  317
            MASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQECYELS EYE
Sbjct  1    MASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQECYELSGEYE  60

Query  318  GRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVD  497
            G+HD KKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIA+RRR KLKKGDF D
Sbjct  61   GKHDGKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAHRRRNKLKKGDFAD  120

Query  498  ENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            EN+A TESDIEET+ RLVVDMKKSP+EVFDAL
Sbjct  121  ENNATTESDIEETIKRLVVDMKKSPEEVFDAL  152



>ref|XP_004297535.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Fragaria vesca 
subsp. vesca]
Length=962

 Score =   279 bits (713),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            M ARNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RETVQ+C
Sbjct  1    MTARNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDIRETVQDC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+ DPKKLEELGNVLTSLDPGDSIV+AK+FSHMLNLANLAEEVQ+AYRRR K
Sbjct  61   YELSAEYEGKRDPKKLEELGNVLTSLDPGDSIVVAKAFSHMLNLANLAEEVQMAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKG FVDE +A TESDIEET  +LV  + KSPQEVFD L
Sbjct  121  LKKGGFVDEANATTESDIEETFKKLVGQLNKSPQEVFDEL  160



>ref|XP_009354255.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Pyrus x bretschneideri]
 ref|XP_009348400.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Pyrus x bretschneideri]
Length=967

 Score =   278 bits (712),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 149/161 (93%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MAA+NLEKMASID QLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQ+C
Sbjct  1    MAAKNLEKMASIDVQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGESLRETVQDC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYE + DP+KL ELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYERKQDPQKLAELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  L-KKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            + KKGDF DE SA TESDIEETL RLV D+KKSP+EVFDAL
Sbjct  121  MKKKGDFADEASATTESDIEETLKRLVGDLKKSPEEVFDAL  161



>gb|KJB82053.1| hypothetical protein B456_013G173500 [Gossypium raimondii]
Length=964

 Score =   278 bits (712),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  129  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  308
             EK+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQECYELSA
Sbjct  12   FEKLASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQECYELSA  71

Query  309  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  488
            EYEG+++PKKLEELGNVLTSLDPGDSIV+AK+FSHMLNLANLAEEVQIA+RRR KLKKGD
Sbjct  72   EYEGKNNPKKLEELGNVLTSLDPGDSIVVAKAFSHMLNLANLAEEVQIAHRRRIKLKKGD  131

Query  489  FVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            FVDEN+A TESD+EETL RLVVD+KKSPQEVFDAL
Sbjct  132  FVDENNATTESDLEETLKRLVVDLKKSPQEVFDAL  166



>gb|AAB80714.1| phosphoenolpyruvate carboxylase 1 [Gossypium hirsutum]
Length=965

 Score =   278 bits (711),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA R +EKMASIDAQLRLL PGKVSEDDKLVEYDA+LLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAGRKVEKMASIDAQLRLLAPGKVSEDDKLVEYDAVLLDRFLDILQDLHGEDIRETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPK LEELG VLTSLDPGDSIV+ KSFSHMLNL NLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKILEELGKVLTSLDPGDSIVVTKSFSHMLNLGNLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DE+SA TESDIEET  RLV  + KSP+EVFDAL
Sbjct  121  LKKGDFADESSATTESDIEETFKRLVGQLNKSPEEVFDAL  160



>ref|XP_007133202.1| hypothetical protein PHAVU_011G160200g [Phaseolus vulgaris]
 gb|ESW05196.1| hypothetical protein PHAVU_011G160200g [Phaseolus vulgaris]
Length=967

 Score =   278 bits (710),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDA LRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAHLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG HD KKL+ELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGNHDSKKLDELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DENSA TESDIEETL +LVVD+KKSPQEVFD L
Sbjct  121  LKKGDFADENSATTESDIEETLKKLVVDLKKSPQEVFDEL  160



>ref|XP_009357178.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Pyrus x bretschneideri]
Length=967

 Score =   278 bits (710),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 149/161 (93%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MAARNLEKMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ+C
Sbjct  1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGESLRETVQDC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYE +  P+KLEELG +LTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYERKQVPQKLEELGKMLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  L-KKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            L KKGDF DE SA TESDIEETL RLV D+KKSP+E+FDAL
Sbjct  121  LKKKGDFADEASATTESDIEETLKRLVGDLKKSPEEIFDAL  161



>ref|XP_010279120.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Nelumbo nucifera]
 ref|XP_010279121.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Nelumbo nucifera]
Length=964

 Score =   277 bits (709),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  120  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  299
            ARNLEK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE L+ETVQE YE
Sbjct  2    ARNLEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEELKETVQEVYE  61

Query  300  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  479
            L+A+YEG+HD +KLEELGNVLTSLDPGDSIV+AKSFSHMLNLANLAEEVQIA+ RR KLK
Sbjct  62   LAAKYEGKHDFQKLEELGNVLTSLDPGDSIVVAKSFSHMLNLANLAEEVQIAHHRRTKLK  121

Query  480  KGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KGDF DENSA TESDIEETL RLVV +KKSP+EVFDAL
Sbjct  122  KGDFHDENSATTESDIEETLKRLVVQLKKSPEEVFDAL  159



>ref|XP_004251893.1| PREDICTED: phosphoenolpyruvate carboxylase [Solanum lycopersicum]
 ref|XP_010313917.1| PREDICTED: phosphoenolpyruvate carboxylase [Solanum lycopersicum]
Length=965

 Score =   277 bits (709),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 150/161 (93%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA +NLEK+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ TVQ+C
Sbjct  1    MATKNLEKLASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKGTVQDC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYE +HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEAKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  474  L-KKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            L KKGDF DE++A TESDIEET  +LV D+KKSPQEVFDA+
Sbjct  121  LKKKGDFGDESNATTESDIEETFKKLVGDLKKSPQEVFDAI  161



>gb|KDP36288.1| hypothetical protein JCGZ_09795 [Jatropha curcas]
Length=965

 Score =   277 bits (709),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA +NLEKM SIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAGKNLEKMVSIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YE+SAEYE +HDP+KLEELG VLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YEISAEYERKHDPQKLEELGKVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRTK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
             KKGDF DENSA TESD+EET  +LVV +KKSP+EVFDAL
Sbjct  121  SKKGDFADENSATTESDMEETFKKLVVQLKKSPEEVFDAL  160



>ref|NP_001241357.1| phosphoenolpyruvate carboxylase [Glycine max]
 ref|XP_006591889.1| PREDICTED: phosphoenolpyruvate carboxylase isoform X1 [Glycine 
max]
 ref|XP_006591890.1| PREDICTED: phosphoenolpyruvate carboxylase isoform X2 [Glycine 
max]
 sp|P51061.1|CAPP2_SOYBN RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Glycine max]
 dbj|BAA03100.1| phosphoenolpyruvate carboxylase [Glycine max]
Length=967

 Score =   277 bits (708),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MATRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELGN++TSLD GDSI++AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSILVAKSFSHMLNLANLAEEVQISRRRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DEN+A TESDIEETL +LV D+KKSPQEVFDAL
Sbjct  121  LKKGDFADENNATTESDIEETLKKLVFDLKKSPQEVFDAL  160



>gb|AAM14596.1|AF494191_1 phosphoenolpyruvate carboxylase FB966 [Flaveria brownii]
Length=966

 Score =   277 bits (708),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA +N+EK+ASIDAQLRLLVPGKVSEDDKL+EYDALLLD+FLDILQDLHGE+L+E VQEC
Sbjct  1    MANKNVEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDKFLDILQDLHGEDLKEAVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LK+GDF DE +A TESDIEET  RLV  + KSP+EVFDAL
Sbjct  121  LKRGDFADEANATTESDIEETFKRLVHKLNKSPEEVFDAL  160



>ref|XP_010552117.1| PREDICTED: phosphoenolpyruvate carboxylase 3 [Tarenaya hassleriana]
 ref|XP_010552118.1| PREDICTED: phosphoenolpyruvate carboxylase 3 [Tarenaya hassleriana]
Length=967

 Score =   276 bits (707),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 150/161 (93%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MAARN+EKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ+ 
Sbjct  1    MAARNIEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQDL  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YELSAEYEG+H+P KLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YELSAEYEGKHEPGKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KL K DF DENSA TESDIEET  RLVVD+KKSP+EVFDAL
Sbjct  121  KLAKRDFADENSATTESDIEETFKRLVVDLKKSPEEVFDAL  161



>gb|ABV80356.1| phosphoenolpyruvate carboxylase [Gossypium hirsutum]
Length=971

 Score =   276 bits (707),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  129  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  308
             EK+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQECYELSA
Sbjct  12   FEKLASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQECYELSA  71

Query  309  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  488
            EYEG+  PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLA+LAEEVQIAYRRR KLKKGD
Sbjct  72   EYEGKSTPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLADLAEEVQIAYRRRIKLKKGD  131

Query  489  FVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            F DENSA TESDIEETL RLVVD+KKSP+EVFDAL
Sbjct  132  FADENSATTESDIEETLKRLVVDLKKSPEEVFDAL  166



>gb|EEC83482.1| hypothetical protein OsI_28999 [Oryza sativa Indica Group]
Length=684

 Score =   271 bits (694),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +3

Query  120  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  299
            A  +EKMASIDAQLR+L P K+SEDDKLVEYDALLLDRFLDILQDLHG++LRE VQECYE
Sbjct  2    AGKVEKMASIDAQLRMLAPAKLSEDDKLVEYDALLLDRFLDILQDLHGDDLREMVQECYE  61

Query  300  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  479
            ++AEYEG+HD +KL+ELGN+LTSLDPGDSIV+AK+FSHMLNLANLAEEVQIAYRRR KLK
Sbjct  62   IAAEYEGKHDSQKLDELGNMLTSLDPGDSIVMAKAFSHMLNLANLAEEVQIAYRRRIKLK  121

Query  480  KGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KGDF DENSA+TESDIEET  RLVVD+KKSP EVFDAL
Sbjct  122  KGDFADENSALTESDIEETFKRLVVDLKKSPAEVFDAL  159



>sp|Q9FV66.1|CAPPB_FLATR RecName: Full=Phosphoenolpyruvate carboxylase 1; Short=PEPC 1; 
Short=PEPCase 1; Short=ppcB [Flaveria trinervia]
 gb|AAG17618.1|AF248079_1 phosphoenolpyruvate carboxylase [Flaveria trinervia]
Length=965

 Score =   276 bits (706),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEK+ASIDA LRLLVPGKVSEDDKL+EYDALLLD+FLDILQDLHGE+L+ETVQEC
Sbjct  1    MANRNLEKLASIDAHLRLLVPGKVSEDDKLIEYDALLLDKFLDILQDLHGEDLKETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+ DPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKRDPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DE  A TESD+EETL +LV  + KSP+EVFDAL
Sbjct  121  LKKGDFADEAHATTESDMEETLKKLVYKLNKSPEEVFDAL  160



>gb|KEH19560.1| phosphoenolpyruvate carboxylase [Medicago truncatula]
Length=873

 Score =   275 bits (703),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDP+KLEELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGKHDPQKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DEN+A TESDIEET+ RLV ++ K+PQEVFDAL
Sbjct  121  LKKGDFADENNATTESDIEETIKRLVGELNKTPQEVFDAL  160



>ref|XP_002280569.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Vitis vinifera]
 ref|XP_010657037.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Vitis vinifera]
 emb|CAN77927.1| hypothetical protein VITISV_018739 [Vitis vinifera]
Length=965

 Score =   276 bits (706),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MAARNLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQ++HGE+L+ETVQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQEIHGEDLKETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDP+KLEELG V+TSLD GDSIV+AKSFS+ML LANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGKHDPQKLEELGRVITSLDAGDSIVVAKSFSNMLTLANLAEEVQIAFRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DE+SA TESDIEET+ RLVV +KKSP+EVFDAL
Sbjct  121  LKKGDFHDESSATTESDIEETIKRLVVQLKKSPEEVFDAL  160



>sp|Q9AU12.1|CAPP_PHAVU RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Phaseolus vulgaris]
 gb|AAK28444.1|AF288382_1 phosphoenolpyruvate carboxylase [Phaseolus vulgaris]
Length=968

 Score =   276 bits (705),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQ+LHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLAPSKVSEDDKLIEYDALLLDRFLDILQNLHGEDLKETVQEV  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELGNV+TSLD GDSIV+AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNVITSLDAGDSIVVAKSFSHMLNLANLAEEVQISRRRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DEN+A TESDIEETL +LV ++KKSPQEVFDAL
Sbjct  121  LKKGDFADENNATTESDIEETLKKLVFELKKSPQEVFDAL  160



>emb|CBI21984.3| unnamed protein product [Vitis vinifera]
Length=944

 Score =   275 bits (704),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MAARNLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQ++HGE+L+ETVQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQEIHGEDLKETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDP+KLEELG V+TSLD GDSIV+AKSFS+ML LANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGKHDPQKLEELGRVITSLDAGDSIVVAKSFSNMLTLANLAEEVQIAFRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DE+SA TESDIEET+ RLVV +KKSP+EVFDAL
Sbjct  121  LKKGDFHDESSATTESDIEETIKRLVVQLKKSPEEVFDAL  160



>ref|XP_011012152.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Populus euphratica]
Length=965

 Score =   276 bits (705),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNL+KMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHG+++RETV +C
Sbjct  1    MADRNLQKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGQDIRETVHDC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYE  HDP+KLEELG V+TSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEAMHDPQKLEELGKVITSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DENSA TESDIEETL RLV  + KSP+EVF+AL
Sbjct  121  LKKGDFADENSATTESDIEETLNRLVGQLNKSPEEVFEAL  160



>ref|XP_004516076.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Cicer arietinum]
Length=967

 Score =   276 bits (705),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDA LR LVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAHLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDP+KLEELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGKHDPEKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DEN+A TESDIEETL RLV D+ KSPQEVFDAL
Sbjct  121  LKKGDFADENNATTESDIEETLKRLVGDLNKSPQEVFDAL  160



>ref|XP_007149391.1| hypothetical protein PHAVU_005G066400g [Phaseolus vulgaris]
 gb|ESW21385.1| hypothetical protein PHAVU_005G066400g [Phaseolus vulgaris]
Length=968

 Score =   275 bits (704),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQ+LHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLAPSKVSEDDKLIEYDALLLDRFLDILQNLHGEDLKETVQEV  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELGNV+TSLD GDSIV+AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNVITSLDAGDSIVVAKSFSHMLNLANLAEEVQISRRRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DEN+A TESDIEETL +LV ++KKSPQEVFDAL
Sbjct  121  LKKGDFADENNATTESDIEETLKKLVFELKKSPQEVFDAL  160



>ref|XP_006306678.1| hypothetical protein CARUB_v10008196mg, partial [Capsella rubella]
 gb|EOA39576.1| hypothetical protein CARUB_v10008196mg, partial [Capsella rubella]
Length=996

 Score =   276 bits (705),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 153/170 (90%), Gaps = 1/170 (1%)
 Frame = +3

Query  87   LWSGADSEKMAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE  266
            +WS    ++MA R LEKMASID  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE
Sbjct  21   IWSEVGEKEMANRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE  80

Query  267  NLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEV  446
            +LRETVQE YE SAEYEG+H+PKKLEELGNVLTSLDPGDSIVI+K+FSHMLNLANLAEEV
Sbjct  81   DLRETVQELYEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVISKAFSHMLNLANLAEEV  140

Query  447  QIAYRRR-QKLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            QIAYRRR +KLKKGDFVDE+SA TESD+EET  +LV D+ KSP+E+FDAL
Sbjct  141  QIAYRRRVKKLKKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDAL  190



>gb|AAU07997.1| phosphoenolpyruvate carboxylase 2 [Lupinus albus]
Length=967

 Score =   275 bits (704),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDAQLR L P KVSEDDKLVEYDALLLDRFLDILQDLHGE+++ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDMKETVQEI  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELGN++TSLD GDSIV AK+FSHMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSIVFAKAFSHMLNLANLAEEVQIAHRRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DEN+A TESDIEET  RLV ++KKSPQEVFDAL
Sbjct  121  LKKGDFADENNATTESDIEETFKRLVRELKKSPQEVFDAL  160



>gb|AJD81369.1| phosphoenolpyruvate carboxylase isoform 3 [Egeria densa]
Length=978

 Score =   275 bits (704),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +3

Query  126  NLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELS  305
            N+EKMASIDAQLR+L P KVSEDDKLVEYDALL+DRFLDILQDLHGE LRETVQ CYELS
Sbjct  18   NVEKMASIDAQLRILAPSKVSEDDKLVEYDALLVDRFLDILQDLHGEELRETVQRCYELS  77

Query  306  AEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKG  485
            AEYEG+ DP+KLEELGNVLTSLDPGDSIV++ SFSHMLNLANLAEEVQIA+RRR KLKKG
Sbjct  78   AEYEGKLDPQKLEELGNVLTSLDPGDSIVVSSSFSHMLNLANLAEEVQIAFRRRAKLKKG  137

Query  486  DFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            DF DE+SA TESDIEETL RLVV +KKSPQEVFDAL
Sbjct  138  DFADESSATTESDIEETLKRLVVQLKKSPQEVFDAL  173



>gb|KEH19559.1| phosphoenolpyruvate carboxylase [Medicago truncatula]
Length=967

 Score =   275 bits (703),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDP+KLEELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGKHDPQKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DEN+A TESDIEET+ RLV ++ K+PQEVFDAL
Sbjct  121  LKKGDFADENNATTESDIEETIKRLVGELNKTPQEVFDAL  160



>gb|AJD81371.1| phosphoenolpyruvate carboxylase isoform 5, partial [Egeria densa]
Length=967

 Score =   275 bits (703),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 146/157 (93%), Gaps = 1/157 (1%)
 Frame = +3

Query  126  NLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETV-QECYEL  302
            N+EKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETV Q CYEL
Sbjct  6    NVEKMASIDAQLRLLAPSKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVVQRCYEL  65

Query  303  SAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKK  482
            SAEYEGR DP+KLEELGNVLTSLDPGDSIV+A SFSHMLNLANLAEEVQIA+RRR KLKK
Sbjct  66   SAEYEGRLDPQKLEELGNVLTSLDPGDSIVVASSFSHMLNLANLAEEVQIAFRRRAKLKK  125

Query  483  GDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            GDF DENSA TESDIEETL RLV+ +KKSPQEVFDAL
Sbjct  126  GDFGDENSATTESDIEETLKRLVMQLKKSPQEVFDAL  162



>ref|XP_006407030.1| hypothetical protein EUTSA_v10019997mg [Eutrema salsugineum]
 dbj|BAJ34436.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48483.1| hypothetical protein EUTSA_v10019997mg [Eutrema salsugineum]
Length=968

 Score =   275 bits (703),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/161 (86%), Positives = 149/161 (93%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAGRNLEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YELSAEYEG  +PKKLEELG+VLTSLDPGDSIVI+K+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YELSAEYEGNREPKKLEELGSVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDFVDE+SA TESDIEET  RLV D+ KSP+E+FDAL
Sbjct  121  KLKKGDFVDESSATTESDIEETFKRLVSDLGKSPEEIFDAL  161



>ref|XP_007048690.1| Phosphoenolpyruvate carboxylase 3 isoform 1 [Theobroma cacao]
 gb|EOX92847.1| Phosphoenolpyruvate carboxylase 3 isoform 1 [Theobroma cacao]
Length=965

 Score =   275 bits (703),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA +++EKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHG ++RETVQEC
Sbjct  1    MAGKSIEKMASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQDLHGGDIRETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDP KLEELG V+TSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPLKLEELGKVITSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DE+SA TESDIEET+ RLV  +KKSP+EVFDAL
Sbjct  121  LKKGDFADESSATTESDIEETIKRLVGQLKKSPEEVFDAL  160



>ref|XP_010542308.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like [Tarenaya hassleriana]
Length=967

 Score =   275 bits (702),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 147/161 (91%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKM SIDAQLR LVP KV EDD+LVEYDALLLDRFLDILQDLHGE LRETVQE 
Sbjct  1    MATRNLEKMVSIDAQLRQLVPAKVGEDDRLVEYDALLLDRFLDILQDLHGEGLRETVQEL  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YELSAEYEG+HDPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YELSAEYEGKHDPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KL + DF DENSA TESDIEET  RLVVD+KKSP+EVF+AL
Sbjct  121  KLARRDFADENSATTESDIEETFKRLVVDLKKSPEEVFEAL  161



>gb|ABU41519.1| phosphoenolpyruvate carboxylase [Jatropha curcas]
Length=965

 Score =   275 bits (702),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA +NLEKM SIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAGKNLEKMVSIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YE+SA YE +HDP+KLEELG VLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YEISAGYERKHDPQKLEELGKVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRTK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
             KKGDF DENSA TESD+EET  +LVV +KKSP+EVFDAL
Sbjct  121  SKKGDFADENSATTESDMEETFKKLVVQLKKSPEEVFDAL  160



>gb|ABR29878.1| phosphoenolpyruvate carboxylase [Ricinus communis]
Length=965

 Score =   275 bits (702),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNL  MASIDAQLRLL   KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQ+C
Sbjct  1    MAGRNLVIMASIDAQLRLLALRKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQDC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+H+P+KL ELG VLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHNPQKLAELGKVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DENSA TESDIEETL RLVV +KKSP+EVFDAL
Sbjct  121  LKKGDFADENSATTESDIEETLKRLVVQLKKSPEEVFDAL  160



>gb|AJD81368.1| phosphoenolpyruvate carboxylase isoform 2 [Egeria densa]
Length=968

 Score =   274 bits (701),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +3

Query  126  NLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELS  305
            N+EKM SIDAQLR+L P KVSEDDKLVEYDALL+DRFLDILQDLHGE LRETVQ CYELS
Sbjct  8    NVEKMVSIDAQLRILAPSKVSEDDKLVEYDALLVDRFLDILQDLHGEELRETVQRCYELS  67

Query  306  AEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKG  485
            AEYEG+ DP+KLE+LGNVLTSLDPGDSIV++ SFSHMLNLANLAEEVQIA+RRR KLKKG
Sbjct  68   AEYEGKLDPQKLEKLGNVLTSLDPGDSIVVSSSFSHMLNLANLAEEVQIAFRRRAKLKKG  127

Query  486  DFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            DF DENSA TESDIEETL RLVV +KKSPQEVFDAL
Sbjct  128  DFADENSATTESDIEETLKRLVVQLKKSPQEVFDAL  163



>gb|KJB48959.1| hypothetical protein B456_008G095300 [Gossypium raimondii]
Length=965

 Score =   274 bits (701),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA+R +EK+ SIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MASRKVEKLTSIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPK LEELG V+TSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKILEELGKVITSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            +KKGDF DE+SA TESDIEETL RLV  + KSP EVFDAL
Sbjct  121  MKKGDFADESSATTESDIEETLKRLVGQLNKSPDEVFDAL  160



>gb|KHG11000.1| Phosphoenolpyruvate carboxylase, housekeeping isozyme [Gossypium 
arboreum]
Length=965

 Score =   274 bits (701),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA+R +EK+ SIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MASRKVEKLTSIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPK LEELG V+TSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKILEELGKVITSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            +KKGDF DE+SA TESDIEETL RLV  + KSP EVFDAL
Sbjct  121  MKKGDFADESSATTESDIEETLKRLVGQLNKSPDEVFDAL  160



>ref|NP_001237394.1| phosphoenolpyruvate carboxylase [Glycine max]
 gb|AAS67006.1| Phosphoenolpyruvate carboxylase [Glycine max]
 gb|KHN27941.1| Phosphoenolpyruvate carboxylase 2 [Glycine soja]
Length=966

 Score =   274 bits (701),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 148/161 (92%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MAARN+EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHGE++R+TVQ+C
Sbjct  1    MAARNIEKMASIDAQLRLLAPRKVSDDDKLVEYDALLLDRFLDILQDLHGEDIRQTVQDC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG H P+KLEELGN+LT LD GDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGEHKPEKLEELGNMLTGLDAGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  -LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
             LKKGDF DENSAITESDIEET  +LV  +KK+PQE+FDAL
Sbjct  121  LLKKGDFADENSAITESDIEETFKKLVAQLKKTPQEIFDAL  161



>ref|NP_001236741.1| phosphoenolpyruvate carboxylase [Glycine max]
 dbj|BAA23419.1| phosphoenolpyruvate carboxylase [Glycine max]
Length=967

 Score =   274 bits (700),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELGN++TSLD GDSI++AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSILVAKSFSHMLNLANLAEEVQISRRRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DEN+A TESDIEETL +LV  +KKSPQEVFDAL
Sbjct  121  LKKGDFADENNATTESDIEETLKKLVFGLKKSPQEVFDAL  160



>emb|CAA45504.1| phosphoenolpyruvate carboxylase [Flaveria trinervia]
Length=967

 Score =   274 bits (700),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RN+EK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLD+FLDILQDLHGE+L+E VQ+C
Sbjct  1    MANRNVEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDKFLDILQDLHGEDLKEAVQQC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKL+ELG++LTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLDELGSLLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LK GDF DE +A TESDIEET  RLV  + KSP+EVFDAL
Sbjct  121  LKSGDFADEANATTESDIEETFKRLVHKLNKSPEEVFDAL  160



>ref|XP_006593478.1| PREDICTED: phosphoenolpyruvate carboxylase isoform X1 [Glycine 
max]
 dbj|BAC41249.1| phosphoenolpyruvate carboxylase [Glycine max]
Length=967

 Score =   274 bits (700),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELGN++TSLD GDSI++AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSILVAKSFSHMLNLANLAEEVQISRRRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DEN+A TESDIEETL +LV  +KKSPQEVFDAL
Sbjct  121  LKKGDFADENNATTESDIEETLKKLVFGLKKSPQEVFDAL  160



>gb|KHN36882.1| Phosphoenolpyruvate carboxylase [Glycine soja]
Length=967

 Score =   273 bits (699),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELGN++TSLD GDSI++AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSILVAKSFSHMLNLANLAEEVQISRRRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DEN+A TESDIEETL +LV  +KKSPQEVFDAL
Sbjct  121  LKKGDFADENNATTESDIEETLKKLVFGLKKSPQEVFDAL  160



>ref|XP_003543306.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Glycine max]
Length=972

 Score =   273 bits (699),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 147/161 (91%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MAARN+EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHGE++R+TVQ+C
Sbjct  1    MAARNIEKMASIDAQLRLLAPRKVSDDDKLVEYDALLLDRFLDILQDLHGEDIRQTVQDC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG H P KLEELGN+LT LD GDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGEHKPDKLEELGNMLTGLDAGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  -LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
             LKKGDF DENSAITESDIEET  +LV  +KK+PQE+FDAL
Sbjct  121  LLKKGDFADENSAITESDIEETFKKLVAQLKKTPQEIFDAL  161



>gb|KFK38845.1| phosphoenolpyruvate carboxylase [Arabis alpina]
Length=968

 Score =   273 bits (698),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 137/161 (85%), Positives = 150/161 (93%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RN+EKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAGRNVEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YELSAEYEG+ +P+KLEELG+VLTSLDPGDSIVI+K+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YELSAEYEGKREPEKLEELGSVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDFVDE+SA TESDIEET  RLV D+ KSP+E+FDAL
Sbjct  121  KLKKGDFVDESSATTESDIEETFKRLVSDLGKSPEEIFDAL  161



>gb|AAO15570.1|AF459644_1 phosphoenolpyruvate carboxylase [Lupinus albus]
Length=967

 Score =   273 bits (698),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDAQLR L P KVSEDDKLVEYDALLLDRFLDILQDLHGE+++ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDMKETVQEI  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELGN++TSLD GDSIV AK+FSHMLNLANLAEEVQIA+RRR  
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSIVFAKAFSHMLNLANLAEEVQIAHRRRNN  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DEN+A TESDIEET  RLV ++KKSPQEVFDAL
Sbjct  121  LKKGDFADENNATTESDIEETFKRLVRELKKSPQEVFDAL  160



>gb|KHN36697.1| Phosphoenolpyruvate carboxylase 2 [Glycine soja]
Length=966

 Score =   273 bits (698),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 147/161 (91%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MAARN+EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHGE++R+TVQ+C
Sbjct  1    MAARNIEKMASIDAQLRLLAPRKVSDDDKLVEYDALLLDRFLDILQDLHGEDIRQTVQDC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG H P KLEELGN+LT LD GDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGEHKPDKLEELGNMLTGLDAGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  -LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
             LKKGDF DENSAITESDIEET  +LV  +KK+PQE+FDAL
Sbjct  121  LLKKGDFADENSAITESDIEETFKKLVAQLKKTPQEIFDAL  161



>ref|XP_002882904.1| ATPPC3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59163.1| ATPPC3 [Arabidopsis lyrata subsp. lyrata]
Length=968

 Score =   273 bits (698),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 137/161 (85%), Positives = 150/161 (93%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RN+EKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAGRNIEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YELSAEYEG+ +PKKLEELG+VLTSLDPGDSIVI+K+FSHMLNLANLAEEVQIA+RRR +
Sbjct  61   YELSAEYEGKREPKKLEELGSVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAHRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDFVDE+SA TESDIEET  RLV D+ KSP+E+FDAL
Sbjct  121  KLKKGDFVDESSATTESDIEETFKRLVSDLGKSPEEIFDAL  161



>ref|XP_007149740.1| hypothetical protein PHAVU_005G095300g [Phaseolus vulgaris]
 gb|ESW21734.1| hypothetical protein PHAVU_005G095300g [Phaseolus vulgaris]
Length=966

 Score =   273 bits (698),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 148/161 (92%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RN+EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHGE++R+TVQ+C
Sbjct  1    MATRNIEKMASIDAQLRLLAPRKVSDDDKLVEYDALLLDRFLDILQDLHGEDIRQTVQDC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG H P+KLEELGN+LT LD GDSIVI+KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGEHRPEKLEELGNMLTGLDAGDSIVISKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  -LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
             LKKGDF DENSA+TESDIEETL RLV  +KK+PQEVFDAL
Sbjct  121  LLKKGDFADENSAMTESDIEETLKRLVTQLKKTPQEVFDAL  161



>ref|XP_010479886.1| PREDICTED: phosphoenolpyruvate carboxylase 1 [Camelina sativa]
Length=967

 Score =   273 bits (697),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 137/161 (85%), Positives = 148/161 (92%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA R LEKMASID  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MANRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YE SAEYEG+H+PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRVK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDFVDE+SA TESD+EET  +LV D+ KSP+E+FDAL
Sbjct  121  KLKKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDAL  161



>ref|XP_002894435.1| ATPPC1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70694.1| ATPPC1 [Arabidopsis lyrata subsp. lyrata]
Length=967

 Score =   273 bits (697),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 137/161 (85%), Positives = 148/161 (92%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA R LEKMASID  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAYRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YE SAEYEG+H+PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDFVDE+SA TESD+EET  +LV D+ KSP+E+FDAL
Sbjct  121  KLKKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDAL  161



>ref|XP_010500970.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like isoform X1 
[Camelina sativa]
 ref|XP_010500971.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like isoform X2 
[Camelina sativa]
 ref|XP_010500972.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like isoform X3 
[Camelina sativa]
 ref|XP_010462211.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like isoform X1 
[Camelina sativa]
 ref|XP_010462212.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like isoform X2 
[Camelina sativa]
 ref|XP_010462213.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like isoform X3 
[Camelina sativa]
Length=967

 Score =   273 bits (697),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 137/161 (85%), Positives = 148/161 (92%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA R LEKMASID  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MANRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YE SAEYEG+H+PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRVK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDFVDE+SA TESD+EET  +LV D+ KSP+E+FDAL
Sbjct  121  KLKKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDAL  161



>ref|XP_002302820.2| hypothetical protein POPTR_0002s22720g [Populus trichocarpa]
 gb|EEE82093.2| hypothetical protein POPTR_0002s22720g [Populus trichocarpa]
Length=995

 Score =   273 bits (698),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNL+KMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHG+++RETV +C
Sbjct  31   MADRNLQKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGKDIRETVHDC  90

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYE +HDP+KLEELG V+TSLDPGDSIV+ KSFSHMLNLANLAEEVQIA RRR K
Sbjct  91   YELSAEYEAKHDPQKLEELGRVITSLDPGDSIVVTKSFSHMLNLANLAEEVQIASRRRIK  150

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DENSA TESDIEETL RLV  + KSP+EVF+AL
Sbjct  151  LKKGDFADENSATTESDIEETLNRLVGQLNKSPEEVFEAL  190



>ref|XP_008813762.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like isoform X1 
[Phoenix dactylifera]
Length=966

 Score =   273 bits (697),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            M+   +EK+ASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQ LHGE+LRETVQE 
Sbjct  1    MSRNVVEKLASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQYLHGEDLRETVQEL  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+ DP KL+ELGNVLTSLDPGDSIV+AKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKPDPSKLDELGNVLTSLDPGDSIVVAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DENSA TESDIEETL RLVV +KKSP E+FDAL
Sbjct  121  LKKGDFADENSAATESDIEETLKRLVVQLKKSPAEIFDAL  160



>ref|XP_007132856.1| hypothetical protein PHAVU_011G130400g [Phaseolus vulgaris]
 gb|ESW04850.1| hypothetical protein PHAVU_011G130400g [Phaseolus vulgaris]
Length=966

 Score =   273 bits (697),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 150/161 (93%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDAQLRLLVP KVS+DDKLVEYDALLLDRFLDILQDLHG ++RETVQ+C
Sbjct  1    MATRNLEKMASIDAQLRLLVPSKVSDDDKLVEYDALLLDRFLDILQDLHGGDIRETVQDC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+++P+KLEELGN+LT LD GDSIVI+KSF+HMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGQNNPQKLEELGNMLTGLDAGDSIVISKSFAHMLNLANLAEEVQIAYRRRIK  120

Query  474  -LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
             LKKGDF+DENSAITESDIEET  RLV  +KK+PQE+FDAL
Sbjct  121  LLKKGDFIDENSAITESDIEETFKRLVNQLKKTPQEIFDAL  161



>ref|XP_010920051.1| PREDICTED: LOW QUALITY PROTEIN: phosphoenolpyruvate carboxylase, 
housekeeping isozyme-like [Elaeis guineensis]
Length=966

 Score =   272 bits (696),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            M+   +EK+ASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MSRNAVEKLASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEL  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDP+KL+ELGNVLTSLDPGDSIVI KSFS+MLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPRKLDELGNVLTSLDPGDSIVITKSFSNMLNLANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DENSA TESDIEETL RLVV +KKSP EVFDAL
Sbjct  121  LKKGDFADENSAATESDIEETLKRLVVQLKKSPAEVFDAL  160



>ref|XP_006296907.1| hypothetical protein CARUB_v10012899mg [Capsella rubella]
 gb|EOA29805.1| hypothetical protein CARUB_v10012899mg [Capsella rubella]
Length=968

 Score =   272 bits (696),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 150/161 (93%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RN+EKMASIDAQLR LVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAGRNVEKMASIDAQLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YELSAEYEG+ +PKKLEELG+VLTSLDPGDSIVI+K+FSHMLNLANLAEEVQIA+RRR +
Sbjct  61   YELSAEYEGKREPKKLEELGSVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAHRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDFVDE+SA TESDIEET  RLV D+ KSP+E+FDAL
Sbjct  121  KLKKGDFVDESSATTESDIEETFKRLVSDLGKSPEEIFDAL  161



>emb|CAB65170.1| phosphoenolpyruvate carboxylase 1 [Solanum lycopersicum var. 
cerasiforme]
Length=964

 Score =   272 bits (695),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 148/161 (92%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            M  RNL+K+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ TVQ+C
Sbjct  1    MTTRNLDKLASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKGTVQDC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYE +HDPKKLEELGNVLTSL PGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEAKHDPKKLEELGNVLTSLVPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  474  L-KKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            L KKGDF DE++A TESDIEET  +LV D+KKSPQEVFDA+
Sbjct  121  LKKKGDFGDESNATTESDIEETFKKLVGDLKKSPQEVFDAI  161



>ref|XP_006306679.1| hypothetical protein CARUB_v10008196mg [Capsella rubella]
 gb|EOA39577.1| hypothetical protein CARUB_v10008196mg [Capsella rubella]
Length=967

 Score =   272 bits (695),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 148/161 (92%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA R LEKMASID  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MANRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YE SAEYEG+H+PKKLEELGNVLTSLDPGDSIVI+K+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAYRRRVK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDFVDE+SA TESD+EET  +LV D+ KSP+E+FDAL
Sbjct  121  KLKKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDAL  161



>ref|XP_010925637.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Elaeis guineensis]
Length=965

 Score =   271 bits (694),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            M+  +LE+ AS+DAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC
Sbjct  1    MSKNSLERHASVDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEY  + D KKL ELGNVLTSLDPGDSIV+A SFSHMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYGRKQDLKKLGELGNVLTSLDPGDSIVVASSFSHMLNLANLAEEVQIAHRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DENSA TESDIEETL RLVV +KKSPQEVFDAL
Sbjct  121  LKKGDFADENSAPTESDIEETLKRLVVQLKKSPQEVFDAL  160



>ref|XP_008793018.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Phoenix dactylifera]
Length=966

 Score =   271 bits (694),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            M+   +EK+AS+DAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MSRNGVEKLASVDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+ DP KL+ELGNVLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKRDPSKLDELGNVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKG F DENSA TESDIEETL RL+V +KKSP EVFDAL
Sbjct  121  LKKGYFADENSAATESDIEETLKRLMVQLKKSPAEVFDAL  160



>ref|NP_001061646.1| Os08g0366000 [Oryza sativa Japonica Group]
 dbj|BAC24913.1| phosphoenolpyruvate carboxylase [Oryza sativa Japonica Group]
 dbj|BAF23560.1| Os08g0366000 [Oryza sativa Japonica Group]
 gb|EAZ06753.1| hypothetical protein OsI_28997 [Oryza sativa Indica Group]
 gb|EAZ42509.1| hypothetical protein OsJ_27076 [Oryza sativa Japonica Group]
 dbj|BAG93600.1| unnamed protein product [Oryza sativa Japonica Group]
Length=964

 Score =   271 bits (694),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +3

Query  120  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  299
            A  +EKMASIDAQLR+L P K+SEDDKLVEYDALLLDRFLDILQDLHG++LRE VQECYE
Sbjct  2    AGKVEKMASIDAQLRMLAPAKLSEDDKLVEYDALLLDRFLDILQDLHGDDLRELVQECYE  61

Query  300  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  479
            ++AEYEG+HD +KL+ELGN+LTSLDPGDSIV+AK+FSHMLNLANLAEEVQIAYRRR KLK
Sbjct  62   IAAEYEGKHDSQKLDELGNMLTSLDPGDSIVMAKAFSHMLNLANLAEEVQIAYRRRIKLK  121

Query  480  KGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KGDF DENSA+TESDIEET  RLVVD+KKSP EVFDAL
Sbjct  122  KGDFADENSALTESDIEETFKRLVVDLKKSPAEVFDAL  159



>ref|XP_006392801.1| hypothetical protein EUTSA_v10011967mg, partial [Eutrema salsugineum]
 gb|ESQ30087.1| hypothetical protein EUTSA_v10011967mg, partial [Eutrema salsugineum]
Length=935

 Score =   271 bits (693),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 148/161 (92%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA R LEKMASID  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MANRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YE SAEYEG+HDPKKLE+LG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHDPKKLEDLGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDFVDE+SA TESD+EET  +LV D+ KSP+E+FDAL
Sbjct  121  KLKKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDAL  161



>ref|NP_001275821.1| phosphoenolpyruvate carboxylase [Citrus sinensis]
 gb|ABK54024.2| phosphoenolpyruvate carboxylase [Citrus sinensis]
Length=967

 Score =   271 bits (694),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 151/162 (93%), Gaps = 2/162 (1%)
 Frame = +3

Query  114  MAA-RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQE  290
            MAA RNLEKMASIDAQLRLLVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE
Sbjct  1    MAANRNLEKMASIDAQLRLLVPRKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQE  60

Query  291  CYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-  467
            CYEL+AEYEG++DP K +ELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEE+QIA+RRR 
Sbjct  61   CYELAAEYEGKNDPSKFKELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEELQIAHRRRI  120

Query  468  QKLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            +KLKKGDF DENSA TESDIEET  RLV ++ KSP+E+FDAL
Sbjct  121  KKLKKGDFADENSATTESDIEETFKRLVGELNKSPEEIFDAL  162



>ref|XP_009406237.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Musa acuminata 
subsp. malaccensis]
Length=963

 Score =   271 bits (693),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  129  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  308
            LEKMASIDA +RLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE +RETVQE YELSA
Sbjct  4    LEKMASIDAHMRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEEIRETVQELYELSA  63

Query  309  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  488
            EYEG H+P+KLEELGNVLTSLDPGD+IV++KSFSHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct  64   EYEGNHEPEKLEELGNVLTSLDPGDTIVVSKSFSHMLNLANLAEEVQIAYRRRIKLKKGD  123

Query  489  FVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            F DENSAITESDIEETL RLV  +KKS +EVFDAL
Sbjct  124  FADENSAITESDIEETLKRLVTQLKKSKEEVFDAL  158



>ref|XP_006659319.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Oryza brachyantha]
Length=964

 Score =   271 bits (693),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  120  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  299
            A  +EKMASIDAQLR+L P K+SEDDKLVEYDALLLDRFLDILQDLHG++LRE VQECYE
Sbjct  2    AGKVEKMASIDAQLRMLAPAKLSEDDKLVEYDALLLDRFLDILQDLHGDDLREMVQECYE  61

Query  300  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  479
            ++AEYEG+HD +KL ELGN+LTSLDPGDSIV+AK+FSHMLNLANLAEEVQIAYRRR KLK
Sbjct  62   IAAEYEGKHDSQKLSELGNMLTSLDPGDSIVMAKAFSHMLNLANLAEEVQIAYRRRIKLK  121

Query  480  KGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KGDF DENSA+TESDIEET  RLVVD+KKSP EVFDAL
Sbjct  122  KGDFADENSALTESDIEETFKRLVVDLKKSPAEVFDAL  159



>ref|NP_188112.1| phosphoenolpyruvate carboxylase 3 [Arabidopsis thaliana]
 sp|Q84VW9.2|CAPP3_ARATH RecName: Full=Phosphoenolpyruvate carboxylase 3; Short=AtPPC3; 
Short=PEPC 3; Short=PEPCase 3 [Arabidopsis thaliana]
 gb|AAC24594.1| phosphoenolpyruvate carboxylase [Arabidopsis thaliana]
 emb|CAA10486.1| phospho enole pyruvate carboxylase [Arabidopsis thaliana]
 dbj|BAA97057.1| phosphoenolpyruvate carboxylase [Arabidopsis thaliana]
 gb|AEE75592.1| phosphoenolpyruvate carboxylase 3 [Arabidopsis thaliana]
Length=968

 Score =   271 bits (693),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 149/161 (93%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RN+EKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAGRNIEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YELSAEYEG+ +P KLEELG+VLTSLDPGDSIVI+K+FSHMLNLANLAEEVQIA+RRR +
Sbjct  61   YELSAEYEGKREPSKLEELGSVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAHRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDFVDE+SA TESDIEET  RLV D+ KSP+E+FDAL
Sbjct  121  KLKKGDFVDESSATTESDIEETFKRLVSDLGKSPEEIFDAL  161



>gb|AAO42888.1| At3g14940 [Arabidopsis thaliana]
 dbj|BAE99551.1| phosphoenolpyruvate carboxylase [Arabidopsis thaliana]
Length=968

 Score =   271 bits (693),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 149/161 (93%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RN+EKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAGRNIEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YELSAEYEG+ +P KLEELG+VLTSLDPGDSIVI+K+FSHMLNLANLAEEVQIA+RRR +
Sbjct  61   YELSAEYEGKREPSKLEELGSVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAHRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDFVDE+SA TESDIEET  RLV D+ KSP+E+FDAL
Sbjct  121  KLKKGDFVDESSATTESDIEETFKRLVSDLGKSPEEIFDAL  161



>dbj|BAJ34480.1| unnamed protein product [Thellungiella halophila]
Length=967

 Score =   271 bits (693),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 148/161 (92%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA R LEKMASID  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MANRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YE SAEYEG+HDPKKLE+LG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHDPKKLEDLGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDFVDE+SA TESD+EET  +LV D+ KSP+E+FDAL
Sbjct  121  KLKKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDAL  161



>ref|XP_009146304.1| PREDICTED: phosphoenolpyruvate carboxylase 3 [Brassica rapa]
 ref|XP_009146305.1| PREDICTED: phosphoenolpyruvate carboxylase 3 [Brassica rapa]
Length=967

 Score =   271 bits (693),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 148/161 (92%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RN+EKMASIDAQLR LVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAGRNIEKMASIDAQLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YELSAEYEG+ DPKKLEELG+VLTSLDPGDSIVI+K+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YELSAEYEGKRDPKKLEELGSVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDF DE+SA TESDIEET  RLV  + KSP+E+FDAL
Sbjct  121  KLKKGDFADESSATTESDIEETFKRLVGVLGKSPEEIFDAL  161



>ref|XP_006487452.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
isoform X1 [Citrus sinensis]
 ref|XP_006487453.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
isoform X2 [Citrus sinensis]
 ref|XP_006487454.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
isoform X3 [Citrus sinensis]
 gb|KDO44634.1| hypothetical protein CISIN_1g002089mg [Citrus sinensis]
 gb|KDO44635.1| hypothetical protein CISIN_1g002089mg [Citrus sinensis]
Length=969

 Score =   271 bits (693),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 151/162 (93%), Gaps = 2/162 (1%)
 Frame = +3

Query  114  MAA-RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQE  290
            MAA RNLEKMASIDAQLRLLVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE
Sbjct  1    MAANRNLEKMASIDAQLRLLVPRKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQE  60

Query  291  CYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-  467
            CYEL+AEYEG++DP K +ELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEE+QIA+RRR 
Sbjct  61   CYELAAEYEGKNDPSKFKELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEELQIAHRRRI  120

Query  468  QKLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            +KLKKGDF DENSA TESDIEET  RLV ++ KSP+E+FDAL
Sbjct  121  KKLKKGDFADENSATTESDIEETFKRLVGELNKSPEEIFDAL  162



>ref|NP_175738.1| phosphoenolpyruvate carboxylase 1 [Arabidopsis thaliana]
 ref|NP_001031178.1| phosphoenolpyruvate carboxylase 1 [Arabidopsis thaliana]
 ref|NP_001031179.1| phosphoenolpyruvate carboxylase 1 [Arabidopsis thaliana]
 sp|Q9MAH0.1|CAPP1_ARATH RecName: Full=Phosphoenolpyruvate carboxylase 1; Short=AtPPC1; 
Short=PEPC 1; Short=PEPCase 1; AltName: Full=107-kDa PEPC 
polypeptide [Arabidopsis thaliana]
 gb|AAF69546.1|AC008007_21 F12M16.21 [Arabidopsis thaliana]
 gb|AAL09748.1| At1g53310/F12M16_21 [Arabidopsis thaliana]
 gb|AAN18213.1| At1g53310/F12M16_21 [Arabidopsis thaliana]
 emb|CAD58725.1| phosphoenolpyruvate carboxylase [Arabidopsis thaliana]
 gb|AEE32921.1| phosphoenolpyruvate carboxylase 1 [Arabidopsis thaliana]
 gb|AEE32922.1| phosphoenolpyruvate carboxylase 1 [Arabidopsis thaliana]
 gb|AEE32923.1| phosphoenolpyruvate carboxylase 1 [Arabidopsis thaliana]
Length=967

 Score =   271 bits (693),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 148/161 (92%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA R LEKMASID  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MANRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YE SAEYEG+H+PKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDFVDE+SA TESD+EET  +LV D+ KSP+E+FDAL
Sbjct  121  KLKKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDAL  161



>dbj|BAH19953.1| AT1G53310 [Arabidopsis thaliana]
Length=967

 Score =   271 bits (692),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 148/161 (92%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA R LEKMASID  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MANRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YE SAEYEG+H+PKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDFVDE+SA TESD+EET  +LV D+ KSP+E+FDAL
Sbjct  121  KLKKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDAL  161



>ref|XP_006442514.1| hypothetical protein CICLE_v10018719mg [Citrus clementina]
 gb|ESR55754.1| hypothetical protein CICLE_v10018719mg [Citrus clementina]
Length=969

 Score =   271 bits (692),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 151/162 (93%), Gaps = 2/162 (1%)
 Frame = +3

Query  114  MAA-RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQE  290
            MAA RNLEKMASIDAQLRLLVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE
Sbjct  1    MAANRNLEKMASIDAQLRLLVPRKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQE  60

Query  291  CYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-  467
            CYEL+AEYEG++DP K +ELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEE+QIA+RRR 
Sbjct  61   CYELAAEYEGKNDPSKFKELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEELQIAHRRRI  120

Query  468  QKLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            +KLKKGDF DENSA TESDIEET  RLV ++ KSP+E+FDAL
Sbjct  121  KKLKKGDFADENSATTESDIEETFKRLVGELNKSPEEIFDAL  162



>pdb|3ZGB|A Chain A, Greater Efficiency Of Photosynthetic Carbon Fixation 
Due To Single Amino Acid Substitution
 pdb|3ZGB|B Chain B, Greater Efficiency Of Photosynthetic Carbon Fixation 
Due To Single Amino Acid Substitution
Length=972

 Score =   271 bits (692),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  129  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  308
            LEK+ASIDAQLRLLVPGKVSEDDKL+EYDALLLD+FLDILQDLHGE+L+E VQECYELSA
Sbjct  12   LEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDKFLDILQDLHGEDLKEAVQECYELSA  71

Query  309  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  488
            EYEG+HDPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR KLK+GD
Sbjct  72   EYEGKHDPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIKLKRGD  131

Query  489  FVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            F DE +A TESDIEET  +LV+ + KSP+EVFDAL
Sbjct  132  FADEANATTESDIEETFKKLVLKLNKSPEEVFDAL  166



>ref|XP_003597124.1| Phosphoenolpyruvate carboxylase [Medicago truncatula]
 gb|AES67375.1| phosphoenolpyruvate carboxylase [Medicago truncatula]
Length=966

 Score =   271 bits (692),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 147/161 (91%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RN+EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHGE++R+TVQ+C
Sbjct  1    MATRNIEKMASIDAQLRLLAPKKVSDDDKLVEYDALLLDRFLDILQDLHGEDIRQTVQDC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG H P+KLEELGN+LT LD GDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGEHRPEKLEELGNMLTGLDAGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  -LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
             LKKGDF DENSAITESDIEET  +LV ++KK+P EVFDAL
Sbjct  121  LLKKGDFADENSAITESDIEETFKKLVTELKKTPLEVFDAL  161



>ref|XP_008812088.1| PREDICTED: SCAR-like protein 2 [Phoenix dactylifera]
Length=2243

 Score =   275 bits (703),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 157/181 (87%), Gaps = 2/181 (1%)
 Frame = +3

Query  54    TICRFR*LKSGLWSGADSEK-MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLD  230
             +ICR + L+ G   G + E+ M+  +LE+ AS+DA+LRLL PGKVSEDDKLVEYDALLLD
Sbjct  1259  SICR-KLLQRGSERGGEREREMSKNSLERHASMDAKLRLLAPGKVSEDDKLVEYDALLLD  1317

Query  231   RFLDILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFS  410
             RFLDILQDLHGE +RETVQECYELSAEYE + DPKKL+ELGNVLTSLDPGDSIV++ SFS
Sbjct  1318  RFLDILQDLHGEEIRETVQECYELSAEYERKQDPKKLDELGNVLTSLDPGDSIVVSSSFS  1377

Query  411   HMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDA  590
             HMLNLANLAEEVQIA+RRR K KKGDF DENSA TESDIEET  RLVV +KKSPQEVFDA
Sbjct  1378  HMLNLANLAEEVQIAHRRRIKRKKGDFADENSATTESDIEETFKRLVVQLKKSPQEVFDA  1437

Query  591   L  593
             L
Sbjct  1438  L  1438



>emb|CAJ84247.1| phosphoenolpyruvate carboxylase [Lupinus luteus]
Length=967

 Score =   270 bits (691),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEV  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYE +H+P+KLE+LGN++TSLD GDSIV AK+FSHMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEEKHEPEKLEKLGNIITSLDAGDSIVFAKAFSHMLNLANLAEEVQIAHRRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DEN+A TESDIEET  RLV ++KKSPQ+VFDAL
Sbjct  121  LKKGDFADENNATTESDIEETFKRLVGELKKSPQQVFDAL  160



>ref|XP_010052683.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Eucalyptus grandis]
 gb|KCW89639.1| hypothetical protein EUGRSUZ_A01915 [Eucalyptus grandis]
 gb|KCW89640.1| hypothetical protein EUGRSUZ_A01915 [Eucalyptus grandis]
Length=966

 Score =   270 bits (691),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MAARNLEK+ SIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAARNLEKLTSIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGESIRETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+ +P+KLEELG +LT LDPGDSIVI KSF+HMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGKQEPQKLEELGKMLTGLDPGDSIVITKSFAHMLNLANLAEEVQIAHRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DE SA TESDIEET  RLV  +KKSP+EVF AL
Sbjct  121  LKKGDFADEASATTESDIEETFKRLVGQLKKSPEEVFSAL  160



>emb|CAA81072.1| phosphoenolpyruvate carboxylase [Flaveria trinervia]
Length=966

 Score =   270 bits (691),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RN+EK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLD+FLDILQDLHGE+L+E VQ+C
Sbjct  1    MANRNVEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDKFLDILQDLHGEDLKEAVQQC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELG++LTSLD GDSIVIAK+FSHMLNLANLAEE+QIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGSLLTSLDTGDSIVIAKAFSHMLNLANLAEELQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LK GDF DE +A TESDIEET  RLV  + KSP+EVFDAL
Sbjct  121  LKSGDFADEANATTESDIEETFKRLVHKLNKSPEEVFDAL  160



>sp|P30694.2|CAPPA_FLATR RecName: Full=C4 phosphoenolpyruvate carboxylase; Short=C4 PEPC; 
Short=C4 PEPCase; Short=ppcA; AltName: Full=Photosynthetic 
PEPCase [Flaveria trinervia]
 emb|CAA43601.1| phosphoenolpyruvate carboxylase [Flaveria trinervia]
Length=966

 Score =   270 bits (690),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RN+EK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLD+FLDILQDLHGE+L+E VQ+C
Sbjct  1    MANRNVEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDKFLDILQDLHGEDLKEAVQQC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELG++LTSLD GDSIVIAK+FSHMLNLANLAEE+QIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGSLLTSLDTGDSIVIAKAFSHMLNLANLAEELQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LK GDF DE +A TESDIEET  RLV  + KSP+EVFDAL
Sbjct  121  LKSGDFADEANATTESDIEETFKRLVHKLNKSPEEVFDAL  160



>prf||1801241A phosphoenolpyruvate carboxylase
Length=966

 Score =   270 bits (690),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RN+EK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLD+FLDILQDLHGE+L+E VQ+C
Sbjct  1    MANRNVEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDKFLDILQDLHGEDLKEAVQQC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELG++LTSLD GDSIVIAK+FSHMLNLANLAEE+QIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGSLLTSLDTGDSIVIAKAFSHMLNLANLAEELQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LK GDF DE +A TESDIEET  RLV  + KSP+EVFDAL
Sbjct  121  LKSGDFADEANATTESDIEETFKRLVHKLNKSPEEVFDAL  160



>pdb|4BXH|B Chain B, Resolving The Activation Site Of Positive Regulators 
In Plant Phosphoenolpyruvate Carboxylase
Length=990

 Score =   270 bits (690),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RN+EK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLD+FLDILQDLHGE+L+E VQ+C
Sbjct  25   MANRNVEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDKFLDILQDLHGEDLKEAVQQC  84

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELG++LTSLD GDSIVIAK+FSHMLNLANLAEE+QIAYRRR K
Sbjct  85   YELSAEYEGKHDPKKLEELGSLLTSLDTGDSIVIAKAFSHMLNLANLAEELQIAYRRRIK  144

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LK GDF DE +A TESDIEET  RLV  + KSP+EVFDAL
Sbjct  145  LKSGDFADEANATTESDIEETFKRLVHKLNKSPEEVFDAL  184



>pdb|3ZGE|A Chain A, Greater Efficiency Of Photosynthetic Carbon Fixation 
Due To Single Amino Acid Substitution
 pdb|3ZGE|B Chain B, Greater Efficiency Of Photosynthetic Carbon Fixation 
Due To Single Amino Acid Substitution
 pdb|4BXC|A Chain A, Resolving The Activation Site Of Positive Regulators 
In Plant Phosphoenolpyruvate Carboxylase
 pdb|4BXC|B Chain B, Resolving The Activation Site Of Positive Regulators 
In Plant Phosphoenolpyruvate Carboxylase
 pdb|4BXH|A Chain A, Resolving The Activation Site Of Positive Regulators 
In Plant Phosphoenolpyruvate Carboxylase
Length=990

 Score =   270 bits (690),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RN+EK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLD+FLDILQDLHGE+L+E VQ+C
Sbjct  25   MANRNVEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDKFLDILQDLHGEDLKEAVQQC  84

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELG++LTSLD GDSIVIAK+FSHMLNLANLAEE+QIAYRRR K
Sbjct  85   YELSAEYEGKHDPKKLEELGSLLTSLDTGDSIVIAKAFSHMLNLANLAEELQIAYRRRIK  144

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LK GDF DE +A TESDIEET  RLV  + KSP+EVFDAL
Sbjct  145  LKSGDFADEANATTESDIEETFKRLVHKLNKSPEEVFDAL  184



>emb|CAJ86550.1| phosphoenolpyrovate carboxylase [Lupinus luteus]
Length=968

 Score =   270 bits (690),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = +3

Query  123  RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYEL  302
            RN+EKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE L++TVQE YEL
Sbjct  5    RNMEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEGLKDTVQEVYEL  64

Query  303  SAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKK  482
            S+EYEG+HDPKKLEE+GNV+TSLD GDSIV+AKSFSHMLNLANLAEEVQI++RRR KLKK
Sbjct  65   SSEYEGKHDPKKLEEIGNVITSLDAGDSIVVAKSFSHMLNLANLAEEVQISHRRRNKLKK  124

Query  483  GDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            G+F DE +A TESDIEETL RLV D+KKSPQEVFDAL
Sbjct  125  GNFADETNATTESDIEETLKRLVFDLKKSPQEVFDAL  161



>gb|ABR17346.1| unknown [Picea sitchensis]
Length=963

 Score =   270 bits (689),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA  NLEKMASIDAQ+RLLVPGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct  1    MARNNLEKMASIDAQMRLLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDIREMVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YE S EYEG++DP KLEELGNVLTSLDPGDSIV+A SFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YERSGEYEGKNDPHKLEELGNVLTSLDPGDSIVVASSFSHMLNLANLAEEVQIAYRRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            +K+G F DE++A TESDIEET  RLV  + KSP EVFDAL
Sbjct  121  IKRGGFADESNATTESDIEETFKRLVNQLGKSPAEVFDAL  160



>ref|XP_009395707.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Musa acuminata 
subsp. malaccensis]
Length=963

 Score =   269 bits (688),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +3

Query  129  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  308
            LEK ASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRE VQECYE SA
Sbjct  4    LEKTASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLREMVQECYEHSA  63

Query  309  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  488
            EYE +HDP+KLEELGN LTSLDPGD IV+ KSFSHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct  64   EYERKHDPRKLEELGNELTSLDPGDLIVVTKSFSHMLNLANLAEEVQIAYRRRIKLKKGD  123

Query  489  FVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            F DENSA TESDIEETL RLV  +KKSP+EVFDAL
Sbjct  124  FADENSATTESDIEETLKRLVAQLKKSPEEVFDAL  158



>ref|XP_002444204.1| hypothetical protein SORBIDRAFT_07g014960 [Sorghum bicolor]
 gb|EES13699.1| hypothetical protein SORBIDRAFT_07g014960 [Sorghum bicolor]
Length=964

 Score =   269 bits (688),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  120  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  299
            A  LEKMASIDAQLR+L P K+SEDDKLVEYDALLLDRFLDILQDLHGE+LRE VQECYE
Sbjct  2    AGKLEKMASIDAQLRMLAPAKLSEDDKLVEYDALLLDRFLDILQDLHGEDLRELVQECYE  61

Query  300  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  479
            ++AEYE +HD +KL+ELGN+LTSLDPGDSIV AK+FSHMLNLANLAEEVQIAYRRR KLK
Sbjct  62   IAAEYERKHDSEKLDELGNMLTSLDPGDSIVTAKAFSHMLNLANLAEEVQIAYRRRIKLK  121

Query  480  KGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KGDF DENSA+TESDIEET  RLVVD+KKSP EVFDAL
Sbjct  122  KGDFADENSALTESDIEETFKRLVVDLKKSPAEVFDAL  159



>ref|XP_004487157.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Cicer arietinum]
Length=965

 Score =   269 bits (688),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 149/161 (93%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RN+EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHG+++R+TVQ+C
Sbjct  1    MATRNIEKMASIDAQLRLLAPRKVSDDDKLVEYDALLLDRFLDILQDLHGQDIRQTVQDC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG H+ +KLEELGN+LT LD GDSIVI+KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGNHESEKLEELGNMLTGLDAGDSIVISKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  -LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
             LKKGDF DENSAITESDIEETL RLV ++KK+P+EVFDAL
Sbjct  121  LLKKGDFADENSAITESDIEETLKRLVTELKKTPEEVFDAL  161



>dbj|BAC41248.1| phosphoenolpyruvate carboxylase [Glycine max]
Length=967

 Score =   269 bits (688),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQ    ENL+ETVQE 
Sbjct  1    MATRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQGFTWENLKETVQEV  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELGN++TSLD GDSI++AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSILVAKSFSHMLNLANLAEEVQISRRRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DEN+A TESDIEETL +LV D+KKSPQEVFDAL
Sbjct  121  LKKGDFADENNATTESDIEETLKKLVFDLKKSPQEVFDAL  160



>ref|XP_009135413.1| PREDICTED: phosphoenolpyruvate carboxylase 3 [Brassica rapa]
Length=967

 Score =   269 bits (687),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 147/161 (91%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RN+EKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAGRNIEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YELSAEYEG+ +PKKLEELG VLTSLD GDSIVI+K+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YELSAEYEGKREPKKLEELGKVLTSLDAGDSIVISKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDFVDE+SA TESDIEET  RLV D+ KSP+E+FDAL
Sbjct  121  KLKKGDFVDESSAATESDIEETFKRLVSDLGKSPEEIFDAL  161



>ref|XP_010915515.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Elaeis guineensis]
Length=965

 Score =   269 bits (687),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            M+  +LE+ AS+DAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGE +RETVQEC
Sbjct  1    MSKNSLERHASVDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGEEIRETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYE + DPKKL+ELGNV TSLDPGDSIV++ SFSHMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEQKQDPKKLDELGNVFTSLDPGDSIVVSSSFSHMLNLANLAEEVQIAHRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
             KKGDF DENSA TESDIEET  RLV  +KKSPQEVFDAL
Sbjct  121  RKKGDFADENSATTESDIEETFKRLVGQLKKSPQEVFDAL  160



>gb|AAO25631.1| phosphoenolpyruvate carboxylase [Oryza sativa Indica Group]
Length=964

 Score =   268 bits (686),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  120  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  299
            A  +EKMASIDAQLR+L P   SEDDKLVEYDALLLDRFLDILQDLHG++LRE VQECYE
Sbjct  2    AGKVEKMASIDAQLRMLAPAHRSEDDKLVEYDALLLDRFLDILQDLHGDDLREMVQECYE  61

Query  300  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  479
            ++AEYEG+HD +KL+ELGN+LTSLDPGDSIV+AK+FSHMLNLANLAEEVQIAYRRR KLK
Sbjct  62   IAAEYEGKHDSQKLDELGNMLTSLDPGDSIVMAKAFSHMLNLANLAEEVQIAYRRRIKLK  121

Query  480  KGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KGDF DENSA+TESDIEET  RLVVD+KKSP EVFDAL
Sbjct  122  KGDFADENSALTESDIEETFKRLVVDLKKSPAEVFDAL  159



>ref|XP_003527347.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Glycine max]
 gb|KHN33958.1| Phosphoenolpyruvate carboxylase 2 [Glycine soja]
Length=966

 Score =   268 bits (685),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 147/161 (91%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            M  RN EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHG+++RETVQ+C
Sbjct  1    MGTRNFEKMASIDAQLRLLAPSKVSDDDKLVEYDALLLDRFLDILQDLHGDDIRETVQDC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+++P+KLEELGN+LT LD GDSIVI+KSF+HMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGQNNPQKLEELGNMLTGLDAGDSIVISKSFAHMLNLANLAEEVQIAYRRRIK  120

Query  474  -LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
             LKKGDF DENSAITESDIEET  RLV  +KK+PQE+FDAL
Sbjct  121  LLKKGDFADENSAITESDIEETFKRLVNQLKKTPQEIFDAL  161



>gb|ABY87944.1| phosphoenolpyruvate carboxylase [Arachis hypogaea]
Length=968

 Score =   268 bits (685),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 148/163 (91%), Gaps = 3/163 (2%)
 Frame = +3

Query  114  MAA--RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQ  287
            MAA  RN+EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHGE++R+TVQ
Sbjct  1    MAATSRNIEKMASIDAQLRLLAPRKVSDDDKLVEYDALLLDRFLDILQDLHGEDIRQTVQ  60

Query  288  ECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR  467
            +CYELSAEYEG+H  +KLEELGN+LT LD GDSIVIAKSFSHMLNLANLAEEVQIAYRRR
Sbjct  61   DCYELSAEYEGKHKTEKLEELGNMLTGLDAGDSIVIAKSFSHMLNLANLAEEVQIAYRRR  120

Query  468  QK-LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
             K LKKGDF DEN AITESDIEET  RLV ++KKSPQEVFDAL
Sbjct  121  IKLLKKGDFADENPAITESDIEETFKRLVTELKKSPQEVFDAL  163



>tpg|DAA61011.1| TPA: phosphoenolpyruvate carboxylase4 [Zea mays]
Length=967

 Score =   268 bits (685),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  129  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  308
            +E+++SIDAQLR+LVPGKVSEDDKL+EYDALLLDRFLDILQDLHG++L+E VQECYE++A
Sbjct  8    MERLSSIDAQLRMLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGDDLKEMVQECYEVAA  67

Query  309  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  488
            EYE +HD +KL+ELG ++TSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct  68   EYETKHDLQKLDELGKMITSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIKLKKGD  127

Query  489  FVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            F DENSAITESDIEETL RLVVD+KKSP EVFDAL
Sbjct  128  FADENSAITESDIEETLKRLVVDLKKSPAEVFDAL  162



>gb|ACN32213.1| phosphoenolpyruvate carboxylase [Arachis hypogaea]
Length=966

 Score =   268 bits (685),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  120  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  299
            A+ LEKMASIDAQLR LVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE YE
Sbjct  2    AKKLEKMASIDAQLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEVYE  61

Query  300  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  479
            LSAEYEG+HD KKL+ELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR KLK
Sbjct  62   LSAEYEGKHDSKKLDELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRIKLK  121

Query  480  KGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KGDF DEN+A TESDIEETL +LVV++KKSPQEVF+AL
Sbjct  122  KGDFADENNATTESDIEETLKKLVVELKKSPQEVFEAL  159



>ref|XP_002462179.1| hypothetical protein SORBIDRAFT_02g021090 [Sorghum bicolor]
 gb|EER98700.1| hypothetical protein SORBIDRAFT_02g021090 [Sorghum bicolor]
Length=967

 Score =   268 bits (684),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  129  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  308
            +E+++SIDAQLR+LVPGKVSEDDKL+EYDALLLDRFLDILQDLHG++L+E VQECYE++A
Sbjct  8    MERLSSIDAQLRMLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGDDLKEMVQECYEVAA  67

Query  309  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  488
            EYE +HD +KL+ELG ++TSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct  68   EYETKHDLQKLDELGKMITSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIKLKKGD  127

Query  489  FVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            F DENSAITESDIEETL RLVVD+KKSP EVFDAL
Sbjct  128  FADENSAITESDIEETLKRLVVDLKKSPAEVFDAL  162



>sp|P29194.1|CAPP2_SORBI RecName: Full=Phosphoenolpyruvate carboxylase 2; Short=PEPC 2; 
Short=PEPCase 2; AltName: Full=CP28 [Sorghum bicolor]
 emb|CAA42549.1| phosphoenolpyruvate carboxylase [Sorghum bicolor]
Length=960

 Score =   268 bits (684),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  129  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  308
            +E+++SIDAQLR+LVPGKVSEDDKL+EYDALLLDRFLDILQDLHG++L+E VQECYE++A
Sbjct  1    MERLSSIDAQLRMLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGDDLKEMVQECYEVAA  60

Query  309  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  488
            EYE +HD +KL+ELG ++TSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct  61   EYETKHDLQKLDELGKMITSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIKLKKGD  120

Query  489  FVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            F DENSAITESDIEETL RLVVD+KKSP EVFDAL
Sbjct  121  FADENSAITESDIEETLKRLVVDLKKSPAEVFDAL  155



>sp|P51063.1|CAPP_PICAB RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Picea abies]
 emb|CAA55700.1| phosphoenolpyruvate carboxylase [Picea abies]
Length=963

 Score =   267 bits (683),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA  NLEKMASIDAQ+RLLVPGKVSEDDKL+EYDALLLDRFLDILQDLHGE++R  VQEC
Sbjct  1    MARNNLEKMASIDAQMRLLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDIRAMVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YE S EYEG++DP KLEELGNVLTSLDPGDSIV+A SFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YERSGEYEGKNDPHKLEELGNVLTSLDPGDSIVVASSFSHMLNLANLAEEVQIAYRRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            +K+G F DE++A TESDIEET  RLV  + KSP EVFDAL
Sbjct  121  IKRGGFADESNATTESDIEETFKRLVNQLGKSPAEVFDAL  160



>ref|XP_010924612.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Elaeis guineensis]
Length=966

 Score =   267 bits (683),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            M+  +LE+ AS+DAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC
Sbjct  1    MSKNSLERHASVDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEY  + D KKL ELGNVLTSLDPGDSIV+A SFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYGRKQDLKKLGELGNVLTSLDPGDSIVVASSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKG F DEN A TESDIEETL RLVV +KKSP EVFDAL
Sbjct  121  LKKGYFADENCATTESDIEETLKRLVVQLKKSPAEVFDAL  160



>gb|AAU07999.1| phosphoenolpyruvate carboxylase 4 [Lupinus albus]
Length=968

 Score =   267 bits (683),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = +3

Query  123  RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYEL  302
            RN+EKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L++TVQE YEL
Sbjct  5    RNMEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKDTVQEVYEL  64

Query  303  SAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKK  482
            S++YEG+HDPKKLEE+GNV+TSLD GDSIV+AKSFSHMLNLANLAEEVQI++RRR KLKK
Sbjct  65   SSQYEGKHDPKKLEEIGNVITSLDAGDSIVVAKSFSHMLNLANLAEEVQISHRRRNKLKK  124

Query  483  GDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            G+F DE +A TESDIEETL RLV D+KKSP EVFDAL
Sbjct  125  GNFADETNATTESDIEETLKRLVFDLKKSPHEVFDAL  161



>ref|XP_010277028.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Nelumbo nucifera]
Length=964

 Score =   267 bits (683),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  120  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  299
            ARNLEK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE YE
Sbjct  2    ARNLEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEVYE  61

Query  300  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  479
            LSAEYE  HDP+KL+ELG VLTSLD GDSIV+ K+FSHMLNLANLAEEVQIAYRRR + K
Sbjct  62   LSAEYERNHDPQKLDELGKVLTSLDAGDSIVLTKAFSHMLNLANLAEEVQIAYRRRTRQK  121

Query  480  KGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KGDF DE++A TESDIEETL RLVV +KKSP+EVFDAL
Sbjct  122  KGDFHDESNATTESDIEETLKRLVVQLKKSPEEVFDAL  159



>ref|XP_010465426.1| PREDICTED: phosphoenolpyruvate carboxylase 3-like [Camelina sativa]
Length=968

 Score =   267 bits (682),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 149/161 (93%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RN+EKMASIDAQLR LVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAGRNVEKMASIDAQLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YELSAEYEG+ +PKKLEELG++LTSLD GDSIVI+K+FSHMLNLANLAEEVQIA+RRR +
Sbjct  61   YELSAEYEGKREPKKLEELGSLLTSLDAGDSIVISKAFSHMLNLANLAEEVQIAHRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDFVDE+SA TESDIEET  RLV D+ KSP+E+FDAL
Sbjct  121  KLKKGDFVDESSATTESDIEETFKRLVSDLGKSPEEIFDAL  161



>ref|XP_010502354.1| PREDICTED: phosphoenolpyruvate carboxylase 3 [Camelina sativa]
Length=968

 Score =   267 bits (682),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 149/161 (93%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RN+EKMASIDAQLR LVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAGRNVEKMASIDAQLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YELSAEYEG+ +PKKLEELG++LTSLD GDSIVI+K+FSHMLNLANLAEEVQIA+RRR +
Sbjct  61   YELSAEYEGKREPKKLEELGSLLTSLDAGDSIVISKAFSHMLNLANLAEEVQIAHRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDFVDE+SA TESDIEET  RLV D+ KSP+E+FDAL
Sbjct  121  KLKKGDFVDESSATTESDIEETFKRLVSDLGKSPEEIFDAL  161



>emb|CAC83481.1| phosphoenolpyruvate carboxylase [Phalaenopsis equestris]
Length=965

 Score =   266 bits (681),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            M+   +E+ ASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQ++HGE++RETVQEC
Sbjct  1    MSRSTVERHASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQEIHGEDIRETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYE  HD KKLEELG+VLTSLDPGDSIV+AKSFS+MLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEATHDSKKLEELGHVLTSLDPGDSIVVAKSFSNMLNLANLAEEVQIAFRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDFVDENSA TESDIEETL RLV ++KKSP+EVFDAL
Sbjct  121  LKKGDFVDENSAATESDIEETLRRLVHELKKSPEEVFDAL  160



>emb|CAC83482.1| phosphoenolpyruvate carboxylase [Phalaenopsis amabilis]
Length=965

 Score =   266 bits (681),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            M+   +E+ ASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQ++HGE++RETVQEC
Sbjct  1    MSRSTVERHASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQEIHGEDIRETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYE  HD KKLEELG+VLTSLDPGDSIV+AKSFS+MLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEATHDSKKLEELGHVLTSLDPGDSIVVAKSFSNMLNLANLAEEVQIAFRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDFVDENSA TESDIEETL RLV ++KKSP+EVFDAL
Sbjct  121  LKKGDFVDENSAATESDIEETLRRLVHELKKSPEEVFDAL  160



>gb|ACO48250.1| phosphoenolpyruvate carboxylase [Arachis hypogaea]
Length=966

 Score =   266 bits (681),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 145/161 (90%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA + +EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHG ++RETVQ+C
Sbjct  1    MATKKVEKMASIDAQLRLLAPSKVSDDDKLVEYDALLLDRFLDILQDLHGLDIRETVQDC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG +DP KLEELGN+LT LD GDSIV+AKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGENDPHKLEELGNMLTGLDAGDSIVVAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  -LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
             LKKGDFVDENSAITESD+EET  RLV  M K+PQEVFDAL
Sbjct  121  LLKKGDFVDENSAITESDLEETFKRLVNQMNKTPQEVFDAL  161



>gb|AAU07998.1| phosphoenolpyruvate carboxylase 3 [Lupinus albus]
Length=968

 Score =   266 bits (681),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +3

Query  123  RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYEL  302
            RN+EKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ TVQ+ YEL
Sbjct  5    RNMEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKNTVQDVYEL  64

Query  303  SAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKK  482
            S+EYEG+HDPKKLEE+GN +TSLD GDSIV+AKSFSHMLNLANLAEEVQI++RRR KLKK
Sbjct  65   SSEYEGKHDPKKLEEIGNAITSLDAGDSIVVAKSFSHMLNLANLAEEVQISHRRRNKLKK  124

Query  483  GDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            G+F DE +A TESDIEETL RLV D+KKSPQEVFDAL
Sbjct  125  GNFADETNATTESDIEETLKRLVFDLKKSPQEVFDAL  161



>emb|CDP15935.1| unnamed protein product [Coffea canephora]
Length=968

 Score =   266 bits (680),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RN+EKMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDI QDLHGE +RETVQ+C
Sbjct  1    MATRNIEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDIFQDLHGEEIRETVQDC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYE + DP+KL+ELG +LTSLD GDSIV+AKSFS+MLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYERKRDPQKLDELGRMLTSLDAGDSIVVAKSFSNMLNLANLAEEVQIAYRRRSK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKK DF DE SA TESDIEETL RLV  +KKSP+EVFDAL
Sbjct  121  LKKRDFSDEASATTESDIEETLKRLVGQLKKSPEEVFDAL  160



>emb|CDY45929.1| BnaC06g09980D [Brassica napus]
Length=838

 Score =   264 bits (674),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 146/161 (91%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            M    LEKMAS+D  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MPHGKLEKMASMDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YE SAEYEG+H+PKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDFVDE+SA TESD+EET  +LV D+ KSP+E+FDAL
Sbjct  121  KLKKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDAL  161



>gb|AAK58637.1|AF271163_1 phosphoenolpyruvate carboxylase isoform 3 [Hydrilla verticillata]
Length=970

 Score =   266 bits (679),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 144/162 (89%), Gaps = 3/162 (2%)
 Frame = +3

Query  117  AARN---LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQ  287
             ARN   LE+MAS+DAQLR+L P KVSEDD LVEYDALLLDRFL+ILQDLHGE+LRETVQ
Sbjct  4    TARNPNHLERMASVDAQLRMLAPSKVSEDDNLVEYDALLLDRFLEILQDLHGEDLRETVQ  63

Query  288  ECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR  467
             CYELSAEYE   DP+KLEELGN+LTSLDPGDSIV+A SFSHMLNL NLAEEVQIA+RRR
Sbjct  64   SCYELSAEYESTLDPQKLEELGNMLTSLDPGDSIVVASSFSHMLNLGNLAEEVQIAFRRR  123

Query  468  QKLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
             KLKKGDF DENSA TESDIEETL +LVV +KKSPQEVFDAL
Sbjct  124  IKLKKGDFADENSAATESDIEETLKKLVVQLKKSPQEVFDAL  165



>gb|AAK58635.2|AF271161_1 phosphoenolpyruvate carboxylase isoform 1 [Hydrilla verticillata]
Length=970

 Score =   266 bits (679),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 144/162 (89%), Gaps = 3/162 (2%)
 Frame = +3

Query  117  AARN---LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQ  287
             ARN   LE+MAS+DAQLR+L P KVSEDD LVEYDALLLDRFL+ILQDLHGE+LRETVQ
Sbjct  4    TARNPNHLERMASVDAQLRMLAPSKVSEDDNLVEYDALLLDRFLEILQDLHGEDLRETVQ  63

Query  288  ECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR  467
             CYELSAEYE   DP+KLEELGN+LTSLDPGDSIV+A SFSHMLNL NLAEEVQIA+RRR
Sbjct  64   SCYELSAEYESTLDPQKLEELGNMLTSLDPGDSIVVASSFSHMLNLGNLAEEVQIAFRRR  123

Query  468  QKLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
             KLKKGDF DENSA TESDIEETL +LVV +KKSPQEVFDAL
Sbjct  124  IKLKKGDFADENSAATESDIEETLKKLVVQLKKSPQEVFDAL  165



>gb|AAK58636.1|AF271162_1 phosphoenolpyruvate carboxylase isoform 2 [Hydrilla verticillata]
Length=968

 Score =   265 bits (678),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 145/163 (89%), Gaps = 3/163 (2%)
 Frame = +3

Query  114  MAARN---LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETV  284
            MAARN   +E+MAS+DAQLR+L P KVSEDD LVEYDALLLDRFLDILQDLHGE+LRETV
Sbjct  1    MAARNSNHVERMASVDAQLRMLAPSKVSEDDNLVEYDALLLDRFLDILQDLHGEDLRETV  60

Query  285  QECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRR  464
            Q CYELSAEYE   +P+KLEELG +LTSLDPGDSIV+A SFSHMLNL NLAEEVQIA+RR
Sbjct  61   QSCYELSAEYESTLNPEKLEELGKMLTSLDPGDSIVVASSFSHMLNLGNLAEEVQIAFRR  120

Query  465  RQKLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            R KLKKGDF DENSA TESDIEETL ++VV +KKSPQEVFDAL
Sbjct  121  RIKLKKGDFADENSATTESDIEETLRKMVVQLKKSPQEVFDAL  163



>ref|XP_003596385.1| Phosphoenolpyruvate-carboxylase [Medicago truncatula]
 gb|AES66636.1| phosphoenolpyruvate carboxylase [Medicago truncatula]
Length=966

 Score =   265 bits (678),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  120  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  299
            A  +EKMASIDAQLR LVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+++VQE YE
Sbjct  2    ANKMEKMASIDAQLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKDSVQEVYE  61

Query  300  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  479
            LSAEYE +HDPKKLEELGN++TS D GDSIV+AKSFSHMLNLANLAEEVQIA+RRR KLK
Sbjct  62   LSAEYERKHDPKKLEELGNLITSFDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNKLK  121

Query  480  KGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KGDF DE++A TESDIEETL +LV DMKKSPQEVFDAL
Sbjct  122  KGDFRDESNATTESDIEETLKKLVFDMKKSPQEVFDAL  159



>ref|NP_001105438.1| phosphoenolpyruvate carboxylase 2 [Zea mays]
 sp|P51059.1|CAPP2_MAIZE RecName: Full=Phosphoenolpyruvate carboxylase 2; Short=PEPC 2; 
Short=PEPCase 2 [Zea mays]
 emb|CAA43709.1| phosphoenolpyruvate carboxylase [Zea mays]
Length=967

 Score =   265 bits (678),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  129  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  308
            +E+++SIDAQLR+LVPGKVSEDDKL+EYDALLLDRFLDILQDLHG++L+E VQECYE++A
Sbjct  8    MERLSSIDAQLRMLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGDDLKEMVQECYEVAA  67

Query  309  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  488
            EYE +HD +KL+ELG ++TSLDPGDSIVIAKS SHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct  68   EYETKHDLQKLDELGKMITSLDPGDSIVIAKSLSHMLNLANLAEEVQIAYRRRIKLKKGD  127

Query  489  FVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            F DENSAITESDIEETL RLVVD+KKSP EVFDAL
Sbjct  128  FADENSAITESDIEETLKRLVVDLKKSPAEVFDAL  162



>sp|Q02735.1|CAPP_MEDSA RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Medicago sativa]
 gb|AAB46618.1| phosphoenolpyruvate carboxylase [Medicago sativa]
 gb|AAB41903.1| phosphoenolpyruvate carboxylase [Medicago sativa]
Length=966

 Score =   265 bits (678),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  120  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  299
            A  +EKMASIDAQLR LVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+++VQE YE
Sbjct  2    ANKMEKMASIDAQLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKDSVQEVYE  61

Query  300  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  479
            LSAEYE +HDPKKLEELGN++TS D GDSIV+AKSFSHMLNLANLAEEVQIA+RRR KLK
Sbjct  62   LSAEYERKHDPKKLEELGNLITSFDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNKLK  121

Query  480  KGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KGDF DE++A TESDIEETL +LV DMKKSPQEVFDAL
Sbjct  122  KGDFRDESNATTESDIEETLKKLVFDMKKSPQEVFDAL  159



>ref|XP_009795584.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Nicotiana sylvestris]
Length=964

 Score =   265 bits (677),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  120  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  299
            +R +EKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQECYE
Sbjct  2    SRKIEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQECYE  61

Query  300  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  479
            LSAEYEG+HDP+KLEELG +LTSLD GDSIV+ K+FS+MLNLANLAEEVQIAYRRR KLK
Sbjct  62   LSAEYEGKHDPQKLEELGRMLTSLDAGDSIVVTKAFSNMLNLANLAEEVQIAYRRRSKLK  121

Query  480  KGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            K DF DE SA+TESDIEETL +LV  + KSPQEVFDAL
Sbjct  122  KRDFSDEASALTESDIEETLRKLVGQLNKSPQEVFDAL  159



>ref|XP_004956559.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Setaria italica]
Length=967

 Score =   265 bits (677),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  129  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  308
            +E+++SIDAQLR+LVPGKVSEDDKL+EYDALLLDRFLDILQDLHG++L+E VQECYE++A
Sbjct  8    VERLSSIDAQLRMLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGDDLKEMVQECYEVAA  67

Query  309  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  488
            EYE +HD +KL+ELG ++TSLDPGDSIV+AK+FSHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct  68   EYETKHDLQKLDELGKMITSLDPGDSIVMAKAFSHMLNLANLAEEVQIAYRRRIKLKKGD  127

Query  489  FVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            F DENSAITESDIEETL RLVVD+KKSP EVFDAL
Sbjct  128  FADENSAITESDIEETLKRLVVDLKKSPAEVFDAL  162



>emb|CDY25721.1| BnaC03g69540D [Brassica napus]
Length=891

 Score =   264 bits (675),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 146/161 (91%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            M    LEKMAS+D  LR LVPGKVSEDDKLVEYDALLLDRFLDILQ+LHGE+LRETVQE 
Sbjct  1    MPHGKLEKMASMDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQELHGEDLRETVQEL  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YE SAEYEG+H+PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDFVDE+SA TESD+EET  +LV D+ KSP+E+FDAL
Sbjct  121  KLKKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDAL  161



>emb|CAA11415.1| phosphoenolpyruvate carboxylase [Brassica juncea]
Length=964

 Score =   264 bits (675),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 146/161 (91%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            M    LEKMAS+D  LR LVPGKVSEDDKLVEYDALLLDRFLDILQ+LHGE+LRETVQE 
Sbjct  1    MPHGKLEKMASMDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQELHGEDLRETVQEL  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YE SAEYEG+H+PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDFVDE+SA TESD+EET  +LV D+ KSP+E+FDAL
Sbjct  121  KLKKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDAL  161



>ref|XP_004489030.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Cicer arietinum]
Length=966

 Score =   264 bits (675),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  129  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  308
            +EKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE YELSA
Sbjct  5    MEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEVYELSA  64

Query  309  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  488
            EYE  +DPKKLEELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR KLKKGD
Sbjct  65   EYERNYDPKKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNKLKKGD  124

Query  489  FVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            FVDEN+A TESDIEETL +LV  MKK+PQEVFDAL
Sbjct  125  FVDENNATTESDIEETLKKLVFKMKKTPQEVFDAL  159



>ref|XP_009106983.1| PREDICTED: phosphoenolpyruvate carboxylase 1 [Brassica rapa]
 emb|CDY02513.1| BnaA08g01200D [Brassica napus]
Length=964

 Score =   264 bits (675),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 146/161 (91%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            M    LEKMAS+D  LR LVPGKVSEDDKLVEYDALLLDRFLDILQ+LHGE+LRETVQE 
Sbjct  1    MPHGKLEKMASMDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQELHGEDLRETVQEL  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YE SAEYEG+H+PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDFVDE+SA TESD+EET  +LV D+ KSP+E+FDAL
Sbjct  121  KLKKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDAL  161



>ref|XP_009416509.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Musa acuminata 
subsp. malaccensis]
Length=963

 Score =   264 bits (675),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  129  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  308
            +EKMASIDA +RLL PGKVSEDDKLVEYDALLLDRFLDILQDLHG+++RETVQ+ YELSA
Sbjct  4    VEKMASIDAHMRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGDDIRETVQDLYELSA  63

Query  309  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  488
            EYEG+HDP+KL ELGNVLTSLD GD+IV+ KSFSHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct  64   EYEGKHDPEKLVELGNVLTSLDAGDTIVVTKSFSHMLNLANLAEEVQIAYRRRIKLKKGD  123

Query  489  FVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            F DENSAITESDIEETL RLV+ +KKS +EVFDAL
Sbjct  124  FADENSAITESDIEETLKRLVMQLKKSKEEVFDAL  158



>dbj|BAC20365.1| phosphoenolpyruvate carboxylase [Lotus japonicus]
Length=967

 Score =   264 bits (675),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEV  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYE +H+P++LE LGN++TSLD GDSIV+AKSF+HMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYERKHEPQRLEVLGNLITSLDAGDSIVVAKSFAHMLNLANLAEEVQIAHRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DE +A TESDIEET  +LV +MKKSPQEVFD L
Sbjct  121  LKKGDFADEGNATTESDIEETFKKLVGEMKKSPQEVFDEL  160



>gb|ACO48251.1| phosphoenolpyruvate carboxylase [Arachis hypogaea]
Length=969

 Score =   264 bits (674),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQEV  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG+HDPKKLEELG V+TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGKVITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDFVD N+A TESDIEETL +LV+++KKSPQEVFDAL
Sbjct  121  LKKGDFVDVNNATTESDIEETLKKLVLNLKKSPQEVFDAL  160



>emb|CAA11414.1| phosphoenolpyrovate carboxylase [Brassica juncea]
Length=964

 Score =   264 bits (674),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 146/161 (91%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            M    LEKMAS+D  LR LVPGKVSEDDKLVEYDALLLDRFLDILQ+LHGE+LRETVQE 
Sbjct  1    MPHGKLEKMASMDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQELHGEDLRETVQEL  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YE SAEYEG+H+PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDFVDE+SA TESD+EET  +LV D+ KSP+E+FDAL
Sbjct  121  KLKKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDAL  161



>ref|XP_004505496.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Cicer arietinum]
Length=966

 Score =   264 bits (674),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 146/161 (91%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            M +R +EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHG+++RETVQ+C
Sbjct  1    MTSRKIEKMASIDAQLRLLAPSKVSDDDKLVEYDALLLDRFLDILQDLHGDDIRETVQDC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG ++P+KLEELGN+LT LD GDSIVIAKSF+HMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGENNPQKLEELGNMLTGLDAGDSIVIAKSFAHMLNLANLAEEVQIAYRRRIK  120

Query  474  -LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
             LKKGDF DENSAITESDIEETL RLV  +KK+P EVF AL
Sbjct  121  LLKKGDFADENSAITESDIEETLKRLVNQLKKTPHEVFGAL  161



>ref|XP_006348868.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Solanum tuberosum]
Length=964

 Score =   264 bits (674),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  120  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  299
            +R +EKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQECYE
Sbjct  2    SRKIEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQECYE  61

Query  300  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  479
            LSAEYEGRHDP KLEELG +LTSLD GDSIV+ K+FS+MLNL NLAEEVQIAYRRR KLK
Sbjct  62   LSAEYEGRHDPHKLEELGRMLTSLDAGDSIVVTKAFSNMLNLGNLAEEVQIAYRRRSKLK  121

Query  480  KGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            K DF DE SA+TESDIEETL +LV  + KSPQEVFDAL
Sbjct  122  KRDFSDEASALTESDIEETLKKLVGQLNKSPQEVFDAL  159



>ref|XP_011100202.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like [Sesamum indicum]
Length=966

 Score =   263 bits (673),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  120  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  299
            +R +EKMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGE +RETVQ+CYE
Sbjct  2    SRKIEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGEEIRETVQDCYE  61

Query  300  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  479
            +SAEYEG+ DP+KLEELG VLTSLD GDSIV+AKSFS+MLNLANLAEEVQIAYRRR KLK
Sbjct  62   ISAEYEGKRDPQKLEELGRVLTSLDAGDSIVVAKSFSNMLNLANLAEEVQIAYRRRIKLK  121

Query  480  KGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            K DF DE SA TESDIEETL RLV  + K+PQEVFDAL
Sbjct  122  KRDFSDEASATTESDIEETLKRLVGQLNKTPQEVFDAL  159



>ref|XP_010527380.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like [Tarenaya hassleriana]
Length=967

 Score =   263 bits (673),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 147/161 (91%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MAAR LEKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAARKLEKMASIDAQLRQLVPVKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YELSAEYE +HDPKKLEELGNVLT+LDPGD+IVI+K+FSHMLNLANLAE+VQIAY R+ +
Sbjct  61   YELSAEYERKHDPKKLEELGNVLTNLDPGDAIVISKAFSHMLNLANLAEKVQIAYLRKIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KL K  F DENSA TESDIEET  RLVVD+KKSP+EVF+AL
Sbjct  121  KLTKRGFADENSATTESDIEETFKRLVVDLKKSPEEVFEAL  161



>ref|XP_003577980.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Brachypodium distachyon]
Length=968

 Score =   263 bits (673),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = +3

Query  117  AARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECY  296
            A   +E+++SIDAQLR+LVP KVSEDDKL+EYDALLLDRFLD+LQ LHG++LRE VQECY
Sbjct  5    APGKIERLSSIDAQLRMLVPAKVSEDDKLIEYDALLLDRFLDVLQGLHGDDLREMVQECY  64

Query  297  ELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKL  476
            E++AEYE +HD +KL+ELG ++TSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR KL
Sbjct  65   EVAAEYETKHDLQKLDELGEMITSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIKL  124

Query  477  KKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KKGDF +ENSAITESDIEETL RLVVDMKKSP EVFDAL
Sbjct  125  KKGDFAEENSAITESDIEETLKRLVVDMKKSPAEVFDAL  163



>ref|XP_008781416.1| PREDICTED: LOW QUALITY PROTEIN: SCAR-like protein 2 [Phoenix 
dactylifera]
Length=2296

 Score =   268 bits (684),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = +3

Query  114   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
             M+  +LE+ AS+DAQLRLL PGKVSEDD LVEYDALLLDRFLDILQDLHGEN+RETVQEC
Sbjct  1332  MSKNSLERHASVDAQLRLLAPGKVSEDDMLVEYDALLLDRFLDILQDLHGENIRETVQEC  1391

Query  294   YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
             YELSAEY  + D KKL+ELGN LTSLDPGDSIV+A SFSHMLNLANLAEEVQIA+RRR K
Sbjct  1392  YELSAEYGRKQDLKKLDELGNELTSLDPGDSIVVASSFSHMLNLANLAEEVQIAHRRRIK  1451

Query  474   LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
             LKKGDF DENSA TESDIEETL RLVV +KKSPQEVFDAL
Sbjct  1452  LKKGDFADENSAPTESDIEETLKRLVVQLKKSPQEVFDAL  1491



>ref|NP_001267665.1| phosphoenolpyruvate carboxylase 2-like [Cucumis sativus]
 ref|XP_004155470.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Cucumis sativus]
 gb|AFS33791.1| phosphoenolpyruvate carboxylase protein [Cucumis sativus]
 gb|KGN43627.1| Phosphoenolpyruvate carboxylase 1 [Cucumis sativus]
Length=965

 Score =   263 bits (672),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 142/159 (89%), Gaps = 1/159 (1%)
 Frame = +3

Query  117  AARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECY  296
            A +NLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQECY
Sbjct  3    AVKNLEKMASIDAQLRLLAPSKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQECY  62

Query  297  ELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKL  476
            E +AEYE + DP+KLEELGN LTSLDPGDSIV+AKSFSHML+LANLAEEVQIAYRRR KL
Sbjct  63   EFAAEYERKRDPEKLEELGNALTSLDPGDSIVVAKSFSHMLSLANLAEEVQIAYRRRIKL  122

Query  477  KKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KKG F DE +A TESDIEET  RL + + KSPQEVFDAL
Sbjct  123  KKGGFADEANATTESDIEETFKRL-LQLNKSPQEVFDAL  160



>sp|P16097.1|CAPP2_MESCR RecName: Full=Phosphoenolpyruvate carboxylase 2; Short=PEPC 2; 
Short=PEPCase 2 [Mesembryanthemum crystallinum]
 emb|CAA32728.2| phosphoenolpyruvate carboxylase [Mesembryanthemum crystallinum]
Length=960

 Score =   263 bits (672),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 142/153 (93%), Gaps = 1/153 (1%)
 Frame = +3

Query  138  MASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAEYE  317
            MASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQECYE SAEYE
Sbjct  1    MASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQECYERSAEYE  60

Query  318  GRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-QKLKKGDFV  494
            G+HDPKKL+ELG+VLTSLD GDSIV+AKSFSHMLNLANLAEEVQIAYRRR +KLKKGD  
Sbjct  61   GKHDPKKLDELGSVLTSLDAGDSIVVAKSFSHMLNLANLAEEVQIAYRRRIKKLKKGDLS  120

Query  495  DENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            DENSA TESDIEET  RLV ++ KSP+E+FDAL
Sbjct  121  DENSATTESDIEETFKRLVAELGKSPEEIFDAL  153



>emb|CAB59571.1| phosphoenolpyruvate carboxylase [Vanilla planifolia]
Length=335

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +3

Query  144  SIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAEYEGR  323
            SIDAQLRLL P KVSEDDKLVEY ALLLDRFLDILQDLHGE +RETVQE YELSAEYE +
Sbjct  1    SIDAQLRLLAPAKVSEDDKLVEYVALLLDRFLDILQDLHGEVVRETVQELYELSAEYESK  60

Query  324  HDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDEN  503
            HDPKKL+ELGN+L SLDPG+SIVIA SFSHMLNLANLAEEVQIA+RRR KLKKGDF DE 
Sbjct  61   HDPKKLDELGNLLISLDPGNSIVIASSFSHMLNLANLAEEVQIAFRRRIKLKKGDFADEA  120

Query  504  SAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            SA TESD EETL RLV  +KK+PQE+FDAL
Sbjct  121  SATTESDFEETLKRLVGKLKKTPQEIFDAL  150



>ref|XP_009603289.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Nicotiana tomentosiformis]
Length=964

 Score =   263 bits (672),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  120  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  299
            +R +EKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQ CYE
Sbjct  2    SRKIEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQACYE  61

Query  300  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  479
            LSAEYEG+HDP+KLEELG +LTSLD GDSIV+ K+FS+MLNLANLAEEVQIAYRRR KLK
Sbjct  62   LSAEYEGKHDPQKLEELGRMLTSLDAGDSIVVTKAFSNMLNLANLAEEVQIAYRRRSKLK  121

Query  480  KGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            K DF DE SA+TESDIEETL +LV  + KSPQEVFDAL
Sbjct  122  KRDFSDEASALTESDIEETLRKLVGQLNKSPQEVFDAL  159



>gb|EMT08272.1| Phosphoenolpyruvate carboxylase 2 [Aegilops tauschii]
Length=972

 Score =   263 bits (671),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  129  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  308
            +E+++SIDAQLRLLVP KVSEDDKL+EYDALLLDRFLD+LQ LHG++LRE VQECYE++A
Sbjct  13   IERLSSIDAQLRLLVPAKVSEDDKLIEYDALLLDRFLDVLQGLHGDDLREMVQECYEVAA  72

Query  309  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  488
            EYE +HD +KL+ELG ++TSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct  73   EYETKHDLEKLDELGEMITSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRVKLKKGD  132

Query  489  FVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            F DENSAITESDIEETL RLV DMKKSP EVFDAL
Sbjct  133  FADENSAITESDIEETLKRLVFDMKKSPAEVFDAL  167



>dbj|BAJ85327.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK06909.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=972

 Score =   262 bits (670),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  129  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  308
            +E+++SIDAQLRLLVP KVSEDDKL+EYDALLLDRFLD+LQ LHG++LRE VQECYE++A
Sbjct  13   IERLSSIDAQLRLLVPAKVSEDDKLIEYDALLLDRFLDVLQGLHGDDLREMVQECYEVAA  72

Query  309  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  488
            EYE +HD +KL+ELG ++TSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct  73   EYETKHDLEKLDELGEMITSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRVKLKKGD  132

Query  489  FVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            F DENSAITESDIEETL RLV DMKKSP EVFDAL
Sbjct  133  FADENSAITESDIEETLKRLVFDMKKSPAEVFDAL  167



>dbj|BAJ97144.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=972

 Score =   262 bits (670),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  129  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  308
            +E+++SIDAQLRLLVP KVSEDDKL+EYDALLLDRFLD+LQ LHG++LRE VQECYE++A
Sbjct  13   IERLSSIDAQLRLLVPAKVSEDDKLIEYDALLLDRFLDVLQGLHGDDLREMVQECYEVAA  72

Query  309  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  488
            EYE +HD +KL+ELG ++TSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct  73   EYETKHDLEKLDELGEMITSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRVKLKKGD  132

Query  489  FVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            F DENSAITESDIEETL RLV DMKKSP EVFDAL
Sbjct  133  FADENSAITESDIEETLKRLVFDMKKSPAEVFDAL  167



>emb|CAA07610.1| phospoenolpyruvate carboxylase [Triticum aestivum]
Length=972

 Score =   262 bits (670),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  129  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  308
            +E+++SIDAQLRLLVP KVSEDDKL+EYDALLLDRFLD+LQ LHG++LRE VQECYE++A
Sbjct  13   IERLSSIDAQLRLLVPAKVSEDDKLIEYDALLLDRFLDVLQGLHGDDLREMVQECYEVAA  72

Query  309  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  488
            EYE +HD +KL+ELG ++TSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct  73   EYETKHDLEKLDELGEMITSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRVKLKKGD  132

Query  489  FVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            F DENSAITESDIEETL RLV DMKKSP EVFDAL
Sbjct  133  FADENSAITESDIEETLKRLVFDMKKSPAEVFDAL  167



>ref|XP_008455304.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Cucumis melo]
Length=965

 Score =   261 bits (668),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 142/159 (89%), Gaps = 1/159 (1%)
 Frame = +3

Query  117  AARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECY  296
            A +NLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQECY
Sbjct  3    AVKNLEKMASIDAQLRLLAPSKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQECY  62

Query  297  ELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKL  476
            E +AEYE + DP+KLEELG+ LTSLDPGDSIV+AKSFSHML+LANLAEEVQIAYRRR KL
Sbjct  63   EFAAEYERKRDPRKLEELGSALTSLDPGDSIVVAKSFSHMLSLANLAEEVQIAYRRRIKL  122

Query  477  KKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KKG F DE +A TESDIEET  RL + + KSPQEVFDAL
Sbjct  123  KKGGFADEANATTESDIEETFKRL-LQLNKSPQEVFDAL  160



>gb|EPS65212.1| hypothetical protein M569_09565, partial [Genlisea aurea]
Length=289

 Score =   246 bits (628),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +3

Query  129  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  308
            +EK AS+DAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHG+ +RETVQ+CYE+ A
Sbjct  5    IEKTASMDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGDEIRETVQDCYEICA  64

Query  309  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  488
            EY+ + DP+KL+ELG VLT LDPGDSIV+AKSFS+MLNLANLAEEVQIA RRR KLKK D
Sbjct  65   EYQRKRDPRKLDELGEVLTGLDPGDSIVVAKSFSNMLNLANLAEEVQIASRRRIKLKKND  124

Query  489  FVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            F DE SA TESD+EETL RLV  + KSP+EVFDAL
Sbjct  125  FSDEASATTESDLEETLKRLVGQLNKSPEEVFDAL  159



>ref|XP_004243288.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Solanum lycopersicum]
Length=964

 Score =   260 bits (665),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  120  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  299
            +R +EKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQ+CYE
Sbjct  2    SRKIEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQDCYE  61

Query  300  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  479
            LSAEYEG+HDP KLEELG++LTSLD GDSIV+ K+FS+MLNL NLAEEVQIAYRRR KLK
Sbjct  62   LSAEYEGKHDPHKLEELGSMLTSLDAGDSIVVTKAFSNMLNLGNLAEEVQIAYRRRSKLK  121

Query  480  KGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            K DF DE SA+TESDIEET  +LV  + KSPQEVFDAL
Sbjct  122  KRDFSDEASALTESDIEETFKKLVGQLNKSPQEVFDAL  159



>ref|XP_003607582.1| Phosphoenolpyruvate carboxylase [Medicago truncatula]
 gb|AES89779.1| phosphoenolpyruvate carboxylase [Medicago truncatula]
Length=966

 Score =   260 bits (665),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 142/161 (88%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            M +R LEK  SIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHG ++RETVQ C
Sbjct  1    MTSRKLEKTTSIDAQLRLLAPSKVSDDDKLVEYDALLLDRFLDILQDLHGHDIRETVQNC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYEG ++P+KLEELGN+LT LD GDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGNNNPQKLEELGNMLTGLDAGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  474  -LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
             LKKGDF DENSAITESDIEET  RLV  +KK+P EVFDAL
Sbjct  121  LLKKGDFGDENSAITESDIEETFKRLVNQLKKTPLEVFDAL  161



>ref|XP_009380945.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009380946.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Musa acuminata 
subsp. malaccensis]
Length=961

 Score =   260 bits (665),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            M+  +LE+ ASIDAQLRLL PGKVSEDDKLVEYDALL+DRFLDILQ LHGE+LRETVQEC
Sbjct  1    MSRDSLERHASIDAQLRLLAPGKVSEDDKLVEYDALLVDRFLDILQCLHGEDLRETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YE+SA+YEG  DP KL+ELGNVL SLDPGDSI++A SFSHMLNL NLAEEVQIAYRRR +
Sbjct  61   YEISAKYEGTGDPSKLDELGNVLMSLDPGDSILVASSFSHMLNLGNLAEEVQIAYRRRNR  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDFVDEN+A TESDIEETL RLV  + KSP EVFDAL
Sbjct  121  LKKGDFVDENNATTESDIEETLKRLVEQLHKSPLEVFDAL  160



>gb|AHF21553.1| phosphoenolpyruvate carboxylase [Hylocereus undatus]
Length=958

 Score =   260 bits (664),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 144/161 (89%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA   LEK+ASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQ LHGE++RETVQE 
Sbjct  1    MATAKLEKLASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQSLHGEDIRETVQEL  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YE +AEYE   DPKKLEELGN++TSLD GDSIV+ KSF+HMLNLANLAEEVQIA+RRR +
Sbjct  61   YEHAAEYERTRDPKKLEELGNMITSLDAGDSIVVTKSFTHMLNLANLAEEVQIAHRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDFVDE+SAITESDIEETL RLVVD KKSPQEVFD L
Sbjct  121  KLKKGDFVDESSAITESDIEETLRRLVVDFKKSPQEVFDTL  161



>ref|XP_006348299.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Solanum tuberosum]
Length=964

 Score =   260 bits (664),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDIL+DLHGE ++ETVQEC
Sbjct  1    MATRNLEKLASIDAQLRLLVPTKVSEDDKLVEYDALLLDRFLDILEDLHGEGIKETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYE   D KKLEELG+VLTSLDPGDSIV+AKS SHMLN+ANLAEEVQIA   R+K
Sbjct  61   YELSAEYENTRDKKKLEELGSVLTSLDPGDSIVVAKSISHMLNMANLAEEVQIANSGREK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
             KKGDF DE++ +TESDIEETL RLVVD+KKSP+EVF+AL
Sbjct  121  SKKGDFSDESNLMTESDIEETLKRLVVDLKKSPREVFEAL  160



>ref|XP_010524060.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Tarenaya hassleriana]
Length=965

 Score =   259 bits (663),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 147/161 (91%), Gaps = 2/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MAARNLEKMASID QLRLL PGKVSEDDKLVE+DALLLDRFLDILQDLHGE +RE VQEC
Sbjct  1    MAARNLEKMASIDVQLRLLAPGKVSEDDKLVEFDALLLDRFLDILQDLHGEEIREFVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YE++AEY+G+ D +KLEELGN+LTSLDPGDSIV+ KSFS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAAEYDGKRDTEKLEELGNMLTSLDPGDSIVVTKSFSNMLSLANLAEEVQIAYRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDF DE SA TESDIEETL RL + +KKSP+EVFDAL
Sbjct  121  KLKKGDFADEASATTESDIEETLKRL-LQLKKSPEEVFDAL  160



>sp|P51062.1|CAPP_PEA RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Pisum sativum]
 dbj|BAA10902.1| phosphoenolpyruvate carboxylase [Pisum sativum]
Length=967

 Score =   259 bits (661),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  120  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  299
            A  +EKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+++VQE YE
Sbjct  2    ANKMEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKDSVQEVYE  61

Query  300  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  479
            LSAEYE +HDPKKLEELG ++T LD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR KLK
Sbjct  62   LSAEYERKHDPKKLEELGKLITGLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNKLK  121

Query  480  KGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KGDF DE++A TESDIEETL +LV +MKKSPQEVFDAL
Sbjct  122  KGDFRDESNATTESDIEETLKKLVFNMKKSPQEVFDAL  159



>gb|AAD45696.1|AF159051_1 phosphoenolpyruvate carboxylase [Picea abies]
Length=955

 Score =   259 bits (661),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = +3

Query  138  MASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAEYE  317
            MASIDAQ+RLLVPGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RE VQECYE S EYE
Sbjct  1    MASIDAQMRLLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDIREMVQECYERSGEYE  60

Query  318  GRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVD  497
            G++DP KLEELGNVLTSLDPGDSIV+A SFSHMLNLANLAEEVQIAYRRR K+K+G F D
Sbjct  61   GKNDPHKLEELGNVLTSLDPGDSIVVASSFSHMLNLANLAEEVQIAYRRRNKIKRGGFAD  120

Query  498  ENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            E++A TESDIEET  RLV  + KSP EVFDAL
Sbjct  121  ESNATTESDIEETFKRLVNQLGKSPAEVFDAL  152



>ref|XP_004970018.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
isoform X1 [Setaria italica]
 ref|XP_004970019.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
isoform X2 [Setaria italica]
Length=969

 Score =   259 bits (661),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA   ++K  SIDAQLRLL P K+SEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  4    MARNAVDKATSIDAQLRLLAPQKLSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  63

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YEL+AEYE + DPK L+E+GNVLTSLDPGDSIVI KSFSHML LANLAEEVQIAYRRR K
Sbjct  64   YELAAEYESKLDPKMLDEIGNVLTSLDPGDSIVITKSFSHMLILANLAEEVQIAYRRRIK  123

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDFVDENSA TESDIEETL RLV  + KSP EVFDAL
Sbjct  124  LKKGDFVDENSATTESDIEETLNRLVHQLNKSPLEVFDAL  163



>emb|CAA09588.1| phosphoenolpyruvate-carboxylase [Vicia faba]
Length=966

 Score =   259 bits (661),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  120  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  299
            A  +EKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+++VQE YE
Sbjct  2    ANKMEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKDSVQEVYE  61

Query  300  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  479
            LSAEYE +HDPKKLEELG ++T LD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR KLK
Sbjct  62   LSAEYERKHDPKKLEELGKLITGLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNKLK  121

Query  480  KGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KGDF DE++A TES+IEETL RLV +MKKSPQEVFDAL
Sbjct  122  KGDFRDESNATTESNIEETLKRLVFNMKKSPQEVFDAL  159



>gb|EYU41129.1| hypothetical protein MIMGU_mgv1a000842mg [Erythranthe guttata]
Length=966

 Score =   259 bits (661),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  120  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  299
            +R LEKMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHG+ +RETVQ+CYE
Sbjct  2    SRKLEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGDEIRETVQDCYE  61

Query  300  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  479
            +SAEYEG+ DP+KLEELG VLTSLD GDSIV+AKSFS+ML LANLAEEVQIAYRRR KLK
Sbjct  62   ISAEYEGKRDPQKLEELGRVLTSLDAGDSIVVAKSFSNMLTLANLAEEVQIAYRRRIKLK  121

Query  480  KGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            K DF DE SA TES+IEETL RLV ++ K+P+EVFDAL
Sbjct  122  KNDFSDEASATTESNIEETLKRLVGELNKTPEEVFDAL  159



>ref|XP_008655339.1| PREDICTED: uncharacterized protein LOC100384708 isoform X1 [Zea 
mays]
 ref|XP_008655340.1| PREDICTED: uncharacterized protein LOC100384708 isoform X1 [Zea 
mays]
 ref|XP_008655341.1| PREDICTED: uncharacterized protein LOC100384708 isoform X1 [Zea 
mays]
 gb|AFW85037.1| hypothetical protein ZEAMMB73_388983 [Zea mays]
 gb|AFW85038.1| hypothetical protein ZEAMMB73_388983 [Zea mays]
Length=966

 Score =   258 bits (659),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA   ++K  SIDAQLRLL P K+S+DDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MARNAVDKATSIDAQLRLLAPQKLSDDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YEL+AEYE + DPK L+E+GNVLTSLDPGDSIVI KSFSHML LANLAEEVQIAYRRR K
Sbjct  61   YELAAEYENKLDPKMLDEIGNVLTSLDPGDSIVITKSFSHMLILANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDFVDENSA TESDIEETL RL+  +KKSP EVFDAL
Sbjct  121  LKKGDFVDENSATTESDIEETLKRLMHQLKKSPLEVFDAL  160



>sp|P29193.1|CAPP1_SACHY RecName: Full=Phosphoenolpyruvate carboxylase, housekeeping isozyme; 
Short=PEPC; Short=PEPCase [Saccharum sp.]
 pir||S28614 phosphoenolpyruvate carboxylase (EC 4.1.1.31) - sugarcane hybrid 
H32-8560
 gb|AAC33164.1| phosphoenolpyruvate carboxylase [Saccharum hybrid cultivar H32-8560]
Length=966

 Score =   258 bits (658),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA   ++K  SIDAQLRLL P K+S+DDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MARNAVDKATSIDAQLRLLAPQKLSDDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YEL+AEYE + DPK L+E+GNVLTSLDPGDSIVI KSFSHML LANLAEEVQIAYRRR K
Sbjct  61   YELAAEYENKLDPKMLDEIGNVLTSLDPGDSIVITKSFSHMLILANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDFVDENSA TESDIEETL RL+  +KKSP EVFDAL
Sbjct  121  LKKGDFVDENSATTESDIEETLKRLMHQLKKSPLEVFDAL  160



>emb|CAA09807.1| ppc2 [Solanum tuberosum]
Length=964

 Score =   257 bits (657),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDIL+ LHGE ++ETVQEC
Sbjct  1    MATRNLEKLASIDAQLRLLVPTKVSEDDKLVEYDALLLDRFLDILEGLHGEGIKETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYE   D KKLEELG+VLTSLDPGDSIV+AKS SHMLN+ANLAEEVQIA   R+K
Sbjct  61   YELSAEYENTRDKKKLEELGSVLTSLDPGDSIVVAKSISHMLNMANLAEEVQIANSGREK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
             KKGDF DE++ +TESDIEETL RLVVD+KKSP+EVF+AL
Sbjct  121  SKKGDFSDESNLMTESDIEETLKRLVVDLKKSPREVFEAL  160



>gb|AEG78834.1| phosphoenolpyruvate carboxylase [Dendrobium catenatum]
Length=964

 Score =   257 bits (656),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = +3

Query  120  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  299
            ++ +EKMAS+DA LRLL PGKVSEDDKLVEYDALLLDRFL+I+QDLHGEN+RETVQECYE
Sbjct  2    SKGVEKMASMDAHLRLLAPGKVSEDDKLVEYDALLLDRFLEIVQDLHGENIRETVQECYE  61

Query  300  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  479
            LSAEYE +HD KKL+ELG+VLT LDPGDSIV+A SFSHMLNL+NLAEEVQIA RRR K K
Sbjct  62   LSAEYERKHDSKKLDELGSVLTGLDPGDSIVVASSFSHMLNLSNLAEEVQIATRRRIKPK  121

Query  480  KGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KGDF DE SA TESD EET  RLV   KKSPQEVFDAL
Sbjct  122  KGDFADEASATTESDAEETFKRLVGRFKKSPQEVFDAL  159



>ref|XP_006293629.1| hypothetical protein CARUB_v10022582mg [Capsella rubella]
 gb|EOA26527.1| hypothetical protein CARUB_v10022582mg [Capsella rubella]
Length=963

 Score =   256 bits (654),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 147/161 (91%), Gaps = 2/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MAARNLEKMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDVREFVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YE++A+Y+G  + +KLEELGN+LTSLDPGDSIV+ KSFS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAADYDGNRNTEKLEELGNMLTSLDPGDSIVVTKSFSNMLSLANLAEEVQIAYRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDF DE SA TESDIEETL RL + + K+P+EVFDAL
Sbjct  121  KLKKGDFADEASATTESDIEETLKRL-LQLNKTPEEVFDAL  160



>ref|NP_850373.4| phosphoenolpyruvate carboxylase 2 [Arabidopsis thaliana]
 ref|NP_850372.4| phosphoenolpyruvate carboxylase 2 [Arabidopsis thaliana]
 sp|Q5GM68.2|CAPP2_ARATH RecName: Full=Phosphoenolpyruvate carboxylase 2; Short=AtPPC2; 
Short=PEPC 2; Short=PEPCase 2 [Arabidopsis thaliana]
 gb|AEC10145.1| phosphoenolpyruvate carboxylase 2 [Arabidopsis thaliana]
 gb|AEC10146.1| phosphoenolpyruvate carboxylase 2 [Arabidopsis thaliana]
Length=963

 Score =   256 bits (653),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 147/161 (91%), Gaps = 2/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MAARNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDVREFVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YE++A+Y+G  + +KLEELGN+LTSLDPGDSIV+ KSFS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAADYDGNRNTEKLEELGNMLTSLDPGDSIVVTKSFSNMLSLANLAEEVQIAYRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDF DE SA TESDIEETL RL + + K+P+EVFDAL
Sbjct  121  KLKKGDFADEASATTESDIEETLKRL-LQLNKTPEEVFDAL  160



>ref|XP_002881863.1| phosphoenolpyruvate carboxylase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58122.1| phosphoenolpyruvate carboxylase [Arabidopsis lyrata subsp. lyrata]
Length=963

 Score =   256 bits (653),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 147/161 (91%), Gaps = 2/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MAARNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDVREFVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YE++A+Y+G  + +KLEELGN+LTSLDPGDSIV+ KSFS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAADYDGNRNTEKLEELGNMLTSLDPGDSIVVTKSFSNMLSLANLAEEVQIAYRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDF DE SA TESDIEETL RL + + K+P+EVFDAL
Sbjct  121  KLKKGDFADEASATTESDIEETLKRL-LQLNKTPEEVFDAL  160



>emb|CAD58726.1| phosphoenolpyruvate carboxylase [Arabidopsis thaliana]
Length=963

 Score =   256 bits (653),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 147/161 (91%), Gaps = 2/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MAARNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDVREFVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YE++A+Y+G  + +KLEELGN+LTSLDPGDSIV+ KSFS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAADYDGNRNTEKLEELGNMLTSLDPGDSIVVTKSFSNMLSLANLAEEVQIAYRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDF DE SA TESDIEETL RL + + K+P+EVFDAL
Sbjct  121  KLKKGDFADEASATTESDIEETLKRL-LQLNKTPEEVFDAL  160



>gb|AAP43628.1| phosphoenolpyruvate carboxylase [Arabidopsis thaliana]
Length=963

 Score =   256 bits (653),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 147/161 (91%), Gaps = 2/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MAARNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDVREFVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YE++A+Y+G  + +KLEELGN+LTSLDPGDSIV+ KSFS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAADYDGNRNTEKLEELGNMLTSLDPGDSIVVTKSFSNMLSLANLAEEVQIAYRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDF DE SA TESDIEETL RL + + K+P+EVFDAL
Sbjct  121  KLKKGDFADEASATTESDIEETLKRL-LQLNKTPEEVFDAL  160



>emb|CAA60627.1| phosphoenolpyruvate-carboxylase [Vanilla planifolia]
Length=956

 Score =   255 bits (652),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  141  ASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAEYEG  320
            +SIDAQLRLL P KVSEDDKLVEY  LLLDRFLDILQDLHGE +RETVQE YELSAEYE 
Sbjct  3    SSIDAQLRLLAPAKVSEDDKLVEYVRLLLDRFLDILQDLHGEVVRETVQELYELSAEYES  62

Query  321  RHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDE  500
            +HDPKKL+ELGN+L SLDPG+SIVIA SFSHMLNLANLAEEVQIA+RRR KLKKGDFVDE
Sbjct  63   KHDPKKLDELGNLLISLDPGNSIVIASSFSHMLNLANLAEEVQIAHRRRIKLKKGDFVDE  122

Query  501  NSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            NSA TESDIEETL RLV D+KKSP+EVFDAL
Sbjct  123  NSATTESDIEETLKRLVHDLKKSPEEVFDAL  153



>gb|AAD22994.1| phosphoenolpyruvate carboxylase [Arabidopsis thaliana]
Length=941

 Score =   255 bits (651),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 147/161 (91%), Gaps = 2/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MAARNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDVREFVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YE++A+Y+G  + +KLEELGN+LTSLDPGDSIV+ KSFS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAADYDGNRNTEKLEELGNMLTSLDPGDSIVVTKSFSNMLSLANLAEEVQIAYRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDF DE SA TESDIEETL RL + + K+P+EVFDAL
Sbjct  121  KLKKGDFADEASATTESDIEETLKRL-LQLNKTPEEVFDAL  160



>ref|XP_006660531.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Oryza brachyantha]
Length=970

 Score =   255 bits (651),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  129  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  308
            +E+++SIDAQLRLLVP K+SEDDKL+EYDALLLDRFLD+L  LHG++L+E VQECYE++A
Sbjct  11   VERLSSIDAQLRLLVPAKLSEDDKLIEYDALLLDRFLDVLHGLHGDDLKEMVQECYEVAA  70

Query  309  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  488
            EYE +HD +KL+ELGN++TSLD GDSIVIAK+FSHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct  71   EYETKHDLQKLDELGNMITSLDAGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIKLKKGD  130

Query  489  FVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            F DENSAITESDIEETL RLV D+KKSP EVFDAL
Sbjct  131  FADENSAITESDIEETLKRLVFDLKKSPAEVFDAL  165



>ref|XP_010413019.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Camelina sativa]
Length=894

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 146/161 (91%), Gaps = 2/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MAARNLEKMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDVREFVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YE++A+Y+G  +  KLEELGN+LTSLDPGDSIV+ K+FS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAADYDGNRNTDKLEELGNMLTSLDPGDSIVVTKAFSNMLSLANLAEEVQIAYRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDF DE SA TESDIEETL R ++ + K+P+EVFDAL
Sbjct  121  KLKKGDFADEASATTESDIEETLKR-ILQLNKTPEEVFDAL  160



>ref|XP_010508551.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Camelina sativa]
Length=963

 Score =   254 bits (649),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 146/161 (91%), Gaps = 2/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MAARNLEKMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDVREFVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YE++A+Y+G  +  KLEELGN+LTSLDPGDSIV+ K+FS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAADYDGNRNTDKLEELGNMLTSLDPGDSIVVTKAFSNMLSLANLAEEVQIAYRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDF DE SA TESDIEETL RL + + K+P+EVFDAL
Sbjct  121  KLKKGDFADEASATTESDIEETLKRL-LQLNKTPEEVFDAL  160



>ref|XP_006644735.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Oryza brachyantha]
Length=966

 Score =   254 bits (648),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA    +K  SIDAQLR+L P K+SEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MARNAADKATSIDAQLRILAPKKLSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YE +AEYE + DPK+L+ +GNVLT LDPGDSIVI KSFSHML LANLAEEVQIAYRRR K
Sbjct  61   YEFAAEYESKIDPKQLDAIGNVLTRLDPGDSIVITKSFSHMLILANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DENSA TES+ EETL RLV ++KKSPQEVFDAL
Sbjct  121  LKKGDFADENSATTESNFEETLKRLVGELKKSPQEVFDAL  160



>gb|ABG01962.1| phosphoenolpyruvate carboxylase [Sesuvium portulacastrum]
Length=966

 Score =   254 bits (648),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 142/161 (88%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA   LEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQ LHGE +RETVQE 
Sbjct  1    MATGKLEKMASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQSLHGEEIRETVQEL  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YE +AEYE   DPKK+EELGN++TSLD GDSIV+ KSF+HMLNLANLAEEVQIA+RRR +
Sbjct  61   YEHAAEYERTRDPKKMEELGNMVTSLDAGDSIVVTKSFAHMLNLANLAEEVQIAHRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            K KKGDF DE+SAITESDIEETL RLVVD+KKSPQEVF+ L
Sbjct  121  KSKKGDFADESSAITESDIEETLRRLVVDLKKSPQEVFETL  161



>dbj|BAD36412.1| putative phosphoenolpyruvate carboxylase [Oryza sativa Japonica 
Group]
 gb|EAZ44215.1| hypothetical protein OsJ_28834 [Oryza sativa Japonica Group]
Length=972

 Score =   254 bits (648),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  129  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  308
            +E+++SIDAQLR LVP K+SEDDKL+EYDALLLDRFLD+L  LHG++L++ VQECYE++A
Sbjct  13   VERLSSIDAQLRQLVPAKLSEDDKLIEYDALLLDRFLDVLHGLHGDDLKDLVQECYEVAA  72

Query  309  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  488
            EYE +HD +KL+ELGN++TSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct  73   EYETKHDVQKLDELGNMITSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIKLKKGD  132

Query  489  FVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            F DENSA+TESDIEETL RLV D+KKSP EVFDAL
Sbjct  133  FADENSAMTESDIEETLKRLVFDLKKSPAEVFDAL  167



>gb|EAZ08566.1| hypothetical protein OsI_30839 [Oryza sativa Indica Group]
Length=971

 Score =   253 bits (647),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  129  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  308
            +E+++SIDAQLR LVP K+SEDDKL+EYDALLLDRFLD+L  LHG++L++ VQECYE++A
Sbjct  12   VERLSSIDAQLRQLVPAKLSEDDKLIEYDALLLDRFLDVLHGLHGDDLKDLVQECYEVAA  71

Query  309  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  488
            EYE +HD +KL+ELGN++TSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct  72   EYETKHDVQKLDELGNMITSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIKLKKGD  131

Query  489  FVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            F DENSA+TESDIEETL RLV D+KKSP EVFDAL
Sbjct  132  FADENSAMTESDIEETLKRLVFDLKKSPAEVFDAL  166



>gb|EMS60171.1| Phosphoenolpyruvate carboxylase 2 [Triticum urartu]
Length=956

 Score =   252 bits (644),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = +3

Query  78   KSGLWSGADSEKMAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDL  257
            +  L  G  S       L     ++ +LRLLVP KVSEDDKL+EYDALLLDRFLD+LQ L
Sbjct  10   RGTLLVGCKSTSYYLTQLTMSMKLNVKLRLLVPAKVSEDDKLIEYDALLLDRFLDVLQGL  69

Query  258  HGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLA  437
            HG++LRE VQECYE++AEYE +HD +KL+ELG ++TSLDPGDSIVIAK+FSHMLNLANLA
Sbjct  70   HGDDLREMVQECYEVAAEYETKHDLEKLDELGEMITSLDPGDSIVIAKAFSHMLNLANLA  129

Query  438  EEVQIAYRRRQKLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            EEVQIAYRRR KLKKGDF DENSAITESDIEETL RLV DMKKSP EVFDAL
Sbjct  130  EEVQIAYRRRVKLKKGDFADENSAITESDIEETLKRLVFDMKKSPAEVFDAL  181



>gb|KFK37112.1| hypothetical protein AALP_AA4G214300 [Arabis alpina]
Length=963

 Score =   252 bits (643),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 146/161 (91%), Gaps = 2/161 (1%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA R+LEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct  1    MAGRSLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDVREFVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  470
            YE++A+Y+G  + +KLEELGN+LTSLDPGDSIV+ KSFS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAADYDGNRNTEKLEELGNMLTSLDPGDSIVVTKSFSNMLSLANLAEEVQIAYRRRIK  120

Query  471  KLKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            KLKKGDF DE SA TESDIEETL RL + + K+P+EVFDAL
Sbjct  121  KLKKGDFADEASATTESDIEETLKRL-LQLNKTPEEVFDAL  160



>gb|AAD31452.1|AF135371_1 phosphoenol pyruvate carboxylase [Lotus corniculatus]
Length=957

 Score =   251 bits (642),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YELSAEYE +HD +KLEELG V+TSLD GDSIV+AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct  61   YELSAEYERKHDHEKLEELGKVITSLDAGDSIVVAKSFSHMLNLANLAEEVQISRRRRNK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DEN+A TESDIEETL +LV  +KKSPQEVFDAL
Sbjct  121  LKKGDFADENNATTESDIEETLKKLVFKLKKSPQEVFDAL  160



>gb|EEE55407.1| hypothetical protein OsJ_03516 [Oryza sativa Japonica Group]
 dbj|BAP76084.1| phosphoenolpyruvate carboxylase [Oryza sativa Japonica Group]
Length=966

 Score =   251 bits (642),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +3

Query  114  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  293
            MA    +K  SIDAQLR+L P K+SEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MARNAADKGTSIDAQLRILAPKKLSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  294  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  473
            YEL+AEYE + DPK+L+ +GNVLT LDPGDSIV+ KSFSHML LANLAEEVQIAYRRR K
Sbjct  61   YELAAEYESKVDPKQLDAIGNVLTRLDPGDSIVMTKSFSHMLILANLAEEVQIAYRRRIK  120

Query  474  LKKGDFVDENSAITESDIEETLXRLVVDMKKSPQEVFDAL  593
            LKKGDF DENSA TES+ EETL RLV ++KKSP EVFDAL
Sbjct  121  LKKGDFADENSATTESNFEETLKRLVGELKKSPHEVFDAL  160



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 778590373395