BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS018C10

Length=634
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010667351.1|  PREDICTED: L-ascorbate oxidase homolog             310   3e-99   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009623446.1|  PREDICTED: L-ascorbate oxidase homolog             309   7e-99   Nicotiana tomentosiformis
emb|CAA65634.1|  PS60                                                   309   8e-99   Nicotiana tabacum [American tobacco]
ref|XP_008452926.1|  PREDICTED: L-ascorbate oxidase homolog             309   8e-99   Cucumis melo [Oriental melon]
ref|XP_004157080.1|  PREDICTED: L-ascorbate oxidase homolog             308   1e-98   
ref|XP_009785141.1|  PREDICTED: L-ascorbate oxidase homolog             308   2e-98   Nicotiana sylvestris
ref|XP_004145593.1|  PREDICTED: L-ascorbate oxidase homolog             308   2e-98   
gb|KGN55480.1|  hypothetical protein Csa_4G653410                       305   3e-98   Cucumis sativus [cucumbers]
ref|XP_009334388.1|  PREDICTED: L-ascorbate oxidase homolog             305   2e-97   Pyrus x bretschneideri [bai li]
ref|XP_008445302.1|  PREDICTED: L-ascorbate oxidase homolog             304   6e-97   Cucumis melo [Oriental melon]
ref|XP_004142986.1|  PREDICTED: L-ascorbate oxidase homolog             304   7e-97   Cucumis sativus [cucumbers]
ref|XP_008387887.1|  PREDICTED: L-ascorbate oxidase homolog             304   8e-97   Malus domestica [apple tree]
gb|KHN33820.1|  L-ascorbate oxidase like                                303   1e-96   Glycine soja [wild soybean]
ref|XP_006435292.1|  hypothetical protein CICLE_v10000783mg             300   2e-96   
ref|XP_003523207.1|  PREDICTED: L-ascorbate oxidase homolog             303   2e-96   Glycine max [soybeans]
ref|XP_006390228.1|  hypothetical protein EUTSA_v10018373mg             301   3e-96   
ref|XP_010101299.1|  L-ascorbate oxidase-like protein                   302   4e-96   Morus notabilis
ref|XP_006342102.1|  PREDICTED: L-ascorbate oxidase homolog             302   4e-96   Solanum tuberosum [potatoes]
emb|CAB08077.1|  pectinesterase                                         300   5e-96   Solanum lycopersicum
gb|KJB58003.1|  hypothetical protein B456_009G189900                    298   6e-96   Gossypium raimondii
ref|XP_007221787.1|  hypothetical protein PRUPE_ppa003860mg             301   1e-95   Prunus persica
gb|KJB58004.1|  hypothetical protein B456_009G189900                    299   1e-95   Gossypium raimondii
ref|XP_006435293.1|  hypothetical protein CICLE_v10000783mg             301   1e-95   Citrus clementina [clementine]
ref|XP_007136137.1|  hypothetical protein PHAVU_009G021000g             301   1e-95   Phaseolus vulgaris [French bean]
ref|XP_006390229.1|  hypothetical protein EUTSA_v10018373mg             300   2e-95   Eutrema salsugineum [saltwater cress]
ref|XP_010667350.1|  PREDICTED: L-ascorbate oxidase homolog             300   2e-95   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH40258.1|  multi-copper oxidase-like protein                       300   2e-95   Medicago truncatula
ref|XP_004238406.1|  PREDICTED: L-ascorbate oxidase homolog             300   2e-95   
ref|XP_004500896.1|  PREDICTED: L-ascorbate oxidase homolog             300   2e-95   Cicer arietinum [garbanzo]
ref|XP_010428667.1|  PREDICTED: L-ascorbate oxidase homolog             300   3e-95   Camelina sativa [gold-of-pleasure]
ref|XP_007017957.1|  SKU5 similar 5 isoform 3                           296   3e-95   
ref|XP_003550444.1|  PREDICTED: L-ascorbate oxidase homolog             300   3e-95   Glycine max [soybeans]
ref|XP_003527461.1|  PREDICTED: L-ascorbate oxidase homolog             299   6e-95   Glycine max [soybeans]
ref|XP_007017956.1|  SKU5 similar 5 isoform 2                           296   7e-95   
ref|XP_002510630.1|  multicopper oxidase, putative                      299   8e-95   Ricinus communis
ref|XP_010539810.1|  PREDICTED: L-ascorbate oxidase homolog             298   9e-95   Tarenaya hassleriana [spider flower]
gb|KHF99853.1|  L-ascorbate oxidase                                     298   9e-95   Gossypium arboreum [tree cotton]
ref|XP_008221175.1|  PREDICTED: L-ascorbate oxidase homolog             298   9e-95   Prunus mume [ume]
ref|XP_008377105.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    298   1e-94   
ref|XP_007160607.1|  hypothetical protein PHAVU_001G001500g             298   1e-94   Phaseolus vulgaris [French bean]
gb|KJB58002.1|  hypothetical protein B456_009G189900                    298   1e-94   Gossypium raimondii
ref|XP_010471765.1|  PREDICTED: L-ascorbate oxidase homolog             298   1e-94   Camelina sativa [gold-of-pleasure]
ref|XP_010536445.1|  PREDICTED: L-ascorbate oxidase homolog             298   2e-94   Tarenaya hassleriana [spider flower]
gb|KDP36848.1|  hypothetical protein JCGZ_08139                         298   2e-94   Jatropha curcas
ref|XP_004291312.1|  PREDICTED: L-ascorbate oxidase homolog             297   2e-94   Fragaria vesca subsp. vesca
ref|XP_007017955.1|  SKU5 similar 5 isoform 1                           296   4e-94   
ref|XP_006596528.1|  PREDICTED: L-ascorbate oxidase homolog             296   6e-94   Glycine max [soybeans]
ref|XP_006302110.1|  hypothetical protein CARUB_v10020107mg             296   6e-94   Capsella rubella
ref|XP_009128157.1|  PREDICTED: L-ascorbate oxidase homolog             296   7e-94   Brassica rapa
ref|XP_010416527.1|  PREDICTED: L-ascorbate oxidase homolog             296   7e-94   Camelina sativa [gold-of-pleasure]
gb|KFK34458.1|  hypothetical protein AALP_AA5G148000                    296   7e-94   Arabis alpina [alpine rockcress]
emb|CDY68834.1|  BnaCnng60730D                                          296   9e-94   Brassica napus [oilseed rape]
emb|CDY55201.1|  BnaCnng28410D                                          296   9e-94   Brassica napus [oilseed rape]
gb|KJB15896.1|  hypothetical protein B456_002G202300                    292   2e-93   Gossypium raimondii
ref|XP_002306213.1|  hypothetical protein POPTR_0004s18730g             295   2e-93   
ref|XP_002282214.1|  PREDICTED: L-ascorbate oxidase homolog             295   2e-93   Vitis vinifera
ref|NP_177743.1|  SKU5-like 5 protein                                   295   2e-93   Arabidopsis thaliana [mouse-ear cress]
gb|AAL09733.1|  At1g76160/T23E18_10                                     295   2e-93   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007041705.1|  SKU5 similar 5                                     295   2e-93   
gb|AAM97070.1|  pectinesterase, putative                                295   2e-93   Arabidopsis thaliana [mouse-ear cress]
gb|KEH36280.1|  multi-copper oxidase-like protein                       295   3e-93   Medicago truncatula
gb|AFK35121.1|  unknown                                                 294   4e-93   Medicago truncatula
gb|ACJ85585.1|  unknown                                                 294   4e-93   Medicago truncatula
ref|XP_002285913.1|  PREDICTED: L-ascorbate oxidase homolog             294   4e-93   Vitis vinifera
emb|CAN83942.1|  hypothetical protein VITISV_013559                     294   5e-93   Vitis vinifera
ref|XP_002889063.1|  hypothetical protein ARALYDRAFT_895494             294   5e-93   Arabidopsis lyrata subsp. lyrata
ref|XP_004499321.1|  PREDICTED: L-ascorbate oxidase homolog             294   6e-93   Cicer arietinum [garbanzo]
gb|KJB47732.1|  hypothetical protein B456_008G038600                    286   6e-93   Gossypium raimondii
ref|XP_008365718.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    288   8e-93   
ref|XP_011046313.1|  PREDICTED: L-ascorbate oxidase homolog             293   1e-92   Populus euphratica
ref|XP_011099705.1|  PREDICTED: L-ascorbate oxidase homolog             293   1e-92   Sesamum indicum [beniseed]
ref|XP_002300669.1|  multi-copper oxidase type 1 family protein         293   1e-92   Populus trichocarpa [western balsam poplar]
ref|XP_002307765.1|  multi-copper oxidase type 1 family protein         292   2e-92   Populus trichocarpa [western balsam poplar]
ref|XP_011041276.1|  PREDICTED: L-ascorbate oxidase homolog             292   3e-92   Populus euphratica
ref|XP_011034917.1|  PREDICTED: L-ascorbate oxidase homolog             292   4e-92   Populus euphratica
emb|CDX73238.1|  BnaC06g36860D                                          291   4e-92   
gb|AGT57427.1|  ascorbate oxidase                                       291   4e-92   Prunus persica
gb|KHG11003.1|  L-ascorbate oxidase                                     291   4e-92   Gossypium arboreum [tree cotton]
gb|KJB15897.1|  hypothetical protein B456_002G202300                    291   5e-92   Gossypium raimondii
gb|AFK33407.1|  unknown                                                 286   5e-92   Lotus japonicus
ref|XP_002528421.1|  multicopper oxidase, putative                      291   5e-92   
gb|KJB14335.1|  hypothetical protein B456_002G120000                    291   6e-92   Gossypium raimondii
ref|XP_008236098.1|  PREDICTED: L-ascorbate oxidase homolog             291   7e-92   Prunus mume [ume]
ref|XP_007200295.1|  hypothetical protein PRUPE_ppa004000mg             291   7e-92   Prunus persica
ref|XP_010530339.1|  PREDICTED: L-ascorbate oxidase homolog             291   9e-92   Tarenaya hassleriana [spider flower]
gb|ACN50176.1|  pectinesterase                                          290   9e-92   Annona cherimola [cherimoya]
gb|KHF99506.1|  L-ascorbate oxidase                                     290   1e-91   Gossypium arboreum [tree cotton]
gb|KJB47729.1|  hypothetical protein B456_008G038600                    287   1e-91   Gossypium raimondii
gb|KCW55614.1|  hypothetical protein EUGRSUZ_I01478                     287   1e-91   Eucalyptus grandis [rose gum]
ref|XP_009106271.1|  PREDICTED: L-ascorbate oxidase homolog             290   2e-91   Brassica rapa
ref|XP_008382461.1|  PREDICTED: L-ascorbate oxidase homolog             289   3e-91   
ref|XP_010266952.1|  PREDICTED: L-ascorbate oxidase homolog             289   4e-91   Nelumbo nucifera [Indian lotus]
gb|KHG21048.1|  L-ascorbate oxidase                                     289   4e-91   Gossypium arboreum [tree cotton]
ref|XP_002888337.1|  hypothetical protein ARALYDRAFT_475543             288   7e-91   
ref|XP_006486657.1|  PREDICTED: L-ascorbate oxidase homolog             288   8e-91   Citrus sinensis [apfelsine]
gb|KJB59710.1|  hypothetical protein B456_009G268100                    286   8e-91   Gossypium raimondii
ref|XP_010266098.1|  PREDICTED: L-ascorbate oxidase homolog             288   1e-90   Nelumbo nucifera [Indian lotus]
emb|CDX87633.1|  BnaA07g32400D                                          288   1e-90   
ref|XP_006422489.1|  hypothetical protein CICLE_v10028140mg             288   1e-90   Citrus clementina [clementine]
gb|KDP47151.1|  hypothetical protein JCGZ_00042                         288   1e-90   Jatropha curcas
ref|XP_011088669.1|  PREDICTED: L-ascorbate oxidase homolog             287   1e-90   Sesamum indicum [beniseed]
gb|KJB47727.1|  hypothetical protein B456_008G038600                    288   1e-90   Gossypium raimondii
gb|KGN43295.1|  hypothetical protein Csa_7G018770                       285   1e-90   Cucumis sativus [cucumbers]
gb|KJB47731.1|  hypothetical protein B456_008G038600                    287   2e-90   Gossypium raimondii
emb|CDP07321.1|  unnamed protein product                                287   3e-90   Coffea canephora [robusta coffee]
gb|KCW70295.1|  hypothetical protein EUGRSUZ_F03538                     285   3e-90   Eucalyptus grandis [rose gum]
ref|XP_008447902.1|  PREDICTED: L-ascorbate oxidase homolog             287   3e-90   Cucumis melo [Oriental melon]
gb|KEH30610.1|  multi-copper oxidase-like protein                       284   3e-90   Medicago truncatula
ref|XP_007131584.1|  hypothetical protein PHAVU_011G025400g             286   4e-90   Phaseolus vulgaris [French bean]
emb|CDY67479.1|  BnaCnng55180D                                          286   4e-90   Brassica napus [oilseed rape]
emb|CDY35790.1|  BnaA08g04510D                                          286   4e-90   Brassica napus [oilseed rape]
gb|KJB59711.1|  hypothetical protein B456_009G268100                    286   5e-90   Gossypium raimondii
ref|XP_010028797.1|  PREDICTED: L-ascorbate oxidase homolog             286   5e-90   Eucalyptus grandis [rose gum]
ref|XP_009107631.1|  PREDICTED: L-ascorbate oxidase homolog             286   5e-90   Brassica rapa
ref|XP_004144874.1|  PREDICTED: L-ascorbate oxidase homolog             286   7e-90   Cucumis sativus [cucumbers]
ref|XP_006307199.1|  hypothetical protein CARUB_v10008790mg             285   9e-90   Capsella rubella
gb|AAF99833.1|AC008046_5  Putative pectinesterase                       285   1e-89   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564479.1|  SKU5 similar 6                                        285   1e-89   Arabidopsis thaliana [mouse-ear cress]
gb|AAL24296.1|  Unknown protein                                         285   1e-89   Arabidopsis thaliana [mouse-ear cress]
gb|KHG21949.1|  L-ascorbate oxidase                                     285   2e-89   Gossypium arboreum [tree cotton]
ref|XP_010063104.1|  PREDICTED: L-ascorbate oxidase homolog             284   2e-89   Eucalyptus grandis [rose gum]
ref|XP_004290036.1|  PREDICTED: L-ascorbate oxidase homolog             284   3e-89   Fragaria vesca subsp. vesca
ref|XP_004505676.1|  PREDICTED: L-ascorbate oxidase homolog             284   3e-89   Cicer arietinum [garbanzo]
gb|KEH30611.1|  multi-copper oxidase-like protein                       283   5e-89   Medicago truncatula
ref|XP_010103298.1|  L-ascorbate oxidase-like protein                   286   6e-89   
ref|XP_010103300.1|  L-ascorbate oxidase-like protein                   283   7e-89   Morus notabilis
ref|XP_007046384.1|  SKU5 similar 5 isoform 2                           280   9e-89   
ref|XP_010461374.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    283   1e-88   Camelina sativa [gold-of-pleasure]
ref|XP_010500092.1|  PREDICTED: L-ascorbate oxidase homolog             283   1e-88   Camelina sativa [gold-of-pleasure]
gb|EYU38005.1|  hypothetical protein MIMGU_mgv1a004001mg                282   3e-88   Erythranthe guttata [common monkey flower]
ref|XP_006364519.1|  PREDICTED: L-ascorbate oxidase homolog             281   3e-88   Solanum tuberosum [potatoes]
gb|KFK34651.1|  hypothetical protein AALP_AA5G173600                    281   4e-88   Arabis alpina [alpine rockcress]
ref|XP_004253133.1|  PREDICTED: L-ascorbate oxidase homolog             281   4e-88   Solanum lycopersicum
ref|XP_006411628.1|  hypothetical protein EUTSA_v10024832mg             281   5e-88   Eutrema salsugineum [saltwater cress]
gb|KHN05478.1|  L-ascorbate oxidase like                                281   5e-88   Glycine soja [wild soybean]
emb|CDY64276.1|  BnaCnng43630D                                          283   5e-88   Brassica napus [oilseed rape]
ref|XP_006592035.1|  PREDICTED: L-ascorbate oxidase homolog             281   6e-88   Glycine max [soybeans]
ref|XP_010676489.1|  PREDICTED: L-ascorbate oxidase homolog             280   9e-88   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009612547.1|  PREDICTED: L-ascorbate oxidase homolog             280   1e-87   Nicotiana tomentosiformis
gb|EYU36818.1|  hypothetical protein MIMGU_mgv1a004264mg                280   1e-87   Erythranthe guttata [common monkey flower]
ref|XP_009758923.1|  PREDICTED: L-ascorbate oxidase homolog             280   2e-87   Nicotiana sylvestris
ref|XP_004287955.1|  PREDICTED: L-ascorbate oxidase homolog             280   2e-87   Fragaria vesca subsp. vesca
ref|XP_007046383.1|  SKU5 similar 5 isoform 1                           279   2e-87   
ref|XP_003537754.1|  PREDICTED: L-ascorbate oxidase homolog             280   2e-87   Glycine max [soybeans]
ref|XP_003527501.1|  PREDICTED: L-ascorbate oxidase homolog             279   3e-87   Glycine max [soybeans]
ref|XP_009101945.1|  PREDICTED: L-ascorbate oxidase homolog             279   3e-87   Brassica rapa
ref|XP_006342555.1|  PREDICTED: L-ascorbate oxidase homolog             279   3e-87   Solanum tuberosum [potatoes]
emb|CDY54804.1|  BnaA06g40970D                                          281   4e-87   Brassica napus [oilseed rape]
ref|XP_009803721.1|  PREDICTED: L-ascorbate oxidase homolog             279   4e-87   Nicotiana sylvestris
ref|XP_004231076.1|  PREDICTED: L-ascorbate oxidase homolog             278   5e-87   Solanum lycopersicum
ref|XP_002866796.1|  hypothetical protein ARALYDRAFT_490604             277   2e-86   
ref|NP_195555.2|  protein SKU5 similar 9                                276   3e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009413373.1|  PREDICTED: L-ascorbate oxidase homolog             276   4e-86   
ref|XP_004243477.1|  PREDICTED: L-ascorbate oxidase homolog             276   5e-86   Solanum lycopersicum
ref|XP_009596487.1|  PREDICTED: L-ascorbate oxidase homolog             276   6e-86   
ref|XP_010061137.1|  PREDICTED: L-ascorbate oxidase homolog             275   8e-86   Eucalyptus grandis [rose gum]
emb|CAB37498.1|  putative pectinesterase                                275   9e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009794442.1|  PREDICTED: L-ascorbate oxidase homolog             275   1e-85   Nicotiana sylvestris
ref|XP_009758924.1|  PREDICTED: L-ascorbate oxidase homolog             275   1e-85   Nicotiana sylvestris
ref|XP_010918208.1|  PREDICTED: L-ascorbate oxidase homolog             275   1e-85   Elaeis guineensis
gb|AGJ03718.1|  multicopper oxidase                                     274   2e-85   Citrus maxima [buntan]
ref|XP_007215641.1|  hypothetical protein PRUPE_ppa003877mg             273   3e-85   Prunus persica
ref|XP_006447580.1|  hypothetical protein CICLE_v10014842mg             273   4e-85   Citrus clementina [clementine]
ref|XP_009630902.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    273   5e-85   Nicotiana tomentosiformis
ref|NP_173604.1|  SKU5 similar 7 protein                                273   6e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010555198.1|  PREDICTED: L-ascorbate oxidase homolog             273   7e-85   Tarenaya hassleriana [spider flower]
ref|XP_008798222.1|  PREDICTED: L-ascorbate oxidase homolog             273   8e-85   Phoenix dactylifera
ref|XP_009630899.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    273   1e-84   
ref|XP_003540295.1|  PREDICTED: L-ascorbate oxidase homolog             272   1e-84   Glycine max [soybeans]
ref|XP_009630901.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    272   1e-84   Nicotiana tomentosiformis
ref|NP_173603.1|  SKU5 similar 8 protein                                273   1e-84   Arabidopsis thaliana [mouse-ear cress]
emb|CDP10787.1|  unnamed protein product                                272   1e-84   Coffea canephora [robusta coffee]
gb|KDP20733.1|  hypothetical protein JCGZ_21204                         272   1e-84   Jatropha curcas
ref|XP_006283464.1|  hypothetical protein CARUB_v10004509mg             272   1e-84   Capsella rubella
gb|KDP22727.1|  hypothetical protein JCGZ_01829                         272   2e-84   Jatropha curcas
ref|XP_002301616.1|  hypothetical protein POPTR_0002s21400g             272   2e-84   Populus trichocarpa [western balsam poplar]
ref|XP_008455444.1|  PREDICTED: L-ascorbate oxidase homolog             271   2e-84   Cucumis melo [Oriental melon]
ref|XP_010431777.1|  PREDICTED: L-ascorbate oxidase homolog             271   3e-84   Camelina sativa [gold-of-pleasure]
ref|XP_010436936.1|  PREDICTED: L-ascorbate oxidase homolog             271   3e-84   Camelina sativa [gold-of-pleasure]
ref|XP_008791980.1|  PREDICTED: L-ascorbate oxidase homolog             271   4e-84   Phoenix dactylifera
ref|XP_006383902.1|  multi-copper oxidase type 1 family protein         270   6e-84   
ref|XP_008229964.1|  PREDICTED: L-ascorbate oxidase homolog             270   7e-84   Prunus mume [ume]
ref|XP_002272880.1|  PREDICTED: L-ascorbate oxidase homolog             270   7e-84   Vitis vinifera
ref|XP_002893186.1|  hypothetical protein ARALYDRAFT_313077             270   1e-83   Arabidopsis lyrata subsp. lyrata
gb|KJB67219.1|  hypothetical protein B456_010G181000                    268   1e-83   Gossypium raimondii
ref|XP_010046372.1|  PREDICTED: L-ascorbate oxidase homolog             269   2e-83   Eucalyptus grandis [rose gum]
ref|XP_003605947.1|  L-ascorbate oxidase-like protein                   269   2e-83   Medicago truncatula
gb|KJB67218.1|  hypothetical protein B456_010G181000                    268   3e-83   Gossypium raimondii
gb|KGN43515.1|  hypothetical protein Csa_7G043570                       266   4e-83   Cucumis sativus [cucumbers]
ref|XP_009400332.1|  PREDICTED: L-ascorbate oxidase homolog             268   4e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002524823.1|  multicopper oxidase, putative                      268   4e-83   Ricinus communis
ref|XP_011047251.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    268   6e-83   Populus euphratica
gb|ABR18324.1|  unknown                                                 268   7e-83   Picea sitchensis
gb|EAZ02087.1|  hypothetical protein OsI_24168                          267   8e-83   Oryza sativa Indica Group [Indian rice]
gb|EAZ38022.1|  hypothetical protein OsJ_22366                          267   8e-83   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058365.1|  Os06g0678800                                       267   8e-83   
ref|XP_007213899.1|  hypothetical protein PRUPE_ppa003872mg             265   9e-83   
ref|XP_004166771.1|  PREDICTED: L-ascorbate oxidase homolog             267   1e-82   
ref|XP_004144498.1|  PREDICTED: L-ascorbate oxidase homolog             267   1e-82   Cucumis sativus [cucumbers]
ref|XP_007026108.1|  SKU5 similar 4 isoform 1                           267   1e-82   
ref|XP_007026110.1|  SKU5 similar 4 isoform 3                           267   1e-82   
gb|EYU17541.1|  hypothetical protein MIMGU_mgv1a004531mg                266   1e-82   Erythranthe guttata [common monkey flower]
tpg|DAA62867.1|  TPA: hypothetical protein ZEAMMB73_701617              256   2e-82   
ref|XP_004232701.1|  PREDICTED: L-ascorbate oxidase homolog             266   2e-82   Solanum lycopersicum
emb|CDP19581.1|  unnamed protein product                                266   3e-82   Coffea canephora [robusta coffee]
ref|XP_006348131.1|  PREDICTED: L-ascorbate oxidase homolog             266   5e-82   Solanum tuberosum [potatoes]
ref|XP_010089487.1|  L-ascorbate oxidase-like protein                   258   5e-82   
dbj|BAK00459.1|  predicted protein                                      265   5e-82   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004506275.1|  PREDICTED: L-ascorbate oxidase homolog             265   6e-82   
ref|XP_004506310.1|  PREDICTED: L-ascorbate oxidase homolog             265   6e-82   Cicer arietinum [garbanzo]
gb|KHG02352.1|  L-ascorbate oxidase                                     265   6e-82   Gossypium arboreum [tree cotton]
dbj|BAJ91397.1|  predicted protein                                      265   7e-82   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007213900.1|  hypothetical protein PRUPE_ppa003872mg             265   8e-82   Prunus persica
ref|XP_002320467.1|  hypothetical protein POPTR_0014s15260g             265   9e-82   
ref|XP_004253203.1|  PREDICTED: L-ascorbate oxidase homolog             265   1e-81   Solanum lycopersicum
ref|XP_006656379.1|  PREDICTED: L-ascorbate oxidase homolog             264   1e-81   Oryza brachyantha
gb|KFK30447.1|  hypothetical protein AALP_AA7G262200                    264   2e-81   Arabis alpina [alpine rockcress]
ref|XP_010923874.1|  PREDICTED: L-ascorbate oxidase homolog             264   2e-81   Elaeis guineensis
ref|XP_008224692.1|  PREDICTED: L-ascorbate oxidase homolog             264   2e-81   Prunus mume [ume]
ref|XP_008789824.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    260   4e-81   
ref|XP_006342554.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    267   4e-81   
ref|NP_001053555.1|  Os04g0561900                                       263   4e-81   
ref|XP_003563398.1|  PREDICTED: L-ascorbate oxidase homolog             263   4e-81   Brachypodium distachyon [annual false brome]
ref|XP_008384084.1|  PREDICTED: L-ascorbate oxidase homolog             263   4e-81   
ref|XP_008440923.1|  PREDICTED: L-ascorbate oxidase homolog             263   4e-81   Cucumis melo [Oriental melon]
emb|CAH67167.1|  H0211B05.4                                             263   4e-81   Oryza sativa [red rice]
ref|XP_009418785.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    263   5e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418784.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    263   8e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003563038.1|  PREDICTED: L-ascorbate oxidase homolog             261   2e-80   Brachypodium distachyon [annual false brome]
gb|KFK44156.1|  hypothetical protein AALP_AA1G222300                    261   2e-80   Arabis alpina [alpine rockcress]
ref|XP_009397777.1|  PREDICTED: L-ascorbate oxidase homolog             261   3e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002438855.1|  hypothetical protein SORBIDRAFT_10g027270          261   3e-80   Sorghum bicolor [broomcorn]
ref|XP_006657750.1|  PREDICTED: L-ascorbate oxidase homolog             261   3e-80   Oryza brachyantha
ref|XP_010244491.1|  PREDICTED: L-ascorbate oxidase homolog             261   4e-80   Nelumbo nucifera [Indian lotus]
ref|XP_006413696.1|  hypothetical protein EUTSA_v10024862mg             260   4e-80   Eutrema salsugineum [saltwater cress]
ref|XP_010929557.1|  PREDICTED: L-ascorbate oxidase homolog             260   4e-80   Elaeis guineensis
ref|NP_001147597.1|  LOC100281206 precursor                             260   5e-80   Zea mays [maize]
ref|XP_010459724.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    260   5e-80   Camelina sativa [gold-of-pleasure]
gb|KGN64509.1|  hypothetical protein Csa_1G062350                       256   5e-80   Cucumis sativus [cucumbers]
ref|XP_010439384.1|  PREDICTED: L-ascorbate oxidase homolog             260   6e-80   
ref|XP_010448953.1|  PREDICTED: L-ascorbate oxidase homolog             260   6e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010434093.1|  PREDICTED: L-ascorbate oxidase homolog             260   6e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010459725.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    260   6e-80   Camelina sativa [gold-of-pleasure]
ref|XP_008806480.1|  PREDICTED: L-ascorbate oxidase homolog             260   7e-80   Phoenix dactylifera
emb|CDX82897.1|  BnaC01g13470D                                          259   9e-80   
ref|XP_002460757.1|  hypothetical protein SORBIDRAFT_02g034420          259   9e-80   
ref|XP_008789823.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    259   1e-79   Phoenix dactylifera
ref|XP_002269614.1|  PREDICTED: L-ascorbate oxidase homolog             259   1e-79   Vitis vinifera
gb|KEH29685.1|  multi-copper oxidase-like protein                       259   1e-79   Medicago truncatula
ref|XP_009135529.1|  PREDICTED: L-ascorbate oxidase homolog             259   1e-79   Brassica rapa
emb|CDX79120.1|  BnaA01g11870D                                          259   1e-79   
gb|KHG04142.1|  L-ascorbate oxidase                                     259   1e-79   Gossypium arboreum [tree cotton]
ref|XP_003539859.1|  PREDICTED: L-ascorbate oxidase homolog             259   2e-79   Glycine max [soybeans]
ref|XP_008371076.1|  PREDICTED: L-ascorbate oxidase homolog             259   2e-79   
gb|ACL53812.1|  unknown                                                 259   2e-79   Zea mays [maize]
gb|KHN21220.1|  L-ascorbate oxidase like                                258   2e-79   Glycine soja [wild soybean]
ref|XP_006282576.1|  hypothetical protein CARUB_v10004445mg             259   2e-79   
ref|XP_004966212.1|  PREDICTED: L-ascorbate oxidase homolog             259   2e-79   Setaria italica
ref|NP_001152000.1|  L-ascorbate oxidase precursor                      259   2e-79   
ref|XP_004145114.1|  PREDICTED: L-ascorbate oxidase homolog             258   3e-79   
ref|XP_003596958.1|  L-ascorbate oxidase-like protein                   258   3e-79   Medicago truncatula
ref|XP_006855939.1|  hypothetical protein AMTR_s00037p00216460          258   3e-79   Amborella trichopoda
dbj|BAK04971.1|  predicted protein                                      258   3e-79   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010480557.1|  PREDICTED: L-ascorbate oxidase homolog             258   4e-79   Camelina sativa [gold-of-pleasure]
ref|XP_004957823.1|  PREDICTED: L-ascorbate oxidase homolog             258   4e-79   Setaria italica
gb|EMT15848.1|  L-ascorbate oxidase-like protein                        258   5e-79   
ref|XP_007132533.1|  hypothetical protein PHAVU_011G102500g             258   5e-79   Phaseolus vulgaris [French bean]
gb|KJB67220.1|  hypothetical protein B456_010G181000                    256   6e-79   Gossypium raimondii
ref|XP_003549771.1|  PREDICTED: L-ascorbate oxidase homolog             258   6e-79   Glycine max [soybeans]
ref|XP_009359037.1|  PREDICTED: L-ascorbate oxidase homolog             257   8e-79   Pyrus x bretschneideri [bai li]
gb|KFK44289.1|  hypothetical protein AALP_AA1G238900                    245   8e-79   Arabis alpina [alpine rockcress]
ref|NP_193932.1|  protein SKU5 similar 4                                256   1e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869849.1|  hypothetical protein ARALYDRAFT_914433             256   2e-78   Arabidopsis lyrata subsp. lyrata
gb|EEC82126.1|  hypothetical protein OsI_26158                          256   2e-78   Oryza sativa Indica Group [Indian rice]
gb|EEE67250.1|  hypothetical protein OsJ_24405                          256   2e-78   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011096053.1|  PREDICTED: L-ascorbate oxidase homolog             256   2e-78   Sesamum indicum [beniseed]
dbj|BAC83966.1|  putative PS60                                          256   3e-78   Oryza sativa Japonica Group [Japonica rice]
gb|EPS74059.1|  hypothetical protein M569_00695                         256   3e-78   Genlisea aurea
ref|XP_010498473.1|  PREDICTED: L-ascorbate oxidase homolog             256   3e-78   Camelina sativa [gold-of-pleasure]
ref|XP_009408654.1|  PREDICTED: L-ascorbate oxidase homolog             255   3e-78   
gb|KJB50840.1|  hypothetical protein B456_008G189200                    255   4e-78   
ref|XP_010529443.1|  PREDICTED: L-ascorbate oxidase homolog             255   6e-78   
gb|KHN03487.1|  L-ascorbate oxidase like                                255   8e-78   
ref|XP_004987010.1|  PREDICTED: L-ascorbate oxidase homolog             254   1e-77   
ref|XP_009597920.1|  PREDICTED: L-ascorbate oxidase homolog             254   1e-77   
ref|XP_006416404.1|  hypothetical protein EUTSA_v10007361mg             253   1e-77   
gb|EMS52588.1|  L-ascorbate oxidase-like protein                        261   1e-77   
gb|KJB57755.1|  hypothetical protein B456_009G179300                    254   1e-77   
ref|XP_008362259.1|  PREDICTED: L-ascorbate oxidase homolog             254   1e-77   
ref|XP_006416260.1|  hypothetical protein EUTSA_v10007292mg             254   2e-77   
ref|XP_009402574.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    253   2e-77   
ref|XP_006366591.1|  PREDICTED: L-ascorbate oxidase homolog             254   2e-77   
ref|XP_009794440.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    253   3e-77   
tpg|DAA62868.1|  TPA: hypothetical protein ZEAMMB73_701617              244   3e-77   
ref|XP_010323833.1|  PREDICTED: L-ascorbate oxidase homolog             253   3e-77   
gb|KHG03845.1|  L-ascorbate oxidase                                     253   3e-77   
ref|XP_010923873.1|  PREDICTED: L-ascorbate oxidase homolog             253   3e-77   
ref|XP_010278638.1|  PREDICTED: L-ascorbate oxidase homolog             253   4e-77   
ref|XP_010539014.1|  PREDICTED: L-ascorbate oxidase homolog             253   4e-77   
ref|XP_002518462.1|  multicopper oxidase, putative                      252   6e-77   
ref|XP_010690287.1|  PREDICTED: L-ascorbate oxidase homolog             252   7e-77   
ref|XP_002270831.1|  PREDICTED: L-ascorbate oxidase homolog             252   7e-77   
ref|XP_009149524.1|  PREDICTED: L-ascorbate oxidase homolog             252   8e-77   
emb|CBI18560.3|  unnamed protein product                                251   9e-77   
ref|XP_008806482.1|  PREDICTED: L-ascorbate oxidase homolog             251   1e-76   
ref|XP_004164922.1|  PREDICTED: L-ascorbate oxidase homolog             251   1e-76   
ref|XP_004149634.1|  PREDICTED: L-ascorbate oxidase homolog             251   1e-76   
emb|CDY31468.1|  BnaC05g15770D                                          251   2e-76   
ref|XP_009353293.1|  PREDICTED: L-ascorbate oxidase homolog             251   2e-76   
ref|XP_004149637.1|  PREDICTED: L-ascorbate oxidase homolog             251   2e-76   
ref|XP_004487420.1|  PREDICTED: L-ascorbate oxidase homolog             250   3e-76   
ref|XP_009347125.1|  PREDICTED: L-ascorbate oxidase homolog             250   3e-76   
ref|XP_004164925.1|  PREDICTED: L-ascorbate oxidase homolog             250   5e-76   
emb|CDY12788.1|  BnaC07g16450D                                          249   1e-75   
gb|KGN63948.1|  hypothetical protein Csa_1G031720                       247   1e-75   
ref|XP_006838146.1|  hypothetical protein AMTR_s00106p00093220          248   2e-75   
ref|XP_009411781.1|  PREDICTED: L-ascorbate oxidase homolog             248   2e-75   
ref|XP_009103469.1|  PREDICTED: L-ascorbate oxidase homolog             248   2e-75   
emb|CDY01453.1|  BnaA07g12260D                                          248   2e-75   
ref|XP_003538519.1|  PREDICTED: L-ascorbate oxidase homolog             248   3e-75   
ref|XP_004293304.1|  PREDICTED: L-ascorbate oxidase homolog             247   5e-75   
ref|XP_004137383.1|  PREDICTED: L-ascorbate oxidase homolog             248   5e-75   
ref|XP_004165665.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    247   5e-75   
ref|XP_010255119.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    247   5e-75   
ref|XP_004507683.1|  PREDICTED: L-ascorbate oxidase homolog             247   6e-75   
gb|EMS67789.1|  L-ascorbate oxidase-like protein                        248   6e-75   
ref|XP_010255117.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    247   8e-75   
gb|ABK25092.1|  unknown                                                 246   1e-74   
gb|ABK95805.1|  unknown                                                 246   1e-74   
ref|XP_011046956.1|  PREDICTED: L-ascorbate oxidase homolog             246   2e-74   
emb|CDY18626.1|  BnaA09g07690D                                          245   3e-74   
ref|XP_009112343.1|  PREDICTED: L-ascorbate oxidase homolog             245   3e-74   
ref|XP_010263761.1|  PREDICTED: L-ascorbate oxidase homolog             245   3e-74   
ref|XP_008438536.1|  PREDICTED: L-ascorbate oxidase homolog             245   4e-74   
ref|NP_569041.1|  protein SKU5 similar 17                               245   4e-74   
gb|AAM61328.1|  pectinesterase-like protein                             245   4e-74   
dbj|BAB08634.1|  pectinesterase like protein                            244   5e-74   
ref|XP_002866726.1|  predicted protein                                  244   6e-74   
ref|XP_009347241.1|  PREDICTED: L-ascorbate oxidase homolog             244   6e-74   
ref|XP_009348086.1|  PREDICTED: L-ascorbate oxidase homolog             244   7e-74   
emb|CDX81353.1|  BnaC09g07640D                                          244   9e-74   
ref|XP_010044914.1|  PREDICTED: L-ascorbate oxidase homolog             244   1e-73   
ref|XP_006467415.1|  PREDICTED: L-ascorbate oxidase homolog             243   1e-73   
ref|XP_002522337.1|  multicopper oxidase, putative                      243   1e-73   
ref|XP_006449754.1|  hypothetical protein CICLE_v10014825mg             243   2e-73   
ref|XP_009782819.1|  PREDICTED: L-ascorbate oxidase homolog             243   2e-73   
ref|XP_006280268.1|  hypothetical protein CARUB_v10026189mg             243   2e-73   
ref|XP_008440238.1|  PREDICTED: L-ascorbate oxidase homolog             243   2e-73   
ref|XP_006304367.1|  hypothetical protein CARUB_v10010844mg             243   2e-73   
gb|KFK28370.1|  hypothetical protein AALP_AA8G506600                    243   2e-73   
gb|KHN44494.1|  L-ascorbate oxidase like                                243   3e-73   
gb|KGN48499.1|  hypothetical protein Csa_6G490140                       240   3e-73   
ref|XP_010028301.1|  PREDICTED: L-ascorbate oxidase homolog             242   4e-73   
gb|EYU27771.1|  hypothetical protein MIMGU_mgv1a003982mg                242   4e-73   
ref|XP_002310162.1|  multi-copper oxidase type 1 family protein         242   4e-73   
ref|XP_010680450.1|  PREDICTED: L-ascorbate oxidase homolog             242   5e-73   
ref|XP_006393890.1|  hypothetical protein EUTSA_v10003952mg             242   6e-73   
ref|XP_006393891.1|  hypothetical protein EUTSA_v10003952mg             242   6e-73   
ref|XP_009629876.1|  PREDICTED: L-ascorbate oxidase homolog             242   7e-73   
ref|XP_004141928.1|  PREDICTED: L-ascorbate oxidase homolog             241   7e-73   
ref|XP_009115829.1|  PREDICTED: L-ascorbate oxidase homolog             241   9e-73   
emb|CDY43557.1|  BnaC02g16540D                                          241   1e-72   
ref|XP_011013814.1|  PREDICTED: L-ascorbate oxidase homolog             241   1e-72   
gb|KCW55012.1|  hypothetical protein EUGRSUZ_I00988                     242   1e-72   
ref|XP_011039228.1|  PREDICTED: L-ascorbate oxidase homolog             241   1e-72   
ref|XP_010558427.1|  PREDICTED: L-ascorbate oxidase homolog             241   1e-72   
gb|AGE09595.1|  SKU5-like protein                                       240   1e-72   
ref|XP_008338225.1|  PREDICTED: L-ascorbate oxidase homolog             241   2e-72   
ref|XP_010484570.1|  PREDICTED: L-ascorbate oxidase homolog             241   2e-72   
ref|XP_010444713.1|  PREDICTED: L-ascorbate oxidase homolog             241   2e-72   
ref|XP_002867467.1|  hypothetical protein ARALYDRAFT_328883             240   3e-72   
ref|XP_007153964.1|  hypothetical protein PHAVU_003G080100g             240   3e-72   
gb|KDP31876.1|  hypothetical protein JCGZ_12337                         240   3e-72   
gb|KDO79340.1|  hypothetical protein CISIN_1g0092422mg                  238   3e-72   
gb|ABK25324.1|  unknown                                                 239   5e-72   
ref|XP_010547509.1|  PREDICTED: L-ascorbate oxidase homolog             239   5e-72   
ref|XP_007163844.1|  hypothetical protein PHAVU_001G269100g             239   7e-72   
ref|XP_003610452.1|  L-ascorbate oxidase-like protein                   238   1e-71   
ref|XP_009407426.1|  PREDICTED: L-ascorbate oxidase homolog             238   1e-71   
ref|XP_009366415.1|  PREDICTED: L-ascorbate oxidase homolog             238   1e-71   
ref|XP_010263764.1|  PREDICTED: L-ascorbate oxidase homolog             238   2e-71   
gb|EYU39394.1|  hypothetical protein MIMGU_mgv11b015886mg               237   3e-71   
ref|XP_006425823.1|  hypothetical protein CICLE_v10025326mg             237   3e-71   
gb|KCW68031.1|  hypothetical protein EUGRSUZ_F01712                     236   3e-71   
gb|KFK28784.1|  hypothetical protein AALP_AA7G047600                    237   3e-71   
gb|KHN44868.1|  L-ascorbate oxidase like                                235   5e-71   
ref|XP_006657409.1|  PREDICTED: L-ascorbate oxidase homolog             236   6e-71   
ref|XP_010088984.1|  L-ascorbate oxidase-like protein                   236   6e-71   
emb|CDP04415.1|  unnamed protein product                                236   7e-71   
ref|XP_006402152.1|  hypothetical protein EUTSA_v10013200mg             236   8e-71   
ref|XP_003529638.1|  PREDICTED: L-ascorbate oxidase homolog             236   9e-71   
ref|NP_194538.1|  SKU5 similar 10 protein                               235   2e-70   
emb|CAN72538.1|  hypothetical protein VITISV_028749                     236   2e-70   
ref|XP_007208285.1|  hypothetical protein PRUPE_ppa003733mg             235   2e-70   
gb|EEE61490.1|  hypothetical protein OsJ_15776                          235   3e-70   
gb|EPS65321.1|  hypothetical protein M569_09457                         224   5e-70   
ref|XP_010052867.1|  PREDICTED: L-ascorbate oxidase homolog             234   5e-70   
gb|EEC77800.1|  hypothetical protein OsI_16980                          234   6e-70   
ref|XP_008792598.1|  PREDICTED: L-ascorbate oxidase homolog             233   9e-70   
ref|XP_008663511.1|  PREDICTED: L-ascorbate oxidase homolog             233   9e-70   
ref|XP_008241557.1|  PREDICTED: L-ascorbate oxidase homolog             233   1e-69   
ref|XP_006850531.1|  hypothetical protein AMTR_s00159p00040990          233   1e-69   
ref|XP_007204826.1|  hypothetical protein PRUPE_ppa003926mg             233   2e-69   
ref|XP_010433262.1|  PREDICTED: L-ascorbate oxidase homolog             233   2e-69   
ref|XP_010028303.1|  PREDICTED: L-ascorbate oxidase homolog             232   4e-69   
ref|XP_003517277.1|  PREDICTED: L-ascorbate oxidase homolog             231   5e-69   
gb|KHN36198.1|  L-ascorbate oxidase like                                231   5e-69   
ref|XP_007155969.1|  hypothetical protein PHAVU_003G247700g             231   5e-69   
ref|XP_009368021.1|  PREDICTED: L-ascorbate oxidase homolog             231   5e-69   
ref|XP_009348089.1|  PREDICTED: L-ascorbate oxidase homolog             230   1e-68   
ref|XP_002448327.1|  hypothetical protein SORBIDRAFT_06g025300          231   2e-68   
ref|XP_003550084.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    230   2e-68   
ref|XP_010247848.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    230   2e-68   
ref|XP_003524640.1|  PREDICTED: L-ascorbate oxidase homolog             229   2e-68   
ref|XP_010247847.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    230   2e-68   
ref|XP_010247849.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    230   2e-68   
ref|XP_010908384.1|  PREDICTED: L-ascorbate oxidase homolog             229   3e-68   
ref|XP_004229062.1|  PREDICTED: L-ascorbate oxidase homolog             230   3e-68   
ref|XP_009376274.1|  PREDICTED: L-ascorbate oxidase homolog             229   3e-68   
ref|XP_009339220.1|  PREDICTED: L-ascorbate oxidase homolog             229   3e-68   
ref|XP_010093150.1|  L-ascorbate oxidase-like protein                   229   4e-68   
ref|XP_004511977.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    229   4e-68   
ref|NP_001058771.1|  Os07g0119400                                       229   5e-68   
ref|XP_009347247.1|  PREDICTED: L-ascorbate oxidase homolog             229   6e-68   
gb|KGN54012.1|  hypothetical protein Csa_4G267470                       227   9e-68   
ref|XP_004511976.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    228   1e-67   
ref|XP_006341879.1|  PREDICTED: L-ascorbate oxidase homolog             228   1e-67   
ref|XP_009594576.1|  PREDICTED: L-ascorbate oxidase homolog             228   2e-67   
ref|XP_009412658.1|  PREDICTED: L-ascorbate oxidase homolog             227   2e-67   
ref|XP_010271079.1|  PREDICTED: L-ascorbate oxidase homolog             228   2e-67   
gb|KEH20500.1|  multi-copper oxidase-like protein                       227   2e-67   
ref|XP_003537368.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    227   2e-67   
ref|XP_008219681.1|  PREDICTED: L-ascorbate oxidase homolog             227   3e-67   
ref|XP_009777142.1|  PREDICTED: L-ascorbate oxidase homolog             227   3e-67   
ref|XP_004149657.1|  PREDICTED: L-ascorbate oxidase homolog             227   3e-67   
ref|XP_007208287.1|  hypothetical protein PRUPE_ppa003715mg             227   3e-67   
ref|XP_003550083.1|  PREDICTED: L-ascorbate oxidase homolog             227   3e-67   
ref|XP_004164924.1|  PREDICTED: L-ascorbate oxidase homolog             227   4e-67   
ref|XP_002310164.1|  multi-copper oxidase type 1 family protein         226   4e-67   
ref|XP_009387378.1|  PREDICTED: L-ascorbate oxidase homolog             227   4e-67   
ref|XP_011085509.1|  PREDICTED: L-ascorbate oxidase homolog             226   4e-67   
ref|XP_008374029.1|  PREDICTED: L-ascorbate oxidase homolog             227   4e-67   
ref|XP_006848556.1|  hypothetical protein AMTR_s00169p00049950          226   5e-67   
ref|XP_007156841.1|  hypothetical protein PHAVU_002G021900g             226   5e-67   
ref|XP_009773470.1|  PREDICTED: L-ascorbate oxidase homolog             226   5e-67   
ref|XP_010227225.1|  PREDICTED: L-ascorbate oxidase homolog             226   6e-67   
ref|XP_008241558.1|  PREDICTED: L-ascorbate oxidase homolog             226   7e-67   
ref|XP_002522339.1|  multicopper oxidase, putative                      226   9e-67   
ref|XP_011013815.1|  PREDICTED: L-ascorbate oxidase homolog             225   9e-67   
ref|XP_007203632.1|  hypothetical protein PRUPE_ppa003976mg             225   9e-67   
ref|XP_002268020.2|  PREDICTED: L-ascorbate oxidase homolog             225   1e-66   
ref|XP_004955371.1|  PREDICTED: L-ascorbate oxidase homolog             225   1e-66   
ref|XP_009420229.1|  PREDICTED: L-ascorbate oxidase homolog             225   1e-66   
ref|XP_003635547.1|  PREDICTED: L-ascorbate oxidase homolog             225   2e-66   
emb|CAN72539.1|  hypothetical protein VITISV_028750                     224   2e-66   
ref|XP_004232058.1|  PREDICTED: L-ascorbate oxidase homolog             224   3e-66   
ref|XP_010034522.1|  PREDICTED: L-ascorbate oxidase homolog             224   3e-66   
emb|CBI18561.3|  unnamed protein product                                225   3e-66   
ref|XP_008449912.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    224   3e-66   
ref|XP_004233429.1|  PREDICTED: L-ascorbate oxidase homolog             224   3e-66   
ref|XP_008449913.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    224   4e-66   
ref|XP_010680456.1|  PREDICTED: L-ascorbate oxidase homolog             224   4e-66   
emb|CDP02462.1|  unnamed protein product                                224   4e-66   
ref|XP_002459273.1|  hypothetical protein SORBIDRAFT_02g001610          217   4e-66   
gb|KHN42054.1|  L-ascorbate oxidase like                                224   4e-66   
ref|XP_010438504.1|  PREDICTED: L-ascorbate oxidase homolog             224   5e-66   
ref|XP_010686816.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    223   9e-66   
ref|XP_007014661.1|  SKU5 similar 12                                    223   1e-65   
ref|XP_010109886.1|  L-ascorbate oxidase-like protein                   223   1e-65   
gb|KEH20499.1|  multi-copper oxidase-like protein                       223   1e-65   
sp|P29162.1|ASOL_TOBAC  RecName: Full=L-ascorbate oxidase homolog...    223   2e-65   
ref|XP_011039229.1|  PREDICTED: L-ascorbate oxidase homolog             222   2e-65   
ref|XP_010464737.1|  PREDICTED: L-ascorbate oxidase homolog             222   2e-65   
ref|XP_007155970.1|  hypothetical protein PHAVU_003G247800g             222   2e-65   
ref|XP_006338228.1|  PREDICTED: L-ascorbate oxidase homolog             222   2e-65   
ref|XP_009588330.1|  PREDICTED: L-ascorbate oxidase homolog             223   3e-65   
emb|CDX89588.1|  BnaC04g36070D                                          214   3e-65   
ref|XP_004301852.1|  PREDICTED: L-ascorbate oxidase homolog             221   3e-65   
gb|KHM99211.1|  L-ascorbate oxidase like                                221   3e-65   
ref|XP_007014658.1|  SKU5 similar 13                                    222   3e-65   
ref|XP_010070498.1|  PREDICTED: L-ascorbate oxidase homolog             221   5e-65   
ref|XP_010044910.1|  PREDICTED: L-ascorbate oxidase homolog             221   6e-65   
gb|AFK33666.1|  unknown                                                 219   7e-65   
ref|XP_006360232.1|  PREDICTED: L-ascorbate oxidase homolog             221   7e-65   
gb|EYU44359.1|  hypothetical protein MIMGU_mgv1a004187mg                220   8e-65   
gb|EMS54595.1|  L-ascorbate oxidase-like protein                        221   9e-65   
ref|XP_011048128.1|  PREDICTED: L-ascorbate oxidase homolog             221   9e-65   
ref|XP_010034521.1|  PREDICTED: L-ascorbate oxidase homolog             221   9e-65   
ref|XP_002299087.1|  multi-copper oxidase type 1 family protein         220   1e-64   
gb|KDP31875.1|  hypothetical protein JCGZ_12336                         220   1e-64   
ref|XP_006445540.1|  hypothetical protein CICLE_v10018007mg             220   1e-64   
ref|XP_009383852.1|  PREDICTED: L-ascorbate oxidase homolog             220   1e-64   
ref|XP_003557661.2|  PREDICTED: L-ascorbate oxidase homolog             219   2e-64   
emb|CDP02461.1|  unnamed protein product                                219   3e-64   
ref|XP_011099220.1|  PREDICTED: L-ascorbate oxidase homolog             218   4e-64   
ref|XP_009766183.1|  PREDICTED: L-ascorbate oxidase homolog             218   6e-64   
gb|AAQ90182.1|  ntp101                                                  218   7e-64   
ref|XP_004509174.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    218   7e-64   
ref|XP_010673838.1|  PREDICTED: L-ascorbate oxidase homolog             218   8e-64   
ref|XP_004509176.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    218   8e-64   



>ref|XP_010667351.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=539

 Score =   310 bits (793),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F+WN+TY  IYPLGV QQGILINGQFPGP+I  VTNDNL INVFN+LD PFLLS
Sbjct  21   EDPYRFFSWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNNLDVPFLLS  80

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+QNRRNSFEDGVYGTTCPI PG NFTYMLQVKDQIGSFYY+PSLAFHKAAG FGGIR
Sbjct  81   WNGVQNRRNSFEDGVYGTTCPIPPGRNFTYMLQVKDQIGSFYYYPSLAFHKAAGAFGGIR  140

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDP+ D+T LIGDWYKANHT L+  LDNGH+LPPPDGI
Sbjct  141  ILSRPRIPVPFPDPSGDYTVLIGDWYKANHTDLQATLDNGHKLPPPDGI  189



>ref|XP_009623446.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=540

 Score =   309 bits (791),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY TIYPLGVPQQGILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  23   EDPYRFFEWNVTYGTIYPLGVPQQGILINGQFPGPDIYSVTNDNLIINVFNSLDEPFLLS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQNRRNSFEDGVYGTTCPI PG NFTY+LQ+KDQIGS+YYFPSLAFHKAAGGFGGI+
Sbjct  83   WNGIQNRRNSFEDGVYGTTCPIPPGRNFTYILQMKDQIGSYYYFPSLAFHKAAGGFGGIK  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK NHT LK +LD G +LP PDGI
Sbjct  143  ILSRPRIPVPFPDPADDYTLLIGDWYKKNHTALKAILDGGKKLPFPDGI  191



>emb|CAA65634.1| PS60 [Nicotiana tabacum]
Length=540

 Score =   309 bits (791),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY TIYPLGVPQQGILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  23   EDPYRFFEWNVTYGTIYPLGVPQQGILINGQFPGPDIYSVTNDNLIINVFNSLDEPFLLS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQNRRNSFEDGVYGTTCPI PG NFTY+LQ+KDQIGS+YYFPSLAFHKAAGGFGGI+
Sbjct  83   WNGIQNRRNSFEDGVYGTTCPIPPGRNFTYILQMKDQIGSYYYFPSLAFHKAAGGFGGIK  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK NHT LK +LD G +LP PDGI
Sbjct  143  ILSRPRIPVPFPDPADDYTLLIGDWYKKNHTALKAILDGGKKLPFPDGI  191



>ref|XP_008452926.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
 gb|ADN34135.1| multicopper oxidase [Cucumis melo subsp. melo]
Length=541

 Score =   309 bits (791),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E+PYR+FTWNV+YA IYPLGV QQGILINGQFPGP+I CVTNDNL INVFNSLD+PFL+S
Sbjct  24   ENPYRFFTWNVSYANIYPLGVRQQGILINGQFPGPDIHCVTNDNLIINVFNSLDEPFLIS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  84   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK+NHTTLK  LD G +LP PDGI
Sbjct  144  ILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTTLKAHLDRGKKLPFPDGI  192



>ref|XP_004157080.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=541

 Score =   308 bits (789),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E+PYR+FTWNV+YA IYPLGV QQGILINGQFPGP++ CVTNDNL INVFNSLD+PFL+S
Sbjct  24   ENPYRFFTWNVSYANIYPLGVRQQGILINGQFPGPDVHCVTNDNLIINVFNSLDEPFLIS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  84   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK+NHTTLK  LD G +LP PDGI
Sbjct  144  ILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTTLKAHLDRGKKLPFPDGI  192



>ref|XP_009785141.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=540

 Score =   308 bits (789),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY TIYPLGVPQQGILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  23   EDPYRFFEWNVTYGTIYPLGVPQQGILINGQFPGPDIYSVTNDNLIINVFNSLDEPFLLS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQNRRNSFEDGVYGTTCPI PG NFTY+LQ+KDQIGS+YYFPSLAFHKAAGGFGGI+
Sbjct  83   WNGIQNRRNSFEDGVYGTTCPIPPGKNFTYILQMKDQIGSYYYFPSLAFHKAAGGFGGIK  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK NHT LK +LD G +LP PDGI
Sbjct  143  ILSRPRIPVPFPDPADDYTVLIGDWYKKNHTALKAILDGGKKLPFPDGI  191



>ref|XP_004145593.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=541

 Score =   308 bits (788),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E+PYR+FTWNV+YA IYPLGV QQGILINGQFPGP++ CVTNDNL INVFNSLD+PFL+S
Sbjct  24   ENPYRFFTWNVSYANIYPLGVRQQGILINGQFPGPDVHCVTNDNLIINVFNSLDEPFLIS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  84   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK+NHTTLK  LD G +LP PDGI
Sbjct  144  ILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTTLKAHLDRGKKLPFPDGI  192



>gb|KGN55480.1| hypothetical protein Csa_4G653410 [Cucumis sativus]
Length=447

 Score =   305 bits (780),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E+PYR+FTWNV+YA IYPLGV QQGILINGQFPGP++ CVTNDNL INVFNSLD+PFL+S
Sbjct  24   ENPYRFFTWNVSYANIYPLGVRQQGILINGQFPGPDVHCVTNDNLIINVFNSLDEPFLIS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  84   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK+NHTTLK  LD G +LP PDGI
Sbjct  144  ILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTTLKAHLDRGKKLPFPDGI  192



>ref|XP_009334388.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=544

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  26   EDPYRFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  85

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNSFEDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  86   WNGIQQRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  145

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYKANHTTLK  LD G +LP PDGI
Sbjct  146  ILSRPRIPVPFPDPAGDYTVLIGDWYKANHTTLKAHLDRGKKLPLPDGI  194



>ref|XP_008445302.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=538

 Score =   304 bits (778),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY TIYPLG+PQQGILINGQFPGP+I  VTNDN+ INVFNSLD+PFLLS
Sbjct  19   EDPYRFFDWNVTYGTIYPLGLPQQGILINGQFPGPDIHSVTNDNIIINVFNSLDEPFLLS  78

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY+LQ+KDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  79   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQMKDQIGSFYYFPSLGFHKAAGGFGGIR  138

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWY+ANHTTL+  LDNG  LP PDGI
Sbjct  139  ILSRPRIPVPFPDPAGDYTVLIGDWYQANHTTLRAQLDNGSMLPLPDGI  187



>ref|XP_004142986.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
 gb|KGN62282.1| Multicopper oxidase [Cucumis sativus]
Length=539

 Score =   304 bits (778),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY TIYPLG+PQQGILINGQFPGP+I  VTNDN+ INVFNSLD+PFLLS
Sbjct  20   EDPYRFFDWNVTYGTIYPLGLPQQGILINGQFPGPDIHSVTNDNIIINVFNSLDEPFLLS  79

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY+LQ+KDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  80   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQMKDQIGSFYYFPSLGFHKAAGGFGGIR  139

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWY+ANHTTL+  LDNG  LP PDGI
Sbjct  140  ILSRPRIPVPFPDPAGDYTVLIGDWYQANHTTLRAQLDNGSMLPLPDGI  188



>ref|XP_008387887.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=544

 Score =   304 bits (778),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  26   EDPYRFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  85

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNSFEDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  86   WNGIQQRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  145

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYKANHTTLK  LD G +LP PDGI
Sbjct  146  ILSRPRIPVPFPDPAGDYTVLIGDWYKANHTTLKAHLDRGKKLPFPDGI  194



>gb|KHN33820.1| L-ascorbate oxidase like [Glycine soja]
Length=540

 Score =   303 bits (776),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV Q GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  22   EDPYRFFNWNVTYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  81

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNSFEDGV+GTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  82   WNGIQQRRNSFEDGVFGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  141

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK+NHTTLK  LD G +LP PDGI
Sbjct  142  ILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTTLKARLDRGKKLPFPDGI  190



>ref|XP_006435292.1| hypothetical protein CICLE_v10000783mg [Citrus clementina]
 gb|ESR48532.1| hypothetical protein CICLE_v10000783mg [Citrus clementina]
Length=446

 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV Q+GILIN QFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  25   EDPYRFFNWNVTYGDIYPLGVRQRGILINWQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQNRRNSFEDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  85   WNGIQNRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK+NHT L+  LD G +LP PDGI
Sbjct  145  ILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTDLRAHLDKGKKLPLPDGI  193



>ref|XP_003523207.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=547

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV Q GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  29   EDPYRFFNWNVTYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  88

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNSFEDGV+GTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  89   WNGIQQRRNSFEDGVFGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  148

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK+NHTTLK  LD G +LP PDGI
Sbjct  149  ILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTTLKARLDRGKKLPFPDGI  197



>ref|XP_006390228.1| hypothetical protein EUTSA_v10018373mg [Eutrema salsugineum]
 gb|ESQ27514.1| hypothetical protein EUTSA_v10018373mg [Eutrema salsugineum]
Length=515

 Score =   301 bits (772),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  24   EDPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNSF DGVYGTTCPI PG N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  84   WNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK+NHT LK  LD+G +LP PDGI
Sbjct  144  ILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTDLKAQLDSGRKLPLPDGI  192



>ref|XP_010101299.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB88234.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=541

 Score =   302 bits (773),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  22   EDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  81

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQNRRNSFEDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  82   WNGIQNRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  141

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDP+ D+T LIGDWYK NHT LK  LD G +LP PDGI
Sbjct  142  ILSRPRIPVPFPDPSGDYTILIGDWYKTNHTDLKDHLDGGKKLPFPDGI  190



>ref|XP_006342102.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=540

 Score =   302 bits (773),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYRYF WNVTY TIYPLGVPQQGILINGQFPGP+I  VTNDNL IN+ NSLD+PFLLS
Sbjct  23   EDPYRYFDWNVTYGTIYPLGVPQQGILINGQFPGPDINSVTNDNLVINIHNSLDEPFLLS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+QNRRNSF DGVYGTTCPI PG N T+ LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  83   WNGVQNRRNSFVDGVYGTTCPIPPGRNNTFNLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK NHT LKT+LD G +LP PDGI
Sbjct  143  ILSRPRIPVPFPDPANDYTILIGDWYKKNHTDLKTILDGGRKLPFPDGI  191



>emb|CAB08077.1| pectinesterase [Solanum lycopersicum]
Length=504

 Score =   300 bits (769),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYRYF WNVTY TIYPLGVPQQGILINGQFPGP+I  VTNDNL IN+ NSLD+PFLLS
Sbjct  1    EDPYRYFDWNVTYGTIYPLGVPQQGILINGQFPGPDINSVTNDNLVINIHNSLDEPFLLS  60

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQNRRNSF DGVYGTTCPI PG N T+ LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  61   WNGIQNRRNSFVDGVYGTTCPIPPGRNNTFNLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  120

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK NHT LK +LD G +LP PDGI
Sbjct  121  ILSRPRIPVPFPDPANDYTILIGDWYKKNHTDLKAILDGGRKLPFPDGI  169



>gb|KJB58003.1| hypothetical protein B456_009G189900 [Gossypium raimondii]
Length=445

 Score =   298 bits (764),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  I+PLGV Q GILINGQFPGP+I  VTNDNL INVFNSL++PFLLS
Sbjct  23   EDPYRFFNWNVTYGDIFPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLLS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+QNRRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  83   WNGVQNRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLGFHKAAGGFGGIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYKANHT L+  LD+G +LP PDGI
Sbjct  143  ILSRPRIPVPFPDPAGDYTVLIGDWYKANHTDLRAQLDSGRKLPFPDGI  191



>ref|XP_007221787.1| hypothetical protein PRUPE_ppa003860mg [Prunus persica]
 gb|EMJ22986.1| hypothetical protein PRUPE_ppa003860mg [Prunus persica]
Length=544

 Score =   301 bits (770),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSLD+PFL+S
Sbjct  26   EDPYRFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLIS  85

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNSFEDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  86   WNGIQQRRNSFEDGVYGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  145

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK+NHT+LK  LD G +LP PDGI
Sbjct  146  ILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTSLKAHLDAGKKLPFPDGI  194



>gb|KJB58004.1| hypothetical protein B456_009G189900 [Gossypium raimondii]
Length=474

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  I+PLGV Q GILINGQFPGP+I  VTNDNL INVFNSL++PFLLS
Sbjct  23   EDPYRFFNWNVTYGDIFPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLLS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+QNRRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  83   WNGVQNRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLGFHKAAGGFGGIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYKANHT L+  LD+G +LP PDGI
Sbjct  143  ILSRPRIPVPFPDPAGDYTVLIGDWYKANHTDLRAQLDSGRKLPFPDGI  191



>ref|XP_006435293.1| hypothetical protein CICLE_v10000783mg [Citrus clementina]
 ref|XP_006473746.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|ESR48533.1| hypothetical protein CICLE_v10000783mg [Citrus clementina]
 gb|KDO85016.1| hypothetical protein CISIN_1g009149mg [Citrus sinensis]
Length=542

 Score =   301 bits (770),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV Q+GILIN QFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  25   EDPYRFFNWNVTYGDIYPLGVRQRGILINWQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQNRRNSFEDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  85   WNGIQNRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK+NHT L+  LD G +LP PDGI
Sbjct  145  ILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTDLRAHLDKGKKLPLPDGI  193



>ref|XP_007136137.1| hypothetical protein PHAVU_009G021000g [Phaseolus vulgaris]
 gb|ESW08131.1| hypothetical protein PHAVU_009G021000g [Phaseolus vulgaris]
Length=548

 Score =   301 bits (770),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  I+PLGV Q+GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  30   EDPYRFFNWNVTYGDIFPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  89

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNSFEDGV+GTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKA GGFGGIR
Sbjct  90   WNGIQQRRNSFEDGVFGTTCPIAPGKNFTYILQVKDQIGSFYYFPSLAFHKAGGGFGGIR  149

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDP  D+T LIGDWYK+NHTTL+  LDNG +LP PDGI
Sbjct  150  ILSRPRIPVPFPDPDGDYTVLIGDWYKSNHTTLRAHLDNGKKLPFPDGI  198



>ref|XP_006390229.1| hypothetical protein EUTSA_v10018373mg [Eutrema salsugineum]
 gb|ESQ27515.1| hypothetical protein EUTSA_v10018373mg [Eutrema salsugineum]
Length=541

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  24   EDPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNSF DGVYGTTCPI PG N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  84   WNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK+NHT LK  LD+G +LP PDGI
Sbjct  144  ILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTDLKAQLDSGRKLPLPDGI  192



>ref|XP_010667350.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=539

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYRYF WN+TY  IYPLGV QQGILINGQFPGP+I  VTNDN+ INVFN+L+ PFLLS
Sbjct  21   EDPYRYFNWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIINVFNNLNVPFLLS  80

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W+G+QNRRNS++DGVYGTTCPI PG NFTY LQ KDQIGSFYYFPSLAFHKAAG FGGIR
Sbjct  81   WSGVQNRRNSYQDGVYGTTCPIPPGRNFTYKLQFKDQIGSFYYFPSLAFHKAAGAFGGIR  140

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYKANHT L+ +LD+GH+LPPPDGI
Sbjct  141  ILSRPRIPVPFPDPAGDYTVLIGDWYKANHTDLQAILDDGHKLPPPDGI  189



>gb|KEH40258.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=543

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INVFNSLD+PFL+S
Sbjct  25   EDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLIS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS+EDGV+GTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  85   WNGVQQRRNSYEDGVFGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPF DPA D+T LIGDWYK+NHT LK  LDNG +LP PDGI
Sbjct  145  ILSRPRIPVPFDDPAGDYTVLIGDWYKSNHTDLKAQLDNGKKLPFPDGI  193



>ref|XP_004238406.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=540

 Score =   300 bits (768),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYRYF WNVTY TIYPLGVPQQGILINGQFPGP+I  VTNDNL IN+ NSLD+PFLLS
Sbjct  23   EDPYRYFDWNVTYGTIYPLGVPQQGILINGQFPGPDINSVTNDNLVINIHNSLDEPFLLS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+QNRRNSF DGVYGTTCPI PG N T+ LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  83   WNGVQNRRNSFVDGVYGTTCPIPPGRNNTFNLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK NHT LK +LD G +LP PDGI
Sbjct  143  ILSRPRIPVPFPDPANDYTILIGDWYKKNHTDLKAILDGGRKLPFPDGI  191



>ref|XP_004500896.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=548

 Score =   300 bits (768),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSLD+PFL+S
Sbjct  30   EDPYRFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLIS  89

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNSFEDGV+GTTCPI PG NFTY+LQVKDQIGSFYYFPSL+FHKAAGGFGGIR
Sbjct  90   WNGIQQRRNSFEDGVFGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLSFHKAAGGFGGIR  149

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDP  D+T LIGDWYK+NHTTLK  LD G +LP PDGI
Sbjct  150  ILSRPRIPVPFPDPDGDYTVLIGDWYKSNHTTLKAHLDKGKKLPIPDGI  198



>ref|XP_010428667.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=542

 Score =   300 bits (767),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR++ WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDN+ INVFNSLD+PFLLS
Sbjct  25   EDPYRFYEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIINVFNSLDEPFLLS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNSF DGVYGTTCPI PG N+TYMLQ+KDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  85   WNGVQQRRNSFVDGVYGTTCPIPPGQNYTYMLQMKDQIGSFYYFPSLAFHKAAGGFGGIR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D T LIGDWYK+NHT LK  LDNG +LP PDGI
Sbjct  145  ILSRPRIPVPFPDPAGDTTVLIGDWYKSNHTDLKAQLDNGKKLPLPDGI  193



>ref|XP_007017957.1| SKU5 similar 5 isoform 3 [Theobroma cacao]
 gb|EOY15182.1| SKU5 similar 5 isoform 3 [Theobroma cacao]
Length=445

 Score =   296 bits (759),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            +DPYR+F WNVTY  IYPLGV Q GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  23   DDPYRFFNWNVTYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  83   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK+NHT L+  LD G +LP PDGI
Sbjct  143  ILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTDLRAHLDLGKKLPFPDGI  191



>ref|XP_003550444.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
 gb|KHN48525.1| L-ascorbate oxidase like [Glycine soja]
Length=541

 Score =   300 bits (767),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+FTWNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INVFNSLDQPFLLS
Sbjct  23   EDPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDQPFLLS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNSFEDGV GTTCPI  G NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  83   WNGVQQRRNSFEDGVLGTTCPIPAGGNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPF DPA D+T LIGDWYK NHT LK+ LD+G +LP PDGI
Sbjct  143  ILSRPRIPVPFDDPAGDYTVLIGDWYKLNHTDLKSQLDSGRKLPLPDGI  191



>ref|XP_003527461.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=547

 Score =   299 bits (765),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WN+TY  IYPLGV Q GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  29   EDPYRFFNWNITYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  88

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNSFEDGV+GTTCPI  G NFTY+LQVKDQIG+FYYFPSLAFHKAAGGFGGIR
Sbjct  89   WNGIQQRRNSFEDGVFGTTCPIPAGKNFTYILQVKDQIGTFYYFPSLAFHKAAGGFGGIR  148

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK+NHTTLK  LD G +LP PDGI
Sbjct  149  ILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTTLKARLDRGKKLPFPDGI  197



>ref|XP_007017956.1| SKU5 similar 5 isoform 2 [Theobroma cacao]
 gb|EOY15181.1| SKU5 similar 5 isoform 2 [Theobroma cacao]
Length=475

 Score =   296 bits (759),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            +DPYR+F WNVTY  IYPLGV Q GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  23   DDPYRFFNWNVTYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  83   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK+NHT L+  LD G +LP PDGI
Sbjct  143  ILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTDLRAHLDLGKKLPFPDGI  191



>ref|XP_002510630.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF52817.1| multicopper oxidase, putative [Ricinus communis]
Length=546

 Score =   299 bits (765),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLG+ QQGILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  28   EDPYRFFNWNVTYGDIYPLGIRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  87

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  88   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  147

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPF DP  D+T LIGDWYK+NHT LK  LDNG +LP PDGI
Sbjct  148  ILSRPRIPVPFADPDGDYTILIGDWYKSNHTDLKAHLDNGKKLPFPDGI  196



>ref|XP_010539810.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=542

 Score =   298 bits (764),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+FTWNVTY  IYPLGV QQGILINGQFPGP++  VTNDNL INVFNSLD+PFL+S
Sbjct  24   EDPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDVRSVTNDNLIINVFNSLDEPFLIS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W+GIQ RRNSF DGVYGTTCPI PG N+TY LQVKDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  84   WSGIQQRRNSFVDGVYGTTCPIPPGKNYTYALQVKDQIGSFYYFPSLGFHKAAGGFGGIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP+IPVPFPDPA D+T LIGDWYK+NHT LK  LDNG +LP PDGI
Sbjct  144  ILSRPKIPVPFPDPAGDYTVLIGDWYKSNHTDLKAQLDNGKKLPLPDGI  192



>gb|KHF99853.1| L-ascorbate oxidase [Gossypium arboreum]
Length=541

 Score =   298 bits (764),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  I+PLGV Q GILINGQFPGP+I  VTNDNL INVFNSL++PFLLS
Sbjct  23   EDPYRFFNWNVTYGDIFPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLLS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+QNRRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  83   WNGVQNRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLGFHKAAGGFGGIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYKANHT L+  LD+G +LP PDGI
Sbjct  143  ILSRPRIPVPFPDPAGDYTVLIGDWYKANHTDLRAQLDSGRKLPFPDGI  191



>ref|XP_008221175.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=544

 Score =   298 bits (764),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPY++F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSLD+PFL+S
Sbjct  26   EDPYKFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLIS  85

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNSFEDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  86   WNGIQQRRNSFEDGVYGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  145

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK+NHT+L+  LD G +LP PDGI
Sbjct  146  ILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTSLRAHLDAGKKLPFPDGI  194



>ref|XP_008377105.1| PREDICTED: LOW QUALITY PROTEIN: L-ascorbate oxidase homolog [Malus 
domestica]
Length=544

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  26   EDPYRFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  85

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNSF DGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  86   WNGIQQRRNSFVDGVYGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLDFHKAAGGFGGIR  145

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDP  D+T LIGDWYK+NHTTLK  LD+G +LP PDGI
Sbjct  146  ILSRPRIPVPFPDPDGDYTVLIGDWYKSNHTTLKAHLDSGKKLPSPDGI  194



>ref|XP_007160607.1| hypothetical protein PHAVU_001G001500g [Phaseolus vulgaris]
 gb|ESW32601.1| hypothetical protein PHAVU_001G001500g [Phaseolus vulgaris]
Length=539

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INVFNSLDQPFLLS
Sbjct  21   EDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDQPFLLS  80

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNSFEDGV+GTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGG+R
Sbjct  81   WNGVQQRRNSFEDGVWGTTCPIPPGGNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGLR  140

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPF DPA D+T LIGDWYK NHT L+ +LD G +LP PDGI
Sbjct  141  ILSRPRIPVPFDDPAGDYTVLIGDWYKFNHTDLQAILDRGSKLPFPDGI  189



>gb|KJB58002.1| hypothetical protein B456_009G189900 [Gossypium raimondii]
Length=541

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  I+PLGV Q GILINGQFPGP+I  VTNDNL INVFNSL++PFLLS
Sbjct  23   EDPYRFFNWNVTYGDIFPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLLS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+QNRRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  83   WNGVQNRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLGFHKAAGGFGGIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYKANHT L+  LD+G +LP PDGI
Sbjct  143  ILSRPRIPVPFPDPAGDYTVLIGDWYKANHTDLRAQLDSGRKLPFPDGI  191



>ref|XP_010471765.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=542

 Score =   298 bits (762),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR++ WN+TY  IYPLGV QQGILINGQFPGP+I  VTNDN+ INV+NSLD+PFLLS
Sbjct  25   EDPYRFYEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIINVYNSLDEPFLLS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNSF DGVYGTTCPI PG N+TYMLQ+KDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  85   WNGVQQRRNSFVDGVYGTTCPIPPGQNYTYMLQMKDQIGSFYYFPSLAFHKAAGGFGGIR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D T LIGDWYK+NHT LK  LDNG +LP PDGI
Sbjct  145  ILSRPRIPVPFPDPAGDTTVLIGDWYKSNHTDLKAQLDNGKKLPLPDGI  193



>ref|XP_010536445.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=541

 Score =   298 bits (762),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSLD+PFL+S
Sbjct  24   EDPYRFFDWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLIS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNSF+DGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  84   WNGIQQRRNSFQDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK+NHT L+  LD+G++LP  DGI
Sbjct  144  ILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTDLRVQLDSGNKLPLADGI  192



>gb|KDP36848.1| hypothetical protein JCGZ_08139 [Jatropha curcas]
Length=542

 Score =   298 bits (762),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  25   EDPYRFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNS+EDGV+GTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  85   WNGIQQRRNSYEDGVFGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPF DP  D+T LIGDWYKANHT LK  LDNG +LP PDGI
Sbjct  145  ILSRPRIPVPFADPDGDYTVLIGDWYKANHTELKAHLDNGKKLPFPDGI  193



>ref|XP_004291312.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=545

 Score =   297 bits (761),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  27   EDPYRFFQWNVTYGDIYPLGVRQRGILINGQFPGPDINSVTNDNLIINVFNSLDEPFLLS  86

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ R NSF+DGVYGTTCPI PG N TY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  87   WNGIQQRHNSFQDGVYGTTCPIPPGRNLTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  146

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDP+ D+T LIGDWYK+NHTTLK  LD G +LP PDGI
Sbjct  147  ILSRPRIPVPFPDPSGDYTVLIGDWYKSNHTTLKAHLDRGKKLPFPDGI  195



>ref|XP_007017955.1| SKU5 similar 5 isoform 1 [Theobroma cacao]
 gb|EOY15180.1| SKU5 similar 5 isoform 1 [Theobroma cacao]
Length=541

 Score =   296 bits (759),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            +DPYR+F WNVTY  IYPLGV Q GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  23   DDPYRFFNWNVTYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  83   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK+NHT L+  LD G +LP PDGI
Sbjct  143  ILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTDLRAHLDLGKKLPFPDGI  191



>ref|XP_006596528.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=547

 Score =   296 bits (759),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INVFNSLDQPFLLS
Sbjct  29   EDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDQPFLLS  88

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNSFEDGV GTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  89   WNGVQQRRNSFEDGVLGTTCPIPPGGNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  148

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPF DPA D+T LIGDWYK NHT L ++LD+G +LP P+GI
Sbjct  149  ILSRPRIPVPFDDPAGDYTVLIGDWYKLNHTDLMSLLDSGRKLPFPNGI  197



>ref|XP_006302110.1| hypothetical protein CARUB_v10020107mg [Capsella rubella]
 gb|EOA35008.1| hypothetical protein CARUB_v10020107mg [Capsella rubella]
Length=541

 Score =   296 bits (758),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WN+TY  IYPLGV QQGILINGQFPGP+I  VTNDN+ INV+NSLD+PFLLS
Sbjct  24   EDPYRFFEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIINVYNSLDEPFLLS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNSF DGVYGTTCPI PG N+TYMLQ+KDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  84   WNGVQQRRNSFVDGVYGTTCPIPPGKNYTYMLQMKDQIGSFYYFPSLGFHKAAGGFGGIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D T LIGDWYK+NHT L+  LDNG +LP PDGI
Sbjct  144  ILSRPRIPVPFPDPAGDTTVLIGDWYKSNHTDLRAQLDNGKKLPLPDGI  192



>ref|XP_009128157.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=542

 Score =   296 bits (758),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV QQGILI+G+FPGP+I  VTNDNL IN+FN+LD+PFLLS
Sbjct  24   EDPYRFFNWNVTYGDIYPLGVRQQGILIDGKFPGPDIHSVTNDNLVINIFNNLDEPFLLS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS+ DGVYGTTCPI PG N+TYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  84   WNGVQQRRNSYVDGVYGTTCPIPPGKNYTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK+NHT LK  LD+G +LP PDGI
Sbjct  144  ILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTDLKAKLDSGRKLPLPDGI  192



>ref|XP_010416527.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=541

 Score =   296 bits (758),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR++ WN+TY  IYPLGV QQGILINGQFPGP+I  VTNDN+ INV+NSLD+PFLLS
Sbjct  24   EDPYRFYEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIINVYNSLDEPFLLS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNSF DGVYGTTCPI PG N+TY+LQ+KDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  84   WNGVQQRRNSFVDGVYGTTCPIPPGQNYTYVLQMKDQIGSFYYFPSLAFHKAAGGFGGIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D T LIGDWYK+NHT LK  LDNG +LP PDGI
Sbjct  144  ILSRPRIPVPFPDPAGDTTVLIGDWYKSNHTDLKAQLDNGKKLPLPDGI  192



>gb|KFK34458.1| hypothetical protein AALP_AA5G148000 [Arabis alpina]
Length=541

 Score =   296 bits (758),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WN+TY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  24   EDPYRFFEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNSF DGVYGTTCPI PG N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  84   WNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPF DPA D+T LIGDWYK+NHT L+  LD+G +LP PDGI
Sbjct  144  ILSRPRIPVPFADPAGDYTVLIGDWYKSNHTDLRAQLDSGRKLPLPDGI  192



>emb|CDY68834.1| BnaCnng60730D, partial [Brassica napus]
Length=549

 Score =   296 bits (757),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV QQGILI+G+FPGP+I  VTNDNL IN+FN+LD+PFLLS
Sbjct  32   EDPYRFFNWNVTYGDIYPLGVRQQGILIDGKFPGPDIHSVTNDNLVINIFNNLDEPFLLS  91

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS+ DGVYGTTCPI PG N+TYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  92   WNGVQQRRNSYVDGVYGTTCPIPPGKNYTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  151

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK+NHT LK  LD+G +LP PDGI
Sbjct  152  ILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTDLKAKLDSGRKLPLPDGI  200



>emb|CDY55201.1| BnaCnng28410D, partial [Brassica napus]
Length=549

 Score =   296 bits (757),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV QQGILI+G+FPGP+I  VTNDNL IN+FN+LD+PFLLS
Sbjct  32   EDPYRFFNWNVTYGDIYPLGVRQQGILIDGKFPGPDIHSVTNDNLVINIFNNLDEPFLLS  91

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS+ DGVYGTTCPI PG N+TYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  92   WNGVQQRRNSYVDGVYGTTCPIPPGKNYTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  151

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK+NHT LK  LD+G +LP PDGI
Sbjct  152  ILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTDLKAKLDSGRKLPLPDGI  200



>gb|KJB15896.1| hypothetical protein B456_002G202300 [Gossypium raimondii]
Length=449

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP++  VTNDNL INV+N+LD+PFLLS
Sbjct  27   EDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDLYSVTNDNLIINVYNNLDEPFLLS  86

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQ KDQIG+FYYFPSLAFHKAAGGFGGIR
Sbjct  87   WNGMQQRRNSYEDGVYGTTCPIPPGKNFTYILQAKDQIGTFYYFPSLAFHKAAGGFGGIR  146

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDW+K +H  L+  LD GH+LP PDGI
Sbjct  147  ILSRPRIPVPFPDPAGDFTVLIGDWFKTDHKKLQAKLDRGHKLPFPDGI  195



>ref|XP_002306213.1| hypothetical protein POPTR_0004s18730g [Populus trichocarpa]
 gb|EEE86724.1| hypothetical protein POPTR_0004s18730g [Populus trichocarpa]
Length=543

 Score =   295 bits (755),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+FTWNVTY  IYPLGV QQGILINGQFPGP+I  VTN+NL INV+NSL +PFL+S
Sbjct  26   EDPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPDIYSVTNNNLIINVYNSLPEPFLIS  85

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSFYY+PSLAFHKAAGGFGGIR
Sbjct  86   WNGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYYPSLAFHKAAGGFGGIR  145

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPFP+PA D+T LIGDWYKANHT LK +LD GH+LP PDGI
Sbjct  146  ILSRPLIPVPFPEPADDFTVLIGDWYKANHTALKAILDRGHKLPLPDGI  194



>ref|XP_002282214.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 emb|CBI37764.3| unnamed protein product [Vitis vinifera]
Length=542

 Score =   295 bits (755),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSL +PFL+S
Sbjct  24   EDPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLPEPFLIS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNSFEDGVYGTTCPI PG NFTY+LQVKDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  84   WNGVQQRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWY  NH TLK +LD G RLP PDGI
Sbjct  144  ILSRPRIPVPFPDPAGDYTILIGDWYTHNHNTLKAILDRGRRLPFPDGI  192



>ref|NP_177743.1| SKU5-like 5 protein [Arabidopsis thaliana]
 gb|AAF17645.1|AC009978_21 T23E18.10 [Arabidopsis thaliana]
 dbj|BAH19558.1| AT1G76160 [Arabidopsis thaliana]
 gb|AEE35804.1| SKU5-like 5 protein [Arabidopsis thaliana]
Length=541

 Score =   295 bits (755),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WN+TY  IYPLGV QQGILING FPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  24   EDPYRFFEWNITYGDIYPLGVRQQGILINGAFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNSF DGVYGTTCPI PG N+TY+LQ+KDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  84   WNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQMKDQIGSFYYFPSLGFHKAAGGFGGIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D T LIGDWYKANHT L+  LDNG +LP PDGI
Sbjct  144  ILSRPRIPVPFPDPAGDTTVLIGDWYKANHTDLRAQLDNGKKLPLPDGI  192



>gb|AAL09733.1| At1g76160/T23E18_10 [Arabidopsis thaliana]
Length=541

 Score =   295 bits (754),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WN+TY  IYPLGV QQGILING FPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  24   EDPYRFFEWNITYGDIYPLGVRQQGILINGAFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNSF DGVYGTTCPI PG N+TY+LQ+KDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  84   WNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQMKDQIGSFYYFPSLGFHKAAGGFGGIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D T LIGDWYKANHT L+  LDNG +LP PDGI
Sbjct  144  ILSRPRIPVPFPDPAGDTTVLIGDWYKANHTDLRAQLDNGKKLPLPDGI  192



>ref|XP_007041705.1| SKU5 similar 5 [Theobroma cacao]
 gb|EOX97536.1| SKU5 similar 5 [Theobroma cacao]
Length=547

 Score =   295 bits (755),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGPE+  VTNDNL INV+N+LD+PFLLS
Sbjct  29   EDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPELYSVTNDNLIINVYNNLDEPFLLS  88

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSF+YFPSLAFHKAAGGFGGI+
Sbjct  89   WNGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIK  148

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK +H  LK  LD GH+LP PDGI
Sbjct  149  ILSRPRIPVPFPDPAGDFTVLIGDWYKTDHRQLKARLDGGHKLPFPDGI  197



>gb|AAM97070.1| pectinesterase, putative [Arabidopsis thaliana]
 gb|AAN15546.1| pectinesterase, putative [Arabidopsis thaliana]
Length=541

 Score =   295 bits (754),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WN+TY  IYPLGV QQGILING FPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  24   EDPYRFFEWNITYGDIYPLGVRQQGILINGAFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNSF DGVYGTTCPI PG N+TY+LQ+KDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  84   WNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQMKDQIGSFYYFPSLGFHKAAGGFGGIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D T LIGDWYKANHT L+  LDNG +LP PDGI
Sbjct  144  ILSRPRIPVPFPDPAGDTTVLIGDWYKANHTDLRAQLDNGKKLPLPDGI  192



>gb|KEH36280.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=544

 Score =   295 bits (754),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPY++F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSL++PFL+S
Sbjct  26   EDPYKFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLIS  85

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNSFEDGV GTTCPI PG NFTY+LQVKDQIGSFYYFPSLAF KAAGGFGGIR
Sbjct  86   WNGIQQRRNSFEDGVSGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLAFQKAAGGFGGIR  145

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFP+PA D+T LIGDWYK+NHTTLK  LD G +LP PDG+
Sbjct  146  ILSRPRIPVPFPEPAGDYTVLIGDWYKSNHTTLKAHLDKGKKLPIPDGV  194



>gb|AFK35121.1| unknown [Medicago truncatula]
Length=544

 Score =   294 bits (753),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPY++F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSL++PFL+S
Sbjct  26   EDPYKFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLIS  85

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNSFEDGV GTTCPI PG NFTY+LQVKDQIGSFYYFPSLAF KAAGGFGGIR
Sbjct  86   WNGIQQRRNSFEDGVSGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLAFQKAAGGFGGIR  145

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFP+PA D+T LIGDWYK+NHTTLK  LD G +LP PDG+
Sbjct  146  ILSRPRIPVPFPEPAGDYTVLIGDWYKSNHTTLKAHLDKGKKLPIPDGV  194



>gb|ACJ85585.1| unknown [Medicago truncatula]
Length=544

 Score =   294 bits (753),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPY++F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSL++PFL+S
Sbjct  26   EDPYKFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLIS  85

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNSFEDGV GTTCPI PG NFTY+LQVKDQIGSFYYFPSLAF KAAGGFGGIR
Sbjct  86   WNGIQQRRNSFEDGVSGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLAFQKAAGGFGGIR  145

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFP+PA D+T LIGDWYK+NHTTLK  LD G +LP PDG+
Sbjct  146  ILSRPRIPVPFPEPAGDYTVLIGDWYKSNHTTLKAHLDKGKKLPIPDGV  194



>ref|XP_002285913.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 emb|CBI18890.3| unnamed protein product [Vitis vinifera]
Length=541

 Score =   294 bits (752),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+FTWNVT+  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSL +PFLLS
Sbjct  23   EDPYRFFTWNVTFGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVYNSLTEPFLLS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W+G+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSF+YFPSL FHKAAGGFGGIR
Sbjct  83   WSGVQQRRNSYEDGVYGTTCPIPPGRNFTYILQVKDQIGSFFYFPSLDFHKAAGGFGGIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D T LIGDWYKANHTTLK +LD G +L  PDGI
Sbjct  143  ILSRPRIPVPFPDPAGDITVLIGDWYKANHTTLKAILDRGKKLHFPDGI  191



>emb|CAN83942.1| hypothetical protein VITISV_013559 [Vitis vinifera]
Length=541

 Score =   294 bits (752),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+FTWNVT+  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSL +PFLLS
Sbjct  23   EDPYRFFTWNVTFGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVYNSLTEPFLLS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W+G+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSF+YFPSL FHKAAGGFGGIR
Sbjct  83   WSGVQQRRNSYEDGVYGTTCPIPPGRNFTYILQVKDQIGSFFYFPSLDFHKAAGGFGGIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D T LIGDWYKANHTTLK +LD G +L  PDGI
Sbjct  143  ILSRPRIPVPFPDPAGDITVLIGDWYKANHTTLKAILDRGKKLHFPDGI  191



>ref|XP_002889063.1| hypothetical protein ARALYDRAFT_895494 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65322.1| hypothetical protein ARALYDRAFT_895494 [Arabidopsis lyrata subsp. 
lyrata]
Length=541

 Score =   294 bits (752),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WN+TY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  24   EDPYRFFEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNSF DGVYGTTCPI PG N+TY+LQ+KDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  84   WNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQMKDQIGSFYYFPSLGFHKAAGGFGGIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D T LIGDWYK+NHT L+  LD+G +LP PDGI
Sbjct  144  ILSRPRIPVPFPDPAGDTTVLIGDWYKSNHTDLRAQLDSGKKLPLPDGI  192



>ref|XP_004499321.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=544

 Score =   294 bits (752),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WN+TY  IYPLG+ QQGILINGQFPGP+I  VTNDNL INVFNSLD PFL+S
Sbjct  26   EDPYRFFDWNITYGDIYPLGIRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDVPFLIS  85

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS+EDGV GTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  86   WNGVQQRRNSYEDGVSGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  145

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPF DPA D+T LIGDWYK+NHT LK  LDNG +LP  DGI
Sbjct  146  ILSRPRIPVPFDDPAGDYTLLIGDWYKSNHTDLKAQLDNGKKLPFADGI  194



>gb|KJB47732.1| hypothetical protein B456_008G038600 [Gossypium raimondii]
Length=325

 Score =   286 bits (733),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR+F WNVTY  I+PLGV QQGILINGQFPGP+I  VTNDNL INV N+LD+PFLLS
Sbjct  25   ESPYRFFDWNVTYGDIFPLGVRQQGILINGQFPGPDIYSVTNDNLIINVQNNLDEPFLLS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  85   WNGLQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            +LSRPRIPVPFPDPA D+T LIGDW+K +H  LK +LD GH+LP PDGI
Sbjct  145  VLSRPRIPVPFPDPAGDFTLLIGDWFKNDHRQLKAMLDGGHKLPFPDGI  193



>ref|XP_008365718.1| PREDICTED: LOW QUALITY PROTEIN: L-ascorbate oxidase homolog [Malus 
domestica]
Length=373

 Score =   288 bits (737),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV NSL +PFL+S
Sbjct  19   EDPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPEIFSVTNDNLIINVHNSLPEPFLIS  78

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGTTC I PG NFTY LQVKDQIGSFYYFPSLAFHKAAGGFG I+
Sbjct  79   WNGVQQRRNSYQDGVYGTTCAIPPGQNFTYTLQVKDQIGSFYYFPSLAFHKAAGGFGAIK  138

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPFP+PA D++ LIGDWYK +H  LKT+LD GHRLP PDG+
Sbjct  139  ILSRPLIPVPFPEPAGDYSILIGDWYKTDHKVLKTILDRGHRLPFPDGV  187



>ref|XP_011046313.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=544

 Score =   293 bits (750),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+FTWNVTY  IYPLGV QQGILINGQFPGP+I  VTN+NL INV+NSL +PFL+S
Sbjct  26   EDPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPDIYSVTNNNLIINVYNSLPEPFLIS  85

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSFYY+PSLAFHKAAGGFGGIR
Sbjct  86   WNGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYYPSLAFHKAAGGFGGIR  145

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPFP+PA D+T LIGDWYKANH  LK +LD GH+LP PDGI
Sbjct  146  ILSRPLIPVPFPEPADDFTVLIGDWYKANHKVLKAILDRGHKLPFPDGI  194



>ref|XP_011099705.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=538

 Score =   293 bits (749),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR++TWNVTY TIYPLGVPQQGILINGQFPGP+I  VTNDN+ +NVFNSLD+PFL+ 
Sbjct  20   ESPYRFYTWNVTYGTIYPLGVPQQGILINGQFPGPDIYSVTNDNIIVNVFNSLDEPFLIH  79

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W+G+QNRRNS+EDGVYGTTCPI PG NFTY+LQ+KDQIGSF+YFPSLAFHKAAGGFGGI+
Sbjct  80   WSGVQNRRNSYEDGVYGTTCPIPPGQNFTYILQMKDQIGSFFYFPSLAFHKAAGGFGGIK  139

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPF  PA D+T LIGDWYK+NHT LK +LD GH+LP PDGI
Sbjct  140  ILSRPLIPVPFDPPADDYTVLIGDWYKSNHTALKAILDKGHKLPFPDGI  188



>ref|XP_002300669.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE79942.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=547

 Score =   293 bits (750),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  29   EDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  88

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNSFEDGV GTTCPI PG NFTY+LQVKDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  89   WNGIQQRRNSFEDGVIGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLGFHKAAGGFGGIR  148

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPF DPA D+T LIGDWY +NHT LK VLD G +LP PDGI
Sbjct  149  ILSRPRIPVPFDDPAGDYTILIGDWYLSNHTDLKAVLDGGRKLPFPDGI  197



>ref|XP_002307765.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE94761.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=548

 Score =   292 bits (748),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  29   EDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  88

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNS+EDGV+GTTCPI PG NFTY+LQVKDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  89   WNGIQQRRNSYEDGVFGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLGFHKAAGGFGGIR  148

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPF DPA D+T LIGDWY +NHT LK +LD+G +LP P+GI
Sbjct  149  ILSRPRIPVPFDDPAGDYTILIGDWYMSNHTKLKAILDSGRKLPFPNGI  197



>ref|XP_011041276.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=548

 Score =   292 bits (747),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  29   EDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  88

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNS+EDGV+GTTCPI PG NFTY+LQVKDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  89   WNGIQQRRNSYEDGVFGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLGFHKAAGGFGGIR  148

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPF DPA D+T LIGDWY +NHT LK +LD+G RLP P GI
Sbjct  149  ILSRPRIPVPFDDPAGDYTILIGDWYMSNHTKLKALLDSGRRLPFPSGI  197



>ref|XP_011034917.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=547

 Score =   292 bits (747),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  29   EDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  88

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNSFEDGV GTTCPI PG NFTY+LQVKDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  89   WNGIQQRRNSFEDGVIGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLGFHKAAGGFGGIR  148

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPF DPA D+T LIGDWY +NHT LK  LD G +LP PDGI
Sbjct  149  ILSRPRIPVPFDDPAGDYTVLIGDWYLSNHTDLKAALDGGRKLPFPDGI  197



>emb|CDX73238.1| BnaC06g36860D [Brassica napus]
Length=541

 Score =   291 bits (746),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  24   ESPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS+ DGVYGTTCPI PG N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGG+R
Sbjct  84   WNGVQQRRNSYVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGLR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPF DPA D+T LIGDWYKANHT LK  LD+G +LP PDGI
Sbjct  144  ILSRPGIPVPFADPAGDYTVLIGDWYKANHTDLKAQLDSGRKLPLPDGI  192



>gb|AGT57427.1| ascorbate oxidase [Prunus persica]
Length=536

 Score =   291 bits (746),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WN+TY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV NSL +PFL+S
Sbjct  19   EDPYRFFDWNITYGDIYPLGVRQQGILINGQFPGPEIYSVTNDNLIINVHNSLPEPFLIS  78

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q+RRNS++DGVYGTTCPI PG NFTY LQVKDQIGSFYYFPSLAFHKAAGGFG I+
Sbjct  79   WNGVQHRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFYYFPSLAFHKAAGGFGAIK  138

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA+D++ LIGDWYK +H  LK +LD GHRLP PDGI
Sbjct  139  ILSRPRIPVPFPDPASDYSILIGDWYKTDHKILKGILDRGHRLPFPDGI  187



>gb|KHG11003.1| L-ascorbate oxidase [Gossypium arboreum]
Length=545

 Score =   291 bits (746),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP++  VTNDNL INV+N+LD+PFLLS
Sbjct  27   EDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDLYSVTNDNLIINVYNNLDEPFLLS  86

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQ KDQIG+FYYFPSLAFHKAAGGFGGIR
Sbjct  87   WNGMQQRRNSYEDGVYGTTCPIPPGKNFTYILQAKDQIGTFYYFPSLAFHKAAGGFGGIR  146

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA+D+T LIGDW+K +H  L+  LD GH+LP PDGI
Sbjct  147  ILSRPRIPVPFPDPASDFTVLIGDWFKTDHKKLQAKLDRGHKLPFPDGI  195



>gb|KJB15897.1| hypothetical protein B456_002G202300 [Gossypium raimondii]
Length=545

 Score =   291 bits (746),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP++  VTNDNL INV+N+LD+PFLLS
Sbjct  27   EDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDLYSVTNDNLIINVYNNLDEPFLLS  86

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQ KDQIG+FYYFPSLAFHKAAGGFGGIR
Sbjct  87   WNGMQQRRNSYEDGVYGTTCPIPPGKNFTYILQAKDQIGTFYYFPSLAFHKAAGGFGGIR  146

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDW+K +H  L+  LD GH+LP PDGI
Sbjct  147  ILSRPRIPVPFPDPAGDFTVLIGDWFKTDHKKLQAKLDRGHKLPFPDGI  195



>gb|AFK33407.1| unknown [Lotus japonicus]
Length=385

 Score =   286 bits (733),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F W +TY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV N L +PFLLS
Sbjct  31   EDPYRFFDWTITYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLVINVHNHLPEPFLLS  90

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQIGSF+YFPSLAFHKAAGGFG I+
Sbjct  91   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYNLQVKDQIGSFFYFPSLAFHKAAGGFGAIK  150

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFP+PAAD++ LIGDWY+ NH  LK VLD+GHRLP P  +
Sbjct  151  ILSRPRIPVPFPEPAADFSLLIGDWYQINHKKLKAVLDHGHRLPSPQAV  199



>ref|XP_002528421.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF33963.1| multicopper oxidase, putative [Ricinus communis]
Length=544

 Score =   291 bits (745),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTN+NL INV NSL +PFL+S
Sbjct  26   EDPYRFFDWNVTYGDIYPLGVKQQGILINGQFPGPDIYSVTNNNLIINVHNSLPEPFLIS  85

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  86   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFGGIR  145

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPFPDPA D+T LIGDWYK NHT LK +LD GHRLP PDGI
Sbjct  146  ILSRPLIPVPFPDPAGDFTVLIGDWYKTNHTKLKAILDYGHRLPFPDGI  194



>gb|KJB14335.1| hypothetical protein B456_002G120000 [Gossypium raimondii]
Length=541

 Score =   291 bits (745),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVT+  IYPLGV Q GILINGQFPGP+I  VTNDNL INV NSL++PFL+S
Sbjct  23   EDPYRFFDWNVTFGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVHNSLNEPFLIS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W+GIQ RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  83   WSGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK+NHT LK  LD G +LP PDGI
Sbjct  143  ILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTNLKARLDRGKKLPFPDGI  191



>ref|XP_008236098.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=536

 Score =   291 bits (744),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WN+TY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV NSL +PFL+S
Sbjct  19   EDPYRFFDWNITYGDIYPLGVRQQGILINGQFPGPEIYSVTNDNLIINVHNSLPEPFLIS  78

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQIGSFYYFPSLAFHKAAGGFG I+
Sbjct  79   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFYYFPSLAFHKAAGGFGAIK  138

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D++ LIGDWYK +H  LK +LD GHRLP PDGI
Sbjct  139  ILSRPRIPVPFPDPAGDYSILIGDWYKTDHKILKGILDRGHRLPFPDGI  187



>ref|XP_007200295.1| hypothetical protein PRUPE_ppa004000mg [Prunus persica]
 gb|EMJ01494.1| hypothetical protein PRUPE_ppa004000mg [Prunus persica]
Length=536

 Score =   291 bits (744),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WN+TY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV NSL +PFL+S
Sbjct  19   EDPYRFFDWNITYGDIYPLGVRQQGILINGQFPGPEIYSVTNDNLIINVHNSLPEPFLIS  78

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q+RRNS++DGVYGTTCPI PG NFTY LQVKDQIGSFYYFPSLAFHKAAGGFG I+
Sbjct  79   WNGVQHRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFYYFPSLAFHKAAGGFGAIK  138

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D++ LIGDWYK +H  LK +LD GHRLP PDGI
Sbjct  139  ILSRPRIPVPFPDPAGDYSILIGDWYKTDHKILKGILDRGHRLPFPDGI  187



>ref|XP_010530339.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=540

 Score =   291 bits (744),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INVFNSLD+PFL+S
Sbjct  23   ESPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLIS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+QNRRNS+ DGVYGTTCPI PG N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  83   WNGVQNRRNSYVDGVYGTTCPIPPGRNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPF  PA D+T LIGDWYK+NHT LK  LD G +LP PDGI
Sbjct  143  ILSRPLIPVPFDQPAGDYTVLIGDWYKSNHTDLKARLDRGKKLPNPDGI  191



>gb|ACN50176.1| pectinesterase [Annona cherimola]
Length=540

 Score =   290 bits (743),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+FTWNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSL +PFL+S
Sbjct  22   EDPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIFSVTNDNLIINVHNSLPEPFLIS  81

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQIGSF+YFPSLAFHKAAGGFGGI+
Sbjct  82   WNGVQQRRNSWQDGVYGTNCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIK  141

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPAAD+T LIGDWYK NHT LK +LD G +LP PDGI
Sbjct  142  ILSRPRIPVPFPDPAADYTALIGDWYKKNHTDLKAILDGGRKLPFPDGI  190



>gb|KHF99506.1| L-ascorbate oxidase [Gossypium arboreum]
Length=541

 Score =   290 bits (743),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVT+  IYPLGV Q GILINGQFPGP+I  VTNDNL INV NSL++PFL+S
Sbjct  23   EDPYRFFDWNVTFGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVHNSLNEPFLIS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W+GIQ RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  83   WSGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T L+GDWYK+NHT LK  LD G +LP PDGI
Sbjct  143  ILSRPRIPVPFPDPAGDYTVLVGDWYKSNHTNLKARLDRGKKLPFPDGI  191



>gb|KJB47729.1| hypothetical protein B456_008G038600 [Gossypium raimondii]
 gb|KJB47730.1| hypothetical protein B456_008G038600 [Gossypium raimondii]
Length=447

 Score =   287 bits (735),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR+F WNVTY  I+PLGV QQGILINGQFPGP+I  VTNDNL INV N+LD+PFLLS
Sbjct  25   ESPYRFFDWNVTYGDIFPLGVRQQGILINGQFPGPDIYSVTNDNLIINVQNNLDEPFLLS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  85   WNGLQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            +LSRPRIPVPFPDPA D+T LIGDW+K +H  LK +LD GH+LP PDGI
Sbjct  145  VLSRPRIPVPFPDPAGDFTLLIGDWFKNDHRQLKAMLDGGHKLPFPDGI  193



>gb|KCW55614.1| hypothetical protein EUGRSUZ_I01478 [Eucalyptus grandis]
Length=449

 Score =   287 bits (735),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSL +PFLL+
Sbjct  27   EDPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLPEPFLLT  86

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS+EDGV GTTCPI PG NFTY+LQVKDQIGSF+Y PSLAFHKAAGGFGGIR
Sbjct  87   WNGVQQRRNSYEDGVQGTTCPIPPGKNFTYILQVKDQIGSFFYSPSLAFHKAAGGFGGIR  146

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPF +PA D+T LIGDWYKANHT LK +LD GHRLP PDGI
Sbjct  147  ILSRPLIPVPFDNPADDYTVLIGDWYKANHTKLKAILDGGHRLPFPDGI  195



>ref|XP_009106271.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=541

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  24   ESPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS+ DGVYGTTCPI PG N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGG+R
Sbjct  84   WNGVQQRRNSYVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGLR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPF DPA D+T LIGDWYK+NHT LK  LD+G +LP PDGI
Sbjct  144  ILSRPGIPVPFADPAGDYTVLIGDWYKSNHTDLKAQLDSGRKLPLPDGI  192



>ref|XP_008382461.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=535

 Score =   289 bits (739),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYRYF WNVTY  IYPLG  QQGILINGQFPGPEI  VTNDNL INV NSL +PFL+S
Sbjct  19   EDPYRYFDWNVTYGDIYPLGARQQGILINGQFPGPEIYSVTNDNLIINVHNSLPEPFLIS  78

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQIGSFYYFPSLAFHKAAGGFG I+
Sbjct  79   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFYYFPSLAFHKAAGGFGAIK  138

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SRPRIPVPFP+PA D++ LIGDWYK +H  LK +LD GHRLP PD +
Sbjct  139  IJSRPRIPVPFPEPAGDYSILIGDWYKTDHKVLKAILDRGHRLPFPDSV  187



>ref|XP_010266952.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=546

 Score =   289 bits (739),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+FTWNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSL +PFL+S
Sbjct  28   EDPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVYNSLPEPFLIS  87

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+  RRNS++DGVYGT CPI PG NFTY+LQVKDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  88   WNGVLQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSFFYFPSLAFHKAAGGFGGIR  147

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYKANHTTLK  LD G +L  PDGI
Sbjct  148  ILSRPRIPVPFPDPAGDFTVLIGDWYKANHTTLKATLDRGKKLHFPDGI  196



>gb|KHG21048.1| L-ascorbate oxidase [Gossypium arboreum]
Length=541

 Score =   289 bits (739),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+++WNVTY  IYPLGV Q G+LINGQFPGP+I  VTNDNL INV+N+L++ FLLS
Sbjct  23   EDPYRFYSWNVTYGDIYPLGVRQTGLLINGQFPGPDIHSVTNDNLIINVYNNLNESFLLS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS+EDGVYGTTCPI PG NFTYMLQVKDQIGSFYY+PSL FHKAAGGFGGIR
Sbjct  83   WNGVQQRRNSYEDGVYGTTCPIPPGKNFTYMLQVKDQIGSFYYYPSLGFHKAAGGFGGIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK+NHT L+  LD G +LP PDG+
Sbjct  143  ILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTVLQAHLDGGKKLPFPDGV  191



>ref|XP_002888337.1| hypothetical protein ARALYDRAFT_475543 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64596.1| hypothetical protein ARALYDRAFT_475543 [Arabidopsis lyrata subsp. 
lyrata]
Length=543

 Score =   288 bits (738),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR+F WNVTY  IYPLGV QQGILING+FPGP+I  VTNDNL INV NSLD+PFL+S
Sbjct  26   ESPYRFFDWNVTYGDIYPLGVRQQGILINGKFPGPDIHSVTNDNLIINVHNSLDEPFLIS  85

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQNRRNS+ DG+YGTTCPI P  N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  86   WNGIQNRRNSYVDGMYGTTCPIPPRSNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  145

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPF DPA D+T LIGDWYK+NHT LK+ LD G +LPPPDGI
Sbjct  146  ILSRPGIPVPFADPAGDYTVLIGDWYKSNHTDLKSRLDRGRKLPPPDGI  194



>ref|XP_006486657.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|KDO68240.1| hypothetical protein CISIN_1g009054mg [Citrus sinensis]
Length=545

 Score =   288 bits (738),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR+FTWNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSL +PFL+S
Sbjct  27   ESPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLPEPFLIS  86

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGS++YFPS+ F KAAGGFGGIR
Sbjct  87   WNGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSYFYFPSVGFQKAAGGFGGIR  146

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPFP+PA D+T LIGDWYKANH  LK+VLD GHRLP PDGI
Sbjct  147  ILSRPLIPVPFPEPAGDFTVLIGDWYKANHNKLKSVLDRGHRLPSPDGI  195



>gb|KJB59710.1| hypothetical protein B456_009G268100 [Gossypium raimondii]
Length=491

 Score =   286 bits (733),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+++WNVTY  IYPLGV Q G+LINGQFPGP+I  VTNDNL INV+N+L++ FLLS
Sbjct  23   EDPYRFYSWNVTYGDIYPLGVRQTGLLINGQFPGPDIHSVTNDNLIINVYNNLNESFLLS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS+EDGV+GTTCPI PG NFTYMLQVKDQIG+FYY+PSL FHKAAGGFGGIR
Sbjct  83   WNGVQQRRNSYEDGVFGTTCPIPPGKNFTYMLQVKDQIGTFYYYPSLGFHKAAGGFGGIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK+NHT L+  LD G +LP PDG+
Sbjct  143  ILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTVLQAHLDGGKKLPFPDGV  191



>ref|XP_010266098.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=547

 Score =   288 bits (737),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+FTWNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSL +PFLLS
Sbjct  29   EDPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVYNSLPEPFLLS  88

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNS++DGVYGT CPI PG NFTY+LQVKDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  89   WNGIQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSFFYFPSLAFHKAAGGFGGIR  148

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWY A+HT LK  LD G RL  PDGI
Sbjct  149  ILSRPRIPVPFPDPAGDFTVLIGDWYNASHTALKAKLDRGKRLHFPDGI  197



>emb|CDX87633.1| BnaA07g32400D [Brassica napus]
Length=541

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  24   ESPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS+ DGVYGTTCPI PG N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGG+R
Sbjct  84   WNGVQQRRNSYVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGLR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPF DPA D T LIGDWYK+NHT LK  LD+G +LP PDGI
Sbjct  144  ILSRPGIPVPFADPAGDNTVLIGDWYKSNHTDLKAQLDSGRKLPLPDGI  192



>ref|XP_006422489.1| hypothetical protein CICLE_v10028140mg [Citrus clementina]
 gb|ESR35729.1| hypothetical protein CICLE_v10028140mg [Citrus clementina]
Length=545

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR+FTWNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSL +PFL+S
Sbjct  27   ESPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLPEPFLIS  86

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGS++YFPS+ F KAAGGFGGIR
Sbjct  87   WNGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSYFYFPSVGFQKAAGGFGGIR  146

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPFP+PA D+T LIGDWYKANH  LK VLD GHRLP PDGI
Sbjct  147  ILSRPLIPVPFPEPAGDFTVLIGDWYKANHNKLKAVLDRGHRLPSPDGI  195



>gb|KDP47151.1| hypothetical protein JCGZ_00042 [Jatropha curcas]
Length=540

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTN+NL INV NSL +PFL+S
Sbjct  22   EDPYRFFDWNVTYGDIYPLGVKQQGILINGQFPGPDIYSVTNNNLIINVHNSLPEPFLIS  81

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  82   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFGGIR  141

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPFP+PA D+T LIGDW+K NHT LK +LD GHRLP PDGI
Sbjct  142  ILSRPLIPVPFPEPADDFTVLIGDWFKTNHTKLKAILDRGHRLPFPDGI  190



>ref|XP_011088669.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=538

 Score =   287 bits (735),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+FTWN+TYA IYPLGV QQGILINGQFPGP+I  VTNDN+ +NV+N+L +PFLLS
Sbjct  22   EDPYRFFTWNITYADIYPLGVRQQGILINGQFPGPDIYAVTNDNIIVNVYNNLPEPFLLS  81

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q R+NSFEDGVYGTTCPI PG NFTY++Q+KDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  82   WNGVQQRKNSFEDGVYGTTCPIPPGKNFTYVMQMKDQIGSFYYFPSLAFHKAAGGFGGIR  141

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFP+P  D+T LIGDWYK NH  LK++LD G  L  PDGI
Sbjct  142  ILSRPRIPVPFPEPHGDFTLLIGDWYKTNHNVLKSILDQGKMLAFPDGI  190



>gb|KJB47727.1| hypothetical protein B456_008G038600 [Gossypium raimondii]
Length=543

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR+F WNVTY  I+PLGV QQGILINGQFPGP+I  VTNDNL INV N+LD+PFLLS
Sbjct  25   ESPYRFFDWNVTYGDIFPLGVRQQGILINGQFPGPDIYSVTNDNLIINVQNNLDEPFLLS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  85   WNGLQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            +LSRPRIPVPFPDPA D+T LIGDW+K +H  LK +LD GH+LP PDGI
Sbjct  145  VLSRPRIPVPFPDPAGDFTLLIGDWFKNDHRQLKAMLDGGHKLPFPDGI  193



>gb|KGN43295.1| hypothetical protein Csa_7G018770 [Cucumis sativus]
Length=444

 Score =   285 bits (728),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            + PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDN++INV NSL +PFLLS
Sbjct  29   DSPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIYAVTNDNIYINVHNSLPEPFLLS  88

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q R+NS++DGVYGTTCPI PG NFTY +QVKDQIGS++YFPSLAFHKAAGGFG IR
Sbjct  89   WNGVQQRKNSYQDGVYGTTCPIPPGQNFTYRIQVKDQIGSYFYFPSLAFHKAAGGFGSIR  148

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            +LSRP IPVPFP+PAAD+T LIGDWY ANHTTLKT+LD GH+LP P+GI
Sbjct  149  VLSRPLIPVPFPEPAADYTLLIGDWYTANHTTLKTILDRGHKLPFPNGI  197



>gb|KJB47731.1| hypothetical protein B456_008G038600 [Gossypium raimondii]
Length=522

 Score =   287 bits (734),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR+F WNVTY  I+PLGV QQGILINGQFPGP+I  VTNDNL INV N+LD+PFLLS
Sbjct  25   ESPYRFFDWNVTYGDIFPLGVRQQGILINGQFPGPDIYSVTNDNLIINVQNNLDEPFLLS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  85   WNGLQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            +LSRPRIPVPFPDPA D+T LIGDW+K +H  LK +LD GH+LP PDGI
Sbjct  145  VLSRPRIPVPFPDPAGDFTLLIGDWFKNDHRQLKAMLDGGHKLPFPDGI  193



>emb|CDP07321.1| unnamed protein product [Coffea canephora]
Length=543

 Score =   287 bits (734),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPY +F WNVTY TIYPLGVPQQGILINGQFPGP+I  VTN+NL INVFNSL +PFLLS
Sbjct  25   EDPYLFFNWNVTYGTIYPLGVPQQGILINGQFPGPDIHSVTNNNLVINVFNSLTEPFLLS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W+GIQNRRNS+ DGVYGTTCPI PG N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGG R
Sbjct  85   WSGIQNRRNSYVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGFR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSR  IPVPF +PA D+T LIGDWY  NHT LK +LD GH+LP PDGI
Sbjct  145  ILSRSVIPVPFAEPAGDFTVLIGDWYSKNHTVLKRILDGGHKLPFPDGI  193



>gb|KCW70295.1| hypothetical protein EUGRSUZ_F03538 [Eucalyptus grandis]
Length=487

 Score =   285 bits (729),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E+PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INVFNSLD PFL+S
Sbjct  22   ENPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDVPFLIS  81

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W+GIQ RRNS+EDGVYGTTCPI PG NFTY+ QVKDQIGSF+YFPSL FHKAAGGFGGIR
Sbjct  82   WSGIQQRRNSYEDGVYGTTCPIPPGRNFTYIFQVKDQIGSFFYFPSLKFHKAAGGFGGIR  141

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPF +PA D+T LIGDWYKANHTTL   LD G +L  PDGI
Sbjct  142  ILSRPLIPVPFAEPAGDYTVLIGDWYKANHTTLIATLDRGKKLKYPDGI  190



>ref|XP_008447902.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=546

 Score =   287 bits (734),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            + PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDN++INV NSL +PFLLS
Sbjct  29   DSPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIYAVTNDNIYINVHNSLPEPFLLS  88

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q R+NS++DGVYGTTCPI PG NFTY +QVKDQIGS++YFPSLAFHKAAGGFG IR
Sbjct  89   WNGVQQRKNSYQDGVYGTTCPIPPGQNFTYRIQVKDQIGSYFYFPSLAFHKAAGGFGSIR  148

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            +LSRP IPVPFP+PAAD+T LIGDWY ANHTTLKT+LD GHRLP P+GI
Sbjct  149  VLSRPLIPVPFPEPAADYTLLIGDWYTANHTTLKTILDRGHRLPFPNGI  197



>gb|KEH30610.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=447

 Score =   284 bits (726),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F W +TY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV N+L +PFLLS
Sbjct  26   EDPYRFFDWTITYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLIINVHNNLPEPFLLS  85

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQIGSF+YFPSLAFHKAAGGFG I+
Sbjct  86   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFGSIK  145

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFP+PA D+TFLIGDWYK +HT L+ VLD GH+LP P  +
Sbjct  146  ILSRPRIPVPFPEPANDYTFLIGDWYKIDHTKLRKVLDFGHKLPLPQAV  194



>ref|XP_007131584.1| hypothetical protein PHAVU_011G025400g [Phaseolus vulgaris]
 gb|ESW03578.1| hypothetical protein PHAVU_011G025400g [Phaseolus vulgaris]
Length=545

 Score =   286 bits (733),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F W VTY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV N+L +PFLLS
Sbjct  30   EDPYRFFDWTVTYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLIINVRNNLTEPFLLS  89

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQIGSF+YFPSLAFHKAAGGFG I+
Sbjct  90   WNGVQQRRNSYQDGVYGTTCPIPPGQNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFGAIK  149

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D++ LIGDWY+ NH TL+TVLD GHRLP P  +
Sbjct  150  ILSRPRIPVPFPDPAGDFSLLIGDWYQINHKTLQTVLDLGHRLPLPQAV  198



>emb|CDY67479.1| BnaCnng55180D [Brassica napus]
Length=541

 Score =   286 bits (732),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSLD+PFL+S
Sbjct  24   ESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPFLIS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+QNRRNS+ DG+YGTTCPI P  N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  84   WNGVQNRRNSYVDGMYGTTCPIPPRTNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPF DPA D+T LIGDWYK+NHT LK  LD G +LP PDGI
Sbjct  144  ILSRPGIPVPFADPAGDYTVLIGDWYKSNHTDLKARLDRGRKLPSPDGI  192



>emb|CDY35790.1| BnaA08g04510D [Brassica napus]
Length=542

 Score =   286 bits (732),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSLD+PFL+S
Sbjct  25   ESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPFLIS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+QNRRNS+ DG+YGTTCPI P  N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  85   WNGVQNRRNSYVDGMYGTTCPIPPRTNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPF DPA D+T LIGDWYK+NHT LK  LD G +LP PDGI
Sbjct  145  ILSRPGIPVPFADPAGDYTVLIGDWYKSNHTDLKARLDRGRKLPSPDGI  193



>gb|KJB59711.1| hypothetical protein B456_009G268100 [Gossypium raimondii]
Length=541

 Score =   286 bits (732),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+++WNVTY  IYPLGV Q G+LINGQFPGP+I  VTNDNL INV+N+L++ FLLS
Sbjct  23   EDPYRFYSWNVTYGDIYPLGVRQTGLLINGQFPGPDIHSVTNDNLIINVYNNLNESFLLS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS+EDGV+GTTCPI PG NFTYMLQVKDQIG+FYY+PSL FHKAAGGFGGIR
Sbjct  83   WNGVQQRRNSYEDGVFGTTCPIPPGKNFTYMLQVKDQIGTFYYYPSLGFHKAAGGFGGIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK+NHT L+  LD G +LP PDG+
Sbjct  143  ILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTVLQAHLDGGKKLPFPDGV  191



>ref|XP_010028797.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW55613.1| hypothetical protein EUGRSUZ_I01478 [Eucalyptus grandis]
Length=545

 Score =   286 bits (732),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSL +PFLL+
Sbjct  27   EDPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLPEPFLLT  86

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS+EDGV GTTCPI PG NFTY+LQVKDQIGSF+Y PSLAFHKAAGGFGGIR
Sbjct  87   WNGVQQRRNSYEDGVQGTTCPIPPGKNFTYILQVKDQIGSFFYSPSLAFHKAAGGFGGIR  146

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPF +PA D+T LIGDWYKANHT LK +LD GHRLP PDGI
Sbjct  147  ILSRPLIPVPFDNPADDYTVLIGDWYKANHTKLKAILDGGHRLPFPDGI  195



>ref|XP_009107631.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=542

 Score =   286 bits (732),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSLD+PFL+S
Sbjct  25   ESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPFLIS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+QNRRNS+ DG+YGTTCPI P  N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  85   WNGVQNRRNSYVDGMYGTTCPIPPRTNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPF DPA D+T LIGDWYK+NHT LK  LD G +LP PDGI
Sbjct  145  ILSRPGIPVPFADPAGDYTVLIGDWYKSNHTDLKARLDRGRKLPSPDGI  193



>ref|XP_004144874.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
 ref|XP_004152953.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=546

 Score =   286 bits (731),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            + PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDN++INV NSL +PFLLS
Sbjct  29   DSPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIYAVTNDNIYINVHNSLPEPFLLS  88

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q R+NS++DGVYGTTCPI PG NFTY +QVKDQIGS++YFPSLAFHKAAGGFG IR
Sbjct  89   WNGVQQRKNSYQDGVYGTTCPIPPGQNFTYRIQVKDQIGSYFYFPSLAFHKAAGGFGSIR  148

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            +LSRP IPVPFP+PAAD+T LIGDWY ANHTTLKT+LD GH+LP P+GI
Sbjct  149  VLSRPLIPVPFPEPAADYTLLIGDWYTANHTTLKTILDRGHKLPFPNGI  197



>ref|XP_006307199.1| hypothetical protein CARUB_v10008790mg [Capsella rubella]
 gb|EOA40097.1| hypothetical protein CARUB_v10008790mg [Capsella rubella]
Length=541

 Score =   285 bits (730),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSLD+PFL+S
Sbjct  24   ESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLVINVHNSLDEPFLIS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+QNRRNSF DG+ GTTCPI P  N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  84   WNGVQNRRNSFVDGMSGTTCPIPPRSNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPF DPA D+T LIGDWYK+NHT LK+ LD G +LP PDGI
Sbjct  144  ILSRPGIPVPFADPAGDYTVLIGDWYKSNHTDLKSRLDRGRKLPSPDGI  192



>gb|AAF99833.1|AC008046_5 Putative pectinesterase [Arabidopsis thaliana]
Length=541

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSLD+PFL+S
Sbjct  24   ESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPFLIS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+QNRRNS+ DG+YGTTCPI P  N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  84   WNGVQNRRNSYVDGMYGTTCPIPPRSNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPF DPA D+T LIGDWYK NHT LK+ LD G +LP PDGI
Sbjct  144  ILSRPGIPVPFADPAGDYTVLIGDWYKFNHTDLKSRLDRGRKLPSPDGI  192



>ref|NP_564479.1| SKU5 similar 6 [Arabidopsis thaliana]
 gb|AEE31910.1| SKU5 similar 6 [Arabidopsis thaliana]
Length=542

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSLD+PFL+S
Sbjct  25   ESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPFLIS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+QNRRNS+ DG+YGTTCPI P  N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  85   WNGVQNRRNSYVDGMYGTTCPIPPRSNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPF DPA D+T LIGDWYK NHT LK+ LD G +LP PDGI
Sbjct  145  ILSRPGIPVPFADPAGDYTVLIGDWYKFNHTDLKSRLDRGRKLPSPDGI  193



>gb|AAL24296.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM91125.1| unknown protein [Arabidopsis thaliana]
Length=542

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSLD+PFL+S
Sbjct  25   ESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPFLIS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+QNRRNS+ DG+YGTTCPI P  N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  85   WNGVQNRRNSYVDGMYGTTCPIPPRSNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPF DPA D+T LIGDWYK NHT LK+ LD G +LP PDGI
Sbjct  145  ILSRPGIPVPFADPAGDYTVLIGDWYKFNHTDLKSRLDRGRKLPSPDGI  193



>gb|KHG21949.1| L-ascorbate oxidase [Gossypium arboreum]
Length=543

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR+F WNVTY  I+PLGV QQGILINGQFPGP+I  VTNDNL INV N+LD+PFLLS
Sbjct  25   ESPYRFFDWNVTYGDIFPLGVRQQGILINGQFPGPDIYSVTNDNLIINVQNNLDEPFLLS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  85   WNGLQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            +LSRPRIPVPF DPA D+T LIGDW+K +H  LK +LD GH+LP PDGI
Sbjct  145  VLSRPRIPVPFTDPAGDFTLLIGDWFKNDHRQLKAMLDGGHKLPFPDGI  193



>ref|XP_010063104.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW70294.1| hypothetical protein EUGRSUZ_F03538 [Eucalyptus grandis]
Length=540

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E+PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INVFNSLD PFL+S
Sbjct  22   ENPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDVPFLIS  81

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W+GIQ RRNS+EDGVYGTTCPI PG NFTY+ QVKDQIGSF+YFPSL FHKAAGGFGGIR
Sbjct  82   WSGIQQRRNSYEDGVYGTTCPIPPGRNFTYIFQVKDQIGSFFYFPSLKFHKAAGGFGGIR  141

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPF +PA D+T LIGDWYKANHTTL   LD G +L  PDGI
Sbjct  142  ILSRPLIPVPFAEPAGDYTVLIGDWYKANHTTLIATLDRGKKLKYPDGI  190



>ref|XP_004290036.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=540

 Score =   284 bits (727),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLG+ Q+GILINGQFPGPEI  VTNDNL INV NSL +PFL++
Sbjct  23   EDPYRFFEWNVTYGDIYPLGIKQRGILINGQFPGPEIYSVTNDNLIINVHNSLPEPFLIT  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQIGSFYYFPSLAFHKAAGGFG I+
Sbjct  83   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFYYFPSLAFHKAAGGFGAIK  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFP+PAAD++ LIGDWY  +H  L+ +LDNGHRLP P G+
Sbjct  143  ILSRPRIPVPFPEPAADYSLLIGDWYNLDHKRLQAILDNGHRLPNPQGL  191



>ref|XP_004505676.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=533

 Score =   284 bits (726),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WN+TY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV NSL +PFL+S
Sbjct  21   EDPYRFFDWNITYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLIINVHNSLPEPFLIS  80

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY LQVKDQIGSF+YFPSLAFHKAAGGFG I+
Sbjct  81   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFGSIK  140

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDP  D+T LIGDWY+ +HT L+ VLD GHRLP P  +
Sbjct  141  ILSRPRIPVPFPDPTDDYTLLIGDWYQIDHTRLRKVLDFGHRLPFPQAV  189



>gb|KEH30611.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=543

 Score =   283 bits (725),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F W +TY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV N+L +PFLLS
Sbjct  26   EDPYRFFDWTITYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLIINVHNNLPEPFLLS  85

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQIGSF+YFPSLAFHKAAGGFG I+
Sbjct  86   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFGSIK  145

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFP+PA D+TFLIGDWYK +HT L+ VLD GH+LP P  +
Sbjct  146  ILSRPRIPVPFPEPANDYTFLIGDWYKIDHTKLRKVLDFGHKLPLPQAV  194



>ref|XP_010103298.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB95365.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=632

 Score =   286 bits (731),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WN+TY  IYPLGV Q+GILINGQFPGPEI  VTNDNL INVFNSL +PFL+S
Sbjct  205  EDPYRFFNWNITYGDIYPLGVRQRGILINGQFPGPEIYSVTNDNLIINVFNSLPEPFLIS  264

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+QNR+NS++DGVYGTTCPI PG NFTY LQ+KDQIGSF+Y+PSLAFHKAAGGFGGIR
Sbjct  265  WNGVQNRKNSYQDGVYGTTCPIPPGKNFTYKLQMKDQIGSFFYYPSLAFHKAAGGFGGIR  324

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK ++  LK +LD G RLP PDG+
Sbjct  325  ILSRPRIPVPFPDPAGDYTILIGDWYKTDNQRLKAILDGGRRLPNPDGL  373


 Score =   235 bits (600),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 125/153 (82%), Gaps = 5/153 (3%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+  WNVTY  IYPLGV Q+GILINGQFPGP I  VTNDNL +NV N+L +PFL+S
Sbjct  28   EDPYRFMEWNVTYGNIYPLGVRQRGILINGQFPGPGIYAVTNDNLIVNVHNNLPEPFLIS  87

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W+G+QNR+NSFEDGVYGTTCPI PG NFTY LQ KDQIGSFYYFPSL FHKAAGGF    
Sbjct  88   WSGLQNRKNSFEDGVYGTTCPIPPGKNFTYRLQAKDQIGSFYYFPSLGFHKAAGGF----  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTL  584
             LSRP+IPVPFP PAAD   LIG+WYK +H  +
Sbjct  144  -LSRPQIPVPFPQPAADHRILIGNWYKTDHKVI  175



>ref|XP_010103300.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB95367.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=548

 Score =   283 bits (725),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F W +TY  IYPLGV Q+GILINGQFPGP+I  VTNDN+ INV N+L +PFLLS
Sbjct  27   EDPYRFFDWKITYGDIYPLGVRQRGILINGQFPGPDIFSVTNDNIIINVQNNLPEPFLLS  86

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W+G+QNR+NSFEDGVYGTTCPI PG NFTY LQ+KDQIG+F+YFPSLAFHKAAGGFGGI+
Sbjct  87   WSGVQNRKNSFEDGVYGTTCPIPPGKNFTYKLQMKDQIGTFFYFPSLAFHKAAGGFGGIK  146

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+T LIGDWYK +H  LK +LD GH+LP PDGI
Sbjct  147  ILSRPRIPVPFPDPAGDYTILIGDWYKLDHQKLKAILDGGHKLPNPDGI  195



>ref|XP_007046384.1| SKU5 similar 5 isoform 2 [Theobroma cacao]
 gb|EOY02216.1| SKU5 similar 5 isoform 2 [Theobroma cacao]
Length=447

 Score =   280 bits (716),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            ED YR+FTWNVTY  IYPLGV QQGILINGQFPGP+IE VTN+NL INVFNSLDQPFL+S
Sbjct  25   EDAYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNENLIINVFNSLDQPFLIS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGT CPI PG NFTY LQVKDQIGS++YFPSLA HKAAGG+GG R
Sbjct  85   WNGVQQRRNSWQDGVYGTNCPIPPGGNFTYTLQVKDQIGSYFYFPSLALHKAAGGYGGFR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSR  IPVPFP PAAD+T L GDWYK NHT LK +LD+G  LP PDG+
Sbjct  145  ILSRSVIPVPFPPPAADYTILAGDWYKKNHTDLKAILDSGSDLPFPDGL  193



>ref|XP_010461374.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Camelina sativa]
 ref|XP_010461375.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Camelina sativa]
Length=542

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR++ WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSLD+PFL+S
Sbjct  25   ESPYRFYDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPFLIS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+QNRRNS+ DG+ GTTCPI P  N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  85   WNGVQNRRNSYVDGMSGTTCPIPPRSNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPF DPA D+T LIGDWYK+NHT LK+ LD G +LP PDGI
Sbjct  145  ILSRPGIPVPFADPAGDYTILIGDWYKSNHTDLKSRLDRGRKLPSPDGI  193



>ref|XP_010500092.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=542

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR++ WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSLD+PFL+S
Sbjct  25   ESPYRFYDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPFLIS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+QNRRNS+ DG+ GTTCPI P  N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  85   WNGVQNRRNSYVDGMSGTTCPIPPRSNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPF DPA D+T LIGDWYK NHT LK+ LD G +LP PDGI
Sbjct  145  ILSRPGIPVPFADPAGDYTVLIGDWYKTNHTDLKSRLDRGRKLPSPDGI  193



>gb|EYU38005.1| hypothetical protein MIMGU_mgv1a004001mg [Erythranthe guttata]
Length=550

 Score =   282 bits (721),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+FTWN+TY  I PLGVPQQGILINGQFPGP+I  VTNDN+ INVFN+L +PFLLS
Sbjct  23   EDPYRFFTWNITYGDISPLGVPQQGILINGQFPGPDIYSVTNDNIIINVFNNLPEPFLLS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ R+NSFEDGV+GTTCPI PG NFTY +Q+KDQIGSFYYFPSLAFHKAAGGFGG R
Sbjct  83   WNGIQQRKNSFEDGVFGTTCPIPPGKNFTYKMQMKDQIGSFYYFPSLAFHKAAGGFGGFR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPFP+PA D T LIGDWYK NH  L+++LD G  L  PDGI
Sbjct  143  ILSRPGIPVPFPEPAGDITVLIGDWYKTNHKVLQSILDKGKMLMSPDGI  191



>ref|XP_006364519.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=541

 Score =   281 bits (720),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYRYF W +TY  IYPLG+ QQGILINGQFPGP+I  VTNDNL INV N L  PFLL+
Sbjct  29   EDPYRYFDWRITYGDIYPLGIRQQGILINGQFPGPDIHSVTNDNLIINVHNDLHDPFLLT  88

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q R+NSFEDGVYGTTCPI PG NFTY++QVKDQIGSF+YFPSL FHKAAGGFGGIR
Sbjct  89   WNGLQQRKNSFEDGVYGTTCPIPPGQNFTYIMQVKDQIGSFFYFPSLQFHKAAGGFGGIR  148

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFP+PA D+T LIGDWYK +H  L+T+LD G RL  PDGI
Sbjct  149  ILSRPRIPVPFPEPAGDFTILIGDWYKTDHKVLQTILDRGKRLTFPDGI  197



>gb|KFK34651.1| hypothetical protein AALP_AA5G173600 [Arabis alpina]
Length=543

 Score =   281 bits (719),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR++ WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDN+ INV NSLD+PFL+S
Sbjct  26   ESPYRFYDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNVIINVHNSLDEPFLIS  85

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+QNRRNS+ DG+YGTTCPI P  N+TY+LQ+KDQIGSFYYFP+LAFHKAAGGFGGIR
Sbjct  86   WNGVQNRRNSYVDGMYGTTCPIPPRTNYTYILQMKDQIGSFYYFPTLAFHKAAGGFGGIR  145

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPF DPA D+T LIGDWYK+NHT LK  LD G +LP PDGI
Sbjct  146  ILSRPGIPVPFADPAGDYTVLIGDWYKSNHTDLKARLDKGKKLPSPDGI  194



>ref|XP_004253133.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=544

 Score =   281 bits (719),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR+F WNVTY TI+PLG+PQ+GILINGQFPGP+I  VTNDN+ INVFN+LD+ FL+S
Sbjct  22   ESPYRFFEWNVTYGTIWPLGLPQKGILINGQFPGPDIHSVTNDNVIINVFNNLDEEFLIS  81

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQNRRNSFEDGV+GTTCPI PG NFTY+LQVKDQIGSFYYFPS AFHKA+GGFGG R
Sbjct  82   WNGIQNRRNSFEDGVWGTTCPIPPGKNFTYILQVKDQIGSFYYFPSTAFHKASGGFGGFR  141

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPF +PA D+T LIGDWYK+NHT LK+VLD  H+LP  D +
Sbjct  142  ILSRPGIPVPFDEPAGDFTVLIGDWYKSNHTYLKSVLDRNHKLPFVDAL  190



>ref|XP_006411628.1| hypothetical protein EUTSA_v10024832mg [Eutrema salsugineum]
 gb|ESQ53081.1| hypothetical protein EUTSA_v10024832mg [Eutrema salsugineum]
Length=551

 Score =   281 bits (719),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 147/170 (86%), Gaps = 1/170 (1%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F W VTY  IYPLG+PQ+GILINGQFPGPEI  VTN+NL INV N LD+PFLLS
Sbjct  24   EDPYRFFDWRVTYGNIYPLGIPQRGILINGQFPGPEIYSVTNNNLIINVHNDLDEPFLLS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q R+NS++DGVYGTTCPI PG N+TY +QVKDQIGSF+YFPSLA HKAAGGFGG R
Sbjct  84   WNGVQLRKNSYQDGVYGTTCPIPPGKNYTYAIQVKDQIGSFFYFPSLALHKAAGGFGGHR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWY-KANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D+TFLIGDWY K +H TLK +LD GH+LP PD +
Sbjct  144  ILSRPRIPVPFPDPAGDFTFLIGDWYTKHDHKTLKALLDRGHKLPLPDEV  193



>gb|KHN05478.1| L-ascorbate oxidase like [Glycine soja]
Length=544

 Score =   281 bits (718),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F W +TY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV N+L +PFLLS
Sbjct  29   EDPYRFFDWTITYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLIINVHNNLTEPFLLS  88

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQIGSF+YFPSLAFHKAAGGFG I+
Sbjct  89   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFGAIK  148

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D++ LIGDWY+ NH  L++VLD GH+LP P  +
Sbjct  149  ILSRPRIPVPFPDPAGDFSLLIGDWYQINHKKLQSVLDFGHKLPFPQAV  197



>emb|CDY64276.1| BnaCnng43630D [Brassica napus]
Length=614

 Score =   283 bits (723),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 147/170 (86%), Gaps = 1/170 (1%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F W VTY+ IYPLG+PQ+GILINGQFPGPEI  VTNDNL INV N LD+PFLLS
Sbjct  87   EDPYRFFDWRVTYSNIYPLGIPQRGILINGQFPGPEIYSVTNDNLIINVHNDLDEPFLLS  146

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q R+NS++DGVYGTTCPI PG N+TY +QVKDQIGSF+YFPSLAFHKAAG FGG+R
Sbjct  147  WNGVQLRKNSYQDGVYGTTCPIPPGKNYTYAIQVKDQIGSFFYFPSLAFHKAAGAFGGLR  206

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYK-ANHTTLKTVLDNGHRLPPPDGI  632
            +LSRPRIPVPFP+PA D+TFLIGDWY   +H  LK +LD GHRLP PD +
Sbjct  207  VLSRPRIPVPFPEPAGDFTFLIGDWYSHHDHKNLKALLDRGHRLPLPDKV  256



>ref|XP_006592035.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=544

 Score =   281 bits (718),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F W +TY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV N+L +PFLLS
Sbjct  29   EDPYRFFDWTITYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLIINVHNNLTEPFLLS  88

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQIGSF+YFPSLAFHKAAGGFG I+
Sbjct  89   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFGAIK  148

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D++ LIGDWY+ NH  L++VLD GH+LP P  +
Sbjct  149  ILSRPRIPVPFPDPAGDFSLLIGDWYQINHKKLQSVLDFGHKLPFPQAV  197



>ref|XP_010676489.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=549

 Score =   280 bits (717),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR++TWNVTY  IYPLGV QQGILINGQFPGP IE VTNDNL ++VFNSLD+PFLLS
Sbjct  25   ESPYRFYTWNVTYGDIYPLGVKQQGILINGQFPGPPIEAVTNDNLIVSVFNSLDEPFLLS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS+YYFPSLAFHKAAGG+GGIR
Sbjct  85   WNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYYYFPSLAFHKAAGGYGGIR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SRP IPVP+P PA D+T L GDWYK NHT LK +LD G  LP PDG+
Sbjct  145  IDSRPLIPVPYPTPAGDFTVLAGDWYKMNHTDLKAILDGGKDLPSPDGL  193



>ref|XP_009612547.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=539

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR++ +NVTY TI PLGV Q+GILINGQFPGP+I  VTNDN+ INVFN LD+PFL+S
Sbjct  22   ESPYRFYEFNVTYGTISPLGVKQKGILINGQFPGPDIYSVTNDNVIINVFNYLDEPFLIS  81

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQNRRNSFEDGV+GTTCPI PG NFTY+LQVKDQIGSFYYFPS AFHKAAGGFGG R
Sbjct  82   WNGIQNRRNSFEDGVWGTTCPIPPGKNFTYILQVKDQIGSFYYFPSTAFHKAAGGFGGFR  141

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPFP+PA D+T LIGDWYK+NHT LK++LD  H+LP  DGI
Sbjct  142  ILSRPGIPVPFPEPAGDFTVLIGDWYKSNHTYLKSILDRNHKLPFVDGI  190



>gb|EYU36818.1| hypothetical protein MIMGU_mgv1a004264mg [Erythranthe guttata]
Length=536

 Score =   280 bits (715),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WN+TY TIYPLG+ QQGILINGQFPGPEI  VTNDN+ +NVFNSLDQPFL+ 
Sbjct  18   EDPYRFFNWNITYGTIYPLGIAQQGILINGQFPGPEIYSVTNDNIIVNVFNSLDQPFLIH  77

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQNRRNS+EDGVYGTTCPI  G NFTY+LQ+KDQIGSF+YFPSL FHKAAG FG I+
Sbjct  78   WNGIQNRRNSYEDGVYGTTCPIPAGGNFTYILQMKDQIGSFFYFPSLGFHKAAGAFGAIK  137

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPF +P  D++ LIGDWY +NHT LK +LD G++LP PDGI
Sbjct  138  ILSRPLIPVPFDNPTDDFSVLIGDWYTSNHTDLKAILDKGNKLPFPDGI  186



>ref|XP_009758923.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=549

 Score =   280 bits (716),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYRYF W ++Y  IYPLGV QQGILINGQFPGP+I  VTNDNL INV N L +PFLL+
Sbjct  32   EDPYRYFDWRISYGDIYPLGVRQQGILINGQFPGPDIISVTNDNLIINVHNDLPEPFLLT  91

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q R+NSFEDGVYGTTCPI PG NFTY++QVKDQIGSF+YFPSL FHKAAGGFGGIR
Sbjct  92   WNGLQQRKNSFEDGVYGTTCPIPPGKNFTYIMQVKDQIGSFFYFPSLKFHKAAGGFGGIR  151

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFP+PA D+T LIGDWYK NH  L+T+LD G  L  PDGI
Sbjct  152  ILSRPRIPVPFPEPAGDFTILIGDWYKTNHKALQTILDRGKMLKFPDGI  200



>ref|XP_004287955.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=542

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR++ WNVTY  IYPLGV QQGILINGQFPGP+I+CVTNDNL I+VFNSLD+PFL+S
Sbjct  24   EDPYRFYNWNVTYGDIYPLGVKQQGILINGQFPGPQIDCVTNDNLIISVFNSLDEPFLIS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGV+GT CPI PG NFTY+LQVKDQIGS+YYFPSLAFHKAAGG+GGI+
Sbjct  84   WNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQVKDQIGSYYYFPSLAFHKAAGGYGGIK  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SRPRIPVPF  PA D+T L GDW+K NHT LK +LD G+ LP PDG+
Sbjct  144  ISSRPRIPVPFDPPAGDFTILAGDWFKQNHTDLKAILDGGNNLPFPDGL  192



>ref|XP_007046383.1| SKU5 similar 5 isoform 1 [Theobroma cacao]
 gb|EOY02215.1| SKU5 similar 5 isoform 1 [Theobroma cacao]
Length=540

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            ED YR+FTWNVTY  IYPLGV QQGILINGQFPGP+IE VTN+NL INVFNSLDQPFL+S
Sbjct  25   EDAYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNENLIINVFNSLDQPFLIS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGT CPI PG NFTY LQVKDQIGS++YFPSLA HKAAGG+GG R
Sbjct  85   WNGVQQRRNSWQDGVYGTNCPIPPGGNFTYTLQVKDQIGSYFYFPSLALHKAAGGYGGFR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSR  IPVPFP PAAD+T L GDWYK NHT LK +LD+G  LP PDG+
Sbjct  145  ILSRSVIPVPFPPPAADYTILAGDWYKKNHTDLKAILDSGSDLPFPDGL  193



>ref|XP_003537754.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=547

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F W +TY  IYPLGV QQ ILINGQFPGPEI  VTNDNL INV N+L +PFLLS
Sbjct  32   EDPYRFFDWTITYGDIYPLGVKQQVILINGQFPGPEIYSVTNDNLIINVHNNLTEPFLLS  91

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQIGSF+YFPSLAFHKAAGGFG I+
Sbjct  92   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFGAIK  151

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFPDPA D++ LIGDWY+ NH  L++VLD GHRLP P  +
Sbjct  152  ILSRPRIPVPFPDPAGDFSLLIGDWYQINHKKLQSVLDFGHRLPFPQAV  200



>ref|XP_003527501.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
 gb|KHN41233.1| L-ascorbate oxidase like [Glycine soja]
Length=537

 Score =   279 bits (713),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR++TWNVTY  IYPLGV QQGILIN QFPGP+IE VTNDNL INV+NSLD+PFLLS
Sbjct  23   EDPYRFYTWNVTYGDIYPLGVKQQGILINWQFPGPQIEAVTNDNLIINVYNSLDEPFLLS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+  RRNS++DGVYGT CPILPGHNFTY+LQVKDQIGS++Y+PSLAFHKAAGG+GG +
Sbjct  83   WNGVLQRRNSWQDGVYGTNCPILPGHNFTYVLQVKDQIGSYFYYPSLAFHKAAGGYGGFK  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SRP IPVPFP PA D+T L GDWYK NHT L+ +LD G  LP PDGI
Sbjct  143  IASRPGIPVPFPTPAGDFTILAGDWYKRNHTDLRAILDGGSDLPFPDGI  191



>ref|XP_009101945.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=549

 Score =   279 bits (714),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 147/170 (86%), Gaps = 1/170 (1%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F W VTY  IYPLG+PQ+GILINGQFPGPEI  VTNDNL INV N LD+PFLLS
Sbjct  24   EDPYRFFDWRVTYGNIYPLGIPQRGILINGQFPGPEIYSVTNDNLIINVHNDLDEPFLLS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q R+NS++DGVYGTTCPI PG N+TY +QVKDQIGSF+YFPSLAFHKAAG FGG+R
Sbjct  84   WNGVQLRKNSYQDGVYGTTCPIPPGKNYTYAIQVKDQIGSFFYFPSLAFHKAAGAFGGLR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWY-KANHTTLKTVLDNGHRLPPPDGI  632
            +LSRPRIPVPFP+PA D+TFLIGDWY + +H  LK +LD GHRLP PD +
Sbjct  144  VLSRPRIPVPFPEPAGDFTFLIGDWYSQHDHKNLKALLDRGHRLPFPDKV  193



>ref|XP_006342555.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=544

 Score =   279 bits (714),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR+F WNVTY TI+PLG+PQ+GILINGQFPGP+I  VTNDN+ INVFN+LD+ FL+S
Sbjct  22   ESPYRFFEWNVTYGTIWPLGLPQKGILINGQFPGPDIHSVTNDNVIINVFNNLDEDFLIS  81

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQNRRNSFEDGV+GTTCPI PG NFTY+LQVKDQIGSFYYFPS AFHKA+GGFGG R
Sbjct  82   WNGIQNRRNSFEDGVWGTTCPIPPGKNFTYILQVKDQIGSFYYFPSTAFHKASGGFGGFR  141

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPF +PA D+T LIGDWYK+NHT LK++LD  H+LP  D +
Sbjct  142  ILSRPGIPVPFDEPAGDFTVLIGDWYKSNHTYLKSILDRNHKLPFVDAL  190



>emb|CDY54804.1| BnaA06g40970D [Brassica napus]
Length=639

 Score =   281 bits (719),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 147/170 (86%), Gaps = 1/170 (1%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F W VTY  IYPLG+PQ+GILINGQFPGPEI  VTNDNL INV N LD+PFLLS
Sbjct  114  EDPYRFFDWRVTYGNIYPLGIPQRGILINGQFPGPEIYSVTNDNLIINVHNDLDEPFLLS  173

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q R+NS++DGVYGTTCPI PG N+TY +QVKDQIGSF+YFPSLAFHKAAG FGG+R
Sbjct  174  WNGVQLRKNSYQDGVYGTTCPIPPGKNYTYAIQVKDQIGSFFYFPSLAFHKAAGAFGGLR  233

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWY-KANHTTLKTVLDNGHRLPPPDGI  632
            +LSRPRIPVPFP+PA D+TFLIGDWY + +H  LK +LD GHRLP PD +
Sbjct  234  VLSRPRIPVPFPEPAGDFTFLIGDWYSQHDHKNLKALLDRGHRLPFPDKV  283



>ref|XP_009803721.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=558

 Score =   279 bits (713),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR++ +NVTY TI PLGV Q+GILINGQFPGP+I  VTNDN+ INVFN LD+PFL+S
Sbjct  41   ESPYRFYEFNVTYGTISPLGVKQKGILINGQFPGPDIYSVTNDNVIINVFNYLDEPFLIS  100

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQNRRNSF+DGV+GTTCPI PG NFTY+LQVKDQIGSFYYFPS AFHKAAGGFGG R
Sbjct  101  WNGIQNRRNSFQDGVWGTTCPIPPGKNFTYVLQVKDQIGSFYYFPSTAFHKAAGGFGGFR  160

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPFP+PA D+T LIGDWYK+NHT LK++LD  H+LP  DGI
Sbjct  161  ILSRPGIPVPFPEPAGDFTVLIGDWYKSNHTYLKSILDRNHKLPFVDGI  209



>ref|XP_004231076.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=536

 Score =   278 bits (711),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYRYF W +TY  I+PLGV QQGILINGQFPGP+I  VTNDNL INV N L  PFLL+
Sbjct  26   EDPYRYFDWRITYGDIHPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNHLPHPFLLT  85

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q R+NSF+DGVYGTTCPI PG NFTY +QVKDQIGSF+YFPSL FHKAAGGFGGIR
Sbjct  86   WNGLQQRKNSFQDGVYGTTCPIPPGKNFTYTMQVKDQIGSFFYFPSLQFHKAAGGFGGIR  145

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP+IPVPFP+PA D+T LIGDWYK +H  LKT+LD+G +LP PDGI
Sbjct  146  ILSRPKIPVPFPEPAGDFTILIGDWYKTDHKVLKTILDHGKKLPFPDGI  194



>ref|XP_002866796.1| hypothetical protein ARALYDRAFT_490604 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43055.1| hypothetical protein ARALYDRAFT_490604 [Arabidopsis lyrata subsp. 
lyrata]
Length=541

 Score =   277 bits (708),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            +DPYR+F W VTY  I PLG+PQ+GILINGQ+PGP+I  VTNDNL INV N LD+PFLLS
Sbjct  14   DDPYRFFDWRVTYGNISPLGIPQRGILINGQYPGPDIYSVTNDNLIINVHNDLDEPFLLS  73

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q R+NS++DGVYGTTCPI PG N+TY +QVKDQIGSF+YFPSLA HKAAGGFGG R
Sbjct  74   WNGVQLRKNSYQDGVYGTTCPIPPGKNYTYAIQVKDQIGSFFYFPSLAVHKAAGGFGGFR  133

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFP+PA D+TFLIGDW++ +H  LK +LD GH+LP P+G+
Sbjct  134  ILSRPRIPVPFPEPAGDFTFLIGDWFEHDHKALKAILDRGHKLPLPEGV  182



>ref|NP_195555.2| protein SKU5 similar 9 [Arabidopsis thaliana]
 gb|AAL60036.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAM20243.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AEE86927.1| protein SKU5 similar 9 [Arabidopsis thaliana]
Length=549

 Score =   276 bits (707),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            +DPYR+F W VTY  I PLG+PQ+GILINGQ+PGP+I  VTNDNL INV N LD+PFLLS
Sbjct  26   DDPYRFFDWRVTYGNISPLGIPQRGILINGQYPGPDIYSVTNDNLIINVHNDLDEPFLLS  85

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q R+NS++DGVYGTTCPI PG N+TY +QVKDQIGSF+YFPSLA HKAAGGFGG R
Sbjct  86   WNGVQLRKNSYQDGVYGTTCPIPPGKNYTYAIQVKDQIGSFFYFPSLAVHKAAGGFGGFR  145

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFP+PA D+TFLIGDW+K +H  LK +LD GH+LP P G+
Sbjct  146  ILSRPRIPVPFPEPAGDFTFLIGDWFKHDHKVLKAILDRGHKLPLPQGV  194



>ref|XP_009413373.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
 ref|XP_009413374.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=543

 Score =   276 bits (706),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            + PYR+FTWNVTY  IYPLGV QQGILINGQFPGP+IE VTNDNL +NVFNSL +PFL S
Sbjct  24   DSPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPQIEAVTNDNLIVNVFNSLPEPFLFS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RR+S++DGVYGT CPI PG NFTY +QVKDQIGS++YFPSLAFHKAAGG+GGIR
Sbjct  84   WNGIQQRRSSWQDGVYGTNCPIPPGGNFTYTMQVKDQIGSYFYFPSLAFHKAAGGYGGIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            +LSRP IPVPF  PAAD+T L+GDWYKANHT L+ +LD G  LP PDG+
Sbjct  144  VLSRPLIPVPFAPPAADYTVLVGDWYKANHTDLRNILDGGKDLPFPDGL  192



>ref|XP_004243477.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=537

 Score =   276 bits (705),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR++ WNVTY  IYPLGV QQGILINGQFPGP I+CVTNDNL INVFN+LD+PFL+S
Sbjct  27   EDPYRFYAWNVTYGDIYPLGVKQQGILINGQFPGPPIQCVTNDNLIINVFNNLDEPFLIS  86

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG++ RRNS++DGVYGT CPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFG I 
Sbjct  87   WNGVEQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSFYYFPSLAFHKAAGGFGSIN  146

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SR  IPVPFP PA +++ L GDW+K NH+ LK +LD GH LP PDG+
Sbjct  147  IASRSVIPVPFPSPAGEFSILTGDWFKQNHSDLKAILDGGHDLPFPDGL  195



>ref|XP_009596487.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=544

 Score =   276 bits (705),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR++TWNVTY  IYPLG+ QQGILINGQFPGP IECVTNDNL INVFN+LD+PFL+S
Sbjct  27   EDPYRFYTWNVTYGDIYPLGLKQQGILINGQFPGPPIECVTNDNLIINVFNNLDEPFLIS  86

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG++ RRNS++DGVYGT CPI PG+NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFG I 
Sbjct  87   WNGVEQRRNSWQDGVYGTNCPIPPGNNFTYVLQVKDQIGSFYYFPSLAFHKAAGGFGSIN  146

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SR  IPVPFP PA +++ L GDW+K NH  LK +LD+GH LP PDG+
Sbjct  147  IASRSVIPVPFPPPAGEFSILSGDWFKQNHNDLKAILDSGHDLPFPDGL  195



>ref|XP_010061137.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW68030.1| hypothetical protein EUGRSUZ_F01712 [Eucalyptus grandis]
Length=543

 Score =   275 bits (704),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSL++PFLLS
Sbjct  26   EDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVINSLNEPFLLS  85

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNSFEDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  86   WNGIQQRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  145

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPFP PA D+T LIGDWYKANHT L+ +LDNG  LP PDGI
Sbjct  146  ILSRPLIPVPFPPPAGDYTILIGDWYKANHTDLRAILDNGKVLPFPDGI  194



>emb|CAB37498.1| putative pectinesterase [Arabidopsis thaliana]
 emb|CAB80507.1| putative pectinesterase [Arabidopsis thaliana]
Length=548

 Score =   275 bits (704),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            +DPYR+F W VTY  I PLG+PQ+GILINGQ+PGP+I  VTNDNL INV N LD+PFLLS
Sbjct  26   DDPYRFFDWRVTYGNISPLGIPQRGILINGQYPGPDIYSVTNDNLIINVHNDLDEPFLLS  85

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q R+NS++DGVYGTTCPI PG N+TY +QVKDQIGSF+YFPSLA HKAAGGFGG R
Sbjct  86   WNGVQLRKNSYQDGVYGTTCPIPPGKNYTYAIQVKDQIGSFFYFPSLAVHKAAGGFGGFR  145

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDG  629
            ILSRPRIPVPFP+PA D+TFLIGDW+K +H  LK +LD GH+LP P G
Sbjct  146  ILSRPRIPVPFPEPAGDFTFLIGDWFKHDHKVLKAILDRGHKLPLPQG  193



>ref|XP_009794442.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=541

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR++TWN+TY  +YPLGV QQGILINGQFPGP IECVTNDNL INVFN+LD+PFL+S
Sbjct  24   EDPYRFYTWNITYGDVYPLGVKQQGILINGQFPGPTIECVTNDNLIINVFNNLDEPFLIS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG++ RRNS++DGVYGT CPI PG+NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFG I 
Sbjct  84   WNGVEQRRNSWQDGVYGTNCPIPPGNNFTYVLQVKDQIGSFYYFPSLAFHKAAGGFGSIN  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I S   IPVPFP PA +++ L GDW+K NH  LK +LD+GH LP PDG+
Sbjct  144  IASSSVIPVPFPPPAGEFSILTGDWFKQNHNDLKAILDSGHDLPFPDGL  192



>ref|XP_009758924.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=548

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYRYF W ++Y  IYPLGV QQGILINGQFPGP+I  VTNDNL INV N L  PFLL+
Sbjct  30   EDPYRYFDWRISYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNDLPDPFLLT  89

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q R+NSFEDGVYGTTCPI PG NFTY++QVKDQIGSF+YFPSL FHKAAGGFGGIR
Sbjct  90   WNGLQQRKNSFEDGVYGTTCPIPPGKNFTYIMQVKDQIGSFFYFPSLKFHKAAGGFGGIR  149

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFP+PA D+T LIGDWYK +H  L+T+L++G  L  PDGI
Sbjct  150  ILSRPRIPVPFPEPAGDFTLLIGDWYKTDHKILQTILNHGKMLKFPDGI  198



>ref|XP_010918208.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=541

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            ++PYR+FTWNV++  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSL +PFL+S
Sbjct  23   DNPYRFFTWNVSFGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLSEPFLIS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS+EDGV GT CPI PG NFTY+LQVKDQIGSF+YFPSL FHKAAGGFGG R
Sbjct  83   WNGVQQRRNSWEDGVSGTNCPIPPGKNFTYILQVKDQIGSFFYFPSLYFHKAAGGFGGFR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPF +PA D+T LIGDWYKANHT L+  LD G +LP PDGI
Sbjct  143  ILSRPLIPVPFSEPAGDYTVLIGDWYKANHTALRATLDGGKKLPFPDGI  191



>gb|AGJ03718.1| multicopper oxidase [Citrus maxima]
Length=538

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP IE VTNDNL I+VFN+LD+PFL+S
Sbjct  23   ESPYRFFNWNVTYGDIYPLGVKQQGILINGQFPGPSIEAVTNDNLIISVFNALDEPFLIS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSLAFHKAAGG+GGI+
Sbjct  83   WNGVQQRRNSWQDGVYGTNCPISPGKNFTYVLQVKDQIGSYFYFPSLAFHKAAGGYGGIK  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SRP IPVPF  PA D+T L GDWYK NHT LK +LD+G  LP PDG+
Sbjct  143  IASRPLIPVPFDPPAGDFTILAGDWYKKNHTDLKAILDSGSDLPFPDGL  191



>ref|XP_007215641.1| hypothetical protein PRUPE_ppa003877mg [Prunus persica]
 gb|EMJ16840.1| hypothetical protein PRUPE_ppa003877mg [Prunus persica]
Length=542

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR++ WNVTY  IYPLG+ Q+GILINGQFPGP+IE VTNDNL INVFNSLD+PFLLS
Sbjct  24   EDPYRFYNWNVTYGDIYPLGLKQRGILINGQFPGPQIESVTNDNLIINVFNSLDEPFLLS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGV+GT CPI PG NFTY+LQVKDQIGS++YFPSL FHKAAGGFGGI+
Sbjct  84   WNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLGFHKAAGGFGGIK  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SR  IPVPFP PA D+T L GDW+  NHT LK +LD+G+ LP PDG+
Sbjct  144  IASRSVIPVPFPPPAGDFTILAGDWFSKNHTDLKAILDSGNNLPSPDGL  192



>ref|XP_006447580.1| hypothetical protein CICLE_v10014842mg [Citrus clementina]
 ref|XP_006469673.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Citrus sinensis]
 gb|ESR60820.1| hypothetical protein CICLE_v10014842mg [Citrus clementina]
 gb|KDO54689.1| hypothetical protein CISIN_1g009283mg [Citrus sinensis]
Length=538

 Score =   273 bits (699),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP IE VTNDNL I+VFN+LD+PFL+S
Sbjct  23   ESPYRFFNWNVTYGDIYPLGVKQQGILINGQFPGPSIEAVTNDNLIISVFNALDEPFLIS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSLAFHKAAGG+GGI+
Sbjct  83   WNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSYFYFPSLAFHKAAGGYGGIK  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SRP IPVPF  PA D+T L GDWYK NHT LK +LD+G  LP PDG+
Sbjct  143  IASRPLIPVPFDPPAGDFTILAGDWYKKNHTDLKAILDSGSDLPFPDGL  191



>ref|XP_009630902.1| PREDICTED: L-ascorbate oxidase homolog isoform X3 [Nicotiana 
tomentosiformis]
Length=543

 Score =   273 bits (698),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYRYF W ++Y  IYPLGV QQGILINGQFPGP+I  VTNDNL INV N L  PFLL+
Sbjct  25   EDPYRYFDWRISYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNDLPDPFLLT  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q R+NSFEDGVYGTTCPI PG NFTY++QVKDQIGSF+YFPSL FHKAAGGFGGIR
Sbjct  85   WNGLQQRKNSFEDGVYGTTCPIPPGKNFTYIMQVKDQIGSFFYFPSLKFHKAAGGFGGIR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPF +PA D+T LIGDWYK +H  L+TVLD G  L  P+GI
Sbjct  145  ILSRPRIPVPFLEPAGDFTILIGDWYKTDHKALQTVLDRGKMLKFPNGI  193



>ref|NP_173604.1| SKU5 similar 7 protein [Arabidopsis thaliana]
 gb|AAF16543.1|AC013482_17 T26F17.7 [Arabidopsis thaliana]
 gb|AEE30163.1| SKU5 similar 7 protein [Arabidopsis thaliana]
Length=538

 Score =   273 bits (698),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 141/169 (83%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F W+VTY  I PLGV QQGILING+FPGP+I  +TNDNL INVFN LD+PFLLS
Sbjct  25   EDPYRFFEWHVTYGNISPLGVAQQGILINGKFPGPDIISITNDNLIINVFNHLDEPFLLS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGI+N +NSF+DGVYGT CPI PG N+TY LQVKDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  85   WNGIRNWKNSFQDGVYGTMCPIPPGKNYTYALQVKDQIGSFYYFPSLGFHKAAGGFGGIR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SR  IPVPFP PA D+T L+GDWYK NH  LK  LDNG +LP PDGI
Sbjct  145  ISSRALIPVPFPTPADDYTLLVGDWYKTNHKDLKAQLDNGGKLPLPDGI  193



>ref|XP_010555198.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=553

 Score =   273 bits (698),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F W V+Y  IYPLG PQ+GILINGQFPGP I  VTNDNL INV N LD+PFLLS
Sbjct  28   EDPYRFFDWTVSYGLIYPLGFPQRGILINGQFPGPNIYSVTNDNLIINVHNDLDEPFLLS  87

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q R+NS++DGVYGTTCPI PG NFTY+ QVKDQIGSF+YFPSL  HKAAGGFGG+R
Sbjct  88   WNGVQMRKNSYQDGVYGTTCPIPPGKNFTYVFQVKDQIGSFFYFPSLGLHKAAGGFGGLR  147

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPFPDP+ D T LIGDW+K +H TLK ++D GH+LP PD +
Sbjct  148  ILSRPLIPVPFPDPSGDLTLLIGDWFKRDHKTLKGIVDRGHKLPLPDAL  196



>ref|XP_008798222.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=541

 Score =   273 bits (697),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR+FTWNVT+  IYPLGV QQGILINGQFPGP+I  V+NDNL INV NSL +PFL+S
Sbjct  23   ESPYRFFTWNVTFGDIYPLGVRQQGILINGQFPGPDIYSVSNDNLIINVHNSLTEPFLIS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS+EDGV GT CPI PG NFTY+LQ KDQIGSF+YFPSL FHKAAGGFGG R
Sbjct  83   WNGVQQRRNSWEDGVSGTNCPIPPGKNFTYILQAKDQIGSFFYFPSLYFHKAAGGFGGFR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPFP+PA D+T LIGDWYKANH  L+  LD G +LP PDGI
Sbjct  143  ILSRPLIPVPFPEPAGDYTVLIGDWYKANHKVLRARLDRGKKLPFPDGI  191



>ref|XP_009630899.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nicotiana 
tomentosiformis]
Length=547

 Score =   273 bits (697),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYRYF W ++Y  IYPLGV QQGILINGQFPGP+I  VTNDNL INV N L  PFLL+
Sbjct  29   EDPYRYFDWRISYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNDLPDPFLLT  88

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q R+NSFEDGVYGTTCPI PG NFTY++QVKDQIGSF+YFPSL FHKAAGGFGGIR
Sbjct  89   WNGLQQRKNSFEDGVYGTTCPIPPGKNFTYIMQVKDQIGSFFYFPSLKFHKAAGGFGGIR  148

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPF +PA D+T LIGDWYK +H  L+TVLD G  L  P+GI
Sbjct  149  ILSRPRIPVPFLEPAGDFTILIGDWYKTDHKALQTVLDRGKMLKFPNGI  197



>ref|XP_003540295.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=536

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR++TWNVTY  IYPLG+ QQGILINGQFPGP+IE VTNDNL ++VFNSLD+PFL+S
Sbjct  23   EDPYRFYTWNVTYGDIYPLGMKQQGILINGQFPGPQIESVTNDNLILHVFNSLDEPFLIS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSLAFHKAAGG+GG +
Sbjct  83   WNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSYFYFPSLAFHKAAGGYGGFK  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SR  IPVPFP PA D+T L GDWYK NHT L+ +LD G  LP PDG+
Sbjct  143  IASRSVIPVPFPPPAGDFTILAGDWYKRNHTDLRAILDGGSDLPFPDGL  191



>ref|XP_009630901.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Nicotiana 
tomentosiformis]
Length=546

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYRYF W ++Y  IYPLGV QQGILINGQFPGP+I  VTNDNL IN+ N L +PFLL+
Sbjct  29   EDPYRYFDWRISYGDIYPLGVRQQGILINGQFPGPDIISVTNDNLIINIHNDLPEPFLLT  88

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q R+NSFEDGVYGTTCPI PG NFTY++QVKDQIGSF+YFPSL FHKAAGGFGGIR
Sbjct  89   WNGLQQRKNSFEDGVYGTTCPIPPGKNFTYIMQVKDQIGSFFYFPSLKFHKAAGGFGGIR  148

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPF +PA D+T LIGDWYK +H  L+TVLD G  L  P+GI
Sbjct  149  ILSRPRIPVPFLEPAGDFTILIGDWYKTDHKALQTVLDRGKMLKFPNGI  197



>ref|NP_173603.1| SKU5 similar 8 protein [Arabidopsis thaliana]
 gb|AAF16544.1|AC013482_18 T26F17.6 [Arabidopsis thaliana]
 gb|ABE65639.1| multi-copper oxidase type I family protein [Arabidopsis thaliana]
 gb|AEE30162.1| SKU5 similar 8 protein [Arabidopsis thaliana]
Length=551

 Score =   273 bits (697),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPY++F W+VTY  I PL V QQGILING+FPGP+I  VTNDNL INVFN LD+PFL+S
Sbjct  25   EDPYKFFEWHVTYGNISPLKVAQQGILINGKFPGPDIAAVTNDNLIINVFNHLDEPFLIS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W+GI+N RNS++DGVYGTTCPI PG N+TY LQVKDQIGSFYYFPSL FHKAAGGFG IR
Sbjct  85   WSGIRNWRNSYQDGVYGTTCPIPPGKNYTYALQVKDQIGSFYYFPSLGFHKAAGGFGAIR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SRPRIPVPFP PA D+T LIGDWYK NH  L+  LDNG +LP PDGI
Sbjct  145  ISSRPRIPVPFPAPAGDYTVLIGDWYKTNHKDLRAQLDNGGKLPFPDGI  193



>emb|CDP10787.1| unnamed protein product [Coffea canephora]
Length=541

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPY++FTWNVTY  IYPLGV QQGILINGQFPGP+I  VTN+NL ++VFNSL++PFLLS
Sbjct  23   EDPYQFFTWNVTYGDIYPLGVKQQGILINGQFPGPQITSVTNENLIVSVFNSLNEPFLLS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQIGSF+YFPSLAF KAAGG+G IR
Sbjct  83   WNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSFFYFPSLAFQKAAGGYGSIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SR  IPVPFP PAA++T L GDW+K NHT L+ +LD GH LP PDGI
Sbjct  143  IYSRSVIPVPFPPPAAEYTILAGDWFKQNHTDLRAILDGGHDLPFPDGI  191



>gb|KDP20733.1| hypothetical protein JCGZ_21204 [Jatropha curcas]
Length=541

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E+PYR+FTW VTY  IYPLGV QQGILINGQFPGP+I+ VTNDNL INVFN L +PFL+S
Sbjct  23   ENPYRFFTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIINVFNYLREPFLIS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNS++DGVYGT CPILPG NFTY+LQVKDQIGSF+YFPSL  HKAAGGFG IR
Sbjct  83   WNGIQQRRNSWQDGVYGTNCPILPGRNFTYILQVKDQIGSFFYFPSLGMHKAAGGFGSIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SRP IPVPFP PA D+T L GDWYK NH  L+ +LD GH LP PDG+
Sbjct  143  IWSRPLIPVPFPTPAGDFTVLAGDWYKRNHYLLRRILDAGHDLPFPDGL  191



>ref|XP_006283464.1| hypothetical protein CARUB_v10004509mg [Capsella rubella]
 gb|EOA16362.1| hypothetical protein CARUB_v10004509mg [Capsella rubella]
Length=554

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F W VTY TI PLG+P +GILINGQ+PGP+I  VTNDNL INV N LD+PFLLS
Sbjct  29   EDPYRFFDWRVTYGTISPLGIPLRGILINGQYPGPDIYSVTNDNLIINVHNDLDEPFLLS  88

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q R+NS++DGVYGTTCPI PG N+TY +QVKDQIGSF+YFPSLA HKA GGFGG R
Sbjct  89   WNGVQLRKNSYQDGVYGTTCPIPPGKNYTYAIQVKDQIGSFFYFPSLAVHKAVGGFGGFR  148

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFP+PA D+TFL+ DW++ +H TLK +LD GH+LP P G+
Sbjct  149  ILSRPRIPVPFPEPAGDFTFLVSDWFERDHKTLKALLDRGHKLPLPQGV  197



>gb|KDP22727.1| hypothetical protein JCGZ_01829 [Jatropha curcas]
Length=541

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+++WNVTY  IYPLGV QQGILINGQFPGP+IE VTN+NL IN+FNSLD+PFLLS
Sbjct  23   EDPYRFYSWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNENLIINIFNSLDEPFLLS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGT CPI PG NFTYMLQVKDQIGS++YFPSL  HKAAGG GG +
Sbjct  83   WNGVQQRRNSWQDGVYGTNCPIPPGQNFTYMLQVKDQIGSYFYFPSLGMHKAAGGIGGFK  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SR  IPVPFP PA D+T L GDW+K NHT LK +LD G  LP PDG+
Sbjct  143  IASRSVIPVPFPPPAGDFTVLAGDWFKKNHTDLKAILDGGSDLPFPDGL  191



>ref|XP_002301616.1| hypothetical protein POPTR_0002s21400g [Populus trichocarpa]
 gb|EEE80889.1| hypothetical protein POPTR_0002s21400g [Populus trichocarpa]
Length=545

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR++TWNVTY  IYPLGV QQGILING+FPGP+IE VTNDNL I+VFNSLD+PFLLS
Sbjct  27   EDPYRFYTWNVTYGDIYPLGVKQQGILINGKFPGPQIESVTNDNLIISVFNSLDEPFLLS  86

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSL  HKAAGGFGG +
Sbjct  87   WNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSYFYFPSLGMHKAAGGFGGFK  146

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SR  IPVPFP PA D+T L GDW+K NHT LK +LD G  LP PDG+
Sbjct  147  IASRSVIPVPFPPPAGDFTILAGDWFKKNHTDLKAILDGGSDLPFPDGL  195



>ref|XP_008455444.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=543

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+FTWN+TY  I+PLGV QQGILINGQFPGP+IE VTN+NL INVFNSLD+PFL+S
Sbjct  25   EDPYRFFTWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTNENLIINVFNSLDEPFLIS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSLA HKAAGGFGG +
Sbjct  85   WNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLALHKAAGGFGGFK  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SR  IP+PFP PA ++T L GDWY  NHT L+ +LD G  LP PDG+
Sbjct  145  IQSRSIIPIPFPTPAGEFTVLAGDWYSKNHTDLRAILDGGSDLPSPDGL  193



>ref|XP_010431777.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=553

 Score =   271 bits (694),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F W VTY  I PLG+P +GILINGQ+PGP+I  VTNDNL INV N LD+PFLLS
Sbjct  25   EDPYRFFDWRVTYGNISPLGIPLKGILINGQYPGPDIYSVTNDNLIINVHNELDEPFLLS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q R+NS++DGVYGTTCPI PG N+TY +QVKDQIGSF+YFPSLA HKA GGFGG R
Sbjct  85   WNGVQMRKNSYQDGVYGTTCPIPPGKNYTYAIQVKDQIGSFFYFPSLAVHKAVGGFGGFR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFP+PA D+TFLI DW++ +H TLK +LD GH+LP P G+
Sbjct  145  ILSRPRIPVPFPEPAGDFTFLISDWFERDHKTLKALLDRGHKLPLPQGV  193



>ref|XP_010436936.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=553

 Score =   271 bits (694),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F W VTY  I PLG+P +GILINGQ+PGP+I  VTNDNL INV N LD+PFLLS
Sbjct  25   EDPYRFFDWRVTYGNISPLGIPLKGILINGQYPGPDIYSVTNDNLIINVHNELDEPFLLS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q R+NS++DGVYGTTCPI PG N+TY +QVKDQIGSF+YFPSLA HKA GGFGG R
Sbjct  85   WNGVQLRKNSYQDGVYGTTCPIPPGKNYTYAIQVKDQIGSFFYFPSLAVHKAVGGFGGFR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFP+PA D+TFLI DW++ +H TLK +LD GH+LP P G+
Sbjct  145  ILSRPRIPVPFPEPAGDFTFLISDWFERDHKTLKALLDRGHKLPLPQGV  193



>ref|XP_008791980.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=541

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            ++PYR+FTWNVT+  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSL +PFL+S
Sbjct  23   DNPYRFFTWNVTFGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLTEPFLIS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS+EDGV GT CPI PG NFTY+LQVKDQIGS++YFPSL FHKAAGGFGG R
Sbjct  83   WNGVQQRRNSWEDGVSGTNCPIPPGKNFTYILQVKDQIGSYFYFPSLYFHKAAGGFGGFR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPF +PA D+T LIGDWYKANH+ L+  LD G +LP PDGI
Sbjct  143  ILSRPLIPVPFSEPAGDYTVLIGDWYKANHSALRARLDGGTKLPFPDGI  191



>ref|XP_006383902.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|ERP61699.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=544

 Score =   270 bits (691),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+ TW +TY  IYPLGV QQGILINGQFPGP+I+ VTN+NL I+V+N L +PFL+S
Sbjct  25   EDPYRFITWKITYGDIYPLGVKQQGILINGQFPGPQIDAVTNENLIISVYNYLREPFLIS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNS++DGVYGT+CPI PG NFTY LQVKDQIGSF+YFPSL FHKAAG FGGIR
Sbjct  85   WNGIQQRRNSWQDGVYGTSCPIPPGKNFTYALQVKDQIGSFFYFPSLGFHKAAGAFGGIR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SRPRIPVPFP PA D+T L GDWYK NH  L+ VLD GH LP PDG+
Sbjct  145  IWSRPRIPVPFPAPAGDFTVLAGDWYKRNHYQLRRVLDGGHNLPFPDGL  193



>ref|XP_008229964.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=542

 Score =   270 bits (690),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR++ WNVTY  IYPLG+ Q+GILINGQFPGP+IE VTNDNL INVFNSLD+PFLLS
Sbjct  24   EDPYRFYNWNVTYGDIYPLGLKQRGILINGQFPGPQIESVTNDNLIINVFNSLDEPFLLS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGV+GT CPI PG NFTY+LQVKDQIGS++YFPSL FHKAAGGFGGI+
Sbjct  84   WNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLGFHKAAGGFGGIK  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SR  IPVPFP PA D+T L GDW+  NHT LK +LD+G+ LP  DG+
Sbjct  144  IASRSVIPVPFPPPAGDFTILAGDWFSKNHTDLKAILDSGNNLPLSDGL  192



>ref|XP_002272880.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 emb|CBI23230.3| unnamed protein product [Vitis vinifera]
Length=540

 Score =   270 bits (690),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR++TW VTY  IYPLGV QQGILINGQFPGP+I+ VTNDNL I+V+N L +PFL+S
Sbjct  22   EDPYRFYTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIISVYNYLREPFLIS  81

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W+G+Q RRNS++DG+YGT CPI PG N TY LQVKDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  82   WSGLQQRRNSWQDGMYGTNCPIPPGRNMTYALQVKDQIGSFFYFPSLAFHKAAGGFGGIR  141

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPFP P+ D+T L GDW+K +H  LK +LD GH LP PDG+
Sbjct  142  ILSRPRIPVPFPAPSGDFTVLAGDWFKRDHAVLKGILDRGHNLPFPDGL  190



>ref|XP_002893186.1| hypothetical protein ARALYDRAFT_313077 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69445.1| hypothetical protein ARALYDRAFT_313077 [Arabidopsis lyrata subsp. 
lyrata]
Length=543

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F W+VTY  I PL V QQGILING+FPGP+I  VTNDNL INVFN LD+ FL+S
Sbjct  25   EDPYRFFEWHVTYGNISPLNVAQQGILINGKFPGPDIVSVTNDNLIINVFNHLDESFLIS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W+GI+N RNS++DGVYGTTCPI PG N+TY+LQVKDQIGSFYYFPSL FHKAAGGFG IR
Sbjct  85   WSGIRNWRNSYQDGVYGTTCPIPPGKNYTYVLQVKDQIGSFYYFPSLGFHKAAGGFGAIR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SRP+IPVPFP PA D+T LIGDWYK NH  L+  LDNG +LP PDGI
Sbjct  145  ISSRPKIPVPFPAPADDYTVLIGDWYKTNHKDLRAQLDNGGKLPLPDGI  193



>gb|KJB67219.1| hypothetical protein B456_010G181000 [Gossypium raimondii]
Length=516

 Score =   268 bits (686),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E+PYRY TW VTY  IYPLGV QQGILINGQFPGP I+ VTNDNL I+V+N L++PFL+S
Sbjct  23   ENPYRYITWKVTYGDIYPLGVKQQGILINGQFPGPHIDAVTNDNLIISVYNYLNEPFLIS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGV GT CPI PG NFTY+LQVKDQIGSFYYFPSL FHKAAGG+G IR
Sbjct  83   WNGVQQRRNSWQDGVSGTNCPIRPGKNFTYVLQVKDQIGSFYYFPSLLFHKAAGGYGAIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SRP+IPVPFP PA D+T L GDWYK NH  L+ +LD+GH LP PDG+
Sbjct  143  IWSRPKIPVPFPSPAGDFTVLAGDWYKTNHYVLRRLLDSGHNLPFPDGL  191



>ref|XP_010046372.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW88773.1| hypothetical protein EUGRSUZ_A01118 [Eucalyptus grandis]
Length=542

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPY ++ WNVTY  IYPLGV QQGILINGQFPGP+IE VTNDNL INVFN+LD+PFLLS
Sbjct  27   EDPYSFYNWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNDNLIINVFNALDEPFLLS  86

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q +RNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSLAFHKAAGGFGG +
Sbjct  87   WNGVQQKRNSWQDGVYGTNCPIPPGQNFTYILQVKDQIGSYFYFPSLAFHKAAGGFGGFK  146

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSR  IPVPFP PA D+T L GDW+  NH+ L+ +LD G  LP PDG+
Sbjct  147  ILSRSVIPVPFPPPANDFTILAGDWFTKNHSDLRAILDGGSDLPFPDGL  195



>ref|XP_003605947.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES88144.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=538

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR++ WNVTY  IYPLGV QQGILINGQFPGP+IE VTNDNL INVFNSLD+PFL+S
Sbjct  23   EDPYRFYNWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNDNLIINVFNSLDEPFLIS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+  RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSLAFHKAAGG+GG  
Sbjct  83   WNGVLQRRNSWQDGVYGTNCPISPGQNFTYILQVKDQIGSYFYFPSLAFHKAAGGYGGFT  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SR  IPVPF  P+ D+T L GDWYK NHT L+ +LD+G  LP PDG+
Sbjct  143  IASRSVIPVPFDPPSGDYTILAGDWYKRNHTDLRAILDSGSDLPFPDGL  191



>gb|KJB67218.1| hypothetical protein B456_010G181000 [Gossypium raimondii]
Length=542

 Score =   268 bits (686),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E+PYRY TW VTY  IYPLGV QQGILINGQFPGP I+ VTNDNL I+V+N L++PFL+S
Sbjct  23   ENPYRYITWKVTYGDIYPLGVKQQGILINGQFPGPHIDAVTNDNLIISVYNYLNEPFLIS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGV GT CPI PG NFTY+LQVKDQIGSFYYFPSL FHKAAGG+G IR
Sbjct  83   WNGVQQRRNSWQDGVSGTNCPIRPGKNFTYVLQVKDQIGSFYYFPSLLFHKAAGGYGAIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SRP+IPVPFP PA D+T L GDWYK NH  L+ +LD+GH LP PDG+
Sbjct  143  IWSRPKIPVPFPSPAGDFTVLAGDWYKTNHYVLRRLLDSGHNLPFPDGL  191



>gb|KGN43515.1| hypothetical protein Csa_7G043570 [Cucumis sativus]
Length=453

 Score =   266 bits (679),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 141/169 (83%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+  WN+TY  I+PLGV QQGILINGQFPGP+IE VTN+NL INVFNSLD+PFL+S
Sbjct  25   EDPYRFLNWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTNENLIINVFNSLDEPFLIS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSLA HKAAGGFGG +
Sbjct  85   WNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLALHKAAGGFGGFK  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SR  IP+PFP PA ++T L GDWY  NHT L+ +LD G  LP PDG+
Sbjct  145  IQSRSIIPIPFPTPAGEFTVLAGDWYSKNHTDLRAILDGGSDLPSPDGL  193



>ref|XP_009400332.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=542

 Score =   268 bits (685),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 141/169 (83%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F WNVT+  IYPLG+ QQGILINGQFPGP+I   TNDN+ +NV+NSL +PFL+S
Sbjct  24   EDPYRFFDWNVTFGDIYPLGIRQQGILINGQFPGPDIHSQTNDNIIVNVYNSLTEPFLIS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q R NS++DGV GT CPI PG NFTY++ +KDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  84   WNGVQQRGNSWQDGVSGTNCPIPPGKNFTYVMHLKDQIGSFFYFPSLAFHKAAGGFGGIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRPRIPVPF  PA D+T LIGDWYKA H+ LK  LD G RLP PD I
Sbjct  144  ILSRPRIPVPFATPADDFTLLIGDWYKAGHSVLKARLDRGKRLPFPDAI  192



>ref|XP_002524823.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF37543.1| multicopper oxidase, putative [Ricinus communis]
Length=538

 Score =   268 bits (685),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+++WN++Y  IYPLGV QQGILINGQFPGP+IE VTNDNL INVFNSLD+PFL+S
Sbjct  25   EDPYRFYSWNISYGDIYPLGVKQQGILINGQFPGPQIESVTNDNLIINVFNSLDEPFLIS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSL  HKAAGG+GG +
Sbjct  85   WNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSYFYFPSLGMHKAAGGYGGFK  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SR  IPVPFP PA D+T L GDW++ NHT LK +LD G  LP PDG+
Sbjct  145  IASRSVIPVPFPPPAGDFTVLAGDWFRMNHTDLKAILDGGSDLPFPDGL  193



>ref|XP_011047251.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Populus euphratica]
 ref|XP_011047252.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Populus euphratica]
Length=547

 Score =   268 bits (685),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 141/169 (83%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+ TWNVTY  IYPLGV QQGILING FPGP+IE VTNDNL I+VFNSLD+PFL+S
Sbjct  29   EDPYRFHTWNVTYGDIYPLGVKQQGILINGLFPGPQIESVTNDNLIISVFNSLDEPFLIS  88

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSL  HKAAGGFGG +
Sbjct  89   WNGVQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLGMHKAAGGFGGFK  148

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SR  IPVPFP P+ D+TFL GDW+K NH  LK +LD G  LP PDG+
Sbjct  149  IASRSVIPVPFPPPSGDFTFLAGDWFKKNHNDLKAILDGGSDLPFPDGL  197



>gb|ABR18324.1| unknown [Picea sitchensis]
Length=542

 Score =   268 bits (684),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 141/169 (83%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPY++FTWNVT+ TI+PLG+PQQGILINGQFPGP I+ VTNDN+ +NVFNSLDQPFL+S
Sbjct  24   EDPYKFFTWNVTWGTIWPLGIPQQGILINGQFPGPRIDSVTNDNIIVNVFNSLDQPFLIS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W+GIQ RRNS++DGV+GT CPI PG NFTY  QVKDQIGS+YYFPS+  HKAAGGFGG+ 
Sbjct  84   WSGIQQRRNSWQDGVFGTNCPIPPGQNFTYKFQVKDQIGSYYYFPSMYMHKAAGGFGGLS  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ++SRP IPVPFP P  D T LIGDWYKANHT L+  LD G  L  PD +
Sbjct  144  VVSRPLIPVPFPAPNGDITLLIGDWYKANHTILRRTLDMGRSLGKPDAV  192



>gb|EAZ02087.1| hypothetical protein OsI_24168 [Oryza sativa Indica Group]
Length=542

 Score =   267 bits (683),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            +DPYR++TWN+T+  IYPLGV QQGILINGQFPGP+I+ VTNDN+ INVFN+L  PFLLS
Sbjct  23   DDPYRFYTWNITFGDIYPLGVKQQGILINGQFPGPQIDAVTNDNIIINVFNNLPSPFLLS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W GIQ RR+S++DGVYGT CPI PG NFTY++Q KDQIGS+YYFPSLAFHKAAGG+GGIR
Sbjct  83   WQGIQQRRSSWQDGVYGTNCPIPPGGNFTYIMQFKDQIGSYYYFPSLAFHKAAGGYGGIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            +LSRP IPVPF  PA D+T L GDW+K NHT L+ +LD+G+ LPPPDG+
Sbjct  143  VLSRPGIPVPFAPPAGDFTILAGDWFKLNHTDLQGILDSGNDLPPPDGL  191



>gb|EAZ38022.1| hypothetical protein OsJ_22366 [Oryza sativa Japonica Group]
Length=532

 Score =   267 bits (683),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            +DPYR++TWN+T+  IYPLGV QQGILINGQFPGP+I+ VTNDN+ INVFN+L  PFLLS
Sbjct  13   DDPYRFYTWNITFGDIYPLGVKQQGILINGQFPGPQIDAVTNDNIIINVFNNLPSPFLLS  72

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W GIQ RR+S++DGVYGT CPI PG NFTY++Q KDQIGS+YYFPSLAFHKAAGG+GGIR
Sbjct  73   WQGIQQRRSSWQDGVYGTNCPIPPGGNFTYIMQFKDQIGSYYYFPSLAFHKAAGGYGGIR  132

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            +LSRP IPVPF  PA D+T L GDW+K NHT L+ +LD+G+ LPPPDG+
Sbjct  133  VLSRPGIPVPFAPPAGDFTILAGDWFKLNHTDLQGILDSGNDLPPPDGL  181



>ref|NP_001058365.1| Os06g0678800 [Oryza sativa Japonica Group]
 dbj|BAD45475.1| putative PS60 [Oryza sativa Japonica Group]
 dbj|BAD45542.1| putative PS60 [Oryza sativa Japonica Group]
 dbj|BAF20279.1| Os06g0678800 [Oryza sativa Japonica Group]
 dbj|BAG92507.1| unnamed protein product [Oryza sativa Japonica Group]
Length=542

 Score =   267 bits (683),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            +DPYR++TWN+T+  IYPLGV QQGILINGQFPGP+I+ VTNDN+ INVFN+L  PFLLS
Sbjct  23   DDPYRFYTWNITFGDIYPLGVKQQGILINGQFPGPQIDAVTNDNIIINVFNNLPSPFLLS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W GIQ RR+S++DGVYGT CPI PG NFTY++Q KDQIGS+YYFPSLAFHKAAGG+GGIR
Sbjct  83   WQGIQQRRSSWQDGVYGTNCPIPPGGNFTYIMQFKDQIGSYYYFPSLAFHKAAGGYGGIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            +LSRP IPVPF  PA D+T L GDW+K NHT L+ +LD+G+ LPPPDG+
Sbjct  143  VLSRPGIPVPFAPPAGDFTILAGDWFKLNHTDLQGILDSGNDLPPPDGL  191



>ref|XP_007213899.1| hypothetical protein PRUPE_ppa003872mg [Prunus persica]
 gb|EMJ15098.1| hypothetical protein PRUPE_ppa003872mg [Prunus persica]
Length=447

 Score =   265 bits (676),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+FTW +TY  IYPLGV QQGILINGQFPGP+I+ VTNDNL I+VFN L +PFL+S
Sbjct  24   EDPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLVISVFNYLREPFLIS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W+GIQ RRNS++DGVYGT CPILPG NFTY +QVKDQIGSF+YFPS  FHKAAGGFGGIR
Sbjct  84   WDGIQQRRNSWQDGVYGTNCPILPGKNFTYNIQVKDQIGSFFYFPSFLFHKAAGGFGGIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTL-KTVLDNGHRLPPPDGI  632
            I SRP+IPVPFP+PA D+T L GDWYK NH  L ++ L+ G  LP PDG+
Sbjct  144  IWSRPKIPVPFPNPAGDFTVLAGDWYKTNHYILRRSYLEFGRNLPSPDGL  193



>ref|XP_004166771.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=543

 Score =   267 bits (683),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 141/169 (83%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+  WN+TY  I+PLGV QQGILINGQFPGP+IE VTN+NL INVFNSLD+PFL+S
Sbjct  25   EDPYRFLNWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTNENLIINVFNSLDEPFLIS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSLA HKAAGGFGG +
Sbjct  85   WNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLALHKAAGGFGGFK  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SR  IP+PFP PA ++T L GDWY  NHT L+ +LD G  LP PDG+
Sbjct  145  IQSRSIIPIPFPTPAGEFTVLAGDWYSKNHTDLRAILDGGSDLPSPDGL  193



>ref|XP_004144498.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=543

 Score =   267 bits (683),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 141/169 (83%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+  WN+TY  I+PLGV QQGILINGQFPGP+IE VTN+NL INVFNSLD+PFL+S
Sbjct  25   EDPYRFLNWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTNENLIINVFNSLDEPFLIS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSLA HKAAGGFGG +
Sbjct  85   WNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLALHKAAGGFGGFK  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SR  IP+PFP PA ++T L GDWY  NHT L+ +LD G  LP PDG+
Sbjct  145  IQSRSIIPIPFPTPAGEFTVLAGDWYSKNHTDLRAILDGGSDLPSPDGL  193



>ref|XP_007026108.1| SKU5 similar 4 isoform 1 [Theobroma cacao]
 ref|XP_007026109.1| SKU5 similar 4 isoform 1 [Theobroma cacao]
 gb|EOY28730.1| SKU5 similar 4 isoform 1 [Theobroma cacao]
 gb|EOY28731.1| SKU5 similar 4 isoform 1 [Theobroma cacao]
Length=542

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E+PYRY TW VTY  IYPLGV QQGILINGQFPGP+I+ VTNDNL I+V+N L++PFL+S
Sbjct  23   ENPYRYITWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIISVYNYLNEPFLIS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGV+GT CPI PG NFTY+LQVKDQIGSF+YFPSL FHKAAGG+GGIR
Sbjct  83   WNGVQQRRNSWQDGVFGTNCPIRPGKNFTYVLQVKDQIGSFFYFPSLLFHKAAGGYGGIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SRP+IPVPFP PA D+T L GDWYK NH  L+ +LD+G  LP PDG+
Sbjct  143  IWSRPKIPVPFPTPAGDFTVLAGDWYKRNHYVLRRLLDSGRNLPFPDGL  191



>ref|XP_007026110.1| SKU5 similar 4 isoform 3 [Theobroma cacao]
 gb|EOY28732.1| SKU5 similar 4 isoform 3 [Theobroma cacao]
Length=543

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E+PYRY TW VTY  IYPLGV QQGILINGQFPGP+I+ VTNDNL I+V+N L++PFL+S
Sbjct  23   ENPYRYITWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIISVYNYLNEPFLIS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGV+GT CPI PG NFTY+LQVKDQIGSF+YFPSL FHKAAGG+GGIR
Sbjct  83   WNGVQQRRNSWQDGVFGTNCPIRPGKNFTYVLQVKDQIGSFFYFPSLLFHKAAGGYGGIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SRP+IPVPFP PA D+T L GDWYK NH  L+ +LD+G  LP PDG+
Sbjct  143  IWSRPKIPVPFPTPAGDFTVLAGDWYKRNHYVLRRLLDSGRNLPFPDGL  191



>gb|EYU17541.1| hypothetical protein MIMGU_mgv1a004531mg [Erythranthe guttata]
Length=522

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 143/169 (85%), Gaps = 7/169 (4%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E+PYR+F WN+TY TIYPLGVPQQ       FPGP+I  VTNDN+ +NVFNSLD+PFL+ 
Sbjct  19   ENPYRFFNWNITYGTIYPLGVPQQ-------FPGPDIYSVTNDNIIVNVFNSLDEPFLIH  71

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+QNRRNS+EDGVYGTTCPI PG NFTY+LQ+KDQIGSF+YFPSLAFHK+AGGFG I+
Sbjct  72   WNGVQNRRNSYEDGVYGTTCPIPPGKNFTYILQMKDQIGSFFYFPSLAFHKSAGGFGSIK  131

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPF  P  D++ LIGDWYK+NHT LK +LDNG +LP PDGI
Sbjct  132  ILSRPLIPVPFDPPTDDFSLLIGDWYKSNHTALKKILDNGKKLPFPDGI  180



>tpg|DAA62867.1| TPA: hypothetical protein ZEAMMB73_701617 [Zea mays]
Length=217

 Score =   256 bits (654),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            +DPYR+FTW VTY  IYPLGV QQGILIN QFPGP+IE VTNDNL INVFN L++PFLLS
Sbjct  30   DDPYRFFTWTVTYGDIYPLGVKQQGILINNQFPGPQIEAVTNDNLIINVFNKLNEPFLLS  89

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W+G+Q RRNSFEDGV GTTCPI PG NFTY++Q KDQIG++YYFPSLAFHKAAGGFGGIR
Sbjct  90   WSGLQQRRNSFEDGVAGTTCPIPPGSNFTYIMQAKDQIGTYYYFPSLAFHKAAGGFGGIR  149

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            +LSRP+IPVPFP PAAD+T LIGDWYKANHT L+ VLD+G  L  PDG+
Sbjct  150  VLSRPQIPVPFPPPAADYTVLIGDWYKANHTDLRYVLDSGVALGFPDGL  198



>ref|XP_004232701.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=548

 Score =   266 bits (681),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            ++PYRY+TW +TY  IYPLGV QQGILINGQFPGP+I+CVTNDNL I+V+N L +PFL+S
Sbjct  30   DNPYRYYTWKITYGDIYPLGVKQQGILINGQFPGPQIDCVTNDNLIISVYNYLSEPFLIS  89

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNS++DGVYGTTCPILPG NFTY LQ KDQIGS++YFPSLA HKAAGG+G IR
Sbjct  90   WNGIQQRRNSWQDGVYGTTCPILPGKNFTYTLQAKDQIGSYFYFPSLAMHKAAGGYGAIR  149

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            + SRPRIPVPF  PA D+T L GD YK +H  LK +LD+GH LP PDG+
Sbjct  150  VYSRPRIPVPFAPPAHDFTVLAGDLYKRSHRQLKYILDSGHDLPLPDGL  198



>emb|CDP19581.1| unnamed protein product [Coffea canephora]
Length=541

 Score =   266 bits (680),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+FTWNVTY  IYPLGV QQGILINGQFPGP IE VTNDNL INVFN+LD+PFL+S
Sbjct  26   EDPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPAIESVTNDNLIINVFNNLDEPFLIS  85

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG++ RRNS++DGV+GT CPI PG N+TY LQVKDQIGS++YFPSLAFHKAAGG+GGI+
Sbjct  86   WNGLEQRRNSWQDGVWGTNCPIPPGKNYTYALQVKDQIGSYFYFPSLAFHKAAGGYGGIK  145

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SR  IPVPF  PA D+T L GDW+  +H  LK +LD+GH LP P+G+
Sbjct  146  IASRSVIPVPFAPPAGDYTILAGDWFNQSHNDLKAILDSGHNLPFPNGL  194



>ref|XP_006348131.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=548

 Score =   266 bits (679),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = +3

Query  129  DPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLSW  308
            +PYRY+TW +TY  IYPLGV QQGILINGQFPGP+I+CVTNDNL I+V+N L +PFL+SW
Sbjct  31   NPYRYYTWKITYGNIYPLGVKQQGILINGQFPGPQIDCVTNDNLIISVYNYLSEPFLISW  90

Query  309  NGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIRI  488
            NGIQ RRNS++DGVYG+TCPILPG NFTY LQ KDQIGS++YFPSLA HKAAGG+G IR+
Sbjct  91   NGIQQRRNSWQDGVYGSTCPILPGKNFTYTLQAKDQIGSYFYFPSLAMHKAAGGYGAIRV  150

Query  489  LSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
             SRPRIPVPF  PA D+T L GD YK +H  LK +LD+GH LP PDG+
Sbjct  151  YSRPRIPVPFAPPAHDFTVLAGDLYKRSHRQLKYILDSGHDLPLPDGL  198



>ref|XP_010089487.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB37880.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=300

 Score =   258 bits (659),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E PYR++ WNVTY  IYPLGV Q+GILINGQFPGP+IE VTNDNL I+VFNSLD+PFL+S
Sbjct  23   ESPYRFYDWNVTYGDIYPLGVKQRGILINGQFPGPQIESVTNDNLIISVFNSLDEPFLIS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++Y PSLAFHKAAGGFGGI+
Sbjct  83   WNGVQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYFYSPSLAFHKAAGGFGGIK  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPFP PA D+T L GDWYK NHT LK +LD GH LP PDG+
Sbjct  143  ILSRPVIPVPFPPPAGDFTILAGDWYKQNHTDLKAILDGGHDLPFPDGL  191



>dbj|BAK00459.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=542

 Score =   265 bits (678),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR++TWNVT+  +YPLGV QQGILINGQFPGP+I+ VTNDN+ INVFN+L  PFLLS
Sbjct  23   EDPYRFYTWNVTFGDVYPLGVKQQGILINGQFPGPQIDAVTNDNIVINVFNNLPAPFLLS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W GIQ RR+S++DGVYGT CP  PG NFTY +Q KDQIGS+YYFPSLAFHKAAGG+GGIR
Sbjct  83   WQGIQQRRSSWQDGVYGTNCPTPPGGNFTYNMQFKDQIGSYYYFPSLAFHKAAGGYGGIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            +LSRPRIPVPF  PA D+T L GDW+K NHT LK +LD+G+ LP PDG+
Sbjct  143  VLSRPRIPVPFDPPAGDFTILAGDWFKLNHTDLKGILDSGNDLPFPDGL  191



>ref|XP_004506275.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=536

 Score =   265 bits (677),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR++TWNVTY  IYP G+ QQGILINGQFPGP+IE VTNDN+ INVFNSLD+PFL+S
Sbjct  23   EDPYRFYTWNVTYGDIYPFGIQQQGILINGQFPGPQIESVTNDNVIINVFNSLDEPFLIS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+  RRNS++DGVYGT CPI PG NFTY LQVK+QIGS++YFPSLA HKAAGG+GG+ 
Sbjct  83   WNGVLQRRNSWQDGVYGTNCPIPPGQNFTYALQVKNQIGSYFYFPSLALHKAAGGYGGLS  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            + SRP IPVPF  P+ D+T L GDWY+ +HT L+ +LDNG+ LP PDGI
Sbjct  143  VASRPMIPVPFDPPSGDFTILAGDWYQKSHTELRAILDNGNNLPFPDGI  191



>ref|XP_004506310.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=536

 Score =   265 bits (677),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR++TWNVTY  IYP G+ QQGILINGQFPGP+IE VTNDN+ INVFNSLD+PFL+S
Sbjct  23   EDPYRFYTWNVTYGDIYPFGIQQQGILINGQFPGPQIESVTNDNVIINVFNSLDEPFLIS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+  RRNS++DGVYGT CPI PG NFTY LQVK+QIGS++YFPSLA HKAAGG+GG+ 
Sbjct  83   WNGVLQRRNSWQDGVYGTNCPIPPGQNFTYALQVKNQIGSYFYFPSLALHKAAGGYGGLS  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            + SRP IPVPF  P+ D+T L GDWY+ +HT L+ +LDNG+ LP PDGI
Sbjct  143  VASRPMIPVPFDPPSGDFTILAGDWYQKSHTELRAILDNGNNLPFPDGI  191



>gb|KHG02352.1| L-ascorbate oxidase [Gossypium arboreum]
Length=542

 Score =   265 bits (677),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E+PYRY TW VTY  IYPLGV QQGILINGQFPGP I+ VTNDNL I+V+N L++PFL+S
Sbjct  23   ENPYRYITWKVTYGDIYPLGVKQQGILINGQFPGPHIDAVTNDNLIISVYNYLNEPFLIS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGV GT CPI PG NFTY+LQVKDQIGSFYYFPSL FHKAAGG+G IR
Sbjct  83   WNGVQQRRNSWQDGVSGTNCPIRPGKNFTYVLQVKDQIGSFYYFPSLLFHKAAGGYGAIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPD  626
            I SRP+IPVPFP PA D+T L GDWYK NH  L+ +LD+GH LP PD
Sbjct  143  IWSRPKIPVPFPSPAGDFTVLAGDWYKRNHYVLRRLLDSGHNLPFPD  189



>dbj|BAJ91397.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=542

 Score =   265 bits (677),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR++TWNVT+  +YPLGV QQGILINGQFPGP+I+ VTNDN+ INVFN+L  PFLLS
Sbjct  23   EDPYRFYTWNVTFGDVYPLGVRQQGILINGQFPGPQIDAVTNDNIVINVFNNLPAPFLLS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W GIQ RR+S++DGVYGT CP  PG NFTY +Q KDQIGS+YYFPSLAFHKAAGG+GGIR
Sbjct  83   WQGIQQRRSSWQDGVYGTNCPTPPGGNFTYNMQFKDQIGSYYYFPSLAFHKAAGGYGGIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            +LSRPRIPVPF  PA D+T L GDW+K NHT LK +LD+G+ LP PDG+
Sbjct  143  VLSRPRIPVPFDPPAGDFTILAGDWFKLNHTDLKGILDSGNDLPFPDGL  191



>ref|XP_007213900.1| hypothetical protein PRUPE_ppa003872mg [Prunus persica]
 gb|EMJ15099.1| hypothetical protein PRUPE_ppa003872mg [Prunus persica]
Length=543

 Score =   265 bits (677),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+FTW +TY  IYPLGV QQGILINGQFPGP+I+ VTNDNL I+VFN L +PFL+S
Sbjct  24   EDPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLVISVFNYLREPFLIS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W+GIQ RRNS++DGVYGT CPILPG NFTY +QVKDQIGSF+YFPS  FHKAAGGFGGIR
Sbjct  84   WDGIQQRRNSWQDGVYGTNCPILPGKNFTYNIQVKDQIGSFFYFPSFLFHKAAGGFGGIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTL-KTVLDNGHRLPPPDGI  632
            I SRP+IPVPFP+PA D+T L GDWYK NH  L ++ L+ G  LP PDG+
Sbjct  144  IWSRPKIPVPFPNPAGDFTVLAGDWYKTNHYILRRSYLEFGRNLPSPDGL  193



>ref|XP_002320467.1| hypothetical protein POPTR_0014s15260g [Populus trichocarpa]
 gb|EEE98782.1| hypothetical protein POPTR_0014s15260g [Populus trichocarpa]
Length=532

 Score =   265 bits (676),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 140/169 (83%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            ED YR+ TWNVTY  IYPLGV QQGILINGQFPGP+IE VTNDNL I+VFNSLD+PFL+S
Sbjct  19   EDAYRFHTWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNDNLIISVFNSLDEPFLIS  78

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGT C I PG NFTY+LQVKDQIGS++YFPSL  HKAAGGFGG +
Sbjct  79   WNGVQQRRNSWQDGVYGTNCAIPPGQNFTYVLQVKDQIGSYFYFPSLGMHKAAGGFGGFK  138

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SR  IPVPF  P+ D+TFL GDW+K NH+ LK +LD G  LP PDG+
Sbjct  139  IASRSVIPVPFSPPSGDFTFLAGDWFKKNHSDLKAILDGGSDLPFPDGL  187



>ref|XP_004253203.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=543

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 141/169 (83%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E+PYR++ WNVTY TI PLGVPQQGILINGQFPGP+I  VTNDN+ INV N+LD  FLLS
Sbjct  23   ENPYRFYEWNVTYGTISPLGVPQQGILINGQFPGPDIISVTNDNVIINVINNLDDDFLLS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W+G+QNRRNS++DGV+GTTCPI PG NFTY LQ+KDQIGSFYYFP+ AFHKAAGGFG IR
Sbjct  83   WHGVQNRRNSYQDGVWGTTCPIPPGKNFTYRLQMKDQIGSFYYFPTTAFHKAAGGFGSIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I S P + VP P  A D+T LIGDWYK NHT LK +LD GH+LP PDGI
Sbjct  143  IFSGPFVHVPLPPYAGDFTVLIGDWYKRNHTNLKAILDRGHKLPFPDGI  191



>ref|XP_006656379.1| PREDICTED: L-ascorbate oxidase homolog [Oryza brachyantha]
Length=546

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            +DPYR++TWNVT+  IYPLGV QQGILINGQFPGP+I+ VTNDN+ INV+NSL  PFLLS
Sbjct  27   DDPYRFYTWNVTFGDIYPLGVKQQGILINGQFPGPQIDAVTNDNIVINVYNSLPSPFLLS  86

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W GIQ RR+S++DGVYGT CPI PG NFTY++Q KDQIGS+YYFPSLAFHKAAGG+GGIR
Sbjct  87   WQGIQQRRSSWQDGVYGTNCPIPPGGNFTYIMQFKDQIGSYYYFPSLAFHKAAGGYGGIR  146

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            +LSRP IPVPF  PA D+T L GDW+K NHT L+ +LD+G+ LP PDG+
Sbjct  147  VLSRPGIPVPFAPPAGDFTILAGDWFKLNHTDLQGILDSGNDLPFPDGL  195



>gb|KFK30447.1| hypothetical protein AALP_AA7G262200 [Arabis alpina]
Length=549

 Score =   264 bits (675),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 142/171 (83%), Gaps = 2/171 (1%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGV-PQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLL  302
            E+PYR+F W VTY  I P G  PQ+GILINGQFPGPEI  VTNDNL INV N LD+PFLL
Sbjct  26   ENPYRFFDWRVTYGNINPSGSSPQKGILINGQFPGPEIYSVTNDNLIINVHNDLDEPFLL  85

Query  303  SWNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGI  482
            SWNG+Q R+NS++DGVYGTTCPI PG N+TY +QVKDQIGSF+YFPSL  HKAAGG+G +
Sbjct  86   SWNGVQLRKNSYQDGVYGTTCPIPPGKNYTYAIQVKDQIGSFFYFPSLGLHKAAGGYGSL  145

Query  483  RILSRPRIPVPFPDPAADWTFLIGDWYK-ANHTTLKTVLDNGHRLPPPDGI  632
            RILSRPRIPVPFP+PA D+TFLIGDWY   +H TLK +LD GHRLP PD +
Sbjct  146  RILSRPRIPVPFPEPAGDFTFLIGDWYSNHDHKTLKALLDRGHRLPMPDTV  196



>ref|XP_010923874.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=542

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+FTWN+TY  I+PLGV QQGILINGQFPGP+IE VTNDNL INV+NSL +PFLLS
Sbjct  24   EDPYRFFTWNITYGDIWPLGVKQQGILINGQFPGPQIESVTNDNLIINVYNSLPEPFLLS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+  RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSLAFHKAAGGFGGIR
Sbjct  84   WNGVLQRRNSWQDGVYGTNCPIPPGGNFTYVLQVKDQIGSYFYFPSLAFHKAAGGFGGIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPFP PAAD+T LIGDWYKANHT LK +LD+G  LP PDG+
Sbjct  144  ILSRPLIPVPFPPPAADYTLLIGDWYKANHTDLKYILDSGKDLPFPDGV  192



>ref|XP_008224692.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=543

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 142/170 (84%), Gaps = 1/170 (1%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR FTW +TY  IYPLGV QQGILINGQFPGP+I+ VTNDNL I+VFN L +PFL+S
Sbjct  24   EDPYRLFTWKITYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLVISVFNYLREPFLIS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W+GIQ RRNS++DGVYGT CPILPG NFTY +QVKDQIGSF+YFPS  FHKAAGGFGGIR
Sbjct  84   WDGIQQRRNSWQDGVYGTNCPILPGKNFTYNIQVKDQIGSFFYFPSFLFHKAAGGFGGIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTL-KTVLDNGHRLPPPDGI  632
            I SRP+IPVPFP+PA D+T L GDWYK NH  L ++ L+ G  LP PDG+
Sbjct  144  IWSRPKIPVPFPNPAGDFTVLAGDWYKTNHYILRRSFLEFGRNLPSPDGL  193



>ref|XP_008789824.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Phoenix dactylifera]
Length=427

 Score =   260 bits (664),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            +DPYR+FTWN+TY  I+PLGV QQGILINGQFPGP+IE VTNDNL INVFNSL +PFLLS
Sbjct  31   DDPYRFFTWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTNDNLIINVFNSLPEPFLLS  90

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNS++DGVYGT CPI P  NFTY+LQVKDQIGS++YFPSLAFHKAAGGFGG R
Sbjct  91   WNGIQQRRNSWQDGVYGTNCPIPPRRNFTYVLQVKDQIGSYFYFPSLAFHKAAGGFGGFR  150

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPFP PA D+T LIGDWYKANHT LK VLD+G  L  PDG+
Sbjct  151  ILSRPLIPVPFPPPAGDYTLLIGDWYKANHTVLKYVLDSGRNLLFPDGV  199



>ref|XP_006342554.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Solanum tuberosum]
Length=706

 Score =   267 bits (683),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 141/169 (83%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            E+PYR++ WNVTY TI PLGVPQQGILINGQFPGP+I  VTNDN+ INVFN+LD  FL+S
Sbjct  186  ENPYRFYEWNVTYGTISPLGVPQQGILINGQFPGPDIISVTNDNIIINVFNNLDDDFLIS  245

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W+G+QNRRNSF+DGV+GTTCPI PG NFTY LQ+KDQIGSFYYFPS AFHKAAGGFG IR
Sbjct  246  WHGVQNRRNSFQDGVWGTTCPIPPGKNFTYRLQMKDQIGSFYYFPSTAFHKAAGGFGSIR  305

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I S P + VP P  + D+  LIGDWYK NHT LK +LD GH+LP PDGI
Sbjct  306  IFSGPFVTVPLPAYSGDFIALIGDWYKRNHTNLKAILDRGHKLPFPDGI  354



>ref|NP_001053555.1| Os04g0561900 [Oryza sativa Japonica Group]
 emb|CAE01850.2| OSJNBa0084K11.18 [Oryza sativa Japonica Group]
 dbj|BAF15469.1| Os04g0561900 [Oryza sativa Japonica Group]
 dbj|BAG92144.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92535.1| unnamed protein product [Oryza sativa Japonica Group]
Length=554

 Score =   263 bits (673),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 138/169 (82%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F W VT   I PLGV QQGILINGQFPGPEI+C TNDNL +NV N L +PFLLS
Sbjct  27   EDPYRFFDWEVTTGNINPLGVQQQGILINGQFPGPEIDCQTNDNLIVNVHNRLSEPFLLS  86

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q+R+NS++DGV GT CPI PG NFTY +Q KDQIGSF+YFPSLAFHKAAGGFG IR
Sbjct  87   WNGLQHRKNSWQDGVSGTNCPIPPGQNFTYQMQAKDQIGSFFYFPSLAFHKAAGGFGAIR  146

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SRP IPVPF  PA ++T LIGDWYK +H  L+ +LD+G +LP PDGI
Sbjct  147  IRSRPLIPVPFDPPAGEYTMLIGDWYKTSHKALQAMLDSGKQLPSPDGI  195



>ref|XP_003563398.1| PREDICTED: L-ascorbate oxidase homolog [Brachypodium distachyon]
Length=549

 Score =   263 bits (673),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR++TWN+T+  IYPLGV Q+GILINGQFPGP+I+ VTNDN+ INVFN+L  PFLLS
Sbjct  30   EDPYRFYTWNITFGDIYPLGVKQEGILINGQFPGPQIDAVTNDNIVINVFNNLPAPFLLS  89

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W GIQ RR+S++DGVYGT CPI PG NFTY +Q KDQIGS+YYFPSL  HKAAGG+GGIR
Sbjct  90   WQGIQQRRSSWQDGVYGTNCPIPPGGNFTYNMQFKDQIGSYYYFPSLELHKAAGGYGGIR  149

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            +LSRPRIPVPF  PA D+T L GDW+K NHT LK +LD+G+ LP PDG+
Sbjct  150  VLSRPRIPVPFDPPAGDFTILAGDWFKLNHTDLKGILDSGNDLPFPDGL  198



>ref|XP_008384084.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=543

 Score =   263 bits (672),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 142/170 (84%), Gaps = 1/170 (1%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+FTW VTY  IYPLGV QQGILINGQFPGP+I+ VTNDNL I+VFN L +PFL+S
Sbjct  24   EDPYRFFTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLVISVFNYLREPFLIS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W+GIQ RRNS++DGV+GTTCPI PG NFTY +QVKDQIGSF+YFPSL FHKAAGGFGGIR
Sbjct  84   WDGIQQRRNSWQDGVFGTTCPIPPGRNFTYNIQVKDQIGSFFYFPSLQFHKAAGGFGGIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKT-VLDNGHRLPPPDGI  632
            I SRP+IPVPFP PA D+T L GDW+K NH  L+   LD G  LP PDG+
Sbjct  144  IWSRPKIPVPFPTPAGDFTVLAGDWFKTNHYILRRGFLDRGRALPNPDGL  193



>ref|XP_008440923.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
 gb|ADN34061.1| multicopper oxidase [Cucumis melo subsp. melo]
Length=542

 Score =   263 bits (672),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 139/169 (82%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            ++PYR+FTW VTY  IYPLGV QQGILINGQFPGP+I+ VTNDNL INV+N L +PFL+S
Sbjct  24   DNPYRFFTWKVTYGNIYPLGVRQQGILINGQFPGPQIDAVTNDNLIINVYNYLKEPFLIS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGTTC I P  NFTY LQ KDQIGS++YFPS AFHKAAG FGGIR
Sbjct  84   WNGLQQRRNSWQDGVYGTTCAIPPMRNFTYTLQAKDQIGSYFYFPSTAFHKAAGAFGGIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SRP IPVPFP PA D+T L GDWYK NH  L+ VLD+G  LP PDG+
Sbjct  144  IWSRPGIPVPFPSPAGDFTVLAGDWYKTNHYILRRVLDSGKNLPSPDGL  192



>emb|CAH67167.1| H0211B05.4 [Oryza sativa Indica Group]
Length=554

 Score =   263 bits (673),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 138/169 (82%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+F W VT   I PLGV QQGILINGQFPGPEI+C TNDNL +NV N L +PFLLS
Sbjct  27   EDPYRFFDWEVTTGNINPLGVQQQGILINGQFPGPEIDCQTNDNLIVNVHNRLSEPFLLS  86

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q+R+NS++DGV GT CPI PG NFTY +Q KDQIGSF+YFPSLAFHKAAGGFG IR
Sbjct  87   WNGLQHRKNSWQDGVSGTNCPIPPGQNFTYQMQAKDQIGSFFYFPSLAFHKAAGGFGAIR  146

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SRP IPVPF  PA ++T LIGDWYK +H  L+ +LD+G +LP PDGI
Sbjct  147  IRSRPLIPVPFDPPAGEYTMLIGDWYKTSHKALQAMLDSGKQLPSPDGI  195



>ref|XP_009418785.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=543

 Score =   263 bits (671),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            +DPYR+FTWNVTY  I+P+GV QQGILINGQFPGP+IE VTNDNL INVFNSL +PFLLS
Sbjct  25   DDPYRFFTWNVTYGDIWPMGVKQQGILINGQFPGPQIEAVTNDNLIINVFNSLPEPFLLS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGT CPI PG NFTY++QVKDQIGS++YFPSLAFHKAAGGFGGIR
Sbjct  85   WNGVQQRRNSWQDGVYGTNCPIPPGGNFTYVMQVKDQIGSYFYFPSLAFHKAAGGFGGIR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            +LSRP IPVPFP PAAD+T LIG WYKANHT L+ +LD+G  LP PDGI
Sbjct  145  VLSRPLIPVPFPPPAADYTLLIGAWYKANHTDLRYILDSGRDLPFPDGI  193



>ref|XP_009418784.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=566

 Score =   263 bits (672),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            +DPYR+FTWNVTY  I+P+GV QQGILINGQFPGP+IE VTNDNL INVFNSL +PFLLS
Sbjct  25   DDPYRFFTWNVTYGDIWPMGVKQQGILINGQFPGPQIEAVTNDNLIINVFNSLPEPFLLS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGT CPI PG NFTY++QVKDQIGS++YFPSLAFHKAAGGFGGIR
Sbjct  85   WNGVQQRRNSWQDGVYGTNCPIPPGGNFTYVMQVKDQIGSYFYFPSLAFHKAAGGFGGIR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            +LSRP IPVPFP PAAD+T LIG WYKANHT L+ +LD+G  LP PDGI
Sbjct  145  VLSRPLIPVPFPPPAADYTLLIGAWYKANHTDLRYILDSGRDLPFPDGI  193



>ref|XP_003563038.1| PREDICTED: L-ascorbate oxidase homolog [Brachypodium distachyon]
Length=543

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+FTWNVTY  I+PLGV QQGILINGQFPGP+I+ VTNDNL +NV+N+L++PFLLS
Sbjct  25   EDPYRFFTWNVTYGDIFPLGVKQQGILINGQFPGPQIDAVTNDNLVVNVYNNLNEPFLLS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNSFEDGV GTTCPI PG NFTY+LQVKDQIG+++YFPSLAFHKAAGGFGGIR
Sbjct  85   WNGVQQRRNSFEDGVAGTTCPIPPGRNFTYILQVKDQIGTYFYFPSLAFHKAAGGFGGIR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            +LSRP IPVPFP PAAD+T LIGDWYK NHT L+ +LD+G  L  PDG+
Sbjct  145  VLSRPMIPVPFPPPAADFTALIGDWYKTNHTDLRYILDSGKTLGFPDGL  193



>gb|KFK44156.1| hypothetical protein AALP_AA1G222300 [Arabis alpina]
Length=538

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR F W+VTY  IYP+GV QQGILIN QFPGPEI  VTNDNL INVFN LD+PFL+S
Sbjct  24   EDPYRNFEWHVTYGDIYPMGVKQQGILINNQFPGPEIRSVTNDNLIINVFNELDEPFLIS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W GIQNR+NSF+DGVYGTTCPI PG N+TY LQVKDQIGSFYYFPSL FHKAAGGFG IR
Sbjct  84   WAGIQNRKNSFQDGVYGTTCPIPPGKNYTYALQVKDQIGSFYYFPSLGFHKAAGGFGAIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPFP PA D+T LIGDWYK NH  L+  LDNG +LP PDGI
Sbjct  144  ILSRPLIPVPFPPPADDFTVLIGDWYKTNHKALRAQLDNGGKLPLPDGI  192



>ref|XP_009397777.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=541

 Score =   261 bits (666),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            +DPYR+FTWN+TY  I+P+GV QQGILINGQFPGP+IE VTNDN+ INVFNSL +PFL+S
Sbjct  23   DDPYRFFTWNITYGDIWPMGVKQQGILINGQFPGPQIEAVTNDNVIINVFNSLPEPFLIS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNS++DGVYGT CPI PG NFTY++Q KDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  83   WNGIQQRRNSWQDGVYGTNCPIPPGRNFTYVMQFKDQIGSFFYFPSLAFHKAAGGFGGIR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            +LSRP IPVPFP PA D+T LIGDWYKANH+TLK VLD+G  L  PDG+
Sbjct  143  VLSRPLIPVPFPPPAGDFTLLIGDWYKANHSTLKYVLDSGRDLAFPDGV  191



>ref|XP_002438855.1| hypothetical protein SORBIDRAFT_10g027270 [Sorghum bicolor]
 gb|EER90222.1| hypothetical protein SORBIDRAFT_10g027270 [Sorghum bicolor]
Length=546

 Score =   261 bits (666),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            +DPYR++TWNVT+  IYPLGV Q+GILINGQFPGP+I+ VTNDN+ +NVFN+L  PFLLS
Sbjct  28   DDPYRFYTWNVTFGDIYPLGVKQEGILINGQFPGPQIDAVTNDNIIVNVFNNLPVPFLLS  87

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W GIQ RR+S++DGVYGT CPI PG NFTY +Q KDQIG++YYFPSL FHKAAGG+GGIR
Sbjct  88   WQGIQQRRSSWQDGVYGTNCPIPPGGNFTYNMQFKDQIGTYYYFPSLLFHKAAGGYGGIR  147

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            +LSRPRIPVPF  PA D+T L GDW+K NHT LK +LD+G+ LP PDG+
Sbjct  148  VLSRPRIPVPFDPPAGDFTILAGDWFKLNHTDLKGILDSGNDLPLPDGL  196



>ref|XP_006657750.1| PREDICTED: L-ascorbate oxidase homolog [Oryza brachyantha]
Length=551

 Score =   261 bits (666),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            +DPYR+FTW VTY  I PLGV QQGILINGQFPGP+IE VTNDNL INVFN+L +PFLLS
Sbjct  31   DDPYRFFTWTVTYGDIAPLGVKQQGILINGQFPGPQIEAVTNDNLIINVFNNLTEPFLLS  90

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNSFEDGV GTTCPI PG NFTY+LQVKDQIG+++YFPSLAFHKAAGGFGGIR
Sbjct  91   WNGIQQRRNSFEDGVAGTTCPIPPGGNFTYILQVKDQIGTYFYFPSLAFHKAAGGFGGIR  150

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            +LSRP IPVPFP PAAD+T L GDWYKANHT LK +LD+G  L  PDG+
Sbjct  151  VLSRPMIPVPFPPPAADYTLLAGDWYKANHTDLKYMLDSGKALGFPDGL  199



>ref|XP_010244491.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=543

 Score =   261 bits (666),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+FTWNVTY  IYPLGV QQGILINGQFPGP I+ V+NDNL I+V+NSLD+PFL+S
Sbjct  25   EDPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPLIDSVSNDNLIISVYNSLDEPFLIS  84

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  85   WNGVQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSFFYFPSLAFHKAAGGFGGIR  144

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SRP IPVPFP PA D+T L GDW+K NHT LK +LD+GH LP PDG+
Sbjct  145  INSRPMIPVPFPPPAGDYTILAGDWFKQNHTDLKAILDSGHDLPFPDGL  193



>ref|XP_006413696.1| hypothetical protein EUTSA_v10024862mg [Eutrema salsugineum]
 gb|ESQ55149.1| hypothetical protein EUTSA_v10024862mg [Eutrema salsugineum]
Length=541

 Score =   260 bits (665),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 139/169 (82%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            ++PYR+FTW +TY  IYPLGV QQGILINGQFPGP I+ +TNDN+ I+VFN L +PFL+S
Sbjct  22   DNPYRFFTWKITYGNIYPLGVKQQGILINGQFPGPHIDAITNDNIIISVFNYLKEPFLIS  81

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q R+NS++DGV GTTCPI PG NFTY++QVKDQIGSFYYFPSLAFHKAAG FG IR
Sbjct  82   WNGVQQRKNSWQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFYYFPSLAFHKAAGAFGAIR  141

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SRPRIPVPFP P  D+  L GDWYK NH  L+ +L+ G  LP PDG+
Sbjct  142  IWSRPRIPVPFPSPDGDFWLLAGDWYKTNHYVLRRLLEAGRNLPFPDGV  190



>ref|XP_010929557.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=541

 Score =   260 bits (665),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            +DPYR+FTWN+TY  I+PLGV QQGILINGQFPGP+IE VTNDN+ INVFNSL +PFLLS
Sbjct  23   DDPYRFFTWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTNDNIIINVFNSLPEPFLLS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNS++DGVYGT CPI P  NFTY+LQVKDQIGS++YFPSLAFHKAAGGFGG R
Sbjct  83   WNGIQQRRNSWQDGVYGTNCPIPPRRNFTYVLQVKDQIGSYFYFPSLAFHKAAGGFGGFR  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPFP PA D T LIGDWYKANHT LK +LD+G  LP PDG+
Sbjct  143  ILSRPLIPVPFPPPAGDHTLLIGDWYKANHTVLKYILDSGRNLPFPDGV  191



>ref|NP_001147597.1| LOC100281206 precursor [Zea mays]
 gb|ACG28039.1| L-ascorbate oxidase precursor [Zea mays]
 gb|ACL54459.1| unknown [Zea mays]
 gb|AFW68979.1| L-ascorbate oxidase [Zea mays]
Length=548

 Score =   260 bits (665),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            +DPYR++TWNVT+  IYPLGV Q+GILINGQFPGP+I+ VTNDN+ +NVFN+L  PFLLS
Sbjct  30   DDPYRFYTWNVTFGDIYPLGVKQEGILINGQFPGPQIDAVTNDNIIVNVFNNLPVPFLLS  89

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W GIQ RR+S++DGVYGT CPI PG NFTY +Q KDQIGS+YYFPSL FHKAAGG+G IR
Sbjct  90   WQGIQQRRSSWQDGVYGTNCPIPPGGNFTYNMQFKDQIGSYYYFPSLLFHKAAGGYGAIR  149

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            +LSRPRIPVPF  PA D+T L GDW+K NHT LK +LD+G+ LP PDG+
Sbjct  150  VLSRPRIPVPFDPPAGDFTILAGDWFKLNHTDLKGILDSGNDLPFPDGL  198



>ref|XP_010459724.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Camelina sativa]
Length=548

 Score =   260 bits (665),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 141/169 (83%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYRYF W++TY  IYP+GV QQGILIN  FPGPEI CVTNDNL INVFN LD+PFL+S
Sbjct  35   EDPYRYFQWHITYGDIYPMGVKQQGILINKMFPGPEIRCVTNDNLIINVFNHLDEPFLIS  94

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W GIQNR+NSF+DGVYGTTCPI PG NFTY LQVKDQIGSFYYFPSL FHKAAGGFG IR
Sbjct  95   WAGIQNRKNSFQDGVYGTTCPIPPGKNFTYALQVKDQIGSFYYFPSLGFHKAAGGFGAIR  154

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SRP IPVPFP PA D+T LIGDWYK NH  L+  LDNG +LP PD I
Sbjct  155  ISSRPLIPVPFPPPADDYTVLIGDWYKTNHKALRAQLDNGGKLPFPDVI  203



>gb|KGN64509.1| hypothetical protein Csa_1G062350 [Cucumis sativus]
Length=420

 Score =   256 bits (655),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 138/169 (82%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            ++PYR+FTW VTY  IYPLGV QQGILINGQFPGP+I+ VTNDNL INV+N L +PFL+S
Sbjct  24   DNPYRFFTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIINVYNYLKEPFLIS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGTTC I P  NFTY LQ KDQIGS++YFPS AFHKAAG FGGIR
Sbjct  84   WNGLQQRRNSWQDGVYGTTCAIPPMRNFTYTLQAKDQIGSYFYFPSTAFHKAAGAFGGIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SRP IPVPF  PA D+T L GDWYK NH  ++ VLD+G  +P PDG+
Sbjct  144  IWSRPGIPVPFAPPAGDFTVLAGDWYKTNHYIMRQVLDSGKNIPSPDGL  192



>ref|XP_010439384.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=541

 Score =   260 bits (664),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 139/169 (82%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            ++PYR+FTW +TY  IYPLGV QQGI+INGQFPGP I+ VTNDN+ I+VFN L +PFL+S
Sbjct  22   DNPYRFFTWKITYGDIYPLGVKQQGIMINGQFPGPHIDAVTNDNIIISVFNYLKEPFLIS  81

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q R+NS++DGV GTTCPI PG NFTY++QVKDQIGSFYYFPSLAFHKAAG FG IR
Sbjct  82   WNGVQQRKNSWQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFYYFPSLAFHKAAGAFGAIR  141

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            + SRPRIPVPFP P  D+  L GDWYK NH  L+ +L+ G  LP PDG+
Sbjct  142  VWSRPRIPVPFPSPDGDFWLLAGDWYKTNHYVLRRLLEAGRNLPMPDGV  190



>ref|XP_010448953.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=541

 Score =   260 bits (664),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 139/169 (82%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            ++PYR+FTW +TY  IYPLGV QQGI+INGQFPGP I+ VTNDN+ I+VFN L +PFL+S
Sbjct  22   DNPYRFFTWKITYGDIYPLGVKQQGIMINGQFPGPHIDAVTNDNIIISVFNYLKEPFLIS  81

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q R+NS++DGV GTTCPI PG NFTY++QVKDQIGSFYYFPSLAFHKAAG FG IR
Sbjct  82   WNGVQQRKNSWQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFYYFPSLAFHKAAGAFGAIR  141

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            + SRPRIPVPFP P  D+  L GDWYK NH  L+ +L+ G  LP PDG+
Sbjct  142  VWSRPRIPVPFPSPDGDFWLLAGDWYKTNHYVLRRLLEAGRNLPMPDGV  190



>ref|XP_010434093.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=541

 Score =   260 bits (664),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 139/169 (82%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            ++PYR+FTW +TY  IYPLGV QQGI+INGQFPGP I+ VTNDN+ I+VFN L +PFL+S
Sbjct  22   DNPYRFFTWKITYGDIYPLGVKQQGIMINGQFPGPHIDAVTNDNIIISVFNYLKEPFLIS  81

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q R+NS++DGV GTTCPI PG NFTY++QVKDQIGSFYYFPSLAFHKAAG FG IR
Sbjct  82   WNGVQQRKNSWQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFYYFPSLAFHKAAGAFGAIR  141

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            + SRPRIPVPFP P  D+  L GDWYK NH  L+ +L+ G  LP PDG+
Sbjct  142  VWSRPRIPVPFPSPDGDFWLLAGDWYKTNHYVLRRLLEAGRNLPMPDGV  190



>ref|XP_010459725.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Camelina sativa]
Length=537

 Score =   260 bits (664),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 141/169 (83%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYRYF W++TY  IYP+GV QQGILIN  FPGPEI CVTNDNL INVFN LD+PFL+S
Sbjct  24   EDPYRYFQWHITYGDIYPMGVKQQGILINKMFPGPEIRCVTNDNLIINVFNHLDEPFLIS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W GIQNR+NSF+DGVYGTTCPI PG NFTY LQVKDQIGSFYYFPSL FHKAAGGFG IR
Sbjct  84   WAGIQNRKNSFQDGVYGTTCPIPPGKNFTYALQVKDQIGSFYYFPSLGFHKAAGGFGAIR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SRP IPVPFP PA D+T LIGDWYK NH  L+  LDNG +LP PD I
Sbjct  144  ISSRPLIPVPFPPPADDYTVLIGDWYKTNHKALRAQLDNGGKLPFPDVI  192



>ref|XP_008806480.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=542

 Score =   260 bits (664),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+ TWNVTY  I+PLGV QQGILINGQFPGP+IE VTNDNL INVFNSL +PFLLS
Sbjct  24   EDPYRFLTWNVTYGDIWPLGVKQQGILINGQFPGPQIEAVTNDNLIINVFNSLPEPFLLS  83

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+  RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSLAFHKAAGGFGG R
Sbjct  84   WNGVLQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLAFHKAAGGFGGFR  143

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPFP PAAD+T L+GDWYKANHT LK +LD+G  L  PDG+
Sbjct  144  ILSRPMIPVPFPPPAADYTLLLGDWYKANHTDLKYILDSGKDLAFPDGV  192



>emb|CDX82897.1| BnaC01g13470D [Brassica napus]
Length=541

 Score =   259 bits (663),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 139/169 (82%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            ++PYR+FTW +TY  IYPLGV QQGILINGQFPGP I+ VTNDN+ I+VFN L +PFL+S
Sbjct  22   DNPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPHIDAVTNDNIIISVFNYLREPFLIS  81

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q R+NS++DGV GTTCPI PG NFTY++QVKDQIGSFYYFPSLAFHKAAG FG IR
Sbjct  82   WNGVQQRKNSYQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFYYFPSLAFHKAAGAFGAIR  141

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            + SRPRIPVPFP P  D+  L GDWYK NH  L+ +L+ G  +P PDG+
Sbjct  142  VWSRPRIPVPFPSPDGDFWLLAGDWYKTNHYVLRRLLEAGRNIPFPDGV  190



>ref|XP_002460757.1| hypothetical protein SORBIDRAFT_02g034420 [Sorghum bicolor]
 gb|EER97278.1| hypothetical protein SORBIDRAFT_02g034420 [Sorghum bicolor]
Length=548

 Score =   259 bits (663),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            +DPYR+FTW VTY  IYPLGV QQGILIN QFPGP+IE VTNDNL INVFN L++PFLLS
Sbjct  30   DDPYRFFTWTVTYGDIYPLGVKQQGILINNQFPGPQIEAVTNDNLIINVFNKLNEPFLLS  89

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            W+G+Q RRNSFEDGV GTTCPI PG NFTY++Q KDQIG++YYFPSLAFHKAAGGFGGIR
Sbjct  90   WSGLQQRRNSFEDGVAGTTCPIPPGANFTYIMQAKDQIGTYYYFPSLAFHKAAGGFGGIR  149

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            +LSRP+IPVPFP PAAD+T LIGDWYKANHT L+ VLD+G  +  PDG+
Sbjct  150  VLSRPQIPVPFPPPAADYTVLIGDWYKANHTDLRYVLDSGKAIGFPDGL  198



>ref|XP_008789823.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Phoenix dactylifera]
Length=549

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            +DPYR+FTWN+TY  I+PLGV QQGILINGQFPGP+IE VTNDNL INVFNSL +PFLLS
Sbjct  31   DDPYRFFTWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTNDNLIINVFNSLPEPFLLS  90

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNGIQ RRNS++DGVYGT CPI P  NFTY+LQVKDQIGS++YFPSLAFHKAAGGFGG R
Sbjct  91   WNGIQQRRNSWQDGVYGTNCPIPPRRNFTYVLQVKDQIGSYFYFPSLAFHKAAGGFGGFR  150

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            ILSRP IPVPFP PA D+T LIGDWYKANHT LK VLD+G  L  PDG+
Sbjct  151  ILSRPLIPVPFPPPAGDYTLLIGDWYKANHTVLKYVLDSGRNLLFPDGV  199



>ref|XP_002269614.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 emb|CBI28811.3| unnamed protein product [Vitis vinifera]
Length=541

 Score =   259 bits (662),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR+FTWNVTY  IYPLGV QQGILINGQFPGP IE VTNDNL ++V+NSLD+PFLLS
Sbjct  23   EDPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPPIESVTNDNLIVSVYNSLDEPFLLS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSLAFHKAAGG+GGI+
Sbjct  83   WNGVQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLAFHKAAGGYGGIK  142

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I SRP IPVPFP PA D+T L GDWYK NHT LK +LD G  LP PDG+
Sbjct  143  ISSRPLIPVPFPPPAGDYTILAGDWYKKNHTDLKAILDGGSDLPFPDGL  191



>gb|KEH29685.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=537

 Score =   259 bits (662),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 141/169 (83%), Gaps = 1/169 (1%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            EDPYR++ WNVTY  IYPLGV QQGILING+FPGP+IE VTNDNL INVFNSLD+PFL+S
Sbjct  23   EDPYRFYNWNVTYGDIYPLGVKQQGILINGKFPGPQIESVTNDNLIINVFNSLDEPFLIS  82

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+  RRNS++DGVYGT CPI PG N TY+LQVKDQIGS++YFPSLAFHKAAGG+GG  
Sbjct  83   WNGVLQRRNSWQDGVYGTNCPISPGKN-TYILQVKDQIGSYFYFPSLAFHKAAGGYGGFT  141

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            I +R  IPVPF  P+ D+T L GDWYK NHT L+ +LD+G  LP PDG+
Sbjct  142  IATRSVIPVPFDPPSGDFTILAGDWYKRNHTDLRAILDSGKNLPFPDGL  190



>ref|XP_009135529.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=541

 Score =   259 bits (662),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 139/169 (82%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  305
            ++PYR+FTW +TY  IYPLGV QQGILINGQFPGP I+ VTNDN+ I+VFN L +PFL+S
Sbjct  22   DNPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPHIDAVTNDNIIISVFNYLREPFLIS  81

Query  306  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  485
            WNG+Q R+NS++DGV GTTCPI PG NFTY++QVKDQIGSFYYFPSLAFHKAAG FG IR
Sbjct  82   WNGVQQRKNSYQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFYYFPSLAFHKAAGAFGAIR  141

Query  486  ILSRPRIPVPFPDPAADWTFLIGDWYKANHTTLKTVLDNGHRLPPPDGI  632
            + SRPRIPVPFP P  D+  L GDWYK NH  L+ +L+ G  +P PDG+
Sbjct  142  VWSRPRIPVPFPSPDGDFWLLAGDWYKTNHYVLRRLLEAGRNVPFPDGV  190



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 920235338500