BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS018B10

Length=612
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002509754.1|  hypothetical protein RCOM_1685990                  136   6e-33   
ref|XP_011072316.1|  PREDICTED: uncharacterized protein LOC105157...    133   1e-32   Sesamum indicum [beniseed]
ref|XP_011072312.1|  PREDICTED: uncharacterized protein LOC105157...    133   1e-32   Sesamum indicum [beniseed]
ref|XP_010661063.1|  PREDICTED: methyl-CpG-binding domain-contain...    129   2e-31   Vitis vinifera
ref|XP_010661055.1|  PREDICTED: methyl-CpG-binding domain-contain...    129   2e-31   Vitis vinifera
ref|XP_010661051.1|  PREDICTED: methyl-CpG-binding domain-contain...    129   3e-31   Vitis vinifera
gb|KDP25474.1|  hypothetical protein JCGZ_20630                         130   8e-31   Jatropha curcas
emb|CBI34715.3|  unnamed protein product                                129   1e-30   Vitis vinifera
ref|XP_008796740.1|  PREDICTED: uncharacterized protein LOC103712...    127   2e-30   Phoenix dactylifera
ref|XP_008796735.1|  PREDICTED: uncharacterized protein LOC103712...    128   2e-30   Phoenix dactylifera
ref|XP_008796737.1|  PREDICTED: uncharacterized protein LOC103712...    127   2e-30   Phoenix dactylifera
ref|XP_007158476.1|  hypothetical protein PHAVU_002G155600g             128   3e-30   Phaseolus vulgaris [French bean]
ref|XP_007158478.1|  hypothetical protein PHAVU_002G155600g             128   4e-30   Phaseolus vulgaris [French bean]
ref|XP_007158475.1|  hypothetical protein PHAVU_002G155600g             127   8e-30   Phaseolus vulgaris [French bean]
ref|XP_007158477.1|  hypothetical protein PHAVU_002G155600g             127   9e-30   Phaseolus vulgaris [French bean]
emb|CBI31785.3|  unnamed protein product                                124   1e-29   Vitis vinifera
ref|XP_010273135.1|  PREDICTED: methyl-CpG-binding domain-contain...    124   1e-29   Nelumbo nucifera [Indian lotus]
ref|XP_010662494.1|  PREDICTED: uncharacterized protein LOC100263...    125   1e-29   Vitis vinifera
gb|KDO55595.1|  hypothetical protein CISIN_1g0013392mg                  120   2e-29   Citrus sinensis [apfelsine]
gb|KDO55594.1|  hypothetical protein CISIN_1g0013392mg                  120   3e-29   Citrus sinensis [apfelsine]
ref|XP_008796741.1|  PREDICTED: uncharacterized protein LOC103712...    124   3e-29   Phoenix dactylifera
ref|XP_008796736.1|  PREDICTED: uncharacterized protein LOC103712...    124   3e-29   Phoenix dactylifera
ref|XP_008796738.1|  PREDICTED: uncharacterized protein LOC103712...    124   3e-29   Phoenix dactylifera
gb|KDO55591.1|  hypothetical protein CISIN_1g0013392mg                  120   4e-29   Citrus sinensis [apfelsine]
ref|XP_006440581.1|  hypothetical protein CICLE_v10018609mg             121   8e-28   Citrus clementina [clementine]
ref|XP_006440582.1|  hypothetical protein CICLE_v10018609mg             121   8e-28   Citrus clementina [clementine]
ref|XP_002276814.3|  PREDICTED: methyl-CpG-binding domain-contain...    118   8e-28   Vitis vinifera
ref|XP_006440583.1|  hypothetical protein CICLE_v10018609mg             121   8e-28   
ref|XP_004143925.1|  PREDICTED: uncharacterized protein LOC101223188    120   1e-27   Cucumis sativus [cucumbers]
gb|KEH21030.1|  methyl-CpG-binding domain protein                       120   2e-27   Medicago truncatula
ref|XP_008437229.1|  PREDICTED: transcriptional regulator ATRX ho...    119   2e-27   Cucumis melo [Oriental melon]
ref|XP_006477436.1|  PREDICTED: uncharacterized protein LOC102622266    119   4e-27   
ref|XP_010918514.1|  PREDICTED: methyl-CpG-binding domain-contain...    116   5e-27   
ref|XP_010918513.1|  PREDICTED: methyl-CpG-binding domain-contain...    116   6e-27   
ref|XP_004503754.1|  PREDICTED: uncharacterized protein LOC101511357    118   1e-26   Cicer arietinum [garbanzo]
ref|XP_008351681.1|  PREDICTED: uncharacterized protein LOC103415104    117   1e-26   
ref|XP_010934846.1|  PREDICTED: uncharacterized protein LOC105054...    117   1e-26   Elaeis guineensis
ref|XP_006358896.1|  PREDICTED: uncharacterized protein LOC102587...    117   3e-26   Solanum tuberosum [potatoes]
ref|XP_008238911.1|  PREDICTED: uncharacterized protein LOC103337528    115   3e-26   
gb|KJB39637.1|  hypothetical protein B456_007G022700                    117   3e-26   Gossypium raimondii
ref|XP_008392616.1|  PREDICTED: uncharacterized protein LOC103454798    117   3e-26   
ref|XP_009401688.1|  PREDICTED: uncharacterized protein LOC103985...    114   5e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007040167.1|  Uncharacterized protein TCM_016211                 116   6e-26   
ref|XP_006590528.1|  PREDICTED: methyl-CpG-binding domain-contain...    108   1e-25   
ref|XP_010325421.1|  PREDICTED: uncharacterized protein LOC101264...    115   1e-25   Solanum lycopersicum
ref|XP_011463824.1|  PREDICTED: uncharacterized protein LOC101312...    115   2e-25   Fragaria vesca subsp. vesca
ref|XP_007038658.1|  Methyl-CPG-binding domain protein 13, putati...    112   4e-25   
ref|XP_008791903.1|  PREDICTED: uncharacterized protein LOC103708650    112   5e-25   Phoenix dactylifera
ref|XP_007038659.1|  Methyl-CPG-binding domain protein 13, putati...    112   5e-25   
ref|XP_006358895.1|  PREDICTED: uncharacterized protein LOC102587...    113   6e-25   Solanum tuberosum [potatoes]
ref|XP_008437227.1|  PREDICTED: uncharacterized protein LOC103482...    112   6e-25   Cucumis melo [Oriental melon]
ref|XP_008437228.1|  PREDICTED: uncharacterized protein LOC103482...    112   7e-25   Cucumis melo [Oriental melon]
ref|XP_009375788.1|  PREDICTED: methyl-CpG-binding domain-contain...    112   9e-25   Pyrus x bretschneideri [bai li]
ref|XP_009375787.1|  PREDICTED: uncharacterized protein LOC103964...    112   1e-24   
ref|XP_011463825.1|  PREDICTED: uncharacterized protein LOC101312...    110   6e-24   Fragaria vesca subsp. vesca
gb|KHG28622.1|  Methyl-CpG-binding domain-containing 13 -like pro...    109   6e-24   Gossypium arboreum [tree cotton]
gb|KJB52811.1|  hypothetical protein B456_008G278300                    107   2e-23   Gossypium raimondii
emb|CDP05220.1|  unnamed protein product                                105   7e-23   Coffea canephora [robusta coffee]
ref|XP_009369054.1|  PREDICTED: uncharacterized protein LOC103958513    107   1e-22   
emb|CDP09782.1|  unnamed protein product                                103   7e-22   Coffea canephora [robusta coffee]
ref|XP_009390529.1|  PREDICTED: uncharacterized protein LOC103976...    102   1e-21   
ref|XP_009390518.1|  PREDICTED: uncharacterized protein LOC103976...    102   1e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390512.1|  PREDICTED: uncharacterized protein LOC103976...    102   1e-21   
ref|XP_007152298.1|  hypothetical protein PHAVU_004G117900g             101   3e-21   Phaseolus vulgaris [French bean]
ref|XP_009589209.1|  PREDICTED: uncharacterized protein LOC104086...    100   2e-20   Nicotiana tomentosiformis
gb|KHN16846.1|  Methyl-CpG-binding domain-containing protein 13       99.8    3e-20   Glycine soja [wild soybean]
ref|XP_003532403.1|  PREDICTED: methyl-CpG-binding domain-contain...  99.8    3e-20   Glycine max [soybeans]
ref|XP_009782392.1|  PREDICTED: uncharacterized protein LOC104231...  99.4    5e-20   Nicotiana sylvestris
ref|XP_009401689.1|  PREDICTED: uncharacterized protein LOC103985...  97.1    7e-20   
ref|XP_010325420.1|  PREDICTED: uncharacterized protein LOC101264...  98.6    1e-19   Solanum lycopersicum
ref|XP_004245626.1|  PREDICTED: uncharacterized protein LOC101264...  98.2    1e-19   Solanum lycopersicum
ref|XP_009782390.1|  PREDICTED: uncharacterized protein LOC104231...  97.8    2e-19   Nicotiana sylvestris
ref|XP_009782391.1|  PREDICTED: uncharacterized protein LOC104231...  97.8    2e-19   Nicotiana sylvestris
ref|XP_009589208.1|  PREDICTED: uncharacterized protein LOC104086...  97.8    2e-19   Nicotiana tomentosiformis
ref|XP_010676507.1|  PREDICTED: uncharacterized protein LOC104892...  97.4    2e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010676508.1|  PREDICTED: uncharacterized protein LOC104892...  97.1    2e-19   
ref|XP_006358894.1|  PREDICTED: uncharacterized protein LOC102587...  97.4    2e-19   Solanum tuberosum [potatoes]
ref|XP_010676506.1|  PREDICTED: uncharacterized protein LOC104892...  97.1    2e-19   Beta vulgaris subsp. vulgaris [field beet]
gb|EMS68477.1|  hypothetical protein TRIUR3_20569                     95.9    3e-19   Triticum urartu
ref|XP_008234128.1|  PREDICTED: methyl-CpG-binding domain-contain...  95.5    3e-19   Prunus mume [ume]
gb|KHN23667.1|  Methyl-CpG-binding domain-containing protein 13       96.3    4e-19   Glycine soja [wild soybean]
ref|XP_006580605.1|  PREDICTED: uncharacterized protein LOC100782433  96.3    4e-19   Glycine max [soybeans]
ref|XP_007160033.1|  hypothetical protein PHAVU_002G287000g           96.3    5e-19   Phaseolus vulgaris [French bean]
gb|EEC83090.1|  hypothetical protein OsI_28224                        95.1    6e-19   Oryza sativa Indica Group [Indian rice]
gb|EEE68228.1|  hypothetical protein OsJ_26412                        95.1    9e-19   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001052334.1|  Os04g0266400                                     91.7    1e-18   
gb|EEC76899.1|  hypothetical protein OsI_15124                        92.0    1e-18   Oryza sativa Indica Group [Indian rice]
gb|EMT22364.1|  hypothetical protein F775_06449                       93.6    1e-18   
emb|CAD39968.2|  OSJNBa0072D08.3                                      93.2    1e-18   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66253.1|  OSIGBa0139I12.2                                      93.2    2e-18   Oryza sativa [red rice]
gb|KJB39638.1|  hypothetical protein B456_007G022700                  94.4    2e-18   Gossypium raimondii
ref|NP_001061241.1|  Os08g0206700                                     92.0    2e-18   
gb|EYU38370.1|  hypothetical protein MIMGU_mgv1a007205mg              91.7    2e-18   Erythranthe guttata [common monkey flower]
dbj|BAG89597.1|  unnamed protein product                              92.8    3e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003581103.2|  PREDICTED: uncharacterized protein LOC100844...  92.4    3e-18   Brachypodium distachyon [annual false brome]
ref|XP_002510809.1|  conserved hypothetical protein                   92.4    4e-18   
ref|XP_004977782.1|  PREDICTED: uncharacterized protein LOC101761695  91.7    5e-18   
gb|EYU25079.1|  hypothetical protein MIMGU_mgv11b021680mg             89.4    9e-18   Erythranthe guttata [common monkey flower]
ref|XP_008439211.1|  PREDICTED: methyl-CpG-binding domain-contain...  86.7    1e-17   Cucumis melo [Oriental melon]
ref|XP_011048654.1|  PREDICTED: methyl-CpG-binding domain-contain...  91.7    1e-17   Populus euphratica
ref|XP_011048657.1|  PREDICTED: uncharacterized protein LOC105142...  91.3    1e-17   Populus euphratica
ref|XP_011048652.1|  PREDICTED: methyl-CpG-binding domain-contain...  91.3    2e-17   Populus euphratica
ref|XP_009418270.1|  PREDICTED: uncharacterized protein LOC103998...  88.2    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN74037.1|  hypothetical protein VITISV_023406                   90.9    2e-17   Vitis vinifera
ref|XP_008439209.1|  PREDICTED: methyl-CpG-binding domain-contain...  87.0    2e-17   Cucumis melo [Oriental melon]
ref|XP_006659212.1|  PREDICTED: uncharacterized protein LOC102718198  90.9    3e-17   Oryza brachyantha
ref|XP_011030071.1|  PREDICTED: methyl-CpG-binding domain-contain...  90.1    3e-17   Populus euphratica
ref|XP_011030070.1|  PREDICTED: methyl-CpG-binding domain-contain...  90.1    3e-17   Populus euphratica
ref|NP_001159179.1|  uncharacterized protein LOC100304264             88.2    4e-17   
ref|XP_011030072.1|  PREDICTED: methyl-CpG-binding domain-contain...  90.1    4e-17   Populus euphratica
ref|XP_011012359.1|  PREDICTED: methyl-CpG-binding domain-contain...  89.7    5e-17   Populus euphratica
ref|XP_006653226.1|  PREDICTED: uncharacterized protein LOC102699500  89.0    5e-17   
ref|XP_011012358.1|  PREDICTED: methyl-CpG-binding domain-contain...  89.7    5e-17   Populus euphratica
ref|XP_011012360.1|  PREDICTED: methyl-CpG-binding domain-contain...  89.4    7e-17   Populus euphratica
ref|XP_011041595.1|  PREDICTED: uncharacterized protein LOC105137...  89.0    8e-17   Populus euphratica
ref|XP_004972592.1|  PREDICTED: methyl-CpG-binding domain-contain...  89.4    9e-17   Setaria italica
ref|XP_011041592.1|  PREDICTED: uncharacterized protein LOC105137...  89.0    9e-17   Populus euphratica
ref|XP_011041593.1|  PREDICTED: uncharacterized protein LOC105137...  89.0    1e-16   Populus euphratica
ref|XP_011041590.1|  PREDICTED: uncharacterized protein LOC105137...  89.0    1e-16   Populus euphratica
gb|AFW57954.1|  methyl-binding domain MBD113 protein                  87.8    1e-16   
ref|XP_004234378.1|  PREDICTED: methyl-CpG-binding domain-contain...  88.2    1e-16   Solanum lycopersicum
ref|XP_008662320.1|  PREDICTED: LOC542207 isoform X3                  87.8    1e-16   Zea mays [maize]
ref|XP_008662316.1|  PREDICTED: LOC542207 isoform X1                  87.8    1e-16   
ref|XP_006353332.1|  PREDICTED: methyl-CpG-binding domain-contain...  87.8    2e-16   Solanum tuberosum [potatoes]
ref|XP_008662319.1|  PREDICTED: LOC542207 isoform X2                  87.4    2e-16   Zea mays [maize]
ref|XP_011048653.1|  PREDICTED: methyl-CpG-binding domain-contain...  87.8    3e-16   Populus euphratica
gb|KHN31504.1|  Methyl-CpG-binding domain-containing protein 13       87.0    3e-16   Glycine soja [wild soybean]
ref|XP_008439210.1|  PREDICTED: methyl-CpG-binding domain-contain...  82.8    6e-16   
ref|XP_011076193.1|  PREDICTED: methyl-CpG-binding domain-contain...  86.3    6e-16   
ref|XP_002444023.1|  hypothetical protein SORBIDRAFT_07g006030        86.3    1e-15   Sorghum bicolor [broomcorn]
ref|XP_008378256.1|  PREDICTED: uncharacterized protein LOC103441353  85.9    1e-15   
gb|EMS57086.1|  Methyl-CpG-binding domain-containing protein 13       85.9    1e-15   Triticum urartu
gb|EMT07793.1|  hypothetical protein F775_13908                       85.9    1e-15   
ref|XP_006827729.1|  hypothetical protein AMTR_s00009p00261370        85.9    1e-15   Amborella trichopoda
ref|XP_011041591.1|  PREDICTED: uncharacterized protein LOC105137...  85.1    2e-15   Populus euphratica
ref|XP_008678194.1|  PREDICTED: uncharacterized protein LOC103652994  84.7    3e-15   Zea mays [maize]
ref|XP_002321896.2|  hypothetical protein POPTR_0015s13470g           84.3    3e-15   Populus trichocarpa [western balsam poplar]
gb|AFW61002.1|  hypothetical protein ZEAMMB73_269384                  84.7    3e-15   
gb|EMT21477.1|  hypothetical protein F775_23896                       83.2    3e-15   
ref|XP_011084407.1|  PREDICTED: methyl-CpG-binding domain-contain...  83.2    4e-15   Sesamum indicum [beniseed]
ref|XP_009595657.1|  PREDICTED: methyl-CpG-binding domain-contain...  83.2    5e-15   Nicotiana tomentosiformis
ref|XP_006664919.1|  PREDICTED: uncharacterized protein LOC102722078  80.5    5e-15   
ref|XP_002318826.1|  hypothetical protein POPTR_0012s13490g           83.6    5e-15   
ref|XP_008662742.1|  PREDICTED: uncharacterized protein LOC103641...  83.6    6e-15   Zea mays [maize]
ref|XP_008662741.1|  PREDICTED: uncharacterized protein LOC103641...  83.6    6e-15   Zea mays [maize]
ref|XP_004976791.1|  PREDICTED: methyl-CpG-binding domain-contain...  82.0    6e-15   
ref|XP_010662495.1|  PREDICTED: uncharacterized protein LOC100263...  80.9    3e-14   Vitis vinifera
ref|XP_010234457.1|  PREDICTED: uncharacterized protein LOC100834...  81.6    3e-14   Brachypodium distachyon [annual false brome]
ref|XP_010234460.1|  PREDICTED: uncharacterized protein LOC100834...  81.6    3e-14   
ref|XP_009760427.1|  PREDICTED: methyl-CpG-binding domain-contain...  80.5    5e-14   Nicotiana sylvestris
gb|AFW57951.1|  methyl-binding domain MBD113 protein                  79.7    6e-14   
ref|XP_010035118.1|  PREDICTED: methyl-CpG-binding domain-contain...  80.5    7e-14   Eucalyptus grandis [rose gum]
ref|XP_010035117.1|  PREDICTED: uncharacterized protein LOC104424...  80.1    7e-14   Eucalyptus grandis [rose gum]
gb|EPS58890.1|  hypothetical protein M569_15921                       73.9    8e-14   Genlisea aurea
dbj|BAK01530.1|  predicted protein                                    80.1    9e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008796742.1|  PREDICTED: uncharacterized protein LOC103712...  79.7    1e-13   Phoenix dactylifera
gb|EEC77988.1|  hypothetical protein OsI_17375                        77.8    2e-13   Oryza sativa Indica Group [Indian rice]
ref|NP_001170014.1|  hypothetical protein                             78.2    2e-13   Zea mays [maize]
ref|NP_001053858.1|  Os04g0613800                                     77.8    2e-13   
emb|CAE05215.3|  OSJNBa0070C17.22                                     78.2    2e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007211158.1|  hypothetical protein PRUPE_ppa027142mg           79.0    2e-13   
gb|KDO60033.1|  hypothetical protein CISIN_1g008463mg                 78.6    2e-13   Citrus sinensis [apfelsine]
ref|XP_006652812.1|  PREDICTED: methyl-CpG-binding domain-contain...  77.4    2e-13   Oryza brachyantha
ref|XP_006652814.1|  PREDICTED: methyl-CpG-binding domain-contain...  77.0    2e-13   Oryza brachyantha
ref|XP_006490367.1|  PREDICTED: methyl-CpG-binding domain-contain...  78.2    3e-13   Citrus sinensis [apfelsine]
ref|XP_006421896.1|  hypothetical protein CICLE_v10004647mg           78.2    3e-13   Citrus clementina [clementine]
gb|KDO60032.1|  hypothetical protein CISIN_1g008463mg                 78.2    3e-13   Citrus sinensis [apfelsine]
dbj|BAA89308.1|  AHM2                                                 76.6    3e-13   Triticum aestivum [Canadian hard winter wheat]
gb|EAY93364.1|  hypothetical protein OsI_15161                        75.9    4e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_009371320.1|  PREDICTED: methyl-CpG-binding domain-contain...  77.4    4e-13   Pyrus x bretschneideri [bai li]
ref|XP_009418271.1|  PREDICTED: uncharacterized protein LOC103998...  74.7    5e-13   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAD39866.2|  OSJNBb0058J09.3                                      76.3    5e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006653233.1|  PREDICTED: uncharacterized protein LOC102703961  75.1    5e-13   
emb|CAH67925.1|  OSIGBa0138E08-OSIGBa0161L23.6                        76.3    5e-13   Oryza sativa [red rice]
ref|XP_009371318.1|  PREDICTED: methyl-CpG-binding domain-contain...  77.4    6e-13   Pyrus x bretschneideri [bai li]
ref|XP_004982529.1|  PREDICTED: uncharacterized protein LOC101763097  75.5    6e-13   
ref|XP_008376557.1|  PREDICTED: methyl-CpG-binding domain-contain...  76.6    8e-13   
ref|XP_008367419.1|  PREDICTED: uncharacterized protein LOC103431052  77.4    8e-13   
ref|XP_002466890.1|  hypothetical protein SORBIDRAFT_01g015930        73.9    1e-12   
ref|XP_002444304.1|  hypothetical protein SORBIDRAFT_07g019900        74.3    1e-12   
ref|XP_008796743.1|  PREDICTED: uncharacterized protein LOC103712...  75.9    1e-12   Phoenix dactylifera
ref|XP_002447565.1|  hypothetical protein SORBIDRAFT_06g004050        73.9    2e-12   
ref|XP_002448522.1|  hypothetical protein SORBIDRAFT_06g028360        73.9    4e-12   Sorghum bicolor [broomcorn]
ref|XP_008665005.1|  PREDICTED: uncharacterized protein LOC103643620  73.2    6e-12   
tpg|DAA59672.1|  TPA: hypothetical protein ZEAMMB73_581852            73.2    7e-12   
ref|XP_003580540.1|  PREDICTED: uncharacterized protein LOC100838054  73.2    7e-12   
ref|XP_002461981.1|  hypothetical protein SORBIDRAFT_02g011480        71.2    7e-12   
tpg|DAA50117.1|  TPA: hypothetical protein ZEAMMB73_042225            72.0    1e-11   
gb|AFW80349.1|  hypothetical protein ZEAMMB73_827373                  72.8    1e-11   
gb|AGT16604.1|  hypothetical protein SHCRBa_016_K03_R_160             71.6    3e-11   Saccharum hybrid cultivar R570
ref|XP_002444202.1|  hypothetical protein SORBIDRAFT_07g014920        70.5    4e-11   
gb|KHN28399.1|  Methyl-CpG-binding domain-containing protein 13       70.9    6e-11   Glycine soja [wild soybean]
ref|XP_010317585.1|  PREDICTED: methyl-CpG-binding domain-contain...  70.9    7e-11   
ref|XP_010934848.1|  PREDICTED: uncharacterized protein LOC105054...  70.9    7e-11   Elaeis guineensis
ref|XP_003572272.2|  PREDICTED: uncharacterized protein LOC100826562  69.7    8e-11   Brachypodium distachyon [annual false brome]
ref|XP_010089148.1|  Methyl-CpG-binding domain-containing protein 5   67.4    8e-11   
ref|XP_010255468.1|  PREDICTED: uncharacterized protein LOC104596...  70.5    1e-10   Nelumbo nucifera [Indian lotus]
gb|EEC76836.1|  hypothetical protein OsI_14986                        68.2    1e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_010255467.1|  PREDICTED: uncharacterized protein LOC104596...  70.5    1e-10   Nelumbo nucifera [Indian lotus]
gb|EEE60561.1|  hypothetical protein OsJ_13923                        68.9    1e-10   Oryza sativa Japonica Group [Japonica rice]
emb|CAE04540.2|  OSJNBa0040D17.8                                      68.2    3e-10   Oryza sativa Japonica Group [Japonica rice]
emb|CAE01997.2|  OSJNBb0033G08.13                                     67.8    3e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ29862.1|  hypothetical protein OsJ_13921                        68.2    3e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EMT11132.1|  hypothetical protein F775_24324                       67.8    5e-10   
emb|CAH67758.1|  H0124E07.5                                           67.0    7e-10   Oryza sativa [red rice]
gb|EAZ30036.1|  hypothetical protein OsJ_14093                        66.2    1e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010521336.1|  PREDICTED: methyl-CpG-binding domain-contain...  67.4    1e-09   
gb|ABO69709.1|  MBD3                                                  63.5    2e-09   Triticum aestivum [Canadian hard winter wheat]
gb|EEE60563.1|  hypothetical protein OsJ_13925                        65.5    2e-09   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001105290.1|  LOC542207                                        65.1    2e-09   
emb|CAE01991.2|  OSJNBb0033G08.7                                      65.9    2e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010482573.1|  PREDICTED: methyl-CpG-binding domain-contain...  65.9    4e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010482572.1|  PREDICTED: methyl-CpG-binding domain-contain...  65.5    4e-09   Camelina sativa [gold-of-pleasure]
gb|KFK26832.1|  hypothetical protein AALP_AA8G299600                  65.1    5e-09   Arabis alpina [alpine rockcress]
ref|XP_010444604.1|  PREDICTED: methyl-CpG-binding domain-contain...  64.3    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010444597.1|  PREDICTED: methyl-CpG-binding domain-contain...  63.9    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_007209689.1|  hypothetical protein PRUPE_ppa012392mg           60.5    2e-08   
ref|XP_002299872.1|  methyl-CpG-binding domain-containing family ...  60.8    3e-08   Populus trichocarpa [western balsam poplar]
gb|EMT08445.1|  hypothetical protein F775_07512                       61.6    3e-08   
dbj|BAJ99501.1|  predicted protein                                    62.4    3e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006369524.1|  hypothetical protein POPTR_0001s24690g           60.1    3e-08   
ref|XP_006369523.1|  hypothetical protein POPTR_0001s24690g           60.1    3e-08   
ref|XP_010107428.1|  Methyl-CpG-binding domain-containing protein 13  62.8    3e-08   
ref|XP_006279588.1|  hypothetical protein CARUB_v10026033mg           62.8    3e-08   
ref|XP_006279589.1|  hypothetical protein CARUB_v10026033mg           62.8    3e-08   Capsella rubella
gb|KDP34493.1|  hypothetical protein JCGZ_11043                       60.8    4e-08   Jatropha curcas
ref|XP_011042705.1|  PREDICTED: methyl-CpG-binding domain-contain...  60.1    5e-08   Populus euphratica
dbj|BAK04695.1|  predicted protein                                    62.0    5e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CBI16127.3|  unnamed protein product                              58.9    6e-08   Vitis vinifera
ref|XP_008674081.1|  PREDICTED: uncharacterized protein LOC103650258  59.3    6e-08   
ref|XP_010934847.1|  PREDICTED: uncharacterized protein LOC105054...  62.0    6e-08   
ref|XP_003632148.1|  PREDICTED: methyl-CpG-binding domain-contain...  60.8    7e-08   Vitis vinifera
ref|XP_002466891.1|  hypothetical protein SORBIDRAFT_01g015940        59.7    9e-08   
ref|XP_002314180.1|  methyl-CpG-binding domain-containing family ...  59.3    9e-08   
emb|CBI34714.3|  unnamed protein product                              60.8    1e-07   Vitis vinifera
gb|KHN35006.1|  hypothetical protein glysoja_004772                   57.8    3e-07   Glycine soja [wild soybean]
ref|XP_010693525.1|  PREDICTED: uncharacterized protein LOC104906467  59.3    3e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010685830.1|  PREDICTED: methyl-CpG-binding domain-contain...  58.9    3e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010264450.1|  PREDICTED: uncharacterized protein LOC104602...  58.9    3e-07   Nelumbo nucifera [Indian lotus]
ref|XP_010264451.1|  PREDICTED: uncharacterized protein LOC104602...  58.9    3e-07   Nelumbo nucifera [Indian lotus]
ref|XP_006401848.1|  hypothetical protein EUTSA_v10012954mg           59.7    4e-07   Eutrema salsugineum [saltwater cress]
ref|XP_011015295.1|  PREDICTED: methyl-CpG-binding domain-contain...  57.0    4e-07   Populus euphratica
emb|CDY31911.1|  BnaC09g28330D                                        58.9    5e-07   Brassica napus [oilseed rape]
ref|XP_009106826.1|  PREDICTED: LOW QUALITY PROTEIN: methyl-CpG-b...  58.9    6e-07   
ref|XP_006846186.1|  hypothetical protein AMTR_s00012p00212320        58.2    8e-07   
gb|AAM97069.1|  unknown protein                                       58.5    9e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200036.1|  methyl-CPG-binding domain protein 13                58.5    9e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006418884.1|  hypothetical protein EUTSA_v10002683mg           56.2    9e-07   Eutrema salsugineum [saltwater cress]
ref|XP_002865903.1|  hypothetical protein ARALYDRAFT_495292           57.8    1e-06   
ref|XP_010089149.1|  hypothetical protein L484_024324                 57.8    1e-06   
ref|XP_002532846.1|  DNA binding protein, putative                    56.2    2e-06   
emb|CDY00521.1|  BnaA10g07520D                                        57.0    2e-06   
ref|XP_004294545.1|  PREDICTED: methyl-CpG-binding domain-contain...  55.5    2e-06   Fragaria vesca subsp. vesca
gb|KGN57363.1|  hypothetical protein Csa_3G181990                     57.0    2e-06   Cucumis sativus [cucumbers]
ref|XP_009353664.1|  PREDICTED: methyl-CpG-binding domain-contain...  55.5    4e-06   Pyrus x bretschneideri [bai li]
ref|XP_008223622.1|  PREDICTED: methyl-CpG-binding domain-contain...  55.5    4e-06   Prunus mume [ume]
ref|XP_003549104.1|  PREDICTED: methyl-CpG-binding domain-contain...  56.2    4e-06   Glycine max [soybeans]
ref|XP_010934849.1|  PREDICTED: uncharacterized protein LOC105054...  54.7    1e-05   
ref|XP_009364396.1|  PREDICTED: methyl-CpG-binding domain-contain...  53.9    1e-05   Pyrus x bretschneideri [bai li]
ref|XP_008357235.1|  PREDICTED: methyl-CpG-binding domain-contain...  53.9    1e-05   Malus domestica [apple tree]
ref|XP_009345985.1|  PREDICTED: methyl-CpG-binding domain-contain...  53.5    1e-05   Pyrus x bretschneideri [bai li]
ref|XP_009345984.1|  PREDICTED: methyl-CpG-binding domain-contain...  53.5    2e-05   Pyrus x bretschneideri [bai li]
ref|XP_007016409.1|  Methyl-CPG-binding domain protein 5, putativ...  53.1    2e-05   
ref|XP_007016410.1|  Methyl-CPG-binding domain protein 5, putativ...  52.8    3e-05   Theobroma cacao [chocolate]
ref|XP_010106481.1|  Methyl-CpG-binding domain-containing protein 6   53.1    3e-05   Morus notabilis
emb|CDP06874.1|  unnamed protein product                              53.1    3e-05   Coffea canephora [robusta coffee]
ref|XP_010033125.1|  PREDICTED: methyl-CpG-binding domain-contain...  53.1    4e-05   Eucalyptus grandis [rose gum]
gb|KJB55876.1|  hypothetical protein B456_009G099200                  52.4    4e-05   Gossypium raimondii
gb|KCW52682.1|  hypothetical protein EUGRSUZ_J02050                   52.4    4e-05   Eucalyptus grandis [rose gum]
gb|KHG20117.1|  Methyl-CpG-binding domain-containing 5 -like protein  52.4    5e-05   Gossypium arboreum [tree cotton]
gb|AFW56991.1|  hypothetical protein ZEAMMB73_310321                  53.1    5e-05   
ref|XP_002448792.1|  hypothetical protein SORBIDRAFT_06g033275        52.8    5e-05   
ref|XP_002961436.1|  hypothetical protein SELMODRAFT_437797           52.8    6e-05   
ref|XP_011048656.1|  PREDICTED: uncharacterized protein LOC105142...  52.8    6e-05   Populus euphratica
ref|XP_011041594.1|  PREDICTED: uncharacterized protein LOC105137...  52.8    7e-05   Populus euphratica
ref|XP_002990266.1|  hypothetical protein SELMODRAFT_428715           52.0    1e-04   
emb|CDY33033.1|  BnaA10g12390D                                        51.6    1e-04   Brassica napus [oilseed rape]
gb|KHF99779.1|  Methyl-CpG-binding domain-containing 6 -like protein  50.8    2e-04   Gossypium arboreum [tree cotton]
ref|XP_010685758.1|  PREDICTED: methyl-CpG-binding domain-contain...  50.8    2e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010255469.1|  PREDICTED: uncharacterized protein LOC104596...  51.2    2e-04   
ref|XP_009121317.1|  PREDICTED: methyl-CpG-binding domain-contain...  50.4    2e-04   
gb|KJB83777.1|  hypothetical protein B456_013G263700                  50.4    2e-04   
emb|CDX80274.1|  BnaC09g34680D                                        50.8    3e-04   
ref|XP_009126698.1|  PREDICTED: methyl-CpG-binding domain-contain...  50.1    3e-04   
emb|CDY53445.1|  BnaA02g07070D                                        50.1    3e-04   
ref|XP_010541402.1|  PREDICTED: methyl-CpG-binding domain-contain...  49.7    3e-04   
ref|XP_006400967.1|  hypothetical protein EUTSA_v10014530mg           50.1    3e-04   
ref|XP_010541401.1|  PREDICTED: methyl-CpG-binding domain-contain...  49.7    4e-04   
ref|XP_004168988.1|  PREDICTED: methyl-CpG-binding domain-contain...  49.3    4e-04   
ref|XP_010503267.1|  PREDICTED: methyl-CpG-binding domain-contain...  48.9    4e-04   
gb|KFK27467.1|  hypothetical protein AALP_AA8G387100                  49.3    4e-04   
ref|XP_007514055.1|  predicted protein                                50.4    4e-04   
emb|CDY59223.1|  BnaCnng34510D                                        49.7    4e-04   
emb|CDY48687.1|  BnaC02g09990D                                        49.7    5e-04   
ref|XP_003619453.1|  Methyl binding domain protein                    50.1    5e-04   
gb|KGN65724.1|  hypothetical protein Csa_1G522010                     49.7    5e-04   
ref|XP_010514981.1|  PREDICTED: methyl-CpG-binding domain-contain...  48.9    5e-04   
ref|XP_010426094.1|  PREDICTED: methyl-CpG-binding domain-contain...  48.5    6e-04   
ref|XP_008457481.1|  PREDICTED: methyl-CpG-binding domain-contain...  49.7    6e-04   
gb|KFK27470.1|  hypothetical protein AALP_AA8G387500                  49.3    6e-04   
gb|KJB08887.1|  hypothetical protein B456_001G110900                  47.4    6e-04   
ref|XP_009604783.1|  PREDICTED: methyl-CpG-binding domain-contain...  49.3    6e-04   
ref|XP_004140849.1|  PREDICTED: uncharacterized protein LOC101215200  49.7    7e-04   
ref|NP_200746.1|  methyl-CpG-binding domain-containing protein 6      48.9    8e-04   
ref|XP_004167079.1|  PREDICTED: uncharacterized protein LOC101225631  49.3    8e-04   
ref|XP_002875791.1|  hypothetical protein ARALYDRAFT_485028           48.1    8e-04   
ref|XP_009787915.1|  PREDICTED: methyl-CpG-binding domain-contain...  48.9    8e-04   
ref|XP_002864630.1|  hypothetical protein ARALYDRAFT_919168           48.9    9e-04   
gb|KDP35643.1|  hypothetical protein JCGZ_09081                       48.9    9e-04   



>ref|XP_002509754.1| hypothetical protein RCOM_1685990 [Ricinus communis]
 gb|EEF51141.1| hypothetical protein RCOM_1685990 [Ricinus communis]
Length=978

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 102/184 (55%), Gaps = 37/184 (20%)
 Frame = +1

Query  1    TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTP  177
            TN+  +WLP GW VELK +++GS  G  YKCY+ PS G KFYSK +V + L +       
Sbjct  7    TNERPEWLPHGWIVELKIKNSGSARGRKYKCYVEPSTGYKFYSKPEVFRHLETTGL----  62

Query  178  IsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVS-----PAVAAQD  342
                                       +S TS+++++V+       VS       V  + 
Sbjct  63   ---------------------------KSCTSKQKEAVVSMLPTNKVSLRYPDAKVKIEK  95

Query  343  ISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKP  522
             + + LP GW+KE++ +   +GIRKDPYYIDPVSGY FRSKRDV RYLETG+I  C I P
Sbjct  96   STVEDLPTGWIKEIKIQRKTNGIRKDPYYIDPVSGYVFRSKRDVQRYLETGEISTCKILP  155

Query  523  KKRD  534
            ++RD
Sbjct  156  RRRD  159



>ref|XP_011072316.1| PREDICTED: uncharacterized protein LOC105157598 isoform X2 [Sesamum 
indicum]
Length=644

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 86/223 (39%), Positives = 116/223 (52%), Gaps = 32/223 (14%)
 Frame = +1

Query  1    TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTP  177
            TN S  WLP GWT+E KTR +GS  GS YK Y    SG +FYS+A V+++LN+  +SNT 
Sbjct  81   TNDSPGWLPSGWTMEEKTRQSGSRKGSVYKVYTDLSSGSRFYSRAAVTRYLNTVDHSNT-  139

Query  178  IsnenknnieesssnleVPQ-------NQTPKENQSRTSRKRKSVMDNQTPKTVSPA---  327
            ++ +NK +  +       PQ       +  P++N    S KR   +D  +P         
Sbjct  140  VTVQNKLDNVDEPVQNVSPQGISMTSTDHIPEKNNG--SFKRLDNVDEPSPDMFREGISM  197

Query  328  ------------------VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYE  453
                              VA +  +AD LP GW+KE+ T    + IRKDPYY DPVSGY 
Sbjct  198  TNTDHVPEKKKKSNSFETVAVESSAADDLPPGWIKEIITSKSGNRIRKDPYYTDPVSGYV  257

Query  454  FRSKRDVMRYLETGDIKKCVIKPKKRDESASKDIHHNIEEVSP  582
            FRSK D +RYL+T DI  C  +PKKR+    K I + +    P
Sbjct  258  FRSKMDALRYLKTNDIGSCACRPKKRELEDLKLIKNKVTSTVP  300



>ref|XP_011072312.1| PREDICTED: uncharacterized protein LOC105157598 isoform X1 [Sesamum 
indicum]
Length=645

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 86/223 (39%), Positives = 116/223 (52%), Gaps = 32/223 (14%)
 Frame = +1

Query  1    TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTP  177
            TN S  WLP GWT+E KTR +GS  GS YK Y    SG +FYS+A V+++LN+  +SNT 
Sbjct  82   TNDSPGWLPSGWTMEEKTRQSGSRKGSVYKVYTDLSSGSRFYSRAAVTRYLNTVDHSNT-  140

Query  178  IsnenknnieesssnleVPQ-------NQTPKENQSRTSRKRKSVMDNQTPKTVSPA---  327
            ++ +NK +  +       PQ       +  P++N    S KR   +D  +P         
Sbjct  141  VTVQNKLDNVDEPVQNVSPQGISMTSTDHIPEKNNG--SFKRLDNVDEPSPDMFREGISM  198

Query  328  ------------------VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYE  453
                              VA +  +AD LP GW+KE+ T    + IRKDPYY DPVSGY 
Sbjct  199  TNTDHVPEKKKKSNSFETVAVESSAADDLPPGWIKEIITSKSGNRIRKDPYYTDPVSGYV  258

Query  454  FRSKRDVMRYLETGDIKKCVIKPKKRDESASKDIHHNIEEVSP  582
            FRSK D +RYL+T DI  C  +PKKR+    K I + +    P
Sbjct  259  FRSKMDALRYLKTNDIGSCACRPKKRELEDLKLIKNKVTSTVP  301



>ref|XP_010661063.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X3 [Vitis vinifera]
Length=482

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 100/184 (54%), Gaps = 48/184 (26%)
 Frame = +1

Query  1    TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTP  177
            T +  DWLP GW +ELKT+ +GS  G  YKCY+ PS G +FYSK  V ++L         
Sbjct  18   TKKFPDWLPNGWILELKTQRSGSCVGKQYKCYLDPSTGYRFYSKPDVFRYL---------  68

Query  178  IsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPA------VAAQ  339
                                 +T K N S TSR++K          V P       V  +
Sbjct  69   ---------------------KTIKHN-SCTSRQKK----------VGPGMPSLGKVVIE  96

Query  340  DISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
              +ADGLPAGW+KE++ R   +GIR+DPYY DPVSGY FRS++DV RYL+TG+I +   K
Sbjct  97   RSTADGLPAGWIKEIKIRMNENGIRRDPYYTDPVSGYVFRSRKDVFRYLKTGEISRHAFK  156

Query  520  PKKR  531
            PK +
Sbjct  157  PKNK  160



>ref|XP_010661055.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Vitis vinifera]
Length=496

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 100/184 (54%), Gaps = 48/184 (26%)
 Frame = +1

Query  1    TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTP  177
            T +  DWLP GW +ELKT+ +GS  G  YKCY+ PS G +FYSK  V ++L         
Sbjct  32   TKKFPDWLPNGWILELKTQRSGSCVGKQYKCYLDPSTGYRFYSKPDVFRYL---------  82

Query  178  IsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPA------VAAQ  339
                                 +T K N S TSR++K          V P       V  +
Sbjct  83   ---------------------KTIKHN-SCTSRQKK----------VGPGMPSLGKVVIE  110

Query  340  DISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
              +ADGLPAGW+KE++ R   +GIR+DPYY DPVSGY FRS++DV RYL+TG+I +   K
Sbjct  111  RSTADGLPAGWIKEIKIRMNENGIRRDPYYTDPVSGYVFRSRKDVFRYLKTGEISRHAFK  170

Query  520  PKKR  531
            PK +
Sbjct  171  PKNK  174



>ref|XP_010661051.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Vitis vinifera]
Length=544

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 100/184 (54%), Gaps = 48/184 (26%)
 Frame = +1

Query  1    TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTP  177
            T +  DWLP GW +ELKT+ +GS  G  YKCY+ PS G +FYSK  V ++L         
Sbjct  80   TKKFPDWLPNGWILELKTQRSGSCVGKQYKCYLDPSTGYRFYSKPDVFRYL---------  130

Query  178  IsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPA------VAAQ  339
                                 +T K N S TSR++K          V P       V  +
Sbjct  131  ---------------------KTIKHN-SCTSRQKK----------VGPGMPSLGKVVIE  158

Query  340  DISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
              +ADGLPAGW+KE++ R   +GIR+DPYY DPVSGY FRS++DV RYL+TG+I +   K
Sbjct  159  RSTADGLPAGWIKEIKIRMNENGIRRDPYYTDPVSGYVFRSRKDVFRYLKTGEISRHAFK  218

Query  520  PKKR  531
            PK +
Sbjct  219  PKNK  222



>gb|KDP25474.1| hypothetical protein JCGZ_20630 [Jatropha curcas]
Length=1044

 Score =   130 bits (327),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 94/177 (53%), Gaps = 36/177 (20%)
 Frame = +1

Query  4    NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPI  180
            N+  +WLP GW VELKTR +G  +G  YKCY+ PS G KFYSK  V ++L +        
Sbjct  80   NERPEWLPNGWVVELKTRKSGDASGKVYKCYVDPSTGCKFYSKPAVVRYLETIKQ-----  134

Query  181  snenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGL  360
                              ++ TPK+         K  + +  P +    V  +  + D L
Sbjct  135  ------------------RSYTPKQ---------KETLKSALPTS---EVKFEKSTVDDL  164

Query  361  PAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKR  531
            P GW+KE++     +GIRKDPYYIDP+ GY FRSKRDV RYLETG I K    PKKR
Sbjct  165  PPGWIKEIKITANANGIRKDPYYIDPIKGYVFRSKRDVERYLETGKISKHAFLPKKR  221



>emb|CBI34715.3| unnamed protein product [Vitis vinifera]
Length=1076

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 100/184 (54%), Gaps = 48/184 (26%)
 Frame = +1

Query  1    TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTP  177
            T +  DWLP GW +ELKT+ +GS  G  YKCY+ PS G +FYSK  V ++L         
Sbjct  32   TKKFPDWLPNGWILELKTQRSGSCVGKQYKCYLDPSTGYRFYSKPDVFRYL---------  82

Query  178  IsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPA------VAAQ  339
                                 +T K N S TSR++K          V P       V  +
Sbjct  83   ---------------------KTIKHN-SCTSRQKK----------VGPGMPSLGKVVIE  110

Query  340  DISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
              +ADGLPAGW+KE++ R   +GIR+DPYY DPVSGY FRS++DV RYL+TG+I +   K
Sbjct  111  RSTADGLPAGWIKEIKIRMNENGIRRDPYYTDPVSGYVFRSRKDVFRYLKTGEISRHAFK  170

Query  520  PKKR  531
            PK +
Sbjct  171  PKNK  174



>ref|XP_008796740.1| PREDICTED: uncharacterized protein LOC103712110 isoform X5 [Phoenix 
dactylifera]
Length=652

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 102/181 (56%), Gaps = 23/181 (13%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnen  192
            DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    + N       
Sbjct  38   DWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMSCNP------  91

Query  193  knnieesssnleVPQNQTPKENQSRTSRK--RKSVMDNQTPKTVSPAVAAQDISADGLPA  366
                  +     V    T     S + RK  ++S M+NQ    +       + + DGLP+
Sbjct  92   -----RAKRKRSVVTKVTENACSSTSQRKGIKRSTMENQVRSQI-------EYTPDGLPS  139

Query  367  GWVKELRTRTCPS--GIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDES  540
            GW+KE+R R   S  G ++D YY DPV+G+ FRS++D ++Y+ETG++ K  IKPK R+ S
Sbjct  140  GWIKEIRYRKTSSRCGAKRDQYYTDPVNGFVFRSRKDAIQYIETGEVSKYAIKPKNRNTS  199

Query  541  A  543
             
Sbjct  200  G  200



>ref|XP_008796735.1| PREDICTED: uncharacterized protein LOC103712110 isoform X1 [Phoenix 
dactylifera]
Length=695

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 102/181 (56%), Gaps = 23/181 (13%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnen  192
            DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    + N       
Sbjct  81   DWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMSCN-------  133

Query  193  knnieesssnleVPQNQTPKENQSRTSRK--RKSVMDNQTPKTVSPAVAAQDISADGLPA  366
                  +     V    T     S + RK  ++S M+NQ    +       + + DGLP+
Sbjct  134  ----PRAKRKRSVVTKVTENACSSTSQRKGIKRSTMENQVRSQI-------EYTPDGLPS  182

Query  367  GWVKELRTRTCPS--GIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDES  540
            GW+KE+R R   S  G ++D YY DPV+G+ FRS++D ++Y+ETG++ K  IKPK R+ S
Sbjct  183  GWIKEIRYRKTSSRCGAKRDQYYTDPVNGFVFRSRKDAIQYIETGEVSKYAIKPKNRNTS  242

Query  541  A  543
             
Sbjct  243  G  243



>ref|XP_008796737.1| PREDICTED: uncharacterized protein LOC103712110 isoform X3 [Phoenix 
dactylifera]
Length=693

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 102/181 (56%), Gaps = 23/181 (13%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnen  192
            DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    + N       
Sbjct  81   DWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMSCNP------  134

Query  193  knnieesssnleVPQNQTPKENQSRTSRK--RKSVMDNQTPKTVSPAVAAQDISADGLPA  366
                  +     V    T     S + RK  ++S M+NQ    +       + + DGLP+
Sbjct  135  -----RAKRKRSVVTKVTENACSSTSQRKGIKRSTMENQVRSQI-------EYTPDGLPS  182

Query  367  GWVKELRTRTCPS--GIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDES  540
            GW+KE+R R   S  G ++D YY DPV+G+ FRS++D ++Y+ETG++ K  IKPK R+ S
Sbjct  183  GWIKEIRYRKTSSRCGAKRDQYYTDPVNGFVFRSRKDAIQYIETGEVSKYAIKPKNRNTS  242

Query  541  A  543
             
Sbjct  243  G  243



>ref|XP_007158476.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
 gb|ESW30470.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
Length=927

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 110/199 (55%), Gaps = 13/199 (7%)
 Frame = +1

Query  1    TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSNTPI  180
            +N+  +WLP GW VE KTR +G++ G  YKCYI P+G KFYSK +V ++L +  NSN+  
Sbjct  28   SNEHPEWLPDGWIVESKTRKSGANMGCGYKCYIDPTGCKFYSKPEVLRYLETV-NSNSHS  86

Query  181  snenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGL  360
            S + K      +      ++  P +  +    K+ S      P TV  +        + L
Sbjct  87   SKKEKMRKSNDAVEKSTAED-LPPDQIADVKMKKSSNGYRIDPDTVEKS------PVEDL  139

Query  361  PAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKR---  531
            P GW  E + R   +G RKD +YIDPVSGY FRSK+D +RY+++GDI  C IKP KR   
Sbjct  140  PPGWTIEAKVRKGGTGNRKDLFYIDPVSGYVFRSKKDALRYVKSGDISACAIKPFKRQNQ  199

Query  532  --DESASKDIHHNIEEVSP  582
              D+ +  D    +E++ P
Sbjct  200  DEDKVSDSDKKSQVEDLPP  218



>ref|XP_007158478.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
 gb|ESW30472.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
Length=972

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 110/199 (55%), Gaps = 13/199 (7%)
 Frame = +1

Query  1    TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSNTPI  180
            +N+  +WLP GW VE KTR +G++ G  YKCYI P+G KFYSK +V ++L +  NSN+  
Sbjct  28   SNEHPEWLPDGWIVESKTRKSGANMGCGYKCYIDPTGCKFYSKPEVLRYLETV-NSNSHS  86

Query  181  snenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGL  360
            S + K      +      ++  P +  +    K+ S      P TV  +        + L
Sbjct  87   SKKEKMRKSNDAVEKSTAED-LPPDQIADVKMKKSSNGYRIDPDTVEKS------PVEDL  139

Query  361  PAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKR---  531
            P GW  E + R   +G RKD +YIDPVSGY FRSK+D +RY+++GDI  C IKP KR   
Sbjct  140  PPGWTIEAKVRKGGTGNRKDLFYIDPVSGYVFRSKKDALRYVKSGDISACAIKPFKRQNQ  199

Query  532  --DESASKDIHHNIEEVSP  582
              D+ +  D    +E++ P
Sbjct  200  DEDKVSDSDKKSQVEDLPP  218


 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 81/171 (47%), Gaps = 37/171 (22%)
 Frame = +1

Query  22   LPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnenkn  198
            LPPGWT+E K R  G+ N      YI P SG  F SK    +++ S   S   I    + 
Sbjct  139  LPPGWTIEAKVRKGGTGNRKDL-FYIDPVSGYVFRSKKDALRYVKSGDISACAIKPFKR-  196

Query  199  nieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVK  378
                        QNQ   E++   S K+  V D                    LP GW+ 
Sbjct  197  ------------QNQ--DEDKVSDSDKKSQVED--------------------LPPGWIT  222

Query  379  ELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKR  531
            E + R   +G +KD  Y+DPVSGY FRSK+D +RY+ +GDI  CV+KP KR
Sbjct  223  EAKVRKGGTGKKKDLLYLDPVSGYVFRSKKDALRYVNSGDIDTCVLKPYKR  273



>ref|XP_007158475.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
 gb|ESW30469.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
Length=959

 Score =   127 bits (319),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 105/190 (55%), Gaps = 8/190 (4%)
 Frame = +1

Query  1    TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSNTPI  180
            +N+  +WLP GW VE KTR +G++ G  YKCYI P+G KFYSK +V ++L +  NSN+  
Sbjct  28   SNEHPEWLPDGWIVESKTRKSGANMGCGYKCYIDPTGCKFYSKPEVLRYLETV-NSNSHS  86

Query  181  snenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGL  360
            S + K      +      ++  P +  +    K+ S      P TV  +        + L
Sbjct  87   SKKEKMRKSNDAVEKSTAED-LPPDQIADVKMKKSSNGYRIDPDTVEKS------PVEDL  139

Query  361  PAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDES  540
            P GW  E + R   +G RKD +YIDPVSGY FRSK+D +RY+++GDI  C IKP KR   
Sbjct  140  PPGWTIEAKVRKGGTGNRKDLFYIDPVSGYVFRSKKDALRYVKSGDISACAIKPFKRQNQ  199

Query  541  ASKDIHHNIE  570
                + + +E
Sbjct  200  DEDKVSNAVE  209



>ref|XP_007158477.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
 gb|ESW30471.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
Length=1004

 Score =   127 bits (318),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 105/190 (55%), Gaps = 8/190 (4%)
 Frame = +1

Query  1    TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSNTPI  180
            +N+  +WLP GW VE KTR +G++ G  YKCYI P+G KFYSK +V ++L +  NSN+  
Sbjct  28   SNEHPEWLPDGWIVESKTRKSGANMGCGYKCYIDPTGCKFYSKPEVLRYLETV-NSNSHS  86

Query  181  snenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGL  360
            S + K      +      ++  P +  +    K+ S      P TV  +        + L
Sbjct  87   SKKEKMRKSNDAVEKSTAED-LPPDQIADVKMKKSSNGYRIDPDTVEKS------PVEDL  139

Query  361  PAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDES  540
            P GW  E + R   +G RKD +YIDPVSGY FRSK+D +RY+++GDI  C IKP KR   
Sbjct  140  PPGWTIEAKVRKGGTGNRKDLFYIDPVSGYVFRSKKDALRYVKSGDISACAIKPFKRQNQ  199

Query  541  ASKDIHHNIE  570
                + + +E
Sbjct  200  DEDKVSNAVE  209


 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/171 (36%), Positives = 86/171 (50%), Gaps = 5/171 (3%)
 Frame = +1

Query  22   LPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnenkn  198
            LPPGWT+E K R  G+ N      YI P SG  F SK    +++ S   S   I    + 
Sbjct  139  LPPGWTIEAKVRKGGTGNRKDL-FYIDPVSGYVFRSKKDALRYVKSGDISACAIKPFKRQ  197

Query  199  nieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVK  378
            N +E   +  V ++    E+       +  +      K + P    +    D LP GW+ 
Sbjct  198  NQDEDKVSNAVEKSII--EDLPPGHLTKVKIRKGSNGKRIDPDSDKKSQVED-LPPGWIT  254

Query  379  ELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKR  531
            E + R   +G +KD  Y+DPVSGY FRSK+D +RY+ +GDI  CV+KP KR
Sbjct  255  EAKVRKGGTGKKKDLLYLDPVSGYVFRSKKDALRYVNSGDIDTCVLKPYKR  305



>emb|CBI31785.3| unnamed protein product [Vitis vinifera]
Length=560

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 106/205 (52%), Gaps = 57/205 (28%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsn  186
            S DWLPPGW VE+K  STG      YKCYI PS G KFYSK +VS++LN A         
Sbjct  6    SDDWLPPGWKVEMKLTSTGRK----YKCYIHPSRGLKFYSKPEVSRYLNKA---------  52

Query  187  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPA-------------  327
                           P N        R S ++KS+      KT++PA             
Sbjct  53   ---------------PLN-------DRESIQKKSIERKTPIKTMAPAGKKKSMEKKKHCI  90

Query  328  ---VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGD  498
               V  + ++A+GLP GW+KE++ +     +R+D YY DPV+GY FRS +D +RYL+TGD
Sbjct  91   AKKVVFERVTAEGLPPGWIKEIKIQKKCGTVRRDAYYTDPVNGYIFRSMKDTLRYLKTGD  150

Query  499  IKKCVIKPKKRDESASKDIHHNIEE  573
              +   KPK RD   S DI  N+E+
Sbjct  151  PGRLAFKPKPRD---SGDI--NLED  170



>ref|XP_010273135.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 [Nelumbo 
nucifera]
 ref|XP_010273136.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 [Nelumbo 
nucifera]
Length=553

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 98/175 (56%), Gaps = 44/175 (25%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsnen  192
            +WLP GW VE+KTR +GS  G  YKCYI+PS G K YSK +V ++L+             
Sbjct  29   EWLPAGWVVEIKTRMSGSSAGQKYKCYIAPSTGCKLYSKKEVQRYLSC------------  76

Query  193  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  372
                        +P+             KRK   + Q+    +  V  +D++ + LP GW
Sbjct  77   -----------YMPE------------VKRKECKNMQS----ACNVVLKDVTEE-LPPGW  108

Query  373  VKELRTR--TCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKR  531
            +KE+R R  TC +  + D YYIDPV+GYEFRSK+DV RYL TGD++ C IKPKKR
Sbjct  109  IKEIRVRRKTCKTK-KSDTYYIDPVNGYEFRSKKDVFRYLGTGDLENCAIKPKKR  162



>ref|XP_010662494.1| PREDICTED: uncharacterized protein LOC100263513 isoform X1 [Vitis 
vinifera]
Length=637

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 106/205 (52%), Gaps = 57/205 (28%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsn  186
            S DWLPPGW VE+K  STG      YKCYI PS G KFYSK +VS++LN A         
Sbjct  6    SDDWLPPGWKVEMKLTSTGRK----YKCYIHPSRGLKFYSKPEVSRYLNKA---------  52

Query  187  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPA-------------  327
                           P N        R S ++KS+      KT++PA             
Sbjct  53   ---------------PLN-------DRESIQKKSIERKTPIKTMAPAGKKKSMEKKKHCI  90

Query  328  ---VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGD  498
               V  + ++A+GLP GW+KE++ +     +R+D YY DPV+GY FRS +D +RYL+TGD
Sbjct  91   AKKVVFERVTAEGLPPGWIKEIKIQKKCGTVRRDAYYTDPVNGYIFRSMKDTLRYLKTGD  150

Query  499  IKKCVIKPKKRDESASKDIHHNIEE  573
              +   KPK RD   S DI  N+E+
Sbjct  151  PGRLAFKPKPRD---SGDI--NLED  170



>gb|KDO55595.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
Length=267

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 94/185 (51%), Gaps = 21/185 (11%)
 Frame = +1

Query  4    NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPI  180
            N   DWLP GW V+LKTR +GS  G  YK YI P +G KF+S  +V + L S  N N+  
Sbjct  98   NNRPDWLPDGWVVDLKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKNRNSEC  157

Query  181  snenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGL  360
              +              P   +  E   + S KR+        +  +  V  +  +   L
Sbjct  158  ERKT------------TPTETSKYEGTRKVSTKRE--------RETTERVVVEKSTVVDL  197

Query  361  PAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDES  540
            P  W KE + +    GIRKD Y+ DPVSGY F SK+DV RYLETG+I K   KP+KR   
Sbjct  198  PPSWTKETKIKKTARGIRKDRYFTDPVSGYVFCSKKDVFRYLETGEISKYAFKPRKRGAD  257

Query  541  ASKDI  555
            AS+ +
Sbjct  258  ASELV  262



>gb|KDO55594.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
Length=273

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 94/185 (51%), Gaps = 21/185 (11%)
 Frame = +1

Query  4    NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPI  180
            N   DWLP GW V+LKTR +GS  G  YK YI P +G KF+S  +V + L S  N N+  
Sbjct  104  NNRPDWLPDGWVVDLKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKNRNSEC  163

Query  181  snenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGL  360
              +              P   +  E   + S KR+        +  +  V  +  +   L
Sbjct  164  ERKT------------TPTETSKYEGTRKVSTKRE--------RETTERVVVEKSTVVDL  203

Query  361  PAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDES  540
            P  W KE + +    GIRKD Y+ DPVSGY F SK+DV RYLETG+I K   KP+KR   
Sbjct  204  PPSWTKETKIKKTARGIRKDRYFTDPVSGYVFCSKKDVFRYLETGEISKYAFKPRKRGAD  263

Query  541  ASKDI  555
            AS+ +
Sbjct  264  ASELV  268



>ref|XP_008796741.1| PREDICTED: uncharacterized protein LOC103712110 isoform X6 [Phoenix 
dactylifera]
Length=651

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 103/182 (57%), Gaps = 26/182 (14%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnen  192
            DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    + N       
Sbjct  38   DWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMSCNP------  91

Query  193  knnieesssnleVPQNQTPKENQSRTSRK--RKSVMDNQTPKTVSPAVAAQ-DISADGLP  363
                  +     V    T     S + RK  ++S M+N         V +Q + + DGLP
Sbjct  92   -----RAKRKRSVVTKVTENACSSTSQRKGIKRSTMEN---------VRSQIEYTPDGLP  137

Query  364  AGWVKELRTRTCPS--GIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDE  537
            +GW+KE+R R   S  G ++D YY DPV+G+ FRS++D ++Y+ETG++ K  IKPK R+ 
Sbjct  138  SGWIKEIRYRKTSSRCGAKRDQYYTDPVNGFVFRSRKDAIQYIETGEVSKYAIKPKNRNT  197

Query  538  SA  543
            S 
Sbjct  198  SG  199



>ref|XP_008796736.1| PREDICTED: uncharacterized protein LOC103712110 isoform X2 [Phoenix 
dactylifera]
Length=694

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 103/182 (57%), Gaps = 26/182 (14%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnen  192
            DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    + N       
Sbjct  81   DWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMSCN-------  133

Query  193  knnieesssnleVPQNQTPKENQSRTSRK--RKSVMDNQTPKTVSPAVAAQ-DISADGLP  363
                  +     V    T     S + RK  ++S M+N         V +Q + + DGLP
Sbjct  134  ----PRAKRKRSVVTKVTENACSSTSQRKGIKRSTMEN---------VRSQIEYTPDGLP  180

Query  364  AGWVKELRTRTCPS--GIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDE  537
            +GW+KE+R R   S  G ++D YY DPV+G+ FRS++D ++Y+ETG++ K  IKPK R+ 
Sbjct  181  SGWIKEIRYRKTSSRCGAKRDQYYTDPVNGFVFRSRKDAIQYIETGEVSKYAIKPKNRNT  240

Query  538  SA  543
            S 
Sbjct  241  SG  242



>ref|XP_008796738.1| PREDICTED: uncharacterized protein LOC103712110 isoform X4 [Phoenix 
dactylifera]
Length=692

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 103/182 (57%), Gaps = 26/182 (14%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnen  192
            DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    + N       
Sbjct  81   DWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMSCNP------  134

Query  193  knnieesssnleVPQNQTPKENQSRTSRK--RKSVMDNQTPKTVSPAVAAQ-DISADGLP  363
                  +     V    T     S + RK  ++S M+N         V +Q + + DGLP
Sbjct  135  -----RAKRKRSVVTKVTENACSSTSQRKGIKRSTMEN---------VRSQIEYTPDGLP  180

Query  364  AGWVKELRTRTCPS--GIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDE  537
            +GW+KE+R R   S  G ++D YY DPV+G+ FRS++D ++Y+ETG++ K  IKPK R+ 
Sbjct  181  SGWIKEIRYRKTSSRCGAKRDQYYTDPVNGFVFRSRKDAIQYIETGEVSKYAIKPKNRNT  240

Query  538  SA  543
            S 
Sbjct  241  SG  242



>gb|KDO55591.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
 gb|KDO55592.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
 gb|KDO55593.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
Length=296

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 94/185 (51%), Gaps = 21/185 (11%)
 Frame = +1

Query  4    NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPI  180
            N   DWLP GW V+LKTR +GS  G  YK YI P +G KF+S  +V + L S  N N+  
Sbjct  127  NNRPDWLPDGWVVDLKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKNRNSEC  186

Query  181  snenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGL  360
              +              P   +  E   + S KR+        +  +  V  +  +   L
Sbjct  187  ERKT------------TPTETSKYEGTRKVSTKRE--------RETTERVVVEKSTVVDL  226

Query  361  PAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDES  540
            P  W KE + +    GIRKD Y+ DPVSGY F SK+DV RYLETG+I K   KP+KR   
Sbjct  227  PPSWTKETKIKKTARGIRKDRYFTDPVSGYVFCSKKDVFRYLETGEISKYAFKPRKRGAD  286

Query  541  ASKDI  555
            AS+ +
Sbjct  287  ASELV  291



>ref|XP_006440581.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
 gb|ESR53821.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
Length=1065

 Score =   121 bits (304),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 94/185 (51%), Gaps = 21/185 (11%)
 Frame = +1

Query  4    NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPI  180
            N   DWLP GW VELKTR +GS  G  YK YI P +G KF+S  +V + L S  N N+  
Sbjct  98   NNRPDWLPDGWVVELKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKNRNSEC  157

Query  181  snenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGL  360
              +              P   +  E   + S KR+        +  +  V  +  +   L
Sbjct  158  ERKT------------TPTETSKYEGTRKVSTKRE--------RETTERVVVEKSTVVDL  197

Query  361  PAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDES  540
            P  W KE + +    GIRKD Y+ DPVSGY F SK+DV RYLETG+I K   KP+KR   
Sbjct  198  PPSWTKETKIKKTARGIRKDRYFTDPVSGYVFCSKKDVFRYLETGEISKYAFKPRKRGAD  257

Query  541  ASKDI  555
            AS+ +
Sbjct  258  ASELV  262



>ref|XP_006440582.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
 gb|ESR53822.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
Length=1094

 Score =   121 bits (304),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 94/185 (51%), Gaps = 21/185 (11%)
 Frame = +1

Query  4    NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPI  180
            N   DWLP GW VELKTR +GS  G  YK YI P +G KF+S  +V + L S  N N+  
Sbjct  127  NNRPDWLPDGWVVELKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKNRNSEC  186

Query  181  snenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGL  360
              +              P   +  E   + S KR+        +  +  V  +  +   L
Sbjct  187  ERKT------------TPTETSKYEGTRKVSTKRE--------RETTERVVVEKSTVVDL  226

Query  361  PAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDES  540
            P  W KE + +    GIRKD Y+ DPVSGY F SK+DV RYLETG+I K   KP+KR   
Sbjct  227  PPSWTKETKIKKTARGIRKDRYFTDPVSGYVFCSKKDVFRYLETGEISKYAFKPRKRGAD  286

Query  541  ASKDI  555
            AS+ +
Sbjct  287  ASELV  291



>ref|XP_002276814.3| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X4 [Vitis vinifera]
Length=462

 Score =   118 bits (296),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 96/181 (53%), Gaps = 52/181 (29%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsn  186
            S DW+P GWTV++K     + NG   KCY+ PS G +FYSK  V ++L            
Sbjct  5    SPDWIPEGWTVQVKL----AKNGRNVKCYLDPSTGYRFYSKPDVFRYL------------  48

Query  187  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPA------VAAQDIS  348
                              +T K N S TSR++K          V P       V  +  +
Sbjct  49   ------------------KTIKHN-SCTSRQKK----------VGPGMPSLGKVVIERST  79

Query  349  ADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK  528
            ADGLPAGW+KE++ R   +GIR+DPYY DPVSGY FRS++DV RYL+TG+I +   KPK 
Sbjct  80   ADGLPAGWIKEIKIRMNENGIRRDPYYTDPVSGYVFRSRKDVFRYLKTGEISRHAFKPKN  139

Query  529  R  531
            +
Sbjct  140  K  140



>ref|XP_006440583.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
 gb|ESR53823.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
Length=1065

 Score =   121 bits (304),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 94/185 (51%), Gaps = 21/185 (11%)
 Frame = +1

Query  4    NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPI  180
            N   DWLP GW VELKTR +GS  G  YK YI P +G KF+S  +V + L S  N N+  
Sbjct  127  NNRPDWLPDGWVVELKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKNRNSEC  186

Query  181  snenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGL  360
              +              P   +  E   + S KR+        +  +  V  +  +   L
Sbjct  187  ERKT------------TPTETSKYEGTRKVSTKRE--------RETTERVVVEKSTVVDL  226

Query  361  PAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDES  540
            P  W KE + +    GIRKD Y+ DPVSGY F SK+DV RYLETG+I K   KP+KR   
Sbjct  227  PPSWTKETKIKKTARGIRKDRYFTDPVSGYVFCSKKDVFRYLETGEISKYAFKPRKRGAD  286

Query  541  ASKDI  555
            AS+ +
Sbjct  287  ASELV  291



>ref|XP_004143925.1| PREDICTED: uncharacterized protein LOC101223188 [Cucumis sativus]
 ref|XP_004159962.1| PREDICTED: uncharacterized protein LOC101226976 [Cucumis sativus]
 gb|KGN50128.1| hypothetical protein Csa_5G154900 [Cucumis sativus]
Length=853

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 94/177 (53%), Gaps = 36/177 (20%)
 Frame = +1

Query  1    TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTP  177
            +N+  +WLP GW VE +TR +GS+ G+ YKCYI P +  +FYSK +V + L +  N    
Sbjct  79   SNEHPEWLPAGWKVESRTRMSGSNVGAVYKCYIDPVTDSRFYSKPEVFRHLRTVKNKLC-  137

Query  178  IsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADG  357
                                  T KE ++   +K +S             V  +    + 
Sbjct  138  ----------------------TLKERRTSNGKKSRS------------RVVIEHYKDED  163

Query  358  LPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK  528
            LP GW+KE++ +    GIRKDP+YIDP SGY FRSK++V RYLETG+I +   KPK+
Sbjct  164  LPPGWIKEIKIKEKADGIRKDPFYIDPKSGYVFRSKKEVFRYLETGEISRHAFKPKE  220


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 75/175 (43%), Gaps = 39/175 (22%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsn  186
            S DWLP GWTV+ K + T    G   + Y +  +G+ FY K  V  ++ S  +  +    
Sbjct  6    SPDWLPSGWTVQYKVQKT----GRKIRFYTNLENGKSFYYKDDVIGYIKSTQSQKSQ---  58

Query  187  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  366
                           P ++  K  QS  S  + +V  N+ P              + LPA
Sbjct  59   ---------------PTSRGVK-TQSGNSPLQLTVKSNEHP--------------EWLPA  88

Query  367  GWVKELRTRTCPSGIRKD-PYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK  528
            GW  E RTR   S +      YIDPV+   F SK +V R+L T   K C +K ++
Sbjct  89   GWKVESRTRMSGSNVGAVYKCYIDPVTDSRFYSKPEVFRHLRTVKNKLCTLKERR  143



>gb|KEH21030.1| methyl-CpG-binding domain protein [Medicago truncatula]
Length=1325

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/207 (36%), Positives = 111/207 (54%), Gaps = 36/207 (17%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNS------------  156
            +WLP GW +E++TR +G   GS YKCYI PS   KFYSK +V + L +            
Sbjct  37   EWLPNGWDIEVRTRQSGPAMGSAYKCYIDPSNTYKFYSKPEVLRHLETIRDRKCSSNKKK  96

Query  157  AANSNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPK--------  312
              + ++P   E ++   +  S  +  + +T K NQ   S++ +  ++  +P         
Sbjct  97   GTSKHSPSKEEGEHTKSKQHSPSKEEEKKT-KSNQHSPSKEEEKCINMHSPNKGEEKHIS  155

Query  313  -------------TVSPA-VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGY  450
                           SP+ VA ++   + LP GW+KE++ R   SGI+KD +YIDPVSGY
Sbjct  156  MHSPSKDGEKCTNMHSPSNVAGENSIVEDLPPGWIKEVKIRKHRSGIKKDWFYIDPVSGY  215

Query  451  EFRSKRDVMRYLETGDIKKCVIKPKKR  531
             F SK+DV R+L++GDI KC IKP +R
Sbjct  216  VFHSKKDVQRFLKSGDIAKCAIKPSRR  242



>ref|XP_008437229.1| PREDICTED: transcriptional regulator ATRX homolog isoform X3 
[Cucumis melo]
Length=628

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 93/177 (53%), Gaps = 36/177 (20%)
 Frame = +1

Query  1    TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTP  177
            +N+  +WLP GW VE +TR +GS+ G+ YKCYI P +  +FYSK +V + L +  N    
Sbjct  79   SNEHPEWLPAGWKVESRTRMSGSNVGAVYKCYIDPVTDSRFYSKPEVFRHLRTVKNKLC-  137

Query  178  IsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADG  357
                                  T KE ++    K +S             V  +    + 
Sbjct  138  ----------------------TLKERRTSNGTKSRS------------RVVIEHYKDED  163

Query  358  LPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK  528
            LP GW+KE++ +    GIRKDP+YIDP SGY FRSK++V RYLETG+I +   KPK+
Sbjct  164  LPPGWIKEIKIKEKADGIRKDPFYIDPKSGYIFRSKKEVFRYLETGEISRHAFKPKE  220


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 76/175 (43%), Gaps = 39/175 (22%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsn  186
            S DWLP GWTV+ K + TG       + Y +  +G+ FY K  V  ++ S  +  +    
Sbjct  6    SPDWLPSGWTVQYKVQKTGRK----IRFYTNLETGKSFYYKDDVLGYIKSTQSQKSQ---  58

Query  187  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  366
                           P ++  K  QS  S  +++V  N+ P              + LPA
Sbjct  59   ---------------PTSRGIK-TQSGNSPVQQTVKSNEHP--------------EWLPA  88

Query  367  GWVKELRTRTCPSGIRKD-PYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK  528
            GW  E RTR   S +      YIDPV+   F SK +V R+L T   K C +K ++
Sbjct  89   GWKVESRTRMSGSNVGAVYKCYIDPVTDSRFYSKPEVFRHLRTVKNKLCTLKERR  143



>ref|XP_006477436.1| PREDICTED: uncharacterized protein LOC102622266 [Citrus sinensis]
Length=1096

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 93/185 (50%), Gaps = 21/185 (11%)
 Frame = +1

Query  4    NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPI  180
            N   DWLP GW V+LKTR +GS  G  YK YI P +G KF+S  +V + L S  N N+  
Sbjct  127  NNRPDWLPDGWVVDLKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKNRNS--  184

Query  181  snenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGL  360
                             P   +  E   + S KR+        +  +  V  +  +   L
Sbjct  185  ----------ECERKTTPTETSKYEGTRKVSTKRE--------RETTERVVVEKSTVVDL  226

Query  361  PAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDES  540
            P  W KE + +    GIRKD Y+ DPVSGY F SK+DV RYLETG+I K   KP+KR   
Sbjct  227  PPSWTKETKIKKTARGIRKDRYFTDPVSGYVFCSKKDVFRYLETGEISKYAFKPRKRGAD  286

Query  541  ASKDI  555
            AS+ +
Sbjct  287  ASELV  291



>ref|XP_010918514.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Elaeis guineensis]
Length=488

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 98/182 (54%), Gaps = 38/182 (21%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnen  192
            DWLP GW +E KTR +G++ G  YKCYI P +G KFYSK +V +++              
Sbjct  55   DWLPAGWGLEFKTRKSGTNAGRQYKCYIDPVTGYKFYSKNEVLRYIKDG-----------  103

Query  193  knnieesssnleVPQNQTPKENQS---------RTSRKRKSVMDNQTPKTVSPAVAAQDI  345
                        +P+N   K  +S         R+S  ++  +   T + +   +   + 
Sbjct  104  ------------IPRNPRAKRKRSVVTRITEHTRSSTNQRKGIKRSTRENLRSQI---EY  148

Query  346  SADGLPAGWVKELRTR--TCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
            + DGLP+GW+KE+R R  T   G ++D YY DPV+GY FRS++D ++Y+ETG + K  IK
Sbjct  149  TPDGLPSGWIKEIRYRKSTSSCGAKRDQYYTDPVNGYVFRSRKDAIQYIETGQVSKYAIK  208

Query  520  PK  525
            PK
Sbjct  209  PK  210



>ref|XP_010918513.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Elaeis guineensis]
Length=514

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 98/182 (54%), Gaps = 38/182 (21%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnen  192
            DWLP GW +E KTR +G++ G  YKCYI P +G KFYSK +V +++              
Sbjct  81   DWLPAGWGLEFKTRKSGTNAGRQYKCYIDPVTGYKFYSKNEVLRYIKDG-----------  129

Query  193  knnieesssnleVPQNQTPKENQS---------RTSRKRKSVMDNQTPKTVSPAVAAQDI  345
                        +P+N   K  +S         R+S  ++  +   T + +   +   + 
Sbjct  130  ------------IPRNPRAKRKRSVVTRITEHTRSSTNQRKGIKRSTRENLRSQI---EY  174

Query  346  SADGLPAGWVKELRTR--TCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
            + DGLP+GW+KE+R R  T   G ++D YY DPV+GY FRS++D ++Y+ETG + K  IK
Sbjct  175  TPDGLPSGWIKEIRYRKSTSSCGAKRDQYYTDPVNGYVFRSRKDAIQYIETGQVSKYAIK  234

Query  520  PK  525
            PK
Sbjct  235  PK  236



>ref|XP_004503754.1| PREDICTED: uncharacterized protein LOC101511357 [Cicer arietinum]
Length=1262

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/220 (36%), Positives = 111/220 (50%), Gaps = 45/220 (20%)
 Frame = +1

Query  4    NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYI-SPSGRKFYSKAQVSQFLNSAANSNTP-  177
            N+  DWLP GW +E++TR +G   GS YKCYI S +G KFYSK +V ++L +   +N   
Sbjct  33   NEWPDWLPDGWDMEVRTRKSGPLMGSGYKCYIDSLNGNKFYSKPEVLRYLETTKGNNCTS  92

Query  178  ------------------IsnenknnieesssnleVPQNQTPK-ENQSRTSRKRKSVMDN  300
                              I+  + +  EE  +N   P  +  K  N+  TS++     D 
Sbjct  93   KKKKFTRTHFPSKEGEKHINKHSPSKEEEKRTNKHSPSKEDEKCTNKHSTSKEEAKCNDK  152

Query  301  QTPK-----------------------TVSPAVAAQDIS-ADGLPAGWVKELRTRTCPSG  408
             +P                          SP+ A  + S  + LP GW+KE++ R   +G
Sbjct  153  HSPNKEEEKCTNSSQHSPNKDGEKCINMHSPSNAVGEKSTVEDLPLGWIKEVKIRKNGNG  212

Query  409  IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK  528
            I+KD +Y DPVSGY FRSK DV+RYLE+GDI KC IKP +
Sbjct  213  IKKDWFYTDPVSGYVFRSKMDVLRYLESGDIGKCAIKPSR  252



>ref|XP_008351681.1| PREDICTED: uncharacterized protein LOC103415104 [Malus domestica]
Length=746

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 99/191 (52%), Gaps = 28/191 (15%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsnen  192
            +WLP GW VEL+TR +G   G  YKCYI PSG   FYSK +V ++L +    ++      
Sbjct  86   EWLPNGWKVELRTRQSGVQVGKEYKCYIDPSGECTFYSKPEVFRYLKTVKRKSS------  139

Query  193  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  372
                          ++ T   +  R   ++K+V   Q  K V      +    + LP GW
Sbjct  140  --------------KSGTLTISSKRCITEKKAVTTVQLAKNV----YVEKHHVEDLPPGW  181

Query  373  VKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESASKD  552
            +KE++     +  R+DPYY DP SGY FRSK+DV RYLETG+I K   KPK      + D
Sbjct  182  IKEIKVTKYANRFRRDPYYTDPDSGYVFRSKKDVFRYLETGEISKYAFKPKNM---CNND  238

Query  553  IHHNIEEVSPN  585
            +    +E++P+
Sbjct  239  LKLVNDEIAPS  249



>ref|XP_010934846.1| PREDICTED: uncharacterized protein LOC105054908 isoform X1 [Elaeis 
guineensis]
Length=687

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 91/175 (52%), Gaps = 36/175 (21%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsn  186
            S  WLPPGW +E++T+  GS     YK Y  PS R +FYSK  V QF+ S          
Sbjct  79   SFKWLPPGWLLEIRTQRCGSKARQIYKSYFDPSTRSRFYSKGDVLQFVKSG---------  129

Query  187  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  366
                            +  +P  +Q R         ++++P+ V   +A  +   DGLP 
Sbjct  130  ----------------KIYSPTSDQKRH-------CESESPEHV---IAQIEFYPDGLPD  163

Query  367  GWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKR  531
            GW KE R +   SGIRKDPYY DPVSGY FR+ +DV RY ETG+I +   +P+K+
Sbjct  164  GWYKETRIKKNRSGIRKDPYYADPVSGYVFRTLKDVQRYTETGEISRHAFRPRKK  218



>ref|XP_006358896.1| PREDICTED: uncharacterized protein LOC102587100 isoform X3 [Solanum 
tuberosum]
Length=1801

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 84/223 (38%), Positives = 113/223 (51%), Gaps = 42/223 (19%)
 Frame = +1

Query  4    NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPI  180
            N S +WLPPGW VELKTR +GSH G+ YK YI PS G KFYSK +VS++L +   +N   
Sbjct  111  NNSHEWLPPGWIVELKTRKSGSHAGTPYKVYIDPSTGSKFYSKPEVSKYLKTMKQNNITG  170

Query  181  snenknnieesssnleVPQN--QTPKENQSRTSRKRKSVMDNQTPKT-------------  315
              +   + E SSSN +  ++        Q+R S++ KS  D  +P               
Sbjct  171  EGQIHGDGEVSSSNQKTSEDSKNIRGGGQTRKSKRLKSDTDQASPGIEEGSFSKLKASQD  230

Query  316  -----------------------VSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDPY  426
                                    SP+VA    SAD LP GW KE  +     G R+   
Sbjct  231  FEEVGEQSCTTKRKKSGITRTTKTSPSVAVDCDSADELPHGWKKE--SSQNDRGTREYLL  288

Query  427  YIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRD-ESASKD  552
            Y DPV GY+F SK++V+RYL+TGD  +C  +P KR+  S +KD
Sbjct  289  YTDPVHGYKFYSKKEVLRYLQTGDASRCARRPAKRNVASTTKD  331


 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  325   AVAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIK  504
             +  +++ S DGLP GW  E R R     I+KDPYY+DPV GY FRSK+DVMRYL+TGDI+
Sbjct  1138  SFLSKEASVDGLPPGWKTEFRMRKNARVIKKDPYYMDPVLGYVFRSKKDVMRYLQTGDIR  1197

Query  505   KCVIKPKKRD  534
              C +KP KRD
Sbjct  1198  SCAVKPTKRD  1207


 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +1

Query  340  DISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
            D S D LP GW KE++     +GIRKDP YIDPV GY FRSK+DV RYL+TGDI  C IK
Sbjct  527  DPSLDDLPPGWKKEIKITKKANGIRKDPLYIDPVDGYVFRSKKDVFRYLQTGDISNCAIK  586

Query  520  PKKRDESAS  546
            P KRD  A+
Sbjct  587  PVKRDLDAT  595


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 69/204 (34%), Positives = 100/204 (49%), Gaps = 25/204 (12%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsn  186
            S DW PPGWT ++K       NG   K Y +  +G+KFYSK +V+++LN+    +     
Sbjct  6    SPDWPPPGWTEDVKV-----SNGRKIKYYTNGQTGKKFYSKKEVARYLNTKDTCDDVTQA  60

Query  187  enknnieesssnleVPQNQTP---KENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADG  357
                    S +N+    NQ     K+N S+     KS  +N     VS AV   + S + 
Sbjct  61   MTIQGKNCSENNVSHMDNQDESFSKDNVSQMDNLDKSCSEN----NVSEAVGRPNNSHEW  116

Query  358  LPAGWVKELRTRTCPSGIRKDPY--YIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKR  531
            LP GW+ EL+TR   S     PY  YIDP +G +F SK +V +YL+T          K+ 
Sbjct  117  LPPGWIVELKTRKSGSHAGT-PYKVYIDPSTGSKFYSKPEVSKYLKTM---------KQN  166

Query  532  DESASKDIHHNIEEVSPNEKSVED  603
            + +    IH + E  S N+K+ ED
Sbjct  167  NITGEGQIHGDGEVSSSNQKTSED  190



>ref|XP_008238911.1| PREDICTED: uncharacterized protein LOC103337528 [Prunus mume]
Length=623

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 90/178 (51%), Gaps = 45/178 (25%)
 Frame = +1

Query  1    TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRK-FYSKAQVSQFLNSAANSNTP  177
            T +  +WLP GW VE++TR TG H G  YKCYI PS    FYSK +V ++L +       
Sbjct  81   TTEYPEWLPKGWKVEVRTRKTGVHVGKEYKCYIDPSTESSFYSKPEVFRYLKTV------  134

Query  178  IsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADG  357
                                             KRKS   ++  KTV   V   D+  + 
Sbjct  135  ---------------------------------KRKSC-KSRNLKTVD--VEKHDV--ED  156

Query  358  LPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKR  531
            LP+GW KE++ +   + +R+DPYY DPVSGY FRSK  VM YLETG+I +   KPK +
Sbjct  157  LPSGWTKEIKVKRVANRLRRDPYYTDPVSGYVFRSKNAVMHYLETGEISRHAFKPKNK  214



>gb|KJB39637.1| hypothetical protein B456_007G022700 [Gossypium raimondii]
Length=914

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 91/179 (51%), Gaps = 38/179 (21%)
 Frame = +1

Query  4    NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPI  180
            N+  +WLP  W VE+KT  +G   G   K Y+ PS G +FYSK  V +FL  A   N   
Sbjct  86   NECPEWLPKNWFVEVKTHKSGEFIGKRVKIYVDPSTGLRFYSKPAVFRFLKQAEQRN---  142

Query  181  snenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGL  360
                                +T K+ Q+  SRK+               V  +  + D L
Sbjct  143  -------------------RKTNKKKQAAYSRKK---------------VVIEKSTVDDL  168

Query  361  PAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDE  537
            PAGW+KE++ +   +G+RKDPYY DPVSGY FRSK+ V+ YLETG+I +    P K ++
Sbjct  169  PAGWIKEIKIQRNANGVRKDPYYTDPVSGYVFRSKKAVLHYLETGEIARSAFLPPKSND  227



>ref|XP_008392616.1| PREDICTED: uncharacterized protein LOC103454798 [Malus domestica]
Length=1228

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 98/190 (52%), Gaps = 28/190 (15%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsnen  192
            +WLP GW VEL+TR +G   G  YKCYI PSG   FYSK +V ++L +    ++      
Sbjct  86   EWLPNGWKVELRTRQSGVQVGKEYKCYIDPSGECTFYSKPEVFRYLKTVKRKSS------  139

Query  193  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  372
                          ++ T   +  R   ++K+V   Q  K V      +    + LP GW
Sbjct  140  --------------KSGTLTISSKRCITEKKAVTTVQLAKNV----YVEKHHVEDLPPGW  181

Query  373  VKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESASKD  552
            +KE++     +  R+DPYY DP SGY FRSK+DV RYLETG+I K   KPK      + D
Sbjct  182  IKEIKVTKYANRFRRDPYYTDPDSGYVFRSKKDVFRYLETGEISKYAFKPKNM---CNND  238

Query  553  IHHNIEEVSP  582
            +    +E++P
Sbjct  239  LKLVNDEIAP  248



>ref|XP_009401688.1| PREDICTED: uncharacterized protein LOC103985652 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=573

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 100/198 (51%), Gaps = 30/198 (15%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnen  192
            DWLP GWT   KT    + +G+   C+  P +G +F SK +V Q L S     +P     
Sbjct  8    DWLPEGWTAVAKT----TRSGAVLWCFHDPYTGSRFCSKKEVLQHLKSGKFRGSPTKQTR  63

Query  193  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  372
                             T  E +++T+  +   ++N TP                LP GW
Sbjct  64   SITTRSMEKLCA----STNLEEENKTNSAKNDQIEN-TPYE--------------LPHGW  104

Query  373  VKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESASKD  552
            +KE+R R   + I+KDP+Y DPVSGYEFRS +DV RYLETGDI  CV KPKKR    S D
Sbjct  105  IKEIRLRNSGTKIKKDPFYFDPVSGYEFRSLKDVFRYLETGDIHSCVNKPKKR----SID  160

Query  553  IHHNIEEVS--PNEKSVE  600
              H++E+ S  P  K VE
Sbjct  161  DIHSLEKESHPPAAKRVE  178



>ref|XP_007040167.1| Uncharacterized protein TCM_016211 [Theobroma cacao]
 gb|EOY24668.1| Uncharacterized protein TCM_016211 [Theobroma cacao]
Length=1028

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 94/182 (52%), Gaps = 38/182 (21%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsnen  192
            +WLP  W  ELKT  +G+  G +YK Y+ PS G +F+S+ +V +FL+             
Sbjct  163  EWLPKNWFTELKTYKSGAKFGKSYKIYVDPSTGLRFHSRPEVFRFLDKG-----------  211

Query  193  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  372
                                E +S  S+ +K  + + +       V  +  + D LPAGW
Sbjct  212  --------------------EQKSTKSKPKKRALCSTS------KVVTRKSTVDDLPAGW  245

Query  373  VKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESASKD  552
            +KE++ +   +G+R+DPYY DP SGY FRSK+D++RYLETG+I +    PKK+       
Sbjct  246  IKEVKIKRHANGVRRDPYYTDPASGYVFRSKKDILRYLETGEIGRYAFLPKKKHSDDQNL  305

Query  553  IH  558
            IH
Sbjct  306  IH  307


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 73/178 (41%), Gaps = 38/178 (21%)
 Frame = +1

Query  4    NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPI  180
            N+  +WLP  W +ELKTR +G   G  YK YI PS G +FYSK QV +FL          
Sbjct  82   NERPEWLPKNWFMELKTRKSGVRIGKHYKIYIDPSTGSRFYSKLQVFRFL----------  131

Query  181  snenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGL  360
                                     N       +       +  T    V A +   + L
Sbjct  132  -------------------------NHVEQKSSKPKQKKKVSHSTSEIVVKAHE-HPEWL  165

Query  361  PAGWVKELRTRTCPSGIRKD-PYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKR  531
            P  W  EL+T    +   K    Y+DP +G  F S+ +V R+L+ G+ K    KPKKR
Sbjct  166  PKNWFTELKTYKSGAKFGKSYKIYVDPSTGLRFHSRPEVFRFLDKGEQKSTKSKPKKR  223



>ref|XP_006590528.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
[Glycine max]
Length=163

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 90/153 (59%), Gaps = 8/153 (5%)
 Frame = +1

Query  76   GSTYKCYISPSGRKFYSKAQVSQFLNSA-ANSNTPIsnenknnieesssnleVPQNQTPK  252
            G  YKCYI+PSG KFYSK +V ++L++   NSN+  S + K      +      ++  P 
Sbjct  2    GHGYKCYIAPSGHKFYSKPEVLRYLDTVNINSNSHTSKKEKICKSNDTVEKSTIEDLPP-  60

Query  253  ENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYI  432
              Q +  + RK   DN+    V P V  +    D LP GW+ E + R   +G RKD +YI
Sbjct  61   -GQIKEVKIRKGSNDNR----VDPDVVEKSPVED-LPPGWITEAKVRKGDTGNRKDMFYI  114

Query  433  DPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKR  531
            DPVSGY FRSK+D +RY+++GDI  CV+KP K+
Sbjct  115  DPVSGYVFRSKKDALRYVKSGDISTCVLKPYKK  147



>ref|XP_010325421.1| PREDICTED: uncharacterized protein LOC101264354 isoform X3 [Solanum 
lycopersicum]
Length=1846

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 85/228 (37%), Positives = 115/228 (50%), Gaps = 48/228 (21%)
 Frame = +1

Query  4    NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPI  180
            N S +WLPPGW VELKTR +GSH G +YK YI PS G KFYSK +VS++L +   +N   
Sbjct  111  NNSHEWLPPGWIVELKTRKSGSHAGLSYKVYIDPSTGSKFYSKPEVSKYLKTMKQNNIAG  170

Query  181  snenknnieesssnleVPQNQTPKENQSRTSRKRKS------------------VMDNQT  306
              +     E S S L+  Q+      QS T++++KS                  +++ +T
Sbjct  171  EGQTPGIEEGSFSKLKASQDFEEVGEQSCTTKRKKSGITRTTKTYPSHGAGEVFILNEKT  230

Query  307  -------------------------PKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGI  411
                                      K+VS +VA    SAD LP GW KE  +R    G 
Sbjct  231  SLGSKENGAQSPQSKRQKPGSGCPSAKSVS-SVAVDCDSADELPPGWKKE--SRKNDRGT  287

Query  412  RKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRD-ESASKD  552
            R    Y DPV GY+F SK++V+RYL+TGD   C  +P KR+  S +KD
Sbjct  288  RNYLLYTDPVHGYKFHSKKEVLRYLQTGDATSCARRPTKRNVASTTKD  335


 Score = 98.6 bits (244),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  325   AVAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIK  504
             +  +++ S DGLP GW  E R R   S I+KDPYY DPV GY FRSK+DVMRYL+TGDI+
Sbjct  1178  SFLSKEASVDGLPPGWKTEFRIRKNASVIKKDPYYTDPVHGYVFRSKKDVMRYLQTGDIR  1237

Query  505   KCVIKPKKRD  534
              C +KP KRD
Sbjct  1238  SCAVKPTKRD  1247


 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +1

Query  340  DISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
            D S D LP GW KE++     +GIRKDP YIDPV GY FRSK+DV RYL+TGDI  C I+
Sbjct  536  DPSLDDLPPGWKKEIKITKKANGIRKDPLYIDPVDGYVFRSKKDVFRYLQTGDISSCAIR  595

Query  520  PKKRDESAS  546
            P KRD  A+
Sbjct  596  PVKRDLDAA  604


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 83/169 (49%), Gaps = 20/169 (12%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsn  186
            S DW PPGWT ++K        G   K Y +  +G+KFYSK +V+++L +    +     
Sbjct  6    SPDWPPPGWTEDVKV-----SKGRKIKYYTNGETGKKFYSKKEVARYLKTKDTCDDVTQA  60

Query  187  enknnieesssnleVPQNQTPKENQSRT-SRKRKSVMDNQ----TPKTVSPAVAAQDISA  351
             N      S        N +  +NQ  + ++   S MDNQ    +   VS  V   + S 
Sbjct  61   MNIQGKSFSE------NNVSDMDNQDGSFAKDNGSQMDNQDNCCSENNVSQTVGKPNNSH  114

Query  352  DGLPAGWVKELRTRTCPS--GIRKDPYYIDPVSGYEFRSKRDVMRYLET  492
            + LP GW+ EL+TR   S  G+     YIDP +G +F SK +V +YL+T
Sbjct  115  EWLPPGWIVELKTRKSGSHAGLSYK-VYIDPSTGSKFYSKPEVSKYLKT  162



>ref|XP_011463824.1| PREDICTED: uncharacterized protein LOC101312827 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=1030

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 91/173 (53%), Gaps = 28/173 (16%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsnen  192
            +WLP GW VEL+TR +G   G  YKCYI PS    FYSK +V + L +            
Sbjct  84   EWLPDGWKVELRTRKSGVQVGKEYKCYIDPSRECTFYSKPEVFRHLRTV-----------  132

Query  193  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVS--PAVAAQDISADGLPA  366
                          + ++ K    +T  +++ ++  +T   +     V  +  + + LP 
Sbjct  133  --------------KRKSYKSRSHKTVNRKRCIIKTKTVTAMHFPSKVVVEKHNVEDLPP  178

Query  367  GWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPK  525
            GW+ E++ R   + IR+DPYY DPV GY FRSK+DV+RYL+TG+  K  IKPK
Sbjct  179  GWILEIKVRKVANRIRRDPYYTDPVHGYIFRSKKDVIRYLQTGETSKHTIKPK  231



>ref|XP_007038658.1| Methyl-CPG-binding domain protein 13, putative isoform 1 [Theobroma 
cacao]
 gb|EOY23159.1| Methyl-CPG-binding domain protein 13, putative isoform 1 [Theobroma 
cacao]
Length=625

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 91/185 (49%), Gaps = 42/185 (23%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsn  186
            + DWLPPGW VE++ R  G  +     CY +P G  +F S+A+VS++L+           
Sbjct  6    TDDWLPPGWKVEVRQRRNGKKDKLRVMCYYAPCGELRFISRAEVSRYLDKCG--------  57

Query  187  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  366
                                      +T  K     +N + K  S  V  +  +A+GLP 
Sbjct  58   -------------------------CKTEEK-----ENGSGKQSSKNVTVEKAAAEGLPP  87

Query  367  GWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKR---DE  537
            GW+KE+R       +RKDP+Y DPVSGY FRS +D +RY+ETG++ K   KPK +   DE
Sbjct  88   GWIKEIRITKRAHRVRKDPFYTDPVSGYVFRSMKDALRYVETGELGKLAFKPKDKGSNDE  147

Query  538  SASKD  552
               +D
Sbjct  148  DLEED  152



>ref|XP_008791903.1| PREDICTED: uncharacterized protein LOC103708650 [Phoenix dactylifera]
Length=569

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 85/175 (49%), Gaps = 36/175 (21%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsn  186
            S  WLPPGW +E++T+  GS     Y  Y  PS G +FYSK  V QF+ S          
Sbjct  79   SFKWLPPGWLLEIRTQRRGSKAQQIYMSYFEPSTGSRFYSKGDVLQFVKSG---------  129

Query  187  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  366
                            +   P  +Q+R              +++   +A  +   DGLP 
Sbjct  130  ----------------KIYGPTSDQTRHCEA----------ESLENVIAQIEFYPDGLPH  163

Query  367  GWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKR  531
            GW KE+R +   SG R+DPYY DP SGY FR+ +DV RY ETG+I K   +P+KR
Sbjct  164  GWYKEIRIKKNRSGFRRDPYYADPESGYVFRTLKDVQRYTETGEISKHAFRPRKR  218



>ref|XP_007038659.1| Methyl-CPG-binding domain protein 13, putative isoform 2 [Theobroma 
cacao]
 gb|EOY23160.1| Methyl-CPG-binding domain protein 13, putative isoform 2 [Theobroma 
cacao]
Length=621

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 92/185 (50%), Gaps = 46/185 (25%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsn  186
            + DWLPPGW VE++ R     NG   KCY +P G  +F S+A+VS++L+           
Sbjct  6    TDDWLPPGWKVEVRQR----RNGKKDKCYYAPCGELRFISRAEVSRYLDKCG--------  53

Query  187  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  366
                                      +T  K     +N + K  S  V  +  +A+GLP 
Sbjct  54   -------------------------CKTEEK-----ENGSGKQSSKNVTVEKAAAEGLPP  83

Query  367  GWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKR---DE  537
            GW+KE+R       +RKDP+Y DPVSGY FRS +D +RY+ETG++ K   KPK +   DE
Sbjct  84   GWIKEIRITKRAHRVRKDPFYTDPVSGYVFRSMKDALRYVETGELGKLAFKPKDKGSNDE  143

Query  538  SASKD  552
               +D
Sbjct  144  DLEED  148



>ref|XP_006358895.1| PREDICTED: uncharacterized protein LOC102587100 isoform X2 [Solanum 
tuberosum]
Length=1805

 Score =   113 bits (283),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 84/228 (37%), Positives = 116/228 (51%), Gaps = 48/228 (21%)
 Frame = +1

Query  4    NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPI  180
            N S +WLPPGW VELKTR +GSH G+ YK YI PS G KFYSK +VS++L +   +N   
Sbjct  111  NNSHEWLPPGWIVELKTRKSGSHAGTPYKVYIDPSTGSKFYSKPEVSKYLKTMKQNNITG  170

Query  181  snenknnieesssnleVPQNQTPKENQSRTSRKRKS------------------VMDNQT  306
              +     E S S L+  Q+      QS T++++KS                  +++ +T
Sbjct  171  EGQIPGIEEGSFSKLKASQDFEEVGEQSCTTKRKKSGITRTTKTSPSHGAGEDFILNEKT  230

Query  307  -------------------------PKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGI  411
                                      K+VS +VA    SAD LP GW KE  +     G 
Sbjct  231  SLGSKENGAQSPQSKRQKPGSGCLSAKSVS-SVAVDCDSADELPHGWKKE--SSQNDRGT  287

Query  412  RKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRD-ESASKD  552
            R+   Y DPV GY+F SK++V+RYL+TGD  +C  +P KR+  S +KD
Sbjct  288  REYLLYTDPVHGYKFYSKKEVLRYLQTGDASRCARRPAKRNVASTTKD  335


 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  325   AVAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIK  504
             +  +++ S DGLP GW  E R R     I+KDPYY+DPV GY FRSK+DVMRYL+TGDI+
Sbjct  1142  SFLSKEASVDGLPPGWKTEFRMRKNARVIKKDPYYMDPVLGYVFRSKKDVMRYLQTGDIR  1201

Query  505   KCVIKPKKRD  534
              C +KP KRD
Sbjct  1202  SCAVKPTKRD  1211


 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +1

Query  340  DISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
            D S D LP GW KE++     +GIRKDP YIDPV GY FRSK+DV RYL+TGDI  C IK
Sbjct  531  DPSLDDLPPGWKKEIKITKKANGIRKDPLYIDPVDGYVFRSKKDVFRYLQTGDISNCAIK  590

Query  520  PKKRDESAS  546
            P KRD  A+
Sbjct  591  PVKRDLDAT  599


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 85/167 (51%), Gaps = 16/167 (10%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsn  186
            S DW PPGWT ++K       NG   K Y +  +G+KFYSK +V+++LN+    +     
Sbjct  6    SPDWPPPGWTEDVKV-----SNGRKIKYYTNGQTGKKFYSKKEVARYLNTKDTCDDVTQA  60

Query  187  enknnieesssnleVPQNQTP---KENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADG  357
                    S +N+    NQ     K+N S+     KS  +N     VS AV   + S + 
Sbjct  61   MTIQGKNCSENNVSHMDNQDESFSKDNVSQMDNLDKSCSEN----NVSEAVGRPNNSHEW  116

Query  358  LPAGWVKELRTRTCPSGIRKDPY--YIDPVSGYEFRSKRDVMRYLET  492
            LP GW+ EL+TR   S     PY  YIDP +G +F SK +V +YL+T
Sbjct  117  LPPGWIVELKTRKSGSHAGT-PYKVYIDPSTGSKFYSKPEVSKYLKT  162



>ref|XP_008437227.1| PREDICTED: uncharacterized protein LOC103482721 isoform X1 [Cucumis 
melo]
Length=635

 Score =   112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 93/184 (51%), Gaps = 43/184 (23%)
 Frame = +1

Query  1    TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTP  177
            +N+  +WLP GW VE +TR +GS+ G+ YKCYI P +  +FYSK +V + L +  N    
Sbjct  79   SNEHPEWLPAGWKVESRTRMSGSNVGAVYKCYIDPVTDSRFYSKPEVFRHLRTVKNKLC-  137

Query  178  IsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADG  357
                                  T KE ++    K +S             V  +    + 
Sbjct  138  ----------------------TLKERRTSNGTKSRS------------RVVIEHYKDED  163

Query  358  LPAGWVKELRTRTCPSGIRKDP-------YYIDPVSGYEFRSKRDVMRYLETGDIKKCVI  516
            LP GW+KE++ +    GIRKDP       +YIDP SGY FRSK++V RYLETG+I +   
Sbjct  164  LPPGWIKEIKIKEKADGIRKDPLYPTFLQFYIDPKSGYIFRSKKEVFRYLETGEISRHAF  223

Query  517  KPKK  528
            KPK+
Sbjct  224  KPKE  227


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 76/175 (43%), Gaps = 39/175 (22%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsn  186
            S DWLP GWTV+ K + TG       + Y +  +G+ FY K  V  ++ S  +  +    
Sbjct  6    SPDWLPSGWTVQYKVQKTGRK----IRFYTNLETGKSFYYKDDVLGYIKSTQSQKSQ---  58

Query  187  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  366
                           P ++  K  QS  S  +++V  N+ P              + LPA
Sbjct  59   ---------------PTSRGIK-TQSGNSPVQQTVKSNEHP--------------EWLPA  88

Query  367  GWVKELRTRTCPSGIRKD-PYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK  528
            GW  E RTR   S +      YIDPV+   F SK +V R+L T   K C +K ++
Sbjct  89   GWKVESRTRMSGSNVGAVYKCYIDPVTDSRFYSKPEVFRHLRTVKNKLCTLKERR  143



>ref|XP_008437228.1| PREDICTED: uncharacterized protein LOC103482721 isoform X2 [Cucumis 
melo]
Length=634

 Score =   112 bits (279),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 93/184 (51%), Gaps = 43/184 (23%)
 Frame = +1

Query  1    TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTP  177
            +N+  +WLP GW VE +TR +GS+ G+ YKCYI P +  +FYSK +V + L +  N    
Sbjct  78   SNEHPEWLPAGWKVESRTRMSGSNVGAVYKCYIDPVTDSRFYSKPEVFRHLRTVKNKLC-  136

Query  178  IsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADG  357
                                  T KE ++    K +S             V  +    + 
Sbjct  137  ----------------------TLKERRTSNGTKSRS------------RVVIEHYKDED  162

Query  358  LPAGWVKELRTRTCPSGIRKDP-------YYIDPVSGYEFRSKRDVMRYLETGDIKKCVI  516
            LP GW+KE++ +    GIRKDP       +YIDP SGY FRSK++V RYLETG+I +   
Sbjct  163  LPPGWIKEIKIKEKADGIRKDPLYPTFLQFYIDPKSGYIFRSKKEVFRYLETGEISRHAF  222

Query  517  KPKK  528
            KPK+
Sbjct  223  KPKE  226


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 73/175 (42%), Gaps = 40/175 (23%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsn  186
            S DWLP GWTV+ K + TG       + Y +  +G+ FY K  V  ++ S  +       
Sbjct  6    SPDWLPSGWTVQYKVQKTGRK----IRFYTNLETGKSFYYKDDVLGYIKSTQS-------  54

Query  187  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  366
                            Q   P      TSR  K+   N   +TV       +   + LPA
Sbjct  55   ----------------QKSQP------TSRGIKTQSGNSPVQTVK-----SNEHPEWLPA  87

Query  367  GWVKELRTRTCPSGIRKD-PYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK  528
            GW  E RTR   S +      YIDPV+   F SK +V R+L T   K C +K ++
Sbjct  88   GWKVESRTRMSGSNVGAVYKCYIDPVTDSRFYSKPEVFRHLRTVKNKLCTLKERR  142



>ref|XP_009375788.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Pyrus x bretschneideri]
Length=1172

 Score =   112 bits (281),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 95/185 (51%), Gaps = 25/185 (14%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsnen  192
            +WLP GW VEL+TR +G   G  YKCYI P     FYSK +V ++L +    N+      
Sbjct  86   EWLPNGWKVELRTRQSGVQVGKEYKCYIDPFRECTFYSKPEVFRYLKTVKRKNS------  139

Query  193  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  372
                          ++ T   +  R   ++K+V   Q  K V      +    + LP GW
Sbjct  140  --------------KSGTLTISGKRCITEKKAVTTMQLAKNV----YVEKHHVEDLPPGW  181

Query  373  VKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESASKD  552
            +KE++     +  R+DPYY DP SGY FRSK+DV+RYLETG++ K   KPK    +  K 
Sbjct  182  IKEIKVTKYANRFRRDPYYTDPDSGYVFRSKKDVIRYLETGEMSKYAFKPKNMCNNDLKL  241

Query  553  IHHNI  567
            ++ +I
Sbjct  242  VNDDI  246



>ref|XP_009375787.1| PREDICTED: uncharacterized protein LOC103964564 isoform X1 [Pyrus 
x bretschneideri]
Length=1224

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 95/185 (51%), Gaps = 25/185 (14%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsnen  192
            +WLP GW VEL+TR +G   G  YKCYI P     FYSK +V ++L +    N+      
Sbjct  86   EWLPNGWKVELRTRQSGVQVGKEYKCYIDPFRECTFYSKPEVFRYLKTVKRKNS------  139

Query  193  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  372
                          ++ T   +  R   ++K+V   Q  K V      +    + LP GW
Sbjct  140  --------------KSGTLTISGKRCITEKKAVTTMQLAKNV----YVEKHHVEDLPPGW  181

Query  373  VKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESASKD  552
            +KE++     +  R+DPYY DP SGY FRSK+DV+RYLETG++ K   KPK    +  K 
Sbjct  182  IKEIKVTKYANRFRRDPYYTDPDSGYVFRSKKDVIRYLETGEMSKYAFKPKNMCNNDLKL  241

Query  553  IHHNI  567
            ++ +I
Sbjct  242  VNDDI  246



>ref|XP_011463825.1| PREDICTED: uncharacterized protein LOC101312827 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=1009

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 63/171 (37%), Positives = 85/171 (50%), Gaps = 45/171 (26%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsnen  192
            +WLP GW VEL+TR +G   G  YKCYI PS    FYSK +V + L +            
Sbjct  84   EWLPDGWKVELRTRKSGVQVGKEYKCYIDPSRECTFYSKPEVFRHLRTV-----------  132

Query  193  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  372
                                + +S  SR  K+V+              +  + + LP GW
Sbjct  133  --------------------KRKSYKSRSHKTVV-------------VEKHNVEDLPPGW  159

Query  373  VKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPK  525
            + E++ R   + IR+DPYY DPV GY FRSK+DV+RYL+TG+  K  IKPK
Sbjct  160  ILEIKVRKVANRIRRDPYYTDPVHGYIFRSKKDVIRYLQTGETSKHTIKPK  210



>gb|KHG28622.1| Methyl-CpG-binding domain-containing 13 -like protein [Gossypium 
arboreum]
Length=598

 Score =   109 bits (272),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 66/189 (35%), Positives = 95/189 (50%), Gaps = 44/189 (23%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsn  186
            S DWLPPGW VE++ R     NG   KCY +P G  +F S+A+V ++L            
Sbjct  6    SDDWLPPGWKVEVRQR----RNGKKDKCYYTPCGELRFISRAEVVRYLEKCG--------  53

Query  187  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  366
                                     S+T  K K V   Q+ K ++     +   A+GLP 
Sbjct  54   -------------------------SKTEEKEK-VPSKQSSKNIT----VEKAEAEGLPP  83

Query  367  GWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESAS  546
            GW KE++     + +R+DP+Y DPVSGY FRS +D +RY+ETG + K   KPK+ +ES  
Sbjct  84   GWTKEVKITKKGNKVRRDPFYTDPVSGYVFRSMKDALRYVETGKLGKLAFKPKE-NESNE  142

Query  547  KDIHHNIEE  573
            +D+  +I E
Sbjct  143  EDLEEDICE  151



>gb|KJB52811.1| hypothetical protein B456_008G278300 [Gossypium raimondii]
Length=600

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/186 (35%), Positives = 94/186 (51%), Gaps = 44/186 (24%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsn  186
            S DWLPPGW VE++ R     NG   KCY +P G  +F S+A+V ++L +          
Sbjct  6    SDDWLPPGWKVEVRQR----RNGKKDKCYYAPCGELRFISRAEVVRYLKNCG--------  53

Query  187  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  366
                                     S+T  K K V   Q+ K V+     +   A+GLP 
Sbjct  54   -------------------------SKTEEKEK-VPSKQSSKNVT----VEKAEAEGLPP  83

Query  367  GWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESAS  546
            GW KE++     + +R+DP+Y DPVSGY FRS +D +RY+ETG + K   KPK+ +ES  
Sbjct  84   GWTKEVKITKKGNKVRRDPFYTDPVSGYVFRSMKDALRYVETGKLGKLAFKPKE-NESNE  142

Query  547  KDIHHN  564
            +D+  +
Sbjct  143  EDLEED  148



>emb|CDP05220.1| unnamed protein product [Coffea canephora]
Length=480

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 87/165 (53%), Gaps = 39/165 (24%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSG-RKFYSKAQVSQFLNSAANSNTPIsn  186
            S DWLP GW VE++ R TG  +    KCY+ PS  RKFYSK +V ++L     S  P+  
Sbjct  7    SDDWLPAGWKVEVRVRKTGKKD----KCYVDPSNERKFYSKPEVLRYLKDVGVSQ-PVHE  61

Query  187  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  366
            E                     +N+S +SR             ++     ++ +A+GLPA
Sbjct  62   ET--------------------QNKSISSR-------------LAIKFVVKEEAAEGLPA  88

Query  367  GWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  501
            GW+KE R     + IR+DPYYIDP SG+ FRS ++V RYL+TG +
Sbjct  89   GWIKETRVTQKGNKIRRDPYYIDPESGHLFRSMKEVFRYLDTGKM  133



>ref|XP_009369054.1| PREDICTED: uncharacterized protein LOC103958513 [Pyrus x bretschneideri]
Length=1208

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 89/173 (51%), Gaps = 28/173 (16%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsnen  192
            +WLP GW VEL+ R +G+  G  YKCYI PS    FYSK +V ++L +            
Sbjct  86   EWLPNGWKVELRIRQSGAQVGREYKCYIDPSRECTFYSKPEVFRYLKTV-----------  134

Query  193  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQ--TPKTVSPAVAAQDISADGLPA  366
                          + ++ K    ++   ++ + + +  T   ++  V  +    + LP 
Sbjct  135  --------------KRKSSKSGNLKSISSKRCITEGKDVTTMQLTKNVYVEKHHVEDLPP  180

Query  367  GWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPK  525
            GW+KE++     +  RKDPYY DP SGY FRSK+DV+ YLETG+I K   KP+
Sbjct  181  GWIKEIKVTKYANRFRKDPYYTDPDSGYVFRSKKDVICYLETGEISKHAFKPR  233



>emb|CDP09782.1| unnamed protein product [Coffea canephora]
Length=819

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 68/113 (60%), Gaps = 6/113 (5%)
 Frame = +1

Query  229  VPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSG  408
             PQ+    +++S  S K ++ MD    K        +    D LP GW+KE+R R    G
Sbjct  245  APQHCESTKSKSHISEKEENRMD----KPFLEIAVDESKVLDELPPGWIKEIRARK--QG  298

Query  409  IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESASKDIHHNI  567
             RKDPYYIDPVSGYEFRSK+D +RYLE GDI +C I PKKRD +  K + H +
Sbjct  299  TRKDPYYIDPVSGYEFRSKKDALRYLEFGDISRCAITPKKRDRNDLKLVEHEV  351


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = +1

Query  4    NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTP  177
            N S +WLP GW +E + R +G+  GS YK Y+ P +G KFYSK QV Q+L S   + +P
Sbjct  85   NSSLEWLPQGWIIESRYRKSGATAGSVYKTYVDPLTGSKFYSKPQVMQYLESVNFNASP  143


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 84/199 (42%), Gaps = 43/199 (22%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA-ANSNTPI  180
            +S D LPPGW   +K       NG   K Y    +G KFYSK +V  F+ +  A   TP 
Sbjct  5    KSPDELPPGWKEHVKVS-----NGRKIKYYTDDVTGLKFYSKKRVINFVQTKDACQGTP-  58

Query  181  snenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGL  360
                                       S +    KS   ++T  + S  V  ++ S + L
Sbjct  59   --------------------------HSVSDHDLKSSC-SKTEASPSQVVVEKNSSLEWL  91

Query  361  PAGWVKELRTRTCPSGIRKDPYY---IDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKR  531
            P GW+ E R R   SG      Y   +DP++G +F SK  VM+YLE+ +      K +K 
Sbjct  92   PQGWIIESRYRK--SGATAGSVYKTYVDPLTGSKFYSKPQVMQYLESVNFNASPEKQQKE  149

Query  532  ---DESASKDIHHNIEEVS  579
               D S+ +D   + E +S
Sbjct  150  VRGDSSSKQDAPQHCESMS  168



>ref|XP_009390529.1| PREDICTED: uncharacterized protein LOC103976890 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=569

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/193 (34%), Positives = 96/193 (50%), Gaps = 20/193 (10%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsn  186
            S DWLP GW +E +T+  G++ G   KCY +PS G +FYSK QV + LN+  + +  I  
Sbjct  32   SPDWLPSGWVLETRTQKNGAYAGREIKCYYNPSTGSRFYSKKQVFRHLNARKDFSPTIRE  91

Query  187  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  366
                           P   T +E         KS+ ++ +    S   A     ++ LP 
Sbjct  92   TRSITSSNMKK----PCTSTSQE---------KSIKESSSNNVCS--YAPTGYGSNELPH  136

Query  367  GWVKELRTRTCPSGI-RKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESA  543
            GW+KE+R R    G    +  YIDP   Y FRS +D  RY+ETGD+ KC  KP+KR   +
Sbjct  137  GWIKEIRFRKYKRGKPVNETLYIDPDGEYAFRSLKDAFRYIETGDVNKCASKPQKR---S  193

Query  544  SKDIHHNIEEVSP  582
             +++H    E+ P
Sbjct  194  IRELHTVERELHP  206



>ref|XP_009390518.1| PREDICTED: uncharacterized protein LOC103976890 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=589

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 97/197 (49%), Gaps = 32/197 (16%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsn  186
            S DWLP GW +E +T+  G++ G   KCY +PS G +FYSK QV + LN+  + +  I  
Sbjct  32   SPDWLPSGWVLETRTQKNGAYAGREIKCYYNPSTGSRFYSKKQVFRHLNARKDFSPTI--  89

Query  187  enknnieesssnleVPQNQTPKENQSRTSRKRK----SVMDNQTPKTVSPAVAAQDISAD  354
                                 +E +S TS   K    S    ++ K  S   A     ++
Sbjct  90   ---------------------RETRSITSSNMKKPCTSTSQEKSIKESSSNNAPTGYGSN  128

Query  355  GLPAGWVKELRTRTCPSGI-RKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKR  531
             LP GW+KE+R R    G    +  YIDP   Y FRS +D  RY+ETGD+ KC  KP+KR
Sbjct  129  ELPHGWIKEIRFRKYKRGKPVNETLYIDPDGEYAFRSLKDAFRYIETGDVNKCASKPQKR  188

Query  532  DESASKDIHHNIEEVSP  582
               + +++H    E+ P
Sbjct  189  ---SIRELHTVERELHP  202



>ref|XP_009390512.1| PREDICTED: uncharacterized protein LOC103976890 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=593

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/193 (34%), Positives = 96/193 (50%), Gaps = 20/193 (10%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsn  186
            S DWLP GW +E +T+  G++ G   KCY +PS G +FYSK QV + LN+  + +  I  
Sbjct  32   SPDWLPSGWVLETRTQKNGAYAGREIKCYYNPSTGSRFYSKKQVFRHLNARKDFSPTIRE  91

Query  187  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  366
                           P   T +E         KS+ ++ +    S   A     ++ LP 
Sbjct  92   TRSITSSNMKK----PCTSTSQE---------KSIKESSSNNVCS--YAPTGYGSNELPH  136

Query  367  GWVKELRTRTCPSGI-RKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESA  543
            GW+KE+R R    G    +  YIDP   Y FRS +D  RY+ETGD+ KC  KP+KR   +
Sbjct  137  GWIKEIRFRKYKRGKPVNETLYIDPDGEYAFRSLKDAFRYIETGDVNKCASKPQKR---S  193

Query  544  SKDIHHNIEEVSP  582
             +++H    E+ P
Sbjct  194  IRELHTVERELHP  206



>ref|XP_007152298.1| hypothetical protein PHAVU_004G117900g [Phaseolus vulgaris]
 gb|ESW24292.1| hypothetical protein PHAVU_004G117900g [Phaseolus vulgaris]
Length=579

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 87/181 (48%), Gaps = 49/181 (27%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsn  186
            S D LPPGWTVE+K R     NG   K Y  PS G KF SK +V ++L++A N       
Sbjct  6    SDDQLPPGWTVEVKVRK----NGKRDKYYFLPSSGLKFNSKVEVYRYLDNANN-------  54

Query  187  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  366
                                           + S+      + +SP V  +   A+GLP 
Sbjct  55   -------------------------------KVSI------QKISPNVVVEKAIAEGLPP  77

Query  367  GWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESAS  546
            GWVK+ R  T    +R+D YYIDPVSGY F S  DV  YLE+G++ +  +KPK  D S +
Sbjct  78   GWVKKTRIATKGDTVRRDTYYIDPVSGYAFHSIEDVDHYLESGEVGRNTLKPKDEDISDT  137

Query  547  K  549
            K
Sbjct  138  K  138



>ref|XP_009589209.1| PREDICTED: uncharacterized protein LOC104086600 isoform X2 [Nicotiana 
tomentosiformis]
Length=1739

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 67/101 (66%), Gaps = 3/101 (3%)
 Frame = +1

Query  250  KEN--QSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDP  423
            KEN  QS  S+++K   D+ + KTV  +VA    S D LP GW KE+  R    GIRKDP
Sbjct  274  KENGVQSPLSKRQKPGSDSPSSKTVC-SVAVDCNSVDELPPGWKKEVIIRQTDRGIRKDP  332

Query  424  YYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESAS  546
             Y DPV GY FRSK+DV+RYL+TGDI KC IKP KRD  A+
Sbjct  333  LYTDPVHGYVFRSKKDVLRYLQTGDISKCAIKPVKRDLDAT  373


 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +1

Query  337   QDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVI  516
             ++ S D LP GW KE+R R    GIRKDP+Y DPV GY FRSK+DVMRYL+TGDI +C +
Sbjct  1148  REASVDELPPGWKKEIRIRQNARGIRKDPFYTDPVHGYVFRSKKDVMRYLQTGDISRCAM  1207

Query  517   KPKKRD  534
             +P KRD
Sbjct  1208  RPTKRD  1213


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 77/150 (51%), Gaps = 2/150 (1%)
 Frame = +1

Query  1    TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTP  177
            T +S +WLP GW VEL+ R +GSH G  YK YI PS G KFYS+ +VS++L +   +N  
Sbjct  110  TKKSPEWLPAGWIVELRNRKSGSHAGLAYKVYIDPSTGNKFYSRPEVSKYLKTMKQNNIA  169

Query  178  IsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADG  357
               +     E SSSN +  +N      QSR S+++KS  D  +      + + Q  S D 
Sbjct  170  GEEQIHGTGEVSSSNQKASENSKDIGGQSRISKRQKSDGDRPSHDIKEGSFSKQKPSQDS  229

Query  358  LPAGWVKELRTRTCPSGIRKDPYYIDPVSG  447
               G    + ++T  SGI +    I P  G
Sbjct  230  EEVGEPSCI-SKTQKSGINRPSTKISPSHG  258


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 105/202 (52%), Gaps = 24/202 (12%)
 Frame = +1

Query  13   SDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNS--AANSNTPIs  183
            +DW PPGWT ++K  S     G   K Y +  +G+KFYSK +V++++N+    +  T + 
Sbjct  8    ADWPPPGWTEDVKITS-----GRKTKYYTNVETGKKFYSKKEVTRYMNTKDTCHDVTQVL  62

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
            N++K++ + + S +        + N S+ + + +S  +N     VS  V     S + LP
Sbjct  63   NQDKSSSQNNVSQMNHQDKSFSENNVSQMNYQDRSCSEN----NVSQIVEETKKSPEWLP  118

Query  364  AGWVKELRTRTCPS--GIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDE  537
            AGW+ ELR R   S  G+     YIDP +G +F S+ +V +YL+T          K+ + 
Sbjct  119  AGWIVELRNRKSGSHAGLAYK-VYIDPSTGNKFYSRPEVSKYLKTM---------KQNNI  168

Query  538  SASKDIHHNIEEVSPNEKSVED  603
            +  + IH   E  S N+K+ E+
Sbjct  169  AGEEQIHGTGEVSSSNQKASEN  190



>gb|KHN16846.1| Methyl-CpG-binding domain-containing protein 13 [Glycine soja]
Length=1122

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 62/96 (65%), Gaps = 6/96 (6%)
 Frame = +1

Query  244  TPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDP  423
            +P +N   + +K  S MD+ T       V  +  + + LP GWVKEL+ R    GIRKDP
Sbjct  216  SPIDNSCSSKKKNCSNMDSPT------DVVVEKSTVEDLPPGWVKELKIRKNSKGIRKDP  269

Query  424  YYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKR  531
            +YIDP SGY FRSK+DV+RYLE+GDI+ C  KP +R
Sbjct  270  FYIDPASGYVFRSKKDVLRYLESGDIRSCAFKPSRR  305


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +1

Query  4    NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFL  150
            N+  DWLP GW VE++TR +G H GS YKCYI P  G KF+SK +V ++L
Sbjct  33   NEHPDWLPDGWNVEVRTRKSGVHMGSGYKCYIEPLKGYKFFSKPEVLRYL  82


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 36/63 (57%), Gaps = 5/63 (8%)
 Frame = +1

Query  352  DGLPAGWVKELRTRTCPSGIRKDP---YYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKP  522
            D LP GW  E+RTR   SG+        YI+P+ GY+F SK +V+RYLET     C  K 
Sbjct  37   DWLPDGWNVEVRTRK--SGVHMGSGYKCYIEPLKGYKFFSKPEVLRYLETVKDNSCTSKK  94

Query  523  KKR  531
             K+
Sbjct  95   GKK  97



>ref|XP_003532403.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Glycine max]
 ref|XP_006584707.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Glycine max]
Length=1122

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 62/96 (65%), Gaps = 6/96 (6%)
 Frame = +1

Query  244  TPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDP  423
            +P +N   + +K  S MD+ T       V  +  + + LP GWVKEL+ R    GIRKDP
Sbjct  216  SPIDNSCSSKKKNCSNMDSPT------DVVVEKSTVEDLPPGWVKELKIRKNSKGIRKDP  269

Query  424  YYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKR  531
            +YIDP SGY FRSK+DV+RYLE+GDI+ C  KP +R
Sbjct  270  FYIDPASGYVFRSKKDVLRYLESGDIRSCAFKPSRR  305


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +1

Query  4    NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFL  150
            N+  DWLP GW VE++TR +G H GS YKCYI P  G KF+SK +V ++L
Sbjct  33   NEHPDWLPDGWNVEVRTRKSGVHMGSGYKCYIEPLKGYKFFSKPEVLRYL  82


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 36/63 (57%), Gaps = 5/63 (8%)
 Frame = +1

Query  352  DGLPAGWVKELRTRTCPSGIRKDP---YYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKP  522
            D LP GW  E+RTR   SG+        YI+P+ GY+F SK +V+RYLET     C  K 
Sbjct  37   DWLPDGWNVEVRTRK--SGVHMGSGYKCYIEPLKGYKFFSKPEVLRYLETVKDNSCTSKK  94

Query  523  KKR  531
             K+
Sbjct  95   GKK  97



>ref|XP_009782392.1| PREDICTED: uncharacterized protein LOC104231139 isoform X3 [Nicotiana 
sylvestris]
Length=1613

 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 67/101 (66%), Gaps = 3/101 (3%)
 Frame = +1

Query  250  KEN--QSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDP  423
            KEN  QS +S+++K   D+ +  TV  +VA    S D LP GW KE+  R    GIRKDP
Sbjct  274  KENGVQSPSSKRQKPGSDSPSAMTVC-SVAVDCNSVDELPPGWKKEVIIRQTDRGIRKDP  332

Query  424  YYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESAS  546
             Y DPV GY FRSK+DV+RYL+TGDI KC IKP KRD  A+
Sbjct  333  LYTDPVHGYVFRSKKDVLRYLQTGDISKCAIKPFKRDLDAT  373


 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +1

Query  337   QDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVI  516
             ++ S D LP GW KE+R R    GIRKDP+Y DPV GY FRSK+DVMRYL+TGDI +C +
Sbjct  1022  REASVDELPPGWKKEIRIRQNARGIRKDPFYTDPVHGYVFRSKKDVMRYLQTGDISRCAM  1081

Query  517   KPKKRD  534
             +P KRD
Sbjct  1082  RPTKRD  1087


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 104/202 (51%), Gaps = 24/202 (12%)
 Frame = +1

Query  13   SDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsne  189
            +DW PPGWT ++K  S     G   K Y    +G+KFYSK +V++++N+    +      
Sbjct  8    ADWPPPGWTEDVKITS-----GRKTKYYTHVETGKKFYSKKEVTRYMNTKDTCHDVAQVL  62

Query  190  nknnieesssnleV-PQNQTPKENQ-SRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
            N++     ++  ++  Q+++  EN  S+ + + +S  +N     VS  V     S + LP
Sbjct  63   NQDKSSTENNVSQMNHQDKSFSENNVSQMNYQDRSCSEN----NVSQIVEETKKSPEWLP  118

Query  364  AGWVKELRTRTCPS--GIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDE  537
            AGW+ EL+TR   S  G+     YIDP +G +F S+ +V +YL+T          K+ D 
Sbjct  119  AGWIVELKTRKSGSNAGLAYK-VYIDPSTGNKFYSRPEVSKYLKTM---------KQNDI  168

Query  538  SASKDIHHNIEEVSPNEKSVED  603
            +  + IH   E  S N+K+ E+
Sbjct  169  TGEEQIHGTGEVSSSNQKASEN  190


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = +1

Query  1    TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFL  150
            T +S +WLP GW VELKTR +GS+ G  YK YI PS G KFYS+ +VS++L
Sbjct  110  TKKSPEWLPAGWIVELKTRKSGSNAGLAYKVYIDPSTGNKFYSRPEVSKYL  160



>ref|XP_009401689.1| PREDICTED: uncharacterized protein LOC103985652 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=504

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 58/83 (70%), Gaps = 6/83 (7%)
 Frame = +1

Query  358  LPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDE  537
            LP GW+KE+R R   + I+KDP+Y DPVSGYEFRS +DV RYLETGDI  CV KPKKR  
Sbjct  31   LPHGWIKEIRLRNSGTKIKKDPFYFDPVSGYEFRSLKDVFRYLETGDIHSCVNKPKKR--  88

Query  538  SASKDIHHNIEEVS--PNEKSVE  600
              S D  H++E+ S  P  K VE
Sbjct  89   --SIDDIHSLEKESHPPAAKRVE  109



>ref|XP_010325420.1| PREDICTED: uncharacterized protein LOC101264354 isoform X2 [Solanum 
lycopersicum]
Length=1852

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  325   AVAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIK  504
             +  +++ S DGLP GW  E R R   S I+KDPYY DPV GY FRSK+DVMRYL+TGDI+
Sbjct  1184  SFLSKEASVDGLPPGWKTEFRIRKNASVIKKDPYYTDPVHGYVFRSKKDVMRYLQTGDIR  1243

Query  505   KCVIKPKKRD  534
              C +KP KRD
Sbjct  1244  SCAVKPTKRD  1253


 Score = 93.6 bits (231),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +1

Query  340  DISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
            D S D LP GW KE++     +GIRKDP YIDPV GY FRSK+DV RYL+TGDI  C I+
Sbjct  576  DPSLDDLPPGWKKEIKITKKANGIRKDPLYIDPVDGYVFRSKKDVFRYLQTGDISSCAIR  635

Query  520  PKKRDESAS  546
            P KRD  A+
Sbjct  636  PVKRDLDAA  644


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 72/127 (57%), Gaps = 11/127 (9%)
 Frame = +1

Query  4    NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPI  180
            N S +WLPPGW VELKTR +GSH G +YK YI PS G KFYSK +VS++L +   +N  I
Sbjct  111  NNSHEWLPPGWIVELKTRKSGSHAGLSYKVYIDPSTGSKFYSKPEVSKYLKTMKQNN--I  168

Query  181  snenknnieesssnleVPQNQTPK----ENQSRTSRKRKSVMDNQTP----KTVSPAVAA  336
            + E + + +   S     +++ PK      Q+R S++ KS  D  +P     + S   A+
Sbjct  169  AGEGQTHGDGEISTTNQKKSEDPKIIRGGGQTRKSKRLKSDTDQASPGIEEGSFSKLKAS  228

Query  337  QDISADG  357
            QD    G
Sbjct  229  QDFEEVG  235


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 62/104 (60%), Gaps = 6/104 (6%)
 Frame = +1

Query  250  KEN--QSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDP  423
            KEN  QS  S+++K      + K+VS +VA    SAD LP GW KE  +R    G R   
Sbjct  275  KENGAQSPQSKRQKPGSGCPSAKSVS-SVAVDCDSADELPPGWKKE--SRKNDRGTRNYL  331

Query  424  YYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRD-ESASKD  552
             Y DPV GY+F SK++V+RYL+TGD   C  +P KR+  S +KD
Sbjct  332  LYTDPVHGYKFHSKKEVLRYLQTGDATSCARRPTKRNVASTTKD  375


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 83/169 (49%), Gaps = 20/169 (12%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsn  186
            S DW PPGWT ++K        G   K Y +  +G+KFYSK +V+++L +    +     
Sbjct  6    SPDWPPPGWTEDVKV-----SKGRKIKYYTNGETGKKFYSKKEVARYLKTKDTCDDVTQA  60

Query  187  enknnieesssnleVPQNQTPKENQSRT-SRKRKSVMDNQ----TPKTVSPAVAAQDISA  351
             N      S        N +  +NQ  + ++   S MDNQ    +   VS  V   + S 
Sbjct  61   MNIQGKSFSE------NNVSDMDNQDGSFAKDNGSQMDNQDNCCSENNVSQTVGKPNNSH  114

Query  352  DGLPAGWVKELRTRTCPS--GIRKDPYYIDPVSGYEFRSKRDVMRYLET  492
            + LP GW+ EL+TR   S  G+     YIDP +G +F SK +V +YL+T
Sbjct  115  EWLPPGWIVELKTRKSGSHAGLSYK-VYIDPSTGSKFYSKPEVSKYLKT  162



>ref|XP_004245626.1| PREDICTED: uncharacterized protein LOC101264354 isoform X1 [Solanum 
lycopersicum]
Length=1886

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  325   AVAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIK  504
             +  +++ S DGLP GW  E R R   S I+KDPYY DPV GY FRSK+DVMRYL+TGDI+
Sbjct  1218  SFLSKEASVDGLPPGWKTEFRIRKNASVIKKDPYYTDPVHGYVFRSKKDVMRYLQTGDIR  1277

Query  505   KCVIKPKKRD  534
              C +KP KRD
Sbjct  1278  SCAVKPTKRD  1287


 Score = 93.6 bits (231),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +1

Query  340  DISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
            D S D LP GW KE++     +GIRKDP YIDPV GY FRSK+DV RYL+TGDI  C I+
Sbjct  576  DPSLDDLPPGWKKEIKITKKANGIRKDPLYIDPVDGYVFRSKKDVFRYLQTGDISSCAIR  635

Query  520  PKKRDESAS  546
            P KRD  A+
Sbjct  636  PVKRDLDAA  644


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 72/127 (57%), Gaps = 11/127 (9%)
 Frame = +1

Query  4    NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPI  180
            N S +WLPPGW VELKTR +GSH G +YK YI PS G KFYSK +VS++L +   +N  I
Sbjct  111  NNSHEWLPPGWIVELKTRKSGSHAGLSYKVYIDPSTGSKFYSKPEVSKYLKTMKQNN--I  168

Query  181  snenknnieesssnleVPQNQTPK----ENQSRTSRKRKSVMDNQTP----KTVSPAVAA  336
            + E + + +   S     +++ PK      Q+R S++ KS  D  +P     + S   A+
Sbjct  169  AGEGQTHGDGEISTTNQKKSEDPKIIRGGGQTRKSKRLKSDTDQASPGIEEGSFSKLKAS  228

Query  337  QDISADG  357
            QD    G
Sbjct  229  QDFEEVG  235


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 62/104 (60%), Gaps = 6/104 (6%)
 Frame = +1

Query  250  KEN--QSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDP  423
            KEN  QS  S+++K      + K+VS +VA    SAD LP GW KE  +R    G R   
Sbjct  275  KENGAQSPQSKRQKPGSGCPSAKSVS-SVAVDCDSADELPPGWKKE--SRKNDRGTRNYL  331

Query  424  YYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRD-ESASKD  552
             Y DPV GY+F SK++V+RYL+TGD   C  +P KR+  S +KD
Sbjct  332  LYTDPVHGYKFHSKKEVLRYLQTGDATSCARRPTKRNVASTTKD  375


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 83/169 (49%), Gaps = 20/169 (12%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsn  186
            S DW PPGWT ++K        G   K Y +  +G+KFYSK +V+++L +    +     
Sbjct  6    SPDWPPPGWTEDVKV-----SKGRKIKYYTNGETGKKFYSKKEVARYLKTKDTCDDVTQA  60

Query  187  enknnieesssnleVPQNQTPKENQSRT-SRKRKSVMDNQ----TPKTVSPAVAAQDISA  351
             N      S        N +  +NQ  + ++   S MDNQ    +   VS  V   + S 
Sbjct  61   MNIQGKSFSE------NNVSDMDNQDGSFAKDNGSQMDNQDNCCSENNVSQTVGKPNNSH  114

Query  352  DGLPAGWVKELRTRTCPS--GIRKDPYYIDPVSGYEFRSKRDVMRYLET  492
            + LP GW+ EL+TR   S  G+     YIDP +G +F SK +V +YL+T
Sbjct  115  EWLPPGWIVELKTRKSGSHAGLSYK-VYIDPSTGSKFYSKPEVSKYLKT  162



>ref|XP_009782390.1| PREDICTED: uncharacterized protein LOC104231139 isoform X1 [Nicotiana 
sylvestris]
Length=1884

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +1

Query  337   QDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVI  516
             ++ S D LP GW KE+R R    GIRKDP+Y DPV GY FRSK+DVMRYL+TGDI +C +
Sbjct  1293  REASVDELPPGWKKEIRIRQNARGIRKDPFYTDPVHGYVFRSKKDVMRYLQTGDISRCAM  1352

Query  517   KPKKRD  534
             +P KRD
Sbjct  1353  RPTKRD  1358


 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +1

Query  325  AVAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIK  504
            A  + + S D LP GW KE++      GIRKDP Y DPV GY FRSK+DV+RYL+TGDI 
Sbjct  571  ASLSGEASVDELPPGWKKEIKVTKKARGIRKDPLYTDPVHGYVFRSKKDVLRYLQTGDIS  630

Query  505  KCVIKPKKRDESAS  546
            KC IKP KRD  A+
Sbjct  631  KCAIKPFKRDLDAT  644


 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 71/113 (63%), Gaps = 4/113 (4%)
 Frame = +1

Query  250  KEN--QSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDP  423
            KEN  QS +S+++K   D+ +  TV  +VA    S D LP GW KE+  R    GIRKDP
Sbjct  274  KENGVQSPSSKRQKPGSDSPSAMTVC-SVAVDCNSVDELPPGWKKEVIIRQTDRGIRKDP  332

Query  424  YYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESAS-KDIHHNIEEVS  579
             Y DPV GY+FRSK++V RYL+TGD  KC  +  KR+ +++ KD  H  ++ S
Sbjct  333  VYTDPVHGYKFRSKKEVFRYLQTGDTSKCARRHSKRNAASTMKDNSHTTDDAS  385


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 104/202 (51%), Gaps = 24/202 (12%)
 Frame = +1

Query  13   SDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsne  189
            +DW PPGWT ++K  S     G   K Y    +G+KFYSK +V++++N+    +      
Sbjct  8    ADWPPPGWTEDVKITS-----GRKTKYYTHVETGKKFYSKKEVTRYMNTKDTCHDVAQVL  62

Query  190  nknnieesssnleV-PQNQTPKENQ-SRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
            N++     ++  ++  Q+++  EN  S+ + + +S  +N     VS  V     S + LP
Sbjct  63   NQDKSSTENNVSQMNHQDKSFSENNVSQMNYQDRSCSEN----NVSQIVEETKKSPEWLP  118

Query  364  AGWVKELRTRTCPS--GIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDE  537
            AGW+ EL+TR   S  G+     YIDP +G +F S+ +V +YL+T          K+ D 
Sbjct  119  AGWIVELKTRKSGSNAGLAYK-VYIDPSTGNKFYSRPEVSKYLKTM---------KQNDI  168

Query  538  SASKDIHHNIEEVSPNEKSVED  603
            +  + IH   E  S N+K+ E+
Sbjct  169  TGEEQIHGTGEVSSSNQKASEN  190


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = +1

Query  1    TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFL  150
            T +S +WLP GW VELKTR +GS+ G  YK YI PS G KFYS+ +VS++L
Sbjct  110  TKKSPEWLPAGWIVELKTRKSGSNAGLAYKVYIDPSTGNKFYSRPEVSKYL  160



>ref|XP_009782391.1| PREDICTED: uncharacterized protein LOC104231139 isoform X2 [Nicotiana 
sylvestris]
Length=1881

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +1

Query  337   QDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVI  516
             ++ S D LP GW KE+R R    GIRKDP+Y DPV GY FRSK+DVMRYL+TGDI +C +
Sbjct  1290  REASVDELPPGWKKEIRIRQNARGIRKDPFYTDPVHGYVFRSKKDVMRYLQTGDISRCAM  1349

Query  517   KPKKRD  534
             +P KRD
Sbjct  1350  RPTKRD  1355


 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +1

Query  325  AVAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIK  504
            A  + + S D LP GW KE++      GIRKDP Y DPV GY FRSK+DV+RYL+TGDI 
Sbjct  568  ASLSGEASVDELPPGWKKEIKVTKKARGIRKDPLYTDPVHGYVFRSKKDVLRYLQTGDIS  627

Query  505  KCVIKPKKRDESAS  546
            KC IKP KRD  A+
Sbjct  628  KCAIKPFKRDLDAT  641


 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 69/113 (61%), Gaps = 7/113 (6%)
 Frame = +1

Query  250  KEN--QSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDP  423
            KEN  QS +S+++K   D+ +  TV    A    S D LP GW KE+  R    GIRKDP
Sbjct  274  KENGVQSPSSKRQKPGSDSPSAMTV----AVDCNSVDELPPGWKKEVIIRQTDRGIRKDP  329

Query  424  YYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESAS-KDIHHNIEEVS  579
             Y DPV GY+FRSK++V RYL+TGD  KC  +  KR+ +++ KD  H  ++ S
Sbjct  330  VYTDPVHGYKFRSKKEVFRYLQTGDTSKCARRHSKRNAASTMKDNSHTTDDAS  382


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 104/202 (51%), Gaps = 24/202 (12%)
 Frame = +1

Query  13   SDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsne  189
            +DW PPGWT ++K  S     G   K Y    +G+KFYSK +V++++N+    +      
Sbjct  8    ADWPPPGWTEDVKITS-----GRKTKYYTHVETGKKFYSKKEVTRYMNTKDTCHDVAQVL  62

Query  190  nknnieesssnleV-PQNQTPKENQ-SRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
            N++     ++  ++  Q+++  EN  S+ + + +S  +N     VS  V     S + LP
Sbjct  63   NQDKSSTENNVSQMNHQDKSFSENNVSQMNYQDRSCSEN----NVSQIVEETKKSPEWLP  118

Query  364  AGWVKELRTRTCPS--GIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDE  537
            AGW+ EL+TR   S  G+     YIDP +G +F S+ +V +YL+T          K+ D 
Sbjct  119  AGWIVELKTRKSGSNAGLAYK-VYIDPSTGNKFYSRPEVSKYLKTM---------KQNDI  168

Query  538  SASKDIHHNIEEVSPNEKSVED  603
            +  + IH   E  S N+K+ E+
Sbjct  169  TGEEQIHGTGEVSSSNQKASEN  190


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = +1

Query  1    TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFL  150
            T +S +WLP GW VELKTR +GS+ G  YK YI PS G KFYS+ +VS++L
Sbjct  110  TKKSPEWLPAGWIVELKTRKSGSNAGLAYKVYIDPSTGNKFYSRPEVSKYL  160



>ref|XP_009589208.1| PREDICTED: uncharacterized protein LOC104086600 isoform X1 [Nicotiana 
tomentosiformis]
Length=2010

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +1

Query  337   QDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVI  516
             ++ S D LP GW KE+R R    GIRKDP+Y DPV GY FRSK+DVMRYL+TGDI +C +
Sbjct  1419  REASVDELPPGWKKEIRIRQNARGIRKDPFYTDPVHGYVFRSKKDVMRYLQTGDISRCAM  1478

Query  517   KPKKRD  534
             +P KRD
Sbjct  1479  RPTKRD  1484


 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +1

Query  325  AVAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIK  504
            A  + + S D LP GW KE++      GIRKDP Y DPV GY FRSK+DV+RYL+TGDI 
Sbjct  571  ASLSGETSVDELPPGWKKEIKVTKKARGIRKDPLYTDPVHGYVFRSKKDVLRYLQTGDIS  630

Query  505  KCVIKPKKRDESAS  546
            KC IKP KRD  A+
Sbjct  631  KCAIKPVKRDLDAT  644


 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 68/113 (60%), Gaps = 4/113 (4%)
 Frame = +1

Query  250  KEN--QSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDP  423
            KEN  QS  S+++K   D+ + KTV  +VA    S D LP GW KE+  R    GIRKDP
Sbjct  274  KENGVQSPLSKRQKPGSDSPSSKTVC-SVAVDCNSVDELPPGWKKEVIIRQTDRGIRKDP  332

Query  424  YYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRD-ESASKDIHHNIEEVS  579
             Y DPV GY+FRSK++V RYL TGD  KC  +  KR+  S  KD  H  ++ S
Sbjct  333  MYTDPVHGYKFRSKKEVFRYLHTGDTSKCARRHSKRNVASTMKDNSHTTDDAS  385


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 77/150 (51%), Gaps = 2/150 (1%)
 Frame = +1

Query  1    TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTP  177
            T +S +WLP GW VEL+ R +GSH G  YK YI PS G KFYS+ +VS++L +   +N  
Sbjct  110  TKKSPEWLPAGWIVELRNRKSGSHAGLAYKVYIDPSTGNKFYSRPEVSKYLKTMKQNNIA  169

Query  178  IsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADG  357
               +     E SSSN +  +N      QSR S+++KS  D  +      + + Q  S D 
Sbjct  170  GEEQIHGTGEVSSSNQKASENSKDIGGQSRISKRQKSDGDRPSHDIKEGSFSKQKPSQDS  229

Query  358  LPAGWVKELRTRTCPSGIRKDPYYIDPVSG  447
               G    + ++T  SGI +    I P  G
Sbjct  230  EEVGEPSCI-SKTQKSGINRPSTKISPSHG  258


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 105/202 (52%), Gaps = 24/202 (12%)
 Frame = +1

Query  13   SDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNS--AANSNTPIs  183
            +DW PPGWT ++K  S     G   K Y +  +G+KFYSK +V++++N+    +  T + 
Sbjct  8    ADWPPPGWTEDVKITS-----GRKTKYYTNVETGKKFYSKKEVTRYMNTKDTCHDVTQVL  62

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
            N++K++ + + S +        + N S+ + + +S  +N     VS  V     S + LP
Sbjct  63   NQDKSSSQNNVSQMNHQDKSFSENNVSQMNYQDRSCSEN----NVSQIVEETKKSPEWLP  118

Query  364  AGWVKELRTRTCPS--GIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDE  537
            AGW+ ELR R   S  G+     YIDP +G +F S+ +V +YL+T          K+ + 
Sbjct  119  AGWIVELRNRKSGSHAGLAYK-VYIDPSTGNKFYSRPEVSKYLKTM---------KQNNI  168

Query  538  SASKDIHHNIEEVSPNEKSVED  603
            +  + IH   E  S N+K+ E+
Sbjct  169  AGEEQIHGTGEVSSSNQKASEN  190



>ref|XP_010676507.1| PREDICTED: uncharacterized protein LOC104892309 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1021

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/175 (37%), Positives = 98/175 (56%), Gaps = 16/175 (9%)
 Frame = +1

Query  13   SDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS--AANSNTPIs  183
            S+WLP GW +E + R +G+  G+ YKC+I PS G K +SK +V ++L S      N   S
Sbjct  82   SEWLPSGWVMETRFRKSGARVGTEYKCFIDPSTGTKLFSKPEVLRYLGSEKTKQHNAESS  141

Query  184  nenknnieesssnleVPQ------NQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI  345
             +      E SS+  V +      N  PK +Q   SR RKS+  ++ PK V+   A ++ 
Sbjct  142  RQKDRGGSEHSSSKVVDRLSAQKSNLEPKVSQISKSRVRKSI-SSEKPKVVTERTADEE-  199

Query  346  SADGLPAGWVKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  507
                LP+GW+KE R +   +  +R+D +Y DP S   F SK +V+RY+ETG++ +
Sbjct  200  ----LPSGWIKETRIKMLDNKVVRRDSFYSDPASRLVFCSKLEVLRYVETGEVSR  250



>ref|XP_010676508.1| PREDICTED: uncharacterized protein LOC104892309 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=942

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 99/176 (56%), Gaps = 17/176 (10%)
 Frame = +1

Query  13   SDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS-------AANS  168
            S+WLP GW +E + R +G+  G+ YKC+I PS G K +SK +V ++L S       A +S
Sbjct  82   SEWLPSGWVMETRFRKSGARVGTEYKCFIDPSTGTKLFSKPEVLRYLGSEKTKQHNAESS  141

Query  169  NTPIsnenknnieesssnleVPQ--NQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQD  342
                   ++++  +   +    Q  N  PK +Q   SR RKS+  ++ PK V+   A ++
Sbjct  142  RQKDRGGSEHSSSKKVVDRLSAQKSNLEPKVSQISKSRVRKSI-SSEKPKVVTERTADEE  200

Query  343  ISADGLPAGWVKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  507
                 LP+GW+KE R +   +  +R+D +Y DP S   F SK +V+RY+ETG++ +
Sbjct  201  -----LPSGWIKETRIKMLDNKVVRRDSFYSDPASRLVFCSKLEVLRYVETGEVSR  251



>ref|XP_006358894.1| PREDICTED: uncharacterized protein LOC102587100 isoform X1 [Solanum 
tuberosum]
Length=1845

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  325   AVAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIK  504
             +  +++ S DGLP GW  E R R     I+KDPYY+DPV GY FRSK+DVMRYL+TGDI+
Sbjct  1182  SFLSKEASVDGLPPGWKTEFRMRKNARVIKKDPYYMDPVLGYVFRSKKDVMRYLQTGDIR  1241

Query  505   KCVIKPKKRD  534
              C +KP KRD
Sbjct  1242  SCAVKPTKRD  1251


 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +1

Query  340  DISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
            D S D LP GW KE++     +GIRKDP YIDPV GY FRSK+DV RYL+TGDI  C IK
Sbjct  571  DPSLDDLPPGWKKEIKITKKANGIRKDPLYIDPVDGYVFRSKKDVFRYLQTGDISNCAIK  630

Query  520  PKKRDESAS  546
            P KRD  A+
Sbjct  631  PVKRDLDAT  639


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 69/204 (34%), Positives = 100/204 (49%), Gaps = 25/204 (12%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsn  186
            S DW PPGWT ++K       NG   K Y +  +G+KFYSK +V+++LN+    +     
Sbjct  6    SPDWPPPGWTEDVKV-----SNGRKIKYYTNGQTGKKFYSKKEVARYLNTKDTCDDVTQA  60

Query  187  enknnieesssnleVPQNQTP---KENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADG  357
                    S +N+    NQ     K+N S+     KS  +N     VS AV   + S + 
Sbjct  61   MTIQGKNCSENNVSHMDNQDESFSKDNVSQMDNLDKSCSEN----NVSEAVGRPNNSHEW  116

Query  358  LPAGWVKELRTRTCPSGIRKDPY--YIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKR  531
            LP GW+ EL+TR   S     PY  YIDP +G +F SK +V +YL+T          K+ 
Sbjct  117  LPPGWIVELKTRKSGSHAGT-PYKVYIDPSTGSKFYSKPEVSKYLKT---------MKQN  166

Query  532  DESASKDIHHNIEEVSPNEKSVED  603
            + +    IH + E  S N+K+ ED
Sbjct  167  NITGEGQIHGDGEVSSSNQKTSED  190


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = +1

Query  4    NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSN  171
            N S +WLPPGW VELKTR +GSH G+ YK YI PS G KFYSK +VS++L +   +N
Sbjct  111  NNSHEWLPPGWIVELKTRKSGSHAGTPYKVYIDPSTGSKFYSKPEVSKYLKTMKQNN  167


 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 63/104 (61%), Gaps = 6/104 (6%)
 Frame = +1

Query  250  KEN--QSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDP  423
            KEN  QS  S+++K      + K+VS +VA    SAD LP GW KE  +     G R+  
Sbjct  275  KENGAQSPQSKRQKPGSGCLSAKSVS-SVAVDCDSADELPHGWKKE--SSQNDRGTREYL  331

Query  424  YYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRD-ESASKD  552
             Y DPV GY+F SK++V+RYL+TGD  +C  +P KR+  S +KD
Sbjct  332  LYTDPVHGYKFYSKKEVLRYLQTGDASRCARRPAKRNVASTTKD  375



>ref|XP_010676506.1| PREDICTED: uncharacterized protein LOC104892309 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1022

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 99/176 (56%), Gaps = 17/176 (10%)
 Frame = +1

Query  13   SDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS-------AANS  168
            S+WLP GW +E + R +G+  G+ YKC+I PS G K +SK +V ++L S       A +S
Sbjct  82   SEWLPSGWVMETRFRKSGARVGTEYKCFIDPSTGTKLFSKPEVLRYLGSEKTKQHNAESS  141

Query  169  NTPIsnenknnieesssnleVPQ--NQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQD  342
                   ++++  +   +    Q  N  PK +Q   SR RKS+  ++ PK V+   A ++
Sbjct  142  RQKDRGGSEHSSSKKVVDRLSAQKSNLEPKVSQISKSRVRKSI-SSEKPKVVTERTADEE  200

Query  343  ISADGLPAGWVKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  507
                 LP+GW+KE R +   +  +R+D +Y DP S   F SK +V+RY+ETG++ +
Sbjct  201  -----LPSGWIKETRIKMLDNKVVRRDSFYSDPASRLVFCSKLEVLRYVETGEVSR  251



>gb|EMS68477.1| hypothetical protein TRIUR3_20569 [Triticum urartu]
Length=619

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 80/171 (47%), Gaps = 41/171 (24%)
 Frame = +1

Query  19   WLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsnenk  195
            WLP GW VE++    G+     YK Y+  P+G +F+SK  V +++N    S   +     
Sbjct  167  WLPDGWVVEVRA---GTMQDKMYKFYVHLPTGMRFFSKEDVLRYVNEGKISECDV-----  218

Query  196  nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWV  375
                                         K + D  +   +   +A  + + DGLP GWV
Sbjct  219  -----------------------------KGLCDTISEDNI---LAQVEFNPDGLPKGWV  246

Query  376  KELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK  528
            KEL  R C  GIRKDPYY DPVS   FR+ + V+ YL+TG+I +    P++
Sbjct  247  KELVFRKCNDGIRKDPYYTDPVSHLLFRTLKSVISYLQTGEISRHAYLPRR  297



>ref|XP_008234128.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Prunus mume]
Length=547

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 85/172 (49%), Gaps = 39/172 (23%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSNTPIsn  186
            +S DWLP GWTVE+K R+ G  +   Y    S SG KF SKA+VS++LN+          
Sbjct  5    KSEDWLPTGWTVEVKVRNNGKRDKYYYD---SASGHKFNSKAEVSRYLNT----------  51

Query  187  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  366
                                     S+ S + K  ++    ++ +  V  + I A GLP 
Sbjct  52   -------------------------SQISDEVKQKVEETLKRSANDVVVEKTI-AGGLPQ  85

Query  367  GWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKP  522
            GW+KE+R       IR+D YYIDPVS   FRS +DV RYLE    ++ +++P
Sbjct  86   GWIKEIRMTKKDHKIRRDSYYIDPVSEKLFRSMKDVNRYLENEKPRRLILEP  137



>gb|KHN23667.1| Methyl-CpG-binding domain-containing protein 13 [Glycine soja]
Length=1188

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +1

Query  328  VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  507
            V  +  + + LP GWVKEL+ R    GIRKDP+YIDP SGY FRSK+DV+RYLE+GDI+ 
Sbjct  220  VVVEKSTVEDLPPGWVKELKIRKNSKGIRKDPFYIDPASGYVFRSKKDVLRYLESGDIRS  279

Query  508  CVIKPKKR  531
            C  +P +R
Sbjct  280  CAFRPSRR  287


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = +1

Query  4    NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSA  159
            N+  DWLP GW VE++TR +G H GS YKCYI P  R KF+SK +V ++L + 
Sbjct  32   NEHPDWLPDGWNVEVRTRKSGVHMGSGYKCYIEPLKRYKFFSKPEVLRYLETV  84



>ref|XP_006580605.1| PREDICTED: uncharacterized protein LOC100782433 [Glycine max]
Length=1209

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +1

Query  328  VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  507
            V  +  + + LP GWVKEL+ R    GIRKDP+YIDP SGY FRSK+DV+RYLE+GDI+ 
Sbjct  220  VVVEKSTVEDLPPGWVKELKIRKNSKGIRKDPFYIDPASGYVFRSKKDVLRYLESGDIRS  279

Query  508  CVIKPKKR  531
            C  +P +R
Sbjct  280  CAFRPSRR  287


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +1

Query  4    NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFL  150
            N+  DWLP GW VE++TR +G H GS YKCYI P  R KF+SK +V ++L
Sbjct  32   NEHPDWLPDGWNVEVRTRKSGVHMGSGYKCYIEPLKRYKFFSKPEVLRYL  81



>ref|XP_007160033.1| hypothetical protein PHAVU_002G287000g [Phaseolus vulgaris]
 gb|ESW32027.1| hypothetical protein PHAVU_002G287000g [Phaseolus vulgaris]
Length=1225

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  349  ADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK  528
            A+ LP GWVKEL+      GIRKDP+YIDPVSGY FRSK+DV+RYLE+GD++ C  KP +
Sbjct  226  AEDLPPGWVKELKITKNSKGIRKDPFYIDPVSGYVFRSKKDVLRYLESGDVRSCAFKPSR  285

Query  529  R  531
            R
Sbjct  286  R  286


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANS  168
            +WLP GW +E++ R +G H GS YKCYI P  G KF+SK +V ++L +  +S
Sbjct  37   EWLPDGWNMEVRIRKSGLHMGSGYKCYIEPLKGYKFFSKPEVLRYLETVKDS  88



>gb|EEC83090.1| hypothetical protein OsI_28224 [Oryza sativa Indica Group]
Length=676

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +1

Query  340  DISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
            D+  DGLP GW KE R R   S ++ DPYYIDPVSGYEFRS +DV R+L++GDI KC+++
Sbjct  105  DLIVDGLPDGWWKEDRPRKNGSNLKTDPYYIDPVSGYEFRSLKDVHRFLKSGDIYKCIVR  164

Query  520  PKKR  531
            P+KR
Sbjct  165  PRKR  168



>gb|EEE68228.1| hypothetical protein OsJ_26412 [Oryza sativa Japonica Group]
Length=899

 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +1

Query  340  DISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
            D+  DGLP GW KE R R   S ++ DPYYIDPVSGYEFRS +DV R+L++GDI KC+++
Sbjct  105  DLIVDGLPDGWWKEDRPRKNGSNLKTDPYYIDPVSGYEFRSLKDVHRFLKSGDIYKCIVR  164

Query  520  PKKR  531
            P+KR
Sbjct  165  PRKR  168



>ref|NP_001052334.1| Os04g0266400 [Oryza sativa Japonica Group]
 dbj|BAF14248.1| Os04g0266400 [Oryza sativa Japonica Group]
Length=313

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 77/171 (45%), Gaps = 40/171 (23%)
 Frame = +1

Query  19   WLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsnenk  195
            WLP GW +E+  R+ G      YK Y+  P+G +F SK  V  + N    S   +     
Sbjct  168  WLPDGWAIEV--RAGGKKMEKMYKFYVHLPTGMRFLSKENVLLYSNEGKISRCDV-----  220

Query  196  nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWV  375
                                         K + D  +   +   +A  + + DGLP GWV
Sbjct  221  -----------------------------KGLCDTSSEDNI---LAMVEFNPDGLPEGWV  248

Query  376  KELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK  528
            KE+  R C  GIRKDPYY DPVS + FR+ + V+ YLETG I K    P++
Sbjct  249  KEIIFRKCNDGIRKDPYYTDPVSRHVFRTLKSVINYLETGQITKHAYIPRR  299



>gb|EEC76899.1| hypothetical protein OsI_15124 [Oryza sativa Indica Group]
 gb|EEE53269.1| hypothetical protein OsJ_36209 [Oryza sativa Japonica Group]
Length=371

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 77/171 (45%), Gaps = 40/171 (23%)
 Frame = +1

Query  19   WLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsnenk  195
            WLP GW +E+  R+ G      YK Y+  P+G +F SK  V  + N    S   +     
Sbjct  168  WLPDGWAIEV--RAGGKKMEKMYKFYVHLPTGMRFLSKENVLLYSNEGKISRCDV-----  220

Query  196  nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWV  375
                                         K + D  +   +   +A  + + DGLP GWV
Sbjct  221  -----------------------------KGLCDTSSEDNI---LAMVEFNPDGLPEGWV  248

Query  376  KELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK  528
            KE+  R C  GIRKDPYY DPVS + FR+ + V+ YLETG I K    P++
Sbjct  249  KEIIFRKCNDGIRKDPYYTDPVSRHVFRTLKSVINYLETGQITKHAYIPRR  299



>gb|EMT22364.1| hypothetical protein F775_06449 [Aegilops tauschii]
Length=566

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 79/171 (46%), Gaps = 41/171 (24%)
 Frame = +1

Query  19   WLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsnenk  195
            WLP GW VE++    G+     YK Y+  P+G +F+SK  V +++N    S   +     
Sbjct  144  WLPDGWVVEVRA---GTMRDKMYKFYVHLPTGMRFFSKEDVLRYVNEGKISEWDV-----  195

Query  196  nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWV  375
                                         K + D  +   +   +A  + + DGLP GWV
Sbjct  196  -----------------------------KGLCDTISEDNI---LAQVEFNPDGLPKGWV  223

Query  376  KELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK  528
            KEL  R C  GIRKDPYY DPVS   FR+ +  + YL+TG+I K    P++
Sbjct  224  KELVFRKCNDGIRKDPYYTDPVSHLLFRTLKSAISYLQTGEISKHAYLPRR  274



>emb|CAD39968.2| OSJNBa0072D08.3 [Oryza sativa Japonica Group]
Length=505

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 77/171 (45%), Gaps = 40/171 (23%)
 Frame = +1

Query  19   WLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsnenk  195
            WLP GW +E+  R+ G      YK Y+  P+G +F SK  V  + N    S   +     
Sbjct  105  WLPDGWAIEV--RAGGKKMEKMYKFYVHLPTGMRFLSKENVLLYSNEGKISRCDV-----  157

Query  196  nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWV  375
                                         K + D  +   +   +A  + + DGLP GWV
Sbjct  158  -----------------------------KGLCDTSSEDNI---LAMVEFNPDGLPEGWV  185

Query  376  KELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK  528
            KE+  R C  GIRKDPYY DPVS + FR+ + V+ YLETG I K    P++
Sbjct  186  KEIIFRKCNDGIRKDPYYTDPVSRHVFRTLKSVINYLETGQITKHAYIPRR  236



>emb|CAH66253.1| OSIGBa0139I12.2 [Oryza sativa Indica Group]
Length=505

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 77/171 (45%), Gaps = 40/171 (23%)
 Frame = +1

Query  19   WLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsnenk  195
            WLP GW +E+  R+ G      YK Y+  P+G +F SK  V  + N    S   +     
Sbjct  105  WLPDGWAIEV--RAGGKKMEKMYKFYVHLPTGMRFLSKENVLLYSNEGKISRCDV-----  157

Query  196  nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWV  375
                                         K + D  +   +   +A  + + DGLP GWV
Sbjct  158  -----------------------------KGLCDTSSEDNI---LAMVEFNPDGLPEGWV  185

Query  376  KELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK  528
            KE+  R C  GIRKDPYY DPVS + FR+ + V+ YLETG I K    P++
Sbjct  186  KEIIFRKCNDGIRKDPYYTDPVSRHVFRTLKSVINYLETGQITKHAYIPRR  236



>gb|KJB39638.1| hypothetical protein B456_007G022700 [Gossypium raimondii]
Length=880

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/225 (30%), Positives = 91/225 (40%), Gaps = 86/225 (38%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTG---SH------------------------------------  72
            S DWLP GWT E + + TG   +H                                    
Sbjct  6    SPDWLPAGWTQEFRFQKTGRRITHYVNLATGQKFFTKDDLIRYTKTETKTESKQYDDRLL  65

Query  73   ---------NGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsnenknnieesssn  222
                       S    Y+ PS G +FYSK  V +FL  A   N                 
Sbjct  66   TLKQITKPSTNSQVNIYVDPSTGLRFYSKPAVFRFLKQAEQRN-----------------  108

Query  223  leVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCP  402
                  +T K+ Q+  SRK+               V  +  + D LPAGW+KE++ +   
Sbjct  109  -----RKTNKKKQAAYSRKK---------------VVIEKSTVDDLPAGWIKEIKIQRNA  148

Query  403  SGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDE  537
            +G+RKDPYY DPVSGY FRSK+ V+ YLETG+I +    P K ++
Sbjct  149  NGVRKDPYYTDPVSGYVFRSKKAVLHYLETGEIARSAFLPPKSND  193



>ref|NP_001061241.1| Os08g0206700 [Oryza sativa Japonica Group]
 dbj|BAD11558.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD12843.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23155.1| Os08g0206700 [Oryza sativa Japonica Group]
 dbj|BAG92499.1| unnamed protein product [Oryza sativa Japonica Group]
Length=422

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +1

Query  340  DISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
            D+  DGLP GW KE R R   S ++ DPYYIDPVSGYEFRS +DV R+L++GDI KC+++
Sbjct  337  DLIVDGLPDGWWKEDRPRKNGSNLKTDPYYIDPVSGYEFRSLKDVHRFLKSGDIYKCIVR  396

Query  520  PKKR  531
            P+KR
Sbjct  397  PRKR  400



>gb|EYU38370.1| hypothetical protein MIMGU_mgv1a007205mg [Erythranthe guttata]
Length=415

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +1

Query  328  VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  507
            VA + ++AD LP GW+KE+ T    + IRKDPYY DPVSGY FRSK DV RYL T +I  
Sbjct  20   VACETVAADDLPPGWIKEIVTSKFGNKIRKDPYYTDPVSGYVFRSKLDVERYLTTNNINS  79

Query  508  CVIKPKKRDESASKDIHHN  564
            C  +PKK+DE   +    N
Sbjct  80   CACRPKKKDEFDDRKFIEN  98



>dbj|BAG89597.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97335.1| unnamed protein product [Oryza sativa Japonica Group]
Length=568

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 77/171 (45%), Gaps = 40/171 (23%)
 Frame = +1

Query  19   WLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsnenk  195
            WLP GW +E+  R+ G      YK Y+  P+G +F SK  V  + N    S   +     
Sbjct  168  WLPDGWAIEV--RAGGKKMEKMYKFYVHLPTGMRFLSKENVLLYSNEGKISRCDV-----  220

Query  196  nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWV  375
                                         K + D  +   +   +A  + + DGLP GWV
Sbjct  221  -----------------------------KGLCDTSSEDNI---LAMVEFNPDGLPEGWV  248

Query  376  KELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK  528
            KE+  R C  GIRKDPYY DPVS + FR+ + V+ YLETG I K    P++
Sbjct  249  KEIIFRKCNDGIRKDPYYTDPVSRHVFRTLKSVINYLETGQITKHAYIPRR  299



>ref|XP_003581103.2| PREDICTED: uncharacterized protein LOC100844950 isoform X1 [Brachypodium 
distachyon]
Length=533

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 79/171 (46%), Gaps = 40/171 (23%)
 Frame = +1

Query  19   WLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsnenk  195
            WLP GW +E+  R+ G      YK Y+  P+G +F+SK  V +++N    S         
Sbjct  187  WLPDGWVIEV--RAGGKVMDKMYKFYVHLPTGTRFFSKEDVLRYVNEGEIS---------  235

Query  196  nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWV  375
                                        R++V +     +    +A  + + DGLP GWV
Sbjct  236  ----------------------------RRNVNELCCTSSEENILAQVEFNPDGLPNGWV  267

Query  376  KELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK  528
            KE+  R C  GIRKDPYY DP+S   FR+ + V  YLETG+I K    P++
Sbjct  268  KEVIFRKCNDGIRKDPYYTDPISHLVFRTLKSVTNYLETGEISKHAYIPRR  318



>ref|XP_002510809.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51411.1| conserved hypothetical protein [Ricinus communis]
Length=644

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/204 (31%), Positives = 85/204 (42%), Gaps = 70/204 (34%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHN---------------GSTYK----------------CY  96
            S D LP GWTV++K  ++G                  GS +K                CY
Sbjct  12   SDDQLPDGWTVKVKVSASGKKYKSSAVGKVLGMQPLLGSKFKTAQQQPPCPEFSSYNPCY  71

Query  97   ISPSGR-KFYSKAQVSQFLNSAANSNTPIsnenknnieesssnleVPQNQTPKENQSRTS  273
              PSG  KFYSK +V++FL                                 K N  ++ 
Sbjct  72   FPPSGEGKFYSKLEVARFL---------------------------------KRNNPKSD  98

Query  274  RKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYE  453
             K   +  +   K V      +    +GLP GW KE++       IR+DPYY DPVSGY 
Sbjct  99   EKENCIEQHSLDKFV-----VEKSEPEGLPLGWTKEIKVTKRGHKIRRDPYYTDPVSGYV  153

Query  454  FRSKRDVMRYLETGDIKKCVIKPK  525
            FRS +D +RYLETG++ +   KPK
Sbjct  154  FRSMKDALRYLETGEVGRLAFKPK  177



>ref|XP_004977782.1| PREDICTED: uncharacterized protein LOC101761695 [Setaria italica]
Length=511

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 79/174 (45%), Gaps = 40/174 (23%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsn  186
            S  WLP GW +E+  R+ G      YK Y  P +G +F SKA+V  ++N    S + +  
Sbjct  160  SHTWLPGGWLIEV--RAGGKKMNKMYKFYFHPPTGMRFLSKAEVLHYVNEGKISASDMDV  217

Query  187  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  366
                                              + D +T   +   +A  + + DGLP 
Sbjct  218  ----------------------------------LCDTRTDDNI---LAHVEFNPDGLPD  240

Query  367  GWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK  528
            GWVKE   R C  GIRKDPYY DP+S   FR+ + V+ YL TG+I K    P++
Sbjct  241  GWVKETIFRNCNDGIRKDPYYTDPISRRVFRTLKSVLSYLGTGEISKHAYLPRR  294



>gb|EYU25079.1| hypothetical protein MIMGU_mgv11b021680mg [Erythranthe guttata]
Length=330

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 84/176 (48%), Gaps = 50/176 (28%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIs  183
            +S DWLP GW V +K R++G  +    K Y++PS GR+F SK +V +++ S+        
Sbjct  65   ESLDWLPVGWRVSVKVRNSGKKD----KYYVNPSNGRRFNSKPEVLRYVKSSV-------  113

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
                             +N  PKE                        +  +    + LP
Sbjct  114  -----------------KNPNPKE---------------------PSKIKIEKTVTENLP  135

Query  364  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKR  531
             GW+KE+RT+      R+DP YIDPVSG  FRS ++V RYLE+ D++K   KP K+
Sbjct  136  PGWIKEIRTKKKGGRTRRDPCYIDPVSGRHFRSMQEVFRYLESKDVRKAESKPDKK  191



>ref|XP_008439211.1| PREDICTED: methyl-CpG-binding domain-containing protein 7 isoform 
X4 [Cucumis melo]
Length=165

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/187 (32%), Positives = 94/187 (50%), Gaps = 34/187 (18%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsn  186
            S D LPPGWTV++K R +G  +    K Y  PS + +F S+A+V ++L +AA  +     
Sbjct  6    SKDLLPPGWTVKVKVRKSGKKD----KYYFEPSSQMRFNSRAEVFRYLKTAAICH-----  56

Query  187  enknnieesssnleVPQNQTPKENQSRTSRK-RKSVMDNQTPKTVSPAVAAQDISADGLP  363
                                P+  +SRT ++   +V     P T +  V  +   A  LP
Sbjct  57   --------------------PESEESRTIKEPGNNVCQKNLPSTYN--VEVKKTIAKDLP  94

Query  364  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESA  543
             GW+ E+R     + IR+D  YIDP++G+  RS RDV RYL +G + +   K + + +S 
Sbjct  95   TGWIGEIRETKTANRIRRDSSYIDPINGHALRSIRDVHRYLTSGKVSRLAHKSRNQRDS-  153

Query  544  SKDIHHN  564
            + D+ H+
Sbjct  154  TIDLQHD  160



>ref|XP_011048654.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X3 [Populus euphratica]
Length=828

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 81/177 (46%), Gaps = 43/177 (24%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSG-RKFYSKAQVSQFLNSAANSNTPIs  183
            +S DWLP GW VE+K R     NG   K Y  P+G  +F SK +VS++LN +        
Sbjct  86   KSDDWLPEGWRVEVKVRD----NGKKDKFYFPPTGGLRFNSKIEVSRYLNGSH-------  134

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
                                 PK  +   S  ++S       KTV           +GLP
Sbjct  135  ---------------------PKSEEKEGSNDQRSSNKVVIEKTV----------PEGLP  163

Query  364  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRD  534
             GW KE++       IR+DP+Y DPVSGY FRS +   RY+E+G + +   K  ++D
Sbjct  164  LGWTKEIKVTKKGGRIRRDPFYTDPVSGYVFRSMKGAHRYIESGGVGRLAFKRNRKD  220



>ref|XP_011048657.1| PREDICTED: uncharacterized protein LOC105142633 isoform X5 [Populus 
euphratica]
Length=800

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 81/177 (46%), Gaps = 43/177 (24%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSG-RKFYSKAQVSQFLNSAANSNTPIs  183
            +S DWLP GW VE+K R     NG   K Y  P+G  +F SK +VS++LN +        
Sbjct  86   KSDDWLPEGWRVEVKVRD----NGKKDKFYFPPTGGLRFNSKIEVSRYLNGSH-------  134

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
                                 PK  +   S  ++S       KTV           +GLP
Sbjct  135  ---------------------PKSEEKEGSNDQRSSNKVVIEKTV----------PEGLP  163

Query  364  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRD  534
             GW KE++       IR+DP+Y DPVSGY FRS +   RY+E+G + +   K  ++D
Sbjct  164  LGWTKEIKVTKKGGRIRRDPFYTDPVSGYVFRSMKGAHRYIESGGVGRLAFKRNRKD  220



>ref|XP_011048652.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Populus euphratica]
Length=855

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 81/177 (46%), Gaps = 43/177 (24%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSG-RKFYSKAQVSQFLNSAANSNTPIs  183
            +S DWLP GW VE+K R     NG   K Y  P+G  +F SK +VS++LN +        
Sbjct  86   KSDDWLPEGWRVEVKVRD----NGKKDKFYFPPTGGLRFNSKIEVSRYLNGS--------  133

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
                                 PK  +   S  ++S       KTV           +GLP
Sbjct  134  --------------------HPKSEEKEGSNDQRSSNKVVIEKTV----------PEGLP  163

Query  364  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRD  534
             GW KE++       IR+DP+Y DPVSGY FRS +   RY+E+G + +   K  ++D
Sbjct  164  LGWTKEIKVTKKGGRIRRDPFYTDPVSGYVFRSMKGAHRYIESGGVGRLAFKRNRKD  220



>ref|XP_009418270.1| PREDICTED: uncharacterized protein LOC103998509 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=268

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 82/175 (47%), Gaps = 38/175 (22%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsn  186
            S  WLP GW +E++TR  G+     YKCY+  S G  FYSK +V QF+ +      P   
Sbjct  79   SLKWLPRGWIMEIRTRKIGAEAEERYKCYLHQSTGTVFYSKEEVLQFIEAGNACGPPT--  136

Query  187  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  366
                                       +SRKR+    N++   V   +   + S DGLP 
Sbjct  137  ---------------------------SSRKRRC--RNKSGDLVLYRI---EYSPDGLPD  164

Query  367  GWVKEL---RTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKP  522
            GW+KE+   R +   S  ++D YY DP SGY FR+ +D + Y+E G + K   KP
Sbjct  165  GWIKEIKFRRNKDKKSPTKQDAYYTDPESGYVFRTLKDCICYIEHGVLSKHAFKP  219



>emb|CAN74037.1| hypothetical protein VITISV_023406 [Vitis vinifera]
Length=730

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 91/189 (48%), Gaps = 57/189 (30%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsn  186
            S DWLPPGW VE+K  STG      YKCYI PS G KFYSK +VS++LN A         
Sbjct  6    SDDWLPPGWKVEMKLTSTGRK----YKCYIHPSRGLKFYSKPEVSRYLNKA---------  52

Query  187  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  366
                           P N        R S ++KS+      KT++PA   + +       
Sbjct  53   ---------------PLN-------DRESIQKKSIERKTPIKTMAPAGKKKSMEK-----  85

Query  367  GWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESAS  546
                    + C   I K  YY DPV+GY FRS +D +RYL+TGD  +   KPK RD   S
Sbjct  86   -------KKHC---IAKK-YYTDPVNGYIFRSMKDTLRYLKTGDPGRLAFKPKPRD---S  131

Query  547  KDIHHNIEE  573
             DI  N+E+
Sbjct  132  GDI--NLED  138



>ref|XP_008439209.1| PREDICTED: methyl-CpG-binding domain-containing protein 7 isoform 
X2 [Cucumis melo]
Length=212

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 97/195 (50%), Gaps = 34/195 (17%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsn  186
            S D LPPGWTV++K R +G  +    K Y  PS + +F S+A+V ++L +AA  +     
Sbjct  6    SKDLLPPGWTVKVKVRKSGKKD----KYYFEPSSQMRFNSRAEVFRYLKTAAICH-----  56

Query  187  enknnieesssnleVPQNQTPKENQSRTSRK-RKSVMDNQTPKTVSPAVAAQDISADGLP  363
                                P+  +SRT ++   +V     P T +  V  +   A  LP
Sbjct  57   --------------------PESEESRTIKEPGNNVCQKNLPSTYN--VEVKKTIAKDLP  94

Query  364  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESA  543
             GW+ E+R     + IR+D  YIDP++G+  RS RDV RYL +G + +   K + + +S 
Sbjct  95   TGWIGEIRETKTANRIRRDSSYIDPINGHALRSIRDVHRYLTSGKVSRLAHKSRNQRDS-  153

Query  544  SKDIHHNIEEVSPNE  588
            + D+ H+   VS  E
Sbjct  154  TIDLQHDEISVSVLE  168



>ref|XP_006659212.1| PREDICTED: uncharacterized protein LOC102718198 [Oryza brachyantha]
Length=1007

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = +1

Query  277  KRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEF  456
            K   ++ N++     P     +++ +GLP GW KE R R   S  + DPYYIDPVSGYEF
Sbjct  272  KEDMLIKNESEHRSDPVQRKDELTINGLPDGWWKEDRPRKNGSNQKTDPYYIDPVSGYEF  331

Query  457  RSKRDVMRYLETGDIKKCVIKPKKR  531
            RS +DV R+L++GDI KC I+P+KR
Sbjct  332  RSLKDVHRFLKSGDIYKCTIRPRKR  356



>ref|XP_011030071.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Populus euphratica]
Length=773

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 86/189 (46%), Gaps = 50/189 (26%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIs  183
            +S DWLP GW VE+K R    +NG   K Y  PSG  +F SK +VS++LNS+        
Sbjct  5    KSDDWLPEGWRVEVKVR----NNGKKDKFYFPPSGGCRFNSKIEVSRYLNSS--------  52

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
                           +   Q  + N  R S +                V  +    +GLP
Sbjct  53   --------------HLNSEQKVRSNDWRHSNE----------------VLIEKTVPEGLP  82

Query  364  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESA  543
             GW KE++       IR+DP Y DPVSGY FRS +D  RY+E+G + +   K   R+   
Sbjct  83   LGWTKEIKVTKRGGRIRRDPLYTDPVSGYVFRSMKDACRYIESGVVGRLAFKRNDRE---  139

Query  544  SKDIHHNIE  570
                +H++E
Sbjct  140  ----NHDVE  144



>ref|XP_011030070.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Populus euphratica]
Length=775

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 86/189 (46%), Gaps = 50/189 (26%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIs  183
            +S DWLP GW VE+K R    +NG   K Y  PSG  +F SK +VS++LNS+        
Sbjct  5    KSDDWLPEGWRVEVKVR----NNGKKDKFYFPPSGGCRFNSKIEVSRYLNSS--------  52

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
                           +   Q  + N  R S +                V  +    +GLP
Sbjct  53   --------------HLNSEQKVRSNDWRHSNE----------------VLIEKTVPEGLP  82

Query  364  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESA  543
             GW KE++       IR+DP Y DPVSGY FRS +D  RY+E+G + +   K   R+   
Sbjct  83   LGWTKEIKVTKRGGRIRRDPLYTDPVSGYVFRSMKDACRYIESGVVGRLAFKRNDRE---  139

Query  544  SKDIHHNIE  570
                +H++E
Sbjct  140  ----NHDVE  144



>ref|NP_001159179.1| uncharacterized protein LOC100304264 [Zea mays]
 gb|ACN25334.1| unknown [Zea mays]
Length=397

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 80/176 (45%), Gaps = 40/176 (23%)
 Frame = +1

Query  4    NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPI  180
            ++S  WLP GW +E+  R+ G      YK Y+  P+G++F SKA+V  F+N    S   +
Sbjct  55   HESHTWLPRGWVIEV--RAGGKKMDKMYKFYVHLPTGQRFLSKAEVLHFVNKGMVSTCDM  112

Query  181  snenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGL  360
                                                + D  T   +   +A  + + DGL
Sbjct  113  DV----------------------------------LCDTSTDDNI---LAHVEFNPDGL  135

Query  361  PAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK  528
            P GWVKE  +R    GIRKD YY DPVS   FR+ + V+ YL TG+I +    P++
Sbjct  136  PDGWVKETISRKFNDGIRKDQYYTDPVSHRVFRTLKSVLSYLGTGEISRHSYLPRR  191



>ref|XP_011030072.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X3 [Populus euphratica]
Length=764

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 85/189 (45%), Gaps = 61/189 (32%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIs  183
            +S DWLP GW VE+K R    +NG   K Y  PSG  +F SK +VS++LNS         
Sbjct  5    KSDDWLPEGWRVEVKVR----NNGKKDKFYFPPSGGCRFNSKIEVSRYLNS---------  51

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
                                      S  + ++K +++   P              +GLP
Sbjct  52   --------------------------SHLNSEQKVLIEKTVP--------------EGLP  71

Query  364  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESA  543
             GW KE++       IR+DP Y DPVSGY FRS +D  RY+E+G + +   K   R+   
Sbjct  72   LGWTKEIKVTKRGGRIRRDPLYTDPVSGYVFRSMKDACRYIESGVVGRLAFKRNDRE---  128

Query  544  SKDIHHNIE  570
                +H++E
Sbjct  129  ----NHDVE  133



>ref|XP_011012359.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Populus euphratica]
Length=773

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 62/189 (33%), Positives = 85/189 (45%), Gaps = 50/189 (26%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIs  183
            +S DWLP GW VE+K R    +NG   K Y  PSG  +F SK +VS++LNS+        
Sbjct  5    KSDDWLPEGWRVEVKVR----NNGKKDKFYFPPSGGCRFNSKIEVSRYLNSSH-------  53

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
                                 P   Q   S   +   +    KTV           +GLP
Sbjct  54   ---------------------PNSEQKVRSNDWRHSNEVLIEKTV----------PEGLP  82

Query  364  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESA  543
             GW KE++       IR+DP Y DPVSGY FRS +D  RY+E+G + +   K   R+   
Sbjct  83   LGWTKEIKVTKRGGRIRRDPLYTDPVSGYVFRSMKDACRYIESGVVGRLAFKRNDRE---  139

Query  544  SKDIHHNIE  570
                +H++E
Sbjct  140  ----NHDVE  144



>ref|XP_006653226.1| PREDICTED: uncharacterized protein LOC102699500 [Oryza brachyantha]
Length=520

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 77/171 (45%), Gaps = 40/171 (23%)
 Frame = +1

Query  19   WLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsnenk  195
            WLP GW +E+  R+ G      YK Y   P+G +F SK  V ++      S   +     
Sbjct  111  WLPDGWIIEI--RAGGKKMEKMYKFYAHLPTGVRFLSKENVLRYSIEGKISRCDV-----  163

Query  196  nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWV  375
                                         K + D  +   +   +A  + + DGLP GWV
Sbjct  164  -----------------------------KVLCDTSSEDNI---LATVEFNPDGLPEGWV  191

Query  376  KELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK  528
            KE+  R C  GIRKDPYY DPVS + FR+ + V+ YLETG+I K    P++
Sbjct  192  KEMIFRKCNDGIRKDPYYTDPVSRHVFRTLKSVINYLETGEITKHAYIPRR  242



>ref|XP_011012358.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Populus euphratica]
Length=775

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 62/189 (33%), Positives = 85/189 (45%), Gaps = 50/189 (26%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIs  183
            +S DWLP GW VE+K R    +NG   K Y  PSG  +F SK +VS++LNS+        
Sbjct  5    KSDDWLPEGWRVEVKVR----NNGKKDKFYFPPSGGCRFNSKIEVSRYLNSSH-------  53

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
                                 P   Q   S   +   +    KTV           +GLP
Sbjct  54   ---------------------PNSEQKVRSNDWRHSNEVLIEKTV----------PEGLP  82

Query  364  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESA  543
             GW KE++       IR+DP Y DPVSGY FRS +D  RY+E+G + +   K   R+   
Sbjct  83   LGWTKEIKVTKRGGRIRRDPLYTDPVSGYVFRSMKDACRYIESGVVGRLAFKRNDRE---  139

Query  544  SKDIHHNIE  570
                +H++E
Sbjct  140  ----NHDVE  144



>ref|XP_011012360.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X3 [Populus euphratica]
Length=764

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 85/189 (45%), Gaps = 61/189 (32%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIs  183
            +S DWLP GW VE+K R    +NG   K Y  PSG  +F SK +VS++LNS         
Sbjct  5    KSDDWLPEGWRVEVKVR----NNGKKDKFYFPPSGGCRFNSKIEVSRYLNS---------  51

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
                                      S  + ++K +++   P              +GLP
Sbjct  52   --------------------------SHPNSEQKVLIEKTVP--------------EGLP  71

Query  364  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESA  543
             GW KE++       IR+DP Y DPVSGY FRS +D  RY+E+G + +   K   R+   
Sbjct  72   LGWTKEIKVTKRGGRIRRDPLYTDPVSGYVFRSMKDACRYIESGVVGRLAFKRNDRE---  128

Query  544  SKDIHHNIE  570
                +H++E
Sbjct  129  ----NHDVE  133



>ref|XP_011041595.1| PREDICTED: uncharacterized protein LOC105137520 isoform X6 [Populus 
euphratica]
Length=802

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 78/172 (45%), Gaps = 43/172 (25%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSG-RKFYSKAQVSQFLNSAANSNTPIs  183
            +S DWLP GW VE+K R     NG   K Y  P+G  +F SK +VS++LN +        
Sbjct  86   KSDDWLPEGWRVEVKVRD----NGKKDKFYFPPTGGLRFNSKIEVSRYLNGSH-------  134

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
                                 PK  +   S  ++S       KTV           +GLP
Sbjct  135  ---------------------PKSEEKEGSNDQRSSNKVVIEKTV----------PEGLP  163

Query  364  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
             GW KE++       IR+DP+Y DPVSGY FRS +   RY+E+G + +   K
Sbjct  164  LGWTKEIKVTKKGGRIRRDPFYTDPVSGYVFRSMKGAHRYIESGGVGRLAFK  215



>ref|XP_004972592.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Setaria italica]
 ref|XP_004972593.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Setaria italica]
Length=954

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 2/59 (3%)
 Frame = +1

Query  352  DGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK  528
            +GLP GW+KE R R   +G  +DP+YIDPVSGYEFRS +DV RYLETGDI +C+++PKK
Sbjct  282  EGLPDGWLKEYRPRK--TGSFQDPFYIDPVSGYEFRSLKDVHRYLETGDINQCIMRPKK  338



>ref|XP_011041592.1| PREDICTED: uncharacterized protein LOC105137520 isoform X3 [Populus 
euphratica]
Length=830

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 78/172 (45%), Gaps = 43/172 (25%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSG-RKFYSKAQVSQFLNSAANSNTPIs  183
            +S DWLP GW VE+K R     NG   K Y  P+G  +F SK +VS++LN +        
Sbjct  86   KSDDWLPEGWRVEVKVRD----NGKKDKFYFPPTGGLRFNSKIEVSRYLNGS--------  133

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
                                 PK  +   S  ++S       KTV           +GLP
Sbjct  134  --------------------HPKSEEKEGSNDQRSSNKVVIEKTV----------PEGLP  163

Query  364  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
             GW KE++       IR+DP+Y DPVSGY FRS +   RY+E+G + +   K
Sbjct  164  LGWTKEIKVTKKGGRIRRDPFYTDPVSGYVFRSMKGAHRYIESGGVGRLAFK  215



>ref|XP_011041593.1| PREDICTED: uncharacterized protein LOC105137520 isoform X4 [Populus 
euphratica]
Length=807

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 78/172 (45%), Gaps = 43/172 (25%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSG-RKFYSKAQVSQFLNSAANSNTPIs  183
            +S DWLP GW VE+K R     NG   K Y  P+G  +F SK +VS++LN +        
Sbjct  86   KSDDWLPEGWRVEVKVRD----NGKKDKFYFPPTGGLRFNSKIEVSRYLNGSH-------  134

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
                                 PK  +   S  ++S       KTV           +GLP
Sbjct  135  ---------------------PKSEEKEGSNDQRSSNKVVIEKTV----------PEGLP  163

Query  364  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
             GW KE++       IR+DP+Y DPVSGY FRS +   RY+E+G + +   K
Sbjct  164  LGWTKEIKVTKKGGRIRRDPFYTDPVSGYVFRSMKGAHRYIESGGVGRLAFK  215



>ref|XP_011041590.1| PREDICTED: uncharacterized protein LOC105137520 isoform X1 [Populus 
euphratica]
Length=857

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 78/172 (45%), Gaps = 43/172 (25%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSG-RKFYSKAQVSQFLNSAANSNTPIs  183
            +S DWLP GW VE+K R     NG   K Y  P+G  +F SK +VS++LN +        
Sbjct  86   KSDDWLPEGWRVEVKVRD----NGKKDKFYFPPTGGLRFNSKIEVSRYLNGS--------  133

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
                                 PK  +   S  ++S       KTV           +GLP
Sbjct  134  --------------------HPKSEEKEGSNDQRSSNKVVIEKTV----------PEGLP  163

Query  364  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
             GW KE++       IR+DP+Y DPVSGY FRS +   RY+E+G + +   K
Sbjct  164  LGWTKEIKVTKKGGRIRRDPFYTDPVSGYVFRSMKGAHRYIESGGVGRLAFK  215



>gb|AFW57954.1| methyl-binding domain MBD113 protein [Zea mays]
Length=485

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 80/176 (45%), Gaps = 40/176 (23%)
 Frame = +1

Query  4    NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPI  180
            ++S  WLP GW +E+  R+ G      YK Y+  P+G++F SKA+V  F+N    S   +
Sbjct  143  HESHTWLPRGWVIEV--RAGGKKMDKMYKFYVHLPTGQRFLSKAEVLHFVNKGMVSTCDM  200

Query  181  snenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGL  360
                                                + D  T   +   +A  + + DGL
Sbjct  201  DV----------------------------------LCDTSTDDNI---LAHVEFNPDGL  223

Query  361  PAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK  528
            P GWVKE  +R    GIRKD YY DPVS   FR+ + V+ YL TG+I +    P++
Sbjct  224  PDGWVKETISRKFNDGIRKDQYYTDPVSHRVFRTLKSVLSYLGTGEISRHSYLPRR  279



>ref|XP_004234378.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Solanum lycopersicum]
Length=587

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 70/211 (33%), Positives = 99/211 (47%), Gaps = 60/211 (28%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsnen  192
            +W+P GW VE++TR      G   K YI PS G KF SKA V  +L+S  +         
Sbjct  9    NWVPDGWKVEVRTR-----KGKKEKWYIDPSKGLKFCSKADVLHYLSSVDS---------  54

Query  193  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  372
                                 N S++S  ++  M+N+     +     +  +++GLP GW
Sbjct  55   ---------------------NCSKSSNTKE--MENKG----TNKCFIEKTASEGLPPGW  87

Query  373  VKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLET---GDIK-----KC------  510
            +KEL+ R     IRKDPYYIDPVSG  FRS + V R+LET   G  +     KC      
Sbjct  88   IKELKVRKKGRKIRKDPYYIDPVSGQTFRSLKQVSRFLETREPGRFESKPDDKCPDTLEL  147

Query  511  ----VIKPKKRDESASKDIHHNIEEVSPNEK  591
                 + P + DE  S D   + +EV+ N+K
Sbjct  148  EEPSSLFPAEADEQISLDCDASCKEVNSNQK  178



>ref|XP_008662320.1| PREDICTED: LOC542207 isoform X3 [Zea mays]
 gb|AFW57952.1| methyl-binding domain MBD113 protein isoform 1 [Zea mays]
 gb|AFW57953.1| methyl-binding domain MBD113 protein isoform 2 [Zea mays]
Length=491

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 80/176 (45%), Gaps = 40/176 (23%)
 Frame = +1

Query  4    NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPI  180
            ++S  WLP GW +E+  R+ G      YK Y+  P+G++F SKA+V  F+N    S   +
Sbjct  149  HESHTWLPRGWVIEV--RAGGKKMDKMYKFYVHLPTGQRFLSKAEVLHFVNKGMVSTCDM  206

Query  181  snenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGL  360
                                                + D  T   +   +A  + + DGL
Sbjct  207  DV----------------------------------LCDTSTDDNI---LAHVEFNPDGL  229

Query  361  PAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK  528
            P GWVKE  +R    GIRKD YY DPVS   FR+ + V+ YL TG+I +    P++
Sbjct  230  PDGWVKETISRKFNDGIRKDQYYTDPVSHRVFRTLKSVLSYLGTGEISRHSYLPRR  285



>ref|XP_008662316.1| PREDICTED: LOC542207 isoform X1 [Zea mays]
 ref|XP_008662317.1| PREDICTED: LOC542207 isoform X1 [Zea mays]
 ref|XP_008662318.1| PREDICTED: LOC542207 isoform X1 [Zea mays]
Length=506

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 80/176 (45%), Gaps = 40/176 (23%)
 Frame = +1

Query  4    NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPI  180
            ++S  WLP GW +E+  R+ G      YK Y+  P+G++F SKA+V  F+N    S   +
Sbjct  164  HESHTWLPRGWVIEV--RAGGKKMDKMYKFYVHLPTGQRFLSKAEVLHFVNKGMVSTCDM  221

Query  181  snenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGL  360
                                                + D  T   +   +A  + + DGL
Sbjct  222  DV----------------------------------LCDTSTDDNI---LAHVEFNPDGL  244

Query  361  PAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK  528
            P GWVKE  +R    GIRKD YY DPVS   FR+ + V+ YL TG+I +    P++
Sbjct  245  PDGWVKETISRKFNDGIRKDQYYTDPVSHRVFRTLKSVLSYLGTGEISRHSYLPRR  300



>ref|XP_006353332.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006353333.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Solanum tuberosum]
Length=594

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 78/160 (49%), Gaps = 41/160 (26%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsnen  192
            +W+P GW VE++TR  G       K YI PS G KF SKA V  +L S+ +SN       
Sbjct  9    NWVPNGWKVEVRTRKKGKKE----KWYIDPSKGLKFCSKADVLHYL-SSVDSN-------  56

Query  193  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  372
                          ++   KE + + + K                   +  +++GLP GW
Sbjct  57   ------------CSKSSNTKEMEKKGTEK----------------CFTEKTASEGLPPGW  88

Query  373  VKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLET  492
            +KEL+ R     IRKDPYYIDPVSG  FRS + V R+LET
Sbjct  89   IKELKVRRKGRKIRKDPYYIDPVSGQTFRSMKQVSRFLET  128



>ref|XP_008662319.1| PREDICTED: LOC542207 isoform X2 [Zea mays]
Length=497

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 79/175 (45%), Gaps = 40/175 (23%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIs  183
            +S  WLP GW +E+  R+ G      YK Y+  P+G++F SKA+V  F+N    S   + 
Sbjct  156  ESHTWLPRGWVIEV--RAGGKKMDKMYKFYVHLPTGQRFLSKAEVLHFVNKGMVSTCDMD  213

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
                                               + D  T   +   +A  + + DGLP
Sbjct  214  V----------------------------------LCDTSTDDNI---LAHVEFNPDGLP  236

Query  364  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK  528
             GWVKE  +R    GIRKD YY DPVS   FR+ + V+ YL TG+I +    P++
Sbjct  237  DGWVKETISRKFNDGIRKDQYYTDPVSHRVFRTLKSVLSYLGTGEISRHSYLPRR  291



>ref|XP_011048653.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Populus euphratica]
Length=844

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 79/177 (45%), Gaps = 54/177 (31%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSG-RKFYSKAQVSQFLNSAANSNTPIs  183
            +S DWLP GW VE+K R     NG   K Y  P+G  +F SK +VS++LN +        
Sbjct  86   KSDDWLPEGWRVEVKVRD----NGKKDKFYFPPTGGLRFNSKIEVSRYLNGSH-------  134

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
                                 PK  +       K V++   P              +GLP
Sbjct  135  ---------------------PKSEE-------KVVIEKTVP--------------EGLP  152

Query  364  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRD  534
             GW KE++       IR+DP+Y DPVSGY FRS +   RY+E+G + +   K  ++D
Sbjct  153  LGWTKEIKVTKKGGRIRRDPFYTDPVSGYVFRSMKGAHRYIESGGVGRLAFKRNRKD  209



>gb|KHN31504.1| Methyl-CpG-binding domain-containing protein 13 [Glycine soja]
Length=590

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 81/173 (47%), Gaps = 49/173 (28%)
 Frame = +1

Query  19   WLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsnenk  195
            WLPPGWTVE++ R     NG   K Y  PS G KF SK +V ++L++A            
Sbjct  9    WLPPGWTVEVRVR----KNGKRDKYYFPPSSGLKFNSKVEVFRYLDNA------------  52

Query  196  nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWV  375
                                 Q++ S ++           +SP V  +   A+GLP G V
Sbjct  53   ---------------------QNKVSIQK-----------ISPNVIVEKAIAEGLPPGRV  80

Query  376  KELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRD  534
            K+ R  T    +R+D +YIDPV+GY F S +DV  YLE+G+I     K K  D
Sbjct  81   KKTRITTNGDSVRRDTFYIDPVNGYTFCSIKDVDCYLESGEIGSYEFKSKDND  133



>ref|XP_008439210.1| PREDICTED: methyl-CpG-binding domain-containing protein 7 isoform 
X3 [Cucumis melo]
Length=201

 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 60/194 (31%), Positives = 96/194 (49%), Gaps = 43/194 (22%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsn  186
            S D LPPGWTV++K R +G  +    K Y  PS + +F S+A+V ++L +AA  +     
Sbjct  6    SKDLLPPGWTVKVKVRKSGKKD----KYYFEPSSQMRFNSRAEVFRYLKTAAICH-----  56

Query  187  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  366
                                P+  +SRT ++  +  + +  KT+          A  LP 
Sbjct  57   --------------------PESEESRTIKEPGN--NVEVKKTI----------AKDLPT  84

Query  367  GWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESAS  546
            GW+ E+R     + IR+D  YIDP++G+  RS RDV RYL +G + +   K + + +S +
Sbjct  85   GWIGEIRETKTANRIRRDSSYIDPINGHALRSIRDVHRYLTSGKVSRLAHKSRNQRDS-T  143

Query  547  KDIHHNIEEVSPNE  588
             D+ H+   VS  E
Sbjct  144  IDLQHDEISVSVLE  157



>ref|XP_011076193.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Sesamum indicum]
 ref|XP_011076194.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Sesamum indicum]
Length=654

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 76/169 (45%), Gaps = 49/169 (29%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsnen  192
            DWLP GW V +K RS G  +    K Y++PS G KF SK +V ++L  +A          
Sbjct  7    DWLPVGWRVSVKVRSCGRKD----KYYVNPSNGLKFNSKPEVLRYLKYSAKG--------  54

Query  193  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  372
                                                + P+ ++  V  +   AD LP GW
Sbjct  55   ------------------------------------RKPRALNNKVEIRKTVADKLPPGW  78

Query  373  VKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
            +KE+RT       R+DPYYIDPV+G  FRS ++V RYLE+ D  K   K
Sbjct  79   IKEIRTTKKGRKTRRDPYYIDPVTGRYFRSMQEVFRYLESKDSGKAEFK  127



>ref|XP_002444023.1| hypothetical protein SORBIDRAFT_07g006030 [Sorghum bicolor]
 gb|EES13518.1| hypothetical protein SORBIDRAFT_07g006030 [Sorghum bicolor]
Length=961

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 51/70 (73%), Gaps = 5/70 (7%)
 Frame = +1

Query  349  ADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK  528
             +G P GW KE R R   SG  +DPYYIDPVSGYEFRS +DV RYL+TGDI++C ++PKK
Sbjct  265  VEGFPDGWRKEYRPRK--SGSFQDPYYIDPVSGYEFRSLKDVHRYLKTGDIRQCAVRPKK  322

Query  529  RDESASKDIH  558
               S + ++H
Sbjct  323  ---STTFEVH  329



>ref|XP_008378256.1| PREDICTED: uncharacterized protein LOC103441353 [Malus domestica]
Length=863

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/171 (34%), Positives = 84/171 (49%), Gaps = 39/171 (23%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSNTPIsne  189
            S +WLP GWTVE+K R  G  +   Y+   S SG +F S+A+VS++L++           
Sbjct  174  SEEWLPAGWTVEVKVRKNGRRDKYYYE---SSSGHRFSSRAEVSRYLST-----------  219

Query  190  nknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAG  369
                                    S+TSR+ K  ++ +T K  S  V  +   A+ LP G
Sbjct  220  ------------------------SKTSREDKQKIE-ETLKRPSDDVVVEKTVAERLPPG  254

Query  370  WVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKP  522
            W+KE+R       IR+D +YI PVS   FRS RDV RYLE  +  +  ++P
Sbjct  255  WIKEIRMTKKARKIRRDTHYIAPVSEKVFRSLRDVHRYLENEEPGRLNVEP  305



>gb|EMS57086.1| Methyl-CpG-binding domain-containing protein 13 [Triticum urartu]
Length=946

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = +1

Query  343  ISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKP  522
            +S   LP GW KE+R R    G + DPYY DPVSGYEFRS +DV RY+E+GDI KC ++P
Sbjct  174  LSKGQLPDGWRKEVRPRK--DGTKSDPYYTDPVSGYEFRSLKDVQRYIESGDISKCNVRP  231

Query  523  KKR  531
            KKR
Sbjct  232  KKR  234



>gb|EMT07793.1| hypothetical protein F775_13908 [Aegilops tauschii]
Length=1078

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = +1

Query  343  ISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKP  522
            +S   LP GW KE+R R    G + DPYY DPVSGYEFRS +DV RY+E+GDI KC ++P
Sbjct  306  LSKGQLPDGWRKEVRPRK--DGTKSDPYYTDPVSGYEFRSLKDVQRYIESGDISKCNVRP  363

Query  523  KKR  531
            KKR
Sbjct  364  KKR  366



>ref|XP_006827729.1| hypothetical protein AMTR_s00009p00261370 [Amborella trichopoda]
 gb|ERM95145.1| hypothetical protein AMTR_s00009p00261370 [Amborella trichopoda]
Length=1239

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/193 (33%), Positives = 101/193 (52%), Gaps = 11/193 (6%)
 Frame = +1

Query  1    TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTP  177
            + QSSDWLPPGWT+E+KTR  G   G   K YI   +G+KF S+  V ++L    + N  
Sbjct  103  SGQSSDWLPPGWTIEIKTRKNGVSAGMREKFYIELATGKKFASRLAVLRYL---TDGNAS  159

Query  178  IsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADG  357
            +S    N ++  + +L   + +  K  + +      S +++     VS  + A+++  D 
Sbjct  160  VSTPRTNMLDTGNVHLTAKEYEGMKAAEEKGPLPENSSLNSTGIVPVS-TMGAEELPPDW  218

Query  358  LPAGWVKE--LRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKR  531
            LP GW+ E  +R R   SG +   +YI+  +G  F S+  V+RYLE G+     +K KK 
Sbjct  219  LPTGWMMETKVRKRGKSSGAQSK-FYIELATGQRFTSRLAVLRYLENGNASLSRLKRKKH  277

Query  532  DESASKDIHHNIE  570
            D +   +I  N+E
Sbjct  278  DAT---NIDLNME  287


 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 77/174 (44%), Gaps = 53/174 (30%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsnen  192
            +WLPPGWT+++K R +G   G   K YI P+ G  F S+  + +++ +            
Sbjct  573  EWLPPGWTMQIKVRKSGKTAGMREKYYIDPATGCSFRSRVAILRYVKT------------  620

Query  193  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVA---------AQDI  345
                                        K+ S    + PKT+SP  +         A++ 
Sbjct  621  ----------------------------KKPSATKQKKPKTLSPKSSGNVMATTPDAKEQ  652

Query  346  SADGLPAGWVKELRTRTC--PSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  501
              + LP GW  E++ R     +G+R + YYIDP +G  FRS+  ++RY+E G +
Sbjct  653  PPEWLPPGWTMEIKERKSGKSAGLR-EKYYIDPATGRSFRSRIAIVRYIEAGKL  705


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 89/168 (53%), Gaps = 21/168 (13%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYI-SPSGRKFYSKAQVSQFLNSAANSNT--PI  180
            S++WLP GW +E K R +G+  G   K +I + +GR F SK QV ++L +   +    P+
Sbjct  6    STNWLPDGWIMEQKRRKSGATKGLADKYFIEAATGRFFRSKLQVLRYLKTEKYTGKLWPV  65

Query  181  snenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGL  360
               + N             N    E ++ +++    ++  +  +T+SP+ + Q  S+D L
Sbjct  66   KLVSNNKELT---------NGESMEKETSSAK----ILQEKVQRTLSPSESGQ--SSDWL  110

Query  361  PAGWVKELRTRT--CPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGD  498
            P GW  E++TR     +G+R + +YI+  +G +F S+  V+RYL  G+
Sbjct  111  PPGWTIEIKTRKNGVSAGMR-EKFYIELATGKKFASRLAVLRYLTDGN  157


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/209 (26%), Positives = 96/209 (46%), Gaps = 29/209 (14%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsnen  192
            +WLPPGWT+ +  R  G   G   K YI   +G++F S+  V ++L    N N  +    
Sbjct  454  EWLPPGWTMVVTVRKAGKTAGRREKFYIELATGQRFASRLAVVRYLE---NGNASLERLK  510

Query  193  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAV--------------  330
                  S  +    ++ +P +      RK  +V+  +  K   P +              
Sbjct  511  SQEHGASKIDFIAEESNSPFQK-----RKESTVIKTKEKKDPLPEICPTNSSGNATVVTS  565

Query  331  AAQDISADGLPAGWVKELRTRTC--PSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIK  504
             A+++  + LP GW  +++ R     +G+R + YYIDP +G  FRS+  ++RY++T   K
Sbjct  566  GAEELRPEWLPPGWTMQIKVRKSGKTAGMR-EKYYIDPATGCSFRSRVAILRYVKT---K  621

Query  505  KCVIKPKKRDESASKDIHHNIEEVSPNEK  591
            K     +K+ ++ S     N+   +P+ K
Sbjct  622  KPSATKQKKPKTLSPKSSGNVMATTPDAK  650


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 97/206 (47%), Gaps = 16/206 (8%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsnen  192
            +WLPPGW  E+  R +G   G   K YI   +G++F S+  V ++L    N N   S   
Sbjct  335  EWLPPGWATEISVRKSGKTAGRREKFYIELATGQRFGSRLAVLRYL---TNGNASPSGLK  391

Query  193  knnieesssnleVPQNQTPKENQS-----RTSRKRKSVMDNQTPKTVS----PAVAAQDI  345
               +   + +L + ++    EN       +T++K+ S+ +    K+        V A ++
Sbjct  392  SKELGVPNIDLNMEESDALIENLKESTVMKTTQKKGSLPEFSPSKSSGNVGVSTVCAGEL  451

Query  346  SADGLPAGWVKELRTRTC-PSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKP  522
            + + LP GW   +  R    +  R++ +YI+  +G  F S+  V+RYLE G+    + + 
Sbjct  452  TPEWLPPGWTMVVTVRKAGKTAGRREKFYIELATGQRFASRLAVVRYLENGNA--SLERL  509

Query  523  KKRDESASKDIHHNIEEVSPNEKSVE  600
            K ++  ASK      E  SP +K  E
Sbjct  510  KSQEHGASKIDFIAEESNSPFQKRKE  535


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 32/52 (62%), Gaps = 1/52 (2%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSA  159
            Q  +WLPPGWT+E+K R +G   G   K YI P+ GR F S+  + +++ + 
Sbjct  652  QPPEWLPPGWTMEIKERKSGKSAGLREKYYIDPATGRSFRSRIAIVRYIEAG  703



>ref|XP_011041591.1| PREDICTED: uncharacterized protein LOC105137520 isoform X2 [Populus 
euphratica]
Length=846

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 76/172 (44%), Gaps = 54/172 (31%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSG-RKFYSKAQVSQFLNSAANSNTPIs  183
            +S DWLP GW VE+K R     NG   K Y  P+G  +F SK +VS++LN +        
Sbjct  86   KSDDWLPEGWRVEVKVRD----NGKKDKFYFPPTGGLRFNSKIEVSRYLNGS--------  133

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
                                 PK  +       K V++   P              +GLP
Sbjct  134  --------------------HPKSEE-------KVVIEKTVP--------------EGLP  152

Query  364  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
             GW KE++       IR+DP+Y DPVSGY FRS +   RY+E+G + +   K
Sbjct  153  LGWTKEIKVTKKGGRIRRDPFYTDPVSGYVFRSMKGAHRYIESGGVGRLAFK  204



>ref|XP_008678194.1| PREDICTED: uncharacterized protein LOC103652994 [Zea mays]
 ref|XP_008678195.1| PREDICTED: uncharacterized protein LOC103652994 [Zea mays]
Length=912

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +1

Query  310  KTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLE  489
            + V+  V+    + +GLP GW KE R R   +G   D YYIDPVSGYEFRS +DV RYLE
Sbjct  220  RLVAKTVSKDKRAVEGLPDGWRKEYRPRK--NGSFLDVYYIDPVSGYEFRSFKDVHRYLE  277

Query  490  TGDIKKCVIKPKK  528
            TGDI++C ++PKK
Sbjct  278  TGDIRQCAVRPKK  290



>ref|XP_002321896.2| hypothetical protein POPTR_0015s13470g [Populus trichocarpa]
 gb|EEF06023.2| hypothetical protein POPTR_0015s13470g [Populus trichocarpa]
Length=774

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 82/177 (46%), Gaps = 43/177 (24%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIs  183
            +S DWLP GW VE+K R++G  +    K Y  P+G  +F SK +VS++LN +        
Sbjct  5    KSDDWLPEGWRVEVKVRNSGKKD----KFYFPPTGGFRFNSKIEVSRYLNGS--------  52

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
                                 PK  +   S  + S       KTV           +GLP
Sbjct  53   --------------------HPKSEEKVGSNDQWSSNKVVIEKTV----------PEGLP  82

Query  364  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRD  534
             GW KE++       IR+DP+Y DPVSG  FRS ++  RY+E+G + +   K  ++D
Sbjct  83   LGWTKEIKVTKKGGRIRRDPFYTDPVSGCVFRSMKEAHRYIESGVVGRLAFKRNRKD  139



>gb|AFW61002.1| hypothetical protein ZEAMMB73_269384 [Zea mays]
Length=921

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +1

Query  310  KTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLE  489
            + V+  V+    + +GLP GW KE R R   +G   D YYIDPVSGYEFRS +DV RYLE
Sbjct  229  RLVAKTVSKDKRAVEGLPDGWRKEYRPRK--NGSFLDVYYIDPVSGYEFRSFKDVHRYLE  286

Query  490  TGDIKKCVIKPKK  528
            TGDI++C ++PKK
Sbjct  287  TGDIRQCAVRPKK  299



>gb|EMT21477.1| hypothetical protein F775_23896 [Aegilops tauschii]
Length=424

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 80/168 (48%), Gaps = 40/168 (24%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIs  183
            +S +WLP GW +E+  R+ G +    YK Y+ P+ G + +SK  V  ++N          
Sbjct  175  KSHEWLPKGWLLEI--RAGGENMDKMYKFYVYPALGIRAFSKEDVLLYVNEM--------  224

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
                          ++P+  T   N    +  R +++            A  + +  GLP
Sbjct  225  --------------KIPECDT---NGKCDTSSRDNIL------------AEVEFNPSGLP  255

Query  364  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  507
             GWVKE+  R    G RKDPYY DPVS Y FR+   V+R+L+TG+I K
Sbjct  256  DGWVKEMVYRKTLKGTRKDPYYTDPVSSYAFRTLTSVVRFLQTGNITK  303



>ref|XP_011084407.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
[Sesamum indicum]
Length=523

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 64/194 (33%), Positives = 86/194 (44%), Gaps = 58/194 (30%)
 Frame = +1

Query  19   WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnenk  195
            WLP  W V +K RS G  +    K YI+P +G KF SK +V ++L +A            
Sbjct  8    WLPVDWKVCVKNRSFGRKD----KYYINPLNGLKFNSKLEVLRYLKNAG-----------  52

Query  196  nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWV  375
                                      +K K + +    KTV          A+ LP GW+
Sbjct  53   ------------------------KDQKLKQLNEIGIKKTV----------AEKLPPGWI  78

Query  376  KELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESASKDI  555
            KE+RT+      R+DPYYIDPVSG  FRS ++V R+LE+ D  K        DES   + 
Sbjct  79   KEIRTKRKGGKTRRDPYYIDPVSGRHFRSMQEVFRFLESTDSGK--------DESKVDNQ  130

Query  556  HHNIEEVSPNEKSV  597
             H  EE+  N KS 
Sbjct  131  GHASEELGENLKSA  144



>ref|XP_009595657.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 [Nicotiana 
tomentosiformis]
Length=541

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 71/160 (44%), Gaps = 44/160 (28%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsnen  192
            DWLP GW VE +        G   K Y  PS G KF SKA V  +L+S            
Sbjct  9    DWLPAGWKVEFR-------KGKKEKWYSDPSKGLKFCSKADVLHYLSSVG----------  51

Query  193  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  372
                                      S   KS    +  K  +  V  +  +++GLP GW
Sbjct  52   --------------------------SNCFKSSSTKEIEKKDTGKVVTEKATSEGLPPGW  85

Query  373  VKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLET  492
            +KE+R R     I+KDPYY DPVSG+ FRS ++V R+LET
Sbjct  86   IKEVRVRRKGHKIKKDPYYTDPVSGHTFRSMKEVSRFLET  125



>ref|XP_006664919.1| PREDICTED: uncharacterized protein LOC102722078, partial [Oryza 
brachyantha]
Length=249

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 77/168 (46%), Gaps = 40/168 (24%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIs  183
             + +WLP  W +E+  R+ G +    +K Y+ P +G + +SK  V  ++N +    TP  
Sbjct  100  MTHEWLPNDWMIEV--RAGGENIDKMFKFYVYPPAGVRLFSKEDVLTYINKS--KITPFD  155

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
                                     Q  TS K     DN         +A  + +   LP
Sbjct  156  T----------------------NGQCDTSMK-----DN--------ILANVEFNPHSLP  180

Query  364  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  507
             GWVKEL  R   +G+RKDPYY DPVS Y FR++R  M Y++TG I K
Sbjct  181  KGWVKELVFRKTENGVRKDPYYTDPVSNYSFRTRRSAMLYVQTGKIPK  228



>ref|XP_002318826.1| hypothetical protein POPTR_0012s13490g [Populus trichocarpa]
 gb|EEE97046.1| hypothetical protein POPTR_0012s13490g [Populus trichocarpa]
Length=762

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 83/189 (44%), Gaps = 61/189 (32%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIs  183
            +S DWLP GW VE+K R    +NG   K Y  PSG  +F SK +VS++LN          
Sbjct  5    KSDDWLPEGWRVEVKVR----NNGKKDKFYFPPSGGCRFNSKIEVSRYLNG---------  51

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
                                      S  + ++K +++   P              +GLP
Sbjct  52   --------------------------SHPNSEQKVLIEKTVP--------------EGLP  71

Query  364  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESA  543
             GW +E++       IR+D  Y DPVSGY FRS +D  RY+E+G + +   K   R+   
Sbjct  72   LGWTQEIKVTKKGGRIRRDSLYTDPVSGYVFRSMKDACRYIESGVVGRLAFKRNDRE---  128

Query  544  SKDIHHNIE  570
                +H++E
Sbjct  129  ----NHDVE  133



>ref|XP_008662742.1| PREDICTED: uncharacterized protein LOC103641148 isoform X2 [Zea 
mays]
Length=934

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 49/72 (68%), Gaps = 7/72 (10%)
 Frame = +1

Query  328  VAAQDISAD-----GLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLET  492
            +AA+ +S D     GLP GW KE R R   +G   DPYYIDPVSGYEFRS +DV  YLET
Sbjct  244  LAAKTVSEDKRGVEGLPDGWQKEYRPRK--NGPCSDPYYIDPVSGYEFRSLKDVHNYLET  301

Query  493  GDIKKCVIKPKK  528
            GDI +C + PKK
Sbjct  302  GDISQCAVTPKK  313



>ref|XP_008662741.1| PREDICTED: uncharacterized protein LOC103641148 isoform X1 [Zea 
mays]
Length=942

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 49/72 (68%), Gaps = 7/72 (10%)
 Frame = +1

Query  328  VAAQDISAD-----GLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLET  492
            +AA+ +S D     GLP GW KE R R   +G   DPYYIDPVSGYEFRS +DV  YLET
Sbjct  252  LAAKTVSEDKRGVEGLPDGWQKEYRPRK--NGPCSDPYYIDPVSGYEFRSLKDVHNYLET  309

Query  493  GDIKKCVIKPKK  528
            GDI +C + PKK
Sbjct  310  GDISQCAVTPKK  321



>ref|XP_004976791.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Setaria italica]
 ref|XP_004976792.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Setaria italica]
 ref|XP_004976793.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X3 [Setaria italica]
 ref|XP_004976794.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X4 [Setaria italica]
 ref|XP_004976795.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X5 [Setaria italica]
Length=389

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 51/73 (70%), Gaps = 5/73 (7%)
 Frame = +1

Query  346  SADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
            + +GLP GW+KE R R   +G  I+ D +YIDPV+GYEFRS +DV RYLE+GDI +CV  
Sbjct  9    AGEGLPDGWLKECRPRKNRNGSRIKGDMFYIDPVNGYEFRSLKDVYRYLESGDISQCVTL  68

Query  520  PKKRDESASKDIH  558
            P KR     +D+H
Sbjct  69   PNKR---KIEDLH  78



>ref|XP_010662495.1| PREDICTED: uncharacterized protein LOC100263513 isoform X2 [Vitis 
vinifera]
Length=564

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 57/86 (66%), Gaps = 5/86 (6%)
 Frame = +1

Query  316  VSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETG  495
            ++  V  + ++A+GLP GW+KE++ +     +R+D YY DPV+GY FRS +D +RYL+TG
Sbjct  17   IAKKVVFERVTAEGLPPGWIKEIKIQKKCGTVRRDAYYTDPVNGYIFRSMKDTLRYLKTG  76

Query  496  DIKKCVIKPKKRDESASKDIHHNIEE  573
            D  +   KPK RD   S DI  N+E+
Sbjct  77   DPGRLAFKPKPRD---SGDI--NLED  97



>ref|XP_010234457.1| PREDICTED: uncharacterized protein LOC100834821 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010234458.1| PREDICTED: uncharacterized protein LOC100834821 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010234459.1| PREDICTED: uncharacterized protein LOC100834821 isoform X1 [Brachypodium 
distachyon]
Length=1096

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +1

Query  358  LPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKR  531
            LP GW +E R R   S  + DPYYIDPV+GYEFRS +DV RY+++GDIK+C  +PKKR
Sbjct  321  LPDGWRREDRPRRNGSTNKTDPYYIDPVNGYEFRSMKDVHRYIKSGDIKQCSFRPKKR  378



>ref|XP_010234460.1| PREDICTED: uncharacterized protein LOC100834821 isoform X2 [Brachypodium 
distachyon]
Length=1092

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +1

Query  358  LPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKR  531
            LP GW +E R R   S  + DPYYIDPV+GYEFRS +DV RY+++GDIK+C  +PKKR
Sbjct  317  LPDGWRREDRPRRNGSTNKTDPYYIDPVNGYEFRSMKDVHRYIKSGDIKQCSFRPKKR  374



>ref|XP_009760427.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
[Nicotiana sylvestris]
Length=522

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 78/170 (46%), Gaps = 44/170 (26%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsnen  192
            DWLP GW VE +        G   K Y  PS   KF SK  V ++L+S  +         
Sbjct  9    DWLPAGWKVEFR-------KGKKEKWYSDPSKELKFNSKTDVLRYLSSVGS---------  52

Query  193  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  372
                                 N S++S  ++  M+ +     S   AA    ++GLP GW
Sbjct  53   ---------------------NCSKSSNTKE--MEKKDTGKFSTGKAA----SEGLPPGW  85

Query  373  VKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKP  522
            +KE+R R     IRKDPYYIDPVSG  FRS ++V R LET +  +   KP
Sbjct  86   IKEMRVRRKGHKIRKDPYYIDPVSGQTFRSMKEVSRLLETRESGRIESKP  135



>gb|AFW57951.1| methyl-binding domain MBD113 protein [Zea mays]
Length=482

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 86/199 (43%), Gaps = 39/199 (20%)
 Frame = +1

Query  19   WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnenk  195
            WLP GWT+E+        NGS YK Y SP SG  F SK +   +L S           + 
Sbjct  88   WLPDGWTMEV----CQEDNGSIYKYYTSPMSGYMFTSKMETLHYLFSGVEERMLELQASA  143

Query  196  nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPA----------------  327
             + E   S+  +P+       + R   K+   MD    + +S A                
Sbjct  144  EDNELHESHTWLPRGWVI---EVRAGGKK---MDKMYKRFLSKAEVLHFVNKGMVSTCDM  197

Query  328  ------------VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRD  471
                        +A  + + DGLP GWVKE  +R    GIRKD YY DPVS   FR+ + 
Sbjct  198  DVLCDTSTDDNILAHVEFNPDGLPDGWVKETISRKFNDGIRKDQYYTDPVSHRVFRTLKS  257

Query  472  VMRYLETGDIKKCVIKPKK  528
            V+ YL TG+I +    P++
Sbjct  258  VLSYLGTGEISRHSYLPRR  276



>ref|XP_010035118.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Eucalyptus grandis]
Length=812

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = +1

Query  349  ADGLPAGWVKELRT-RTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPK  525
            A+GLP GW KE++  R   + IR+DPYY DPVSGY FRS +DV RYL+TGDI +   KP 
Sbjct  259  AEGLPEGWTKEIKVKRKNGTIIRRDPYYTDPVSGYVFRSMKDVRRYLDTGDIGRLAYKPP  318

Query  526  KRDE  537
             +DE
Sbjct  319  DKDE  322



>ref|XP_010035117.1| PREDICTED: uncharacterized protein LOC104424406 isoform X1 [Eucalyptus 
grandis]
 gb|KCW46411.1| hypothetical protein EUGRSUZ_K00243 [Eucalyptus grandis]
Length=818

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = +1

Query  349  ADGLPAGWVKELRT-RTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPK  525
            A+GLP GW KE++  R   + IR+DPYY DPVSGY FRS +DV RYL+TGDI +   KP 
Sbjct  259  AEGLPEGWTKEIKVKRKNGTIIRRDPYYTDPVSGYVFRSMKDVRRYLDTGDIGRLAYKPP  318

Query  526  KRDE  537
             +DE
Sbjct  319  DKDE  322



>gb|EPS58890.1| hypothetical protein M569_15921, partial [Genlisea aurea]
Length=77

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +1

Query  328  VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  507
            +A +   AD LP GW+KE++T+   +  RKD ++ DP SGY F SK D +RYL+T DI K
Sbjct  2    IAVETFPADELPPGWIKEIKTKKRGNMTRKDLFFTDPKSGYTFYSKLDALRYLKTDDISK  61

Query  508  CVIKPKKRDESASK  549
            C I+P K+   + K
Sbjct  62   CAIRPIKQGSDSIK  75



>dbj|BAK01530.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1091

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 42/58 (72%), Gaps = 2/58 (3%)
 Frame = +1

Query  358  LPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKR  531
            LP GW +E R R    G + D YY DPVSGYEFRS +DV RY+E+GDI KC I+PKKR
Sbjct  318  LPDGWRREDRLRK--DGTKSDTYYTDPVSGYEFRSLKDVQRYIESGDISKCNIRPKKR  373



>ref|XP_008796742.1| PREDICTED: uncharacterized protein LOC103712110 isoform X7 [Phoenix 
dactylifera]
Length=644

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 71/140 (51%), Gaps = 23/140 (16%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnen  192
            DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    + N       
Sbjct  81   DWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMSCNP------  134

Query  193  knnieesssnleVPQNQTPKENQSRTSRK--RKSVMDNQTPKTVSPAVAAQDISADGLPA  366
                  +     V    T     S + RK  ++S M+NQ    +       + + DGLP+
Sbjct  135  -----RAKRKRSVVTKVTENACSSTSQRKGIKRSTMENQVRSQI-------EYTPDGLPS  182

Query  367  GWVKELRTRTCPS--GIRKD  420
            GW+KE+R R   S  G ++D
Sbjct  183  GWIKEIRYRKTSSRCGAKRD  202


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 68/164 (41%), Gaps = 46/164 (28%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnen  192
            +WLP GW + +KT  TG  +     CY  P S R F+SK ++  +LN             
Sbjct  8    EWLPEGWKMVVKTSMTGDKD----VCYTCPTSSRTFHSKEEIMHYLNY------------  51

Query  193  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  372
                               +      S+      DN     V P         D LPAGW
Sbjct  52   -------------------ERVDGYISKPTSCFGDN-----VHPLAEQIKDFPDWLPAGW  87

Query  373  VKELRTRTCPSGI---RKDPYYIDPVSGYEFRSKRDVMRYLETG  495
            V E +TR   SG    R+   YIDPV+G+ F SK +V+RY++ G
Sbjct  88   VLEFKTRK--SGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDG  129



>gb|EEC77988.1| hypothetical protein OsI_17375 [Oryza sativa Indica Group]
Length=394

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 54/84 (64%), Gaps = 8/84 (10%)
 Frame = +1

Query  322  PAVAAQ---DISADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYL  486
            PAV A    + + +GLP GW+KE R R   SG  ++ D +YIDP + YEFRS++DV RYL
Sbjct  20   PAVTADGKIEPAGEGLPHGWLKEYRPRKNQSGSRVKGDTFYIDPTNMYEFRSQKDVQRYL  79

Query  487  ETGDIKKCVIKPKKRDESASKDIH  558
            E+GD+  CV+   KR     +D+H
Sbjct  80   ESGDVTNCVMIQNKR---KMEDLH  100



>ref|NP_001170014.1| hypothetical protein [Zea mays]
 gb|ACN35529.1| unknown [Zea mays]
 gb|AFW59433.1| hypothetical protein ZEAMMB73_114433 [Zea mays]
Length=432

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 53/83 (64%), Gaps = 5/83 (6%)
 Frame = +1

Query  346  SADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
            + +GLP GW+KE R R    G  ++ D +YIDP++GYEF S +DV RYLE+GDI KC+  
Sbjct  31   AVEGLPNGWLKECRPRKNRYGSRVKSDTFYIDPINGYEFHSLKDVHRYLESGDISKCIRL  90

Query  520  PKKR---DESASKDIHHNIEEVS  579
            P KR   D    +D  H+  ++S
Sbjct  91   PNKRKIEDLHTKEDQSHHTGKLS  113



>ref|NP_001053858.1| Os04g0613800 [Oryza sativa Japonica Group]
 dbj|BAF15772.1| Os04g0613800 [Oryza sativa Japonica Group]
 dbj|BAG91729.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92796.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67422.1| hypothetical protein OsJ_24762 [Oryza sativa Japonica Group]
Length=394

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 54/84 (64%), Gaps = 8/84 (10%)
 Frame = +1

Query  322  PAVAAQ---DISADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYL  486
            PAV A    + + +GLP GW+KE R R   SG  ++ D +YIDP + YEFRS++DV RYL
Sbjct  20   PAVTADGKIEPAGEGLPHGWLKEYRPRKNQSGSRVKGDTFYIDPTNMYEFRSQKDVQRYL  79

Query  487  ETGDIKKCVIKPKKRDESASKDIH  558
            E+GD+  CV+   KR     +D+H
Sbjct  80   ESGDVTNCVMIQNKR---KMEDLH  100



>emb|CAE05215.3| OSJNBa0070C17.22 [Oryza sativa Japonica Group]
Length=438

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 54/84 (64%), Gaps = 8/84 (10%)
 Frame = +1

Query  322  PAVAAQ---DISADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYL  486
            PAV A    + + +GLP GW+KE R R   SG  ++ D +YIDP + YEFRS++DV RYL
Sbjct  20   PAVTADGKIEPAGEGLPHGWLKEYRPRKNQSGSRVKGDTFYIDPTNMYEFRSQKDVQRYL  79

Query  487  ETGDIKKCVIKPKKRDESASKDIH  558
            E+GD+  CV+   KR     +D+H
Sbjct  80   ESGDVTNCVMIQNKRK---MEDLH  100



>ref|XP_007211158.1| hypothetical protein PRUPE_ppa027142mg, partial [Prunus persica]
 gb|EMJ12357.1| hypothetical protein PRUPE_ppa027142mg, partial [Prunus persica]
Length=747

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +1

Query  358  LPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKR  531
            LP+GW KE++ +   + +R+DPYY DPVSGY FRSK  VM YLETG+I +   KPK +
Sbjct  11   LPSGWTKEIKVKRVANRLRRDPYYTDPVSGYVFRSKNAVMHYLETGEISRHAFKPKNK  68



>gb|KDO60033.1| hypothetical protein CISIN_1g008463mg [Citrus sinensis]
Length=537

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +1

Query  352  DGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPK  525
            DGLP GW KE++       +R+DPYYIDP SGY FRS +D +RY+ETG+I +   KPK
Sbjct  11   DGLPPGWTKEIKVTKTGRKVRRDPYYIDPASGYIFRSMKDAVRYVETGEIGRLAYKPK  68



>ref|XP_006652812.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Oryza brachyantha]
 ref|XP_006652813.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Oryza brachyantha]
Length=393

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 48/73 (66%), Gaps = 6/73 (8%)
 Frame = +1

Query  346  SADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
            + +GLP GW+K  R R   SG  I+ D +YIDP + YEFRS +DV RYLE+GD+  CV+ 
Sbjct  31   AGEGLPPGWLKAYRPRKSQSGSKIKGDTFYIDPTNMYEFRSLKDVHRYLESGDVSNCVMI  90

Query  520  PKKRDESASKDIH  558
            P K+     KD+H
Sbjct  91   PNKK----IKDLH  99



>ref|XP_006652814.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X3 [Oryza brachyantha]
Length=365

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 48/73 (66%), Gaps = 6/73 (8%)
 Frame = +1

Query  346  SADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
            + +GLP GW+K  R R   SG  I+ D +YIDP + YEFRS +DV RYLE+GD+  CV+ 
Sbjct  31   AGEGLPPGWLKAYRPRKSQSGSKIKGDTFYIDPTNMYEFRSLKDVHRYLESGDVSNCVMI  90

Query  520  PKKRDESASKDIH  558
            P K+     KD+H
Sbjct  91   PNKK----IKDLH  99



>ref|XP_006490367.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
[Citrus sinensis]
 gb|KDO60031.1| hypothetical protein CISIN_1g008463mg [Citrus sinensis]
Length=564

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +1

Query  352  DGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPK  525
            DGLP GW KE++       +R+DPYYIDP SGY FRS +D +RY+ETG+I +   KPK
Sbjct  38   DGLPPGWTKEIKVTKTGRKVRRDPYYIDPASGYIFRSMKDAVRYVETGEIGRLAYKPK  95



>ref|XP_006421896.1| hypothetical protein CICLE_v10004647mg [Citrus clementina]
 gb|ESR35136.1| hypothetical protein CICLE_v10004647mg [Citrus clementina]
Length=564

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +1

Query  352  DGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPK  525
            DGLP GW KE++       +R+DPYYIDP SGY FRS +D +RY+ETG+I +   KPK
Sbjct  38   DGLPPGWTKEIKVTKTGRKVRRDPYYIDPASGYIFRSMKDAVRYVETGEIGRLAYKPK  95



>gb|KDO60032.1| hypothetical protein CISIN_1g008463mg [Citrus sinensis]
Length=549

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +1

Query  352  DGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPK  525
            DGLP GW KE++       +R+DPYYIDP SGY FRS +D +RY+ETG+I +   KPK
Sbjct  38   DGLPPGWTKEIKVTKTGRKVRRDPYYIDPASGYIFRSMKDAVRYVETGEIGRLAYKPK  95



>dbj|BAA89308.1| AHM2 [Triticum aestivum]
Length=353

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  352  DGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK  528
            DGLP GWVKEL  R C  GIRKDPYY DPVS   FR+ + V+ YL+TG+I +    P++
Sbjct  3    DGLPKGWVKELVFRKCNDGIRKDPYYTDPVSHLLFRTLKSVISYLQTGEISRHAYLPRR  61



>gb|EAY93364.1| hypothetical protein OsI_15161 [Oryza sativa Indica Group]
Length=316

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 79/169 (47%), Gaps = 41/169 (24%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIs  183
             + +WLP GW +E+  R+ G +    YK Y+ P +G + +SK  V  ++N +        
Sbjct  120  MTHEWLPKGWIIEV--RAGGKNMNKMYKFYVYPPAGVRLFSKEDVLLYINKS--------  169

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
                          E+    T  E  +RT        DN         +A  + +   LP
Sbjct  170  --------------EITGFDTNGECDTRTK-------DN--------ILANVEFNPHSLP  200

Query  364  AGWVKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  507
             GWVKE+  R   +G IRKDPY+ DPV+ Y FR+++  M Y++TG + K
Sbjct  201  EGWVKEVVFRKTKTGVIRKDPYFTDPVNNYSFRTRKSAMLYVQTGKVPK  249



>ref|XP_009371320.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Pyrus x bretschneideri]
Length=572

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 57/170 (34%), Positives = 80/170 (47%), Gaps = 41/170 (24%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSNTPIsne  189
            S DWLP GWTVE+K R  G  +   Y+   S SG +F S+A+VS++L+++++ +      
Sbjct  6    SEDWLPTGWTVEVKFRKNGRRDKYYYE---SSSGHRFSSRAEVSRYLSTSSHED------  56

Query  190  nknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAG  369
                             Q  KE   R S       D    KTV          A+GLP G
Sbjct  57   ----------------EQKIKETLKRPSD------DIVVEKTV----------AEGLPPG  84

Query  370  WVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
            W KE+R        R+D +YI PVS   F S RDV RYLE  +  + +++
Sbjct  85   WTKEIRITKKARKTRRDTHYIAPVSEKVFCSIRDVHRYLENEEPGRLILE  134



>ref|XP_009418271.1| PREDICTED: uncharacterized protein LOC103998509 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=223

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 85/179 (47%), Gaps = 22/179 (12%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnen  192
            DWLP GW +E++        G TY+ Y  P S   F SK +V  +LN  A ++       
Sbjct  8    DWLPDGWIMEVRR----GKKGFTYRYYTCPISEYTFCSKEEVIHYLNIVAAAS-------  56

Query  193  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPA------VAAQDISAD  354
             +  E++    +  Q    K   S     R  +M+ +T K  + A      +   + S D
Sbjct  57   -HASEDTECFGDEDQQLVHKVKDSLKWLPRGWIMEIRTRKIGAEAEERYKVLYRIEYSPD  115

Query  355  GLPAGWVKEL---RTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKP  522
            GLP GW+KE+   R +   S  ++D YY DP SGY FR+ +D + Y+E G + K   KP
Sbjct  116  GLPDGWIKEIKFRRNKDKKSPTKQDAYYTDPESGYVFRTLKDCICYIEHGVLSKHAFKP  174



>emb|CAD39866.2| OSJNBb0058J09.3 [Oryza sativa Japonica Group]
Length=385

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 79/169 (47%), Gaps = 41/169 (24%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIs  183
             + +WLP GW +E+  R+ G +    YK Y+ P +G + +SK  V  ++N +        
Sbjct  120  MTHEWLPKGWIIEV--RAGGKNMNKMYKFYVYPPAGVRLFSKEDVLLYINKS--------  169

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
                          E+    T  E  +RT        DN         +A  + +   LP
Sbjct  170  --------------EITGFDTNGECDTRTK-------DN--------ILANVEFNPHSLP  200

Query  364  AGWVKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  507
             GWVKE+  R   +G IRKDPY+ DPV+ Y FR+++  M Y++TG + K
Sbjct  201  EGWVKEVVFRKTKTGVIRKDPYFTDPVNNYSFRTRKSAMLYVQTGKVPK  249



>ref|XP_006653233.1| PREDICTED: uncharacterized protein LOC102703961 [Oryza brachyantha]
Length=280

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 73/166 (44%), Gaps = 40/166 (24%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIs  183
             + +WLP  W +E+  R+ G +    +K Y+ P +G + +SK  V  ++N          
Sbjct  100  MTHEWLPNDWLIEI--RAGGENTDKMFKFYVYPPAGVRLFSKEDVLTYINKC--------  149

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
                                TP +   +   + K   DN         +A  + +   LP
Sbjct  150  ------------------KITPFDTNGQCDTRTK---DN--------ILANVEFNPHSLP  180

Query  364  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  501
             GWVKEL  R     +RKDPYY DPVS Y FR++R  M +++TG +
Sbjct  181  KGWVKELVFRKTKDAVRKDPYYTDPVSNYSFRTRRSAMLFVQTGKV  226



>emb|CAH67925.1| OSIGBa0138E08-OSIGBa0161L23.6 [Oryza sativa Indica Group]
Length=383

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 79/169 (47%), Gaps = 41/169 (24%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIs  183
             + +WLP GW +E+  R+ G +    YK Y+ P +G + +SK  V  ++N +        
Sbjct  120  MTHEWLPKGWIIEV--RAGGKNMNKMYKFYVYPPAGVRLFSKEDVLLYINKS--------  169

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
                          E+    T  E  +RT        DN         +A  + +   LP
Sbjct  170  --------------EITGFDTNGECDTRTK-------DN--------ILANVEFNPHSLP  200

Query  364  AGWVKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  507
             GWVKE+  R   +G IRKDPY+ DPV+ Y FR+++  M Y++TG + K
Sbjct  201  EGWVKEVVFRKTKTGVIRKDPYFTDPVNNYSFRTRKSAMLYVQTGKVPK  249



>ref|XP_009371318.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Pyrus x bretschneideri]
Length=697

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 57/170 (34%), Positives = 80/170 (47%), Gaps = 41/170 (24%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSNTPIsne  189
            S DWLP GWTVE+K R  G  +   Y+   S SG +F S+A+VS++L+++++ +      
Sbjct  6    SEDWLPTGWTVEVKFRKNGRRDKYYYE---SSSGHRFSSRAEVSRYLSTSSHED------  56

Query  190  nknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAG  369
                             Q  KE   R S       D    KTV          A+GLP G
Sbjct  57   ----------------EQKIKETLKRPSD------DIVVEKTV----------AEGLPPG  84

Query  370  WVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
            W KE+R        R+D +YI PVS   F S RDV RYLE  +  + +++
Sbjct  85   WTKEIRITKKARKTRRDTHYIAPVSEKVFCSIRDVHRYLENEEPGRLILE  134



>ref|XP_004982529.1| PREDICTED: uncharacterized protein LOC101763097 [Setaria italica]
Length=338

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 52/165 (32%), Positives = 70/165 (42%), Gaps = 41/165 (25%)
 Frame = +1

Query  19   WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnenk  195
            WLP GW +E+  R+ G      YK Y+ P +G +  SK  V  ++N A  S         
Sbjct  95   WLPKGWVMEI--RAGGEKMDKMYKFYVYPKTGVRLLSKQDVLLYINEATVS---------  143

Query  196  nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWV  375
                           +     Q  TS +             +  +A  D    GLP GWV
Sbjct  144  ---------------KCDTNGQCNTSSE-------------ANLLAIVDFHPSGLPEGWV  175

Query  376  KELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  507
            KEL  R    G IR+DPYY DP S Y FR+ +  + ++ETG I K
Sbjct  176  KELVFRKTKEGLIRRDPYYTDPASSYTFRTLKSALCFVETGKISK  220



>ref|XP_008376557.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 [Malus 
domestica]
Length=574

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 80/181 (44%), Gaps = 41/181 (23%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSNTPIsne  189
            S DWLP GWTVE+K R  G  +   Y+   S SG +F S+A+VS++L+++++ +      
Sbjct  6    SEDWLPTGWTVEVKFRKNGKRDKYYYE---SSSGHRFSSRAEVSRYLSTSSHED------  56

Query  190  nknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAG  369
                             Q  KE                T K  S  V  +   A+GLP G
Sbjct  57   ----------------EQKIKE----------------TLKRPSDDVVVEKTVAEGLPPG  84

Query  370  WVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESASK  549
            W KE+R        R+D +YI P S   F S RDV RYLE        ++P    +  S+
Sbjct  85   WTKEIRITKKARKTRRDTHYIAPASEKVFCSIRDVHRYLENEQPGTLTLEPSGSGDKESE  144

Query  550  D  552
            D
Sbjct  145  D  145



>ref|XP_008367419.1| PREDICTED: uncharacterized protein LOC103431052 [Malus domestica]
Length=1123

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 71/151 (47%), Gaps = 34/151 (23%)
 Frame = +1

Query  91   CYISPSGR-KFYSKAQVSQFLNSAANSNTPIsnenknnieesssnleVPQNQTPKENQSR  267
            CYI PS    FYSK +V ++L +                        V +  +   N   
Sbjct  29   CYIDPSRECTFYSKPEVFRYLKT------------------------VKRKSSKSGNLKS  64

Query  268  TSRKR-----KSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYI  432
            TS KR     K+V   Q  K V      +    + LP GW+KE++     +  RKDPYY 
Sbjct  65   TSSKRCITEGKAVTTLQLTKNV----YVEKHHVEDLPPGWIKEIKVTKYANRFRKDPYYT  120

Query  433  DPVSGYEFRSKRDVMRYLETGDIKKCVIKPK  525
            DP SGY FRSK+DV+ YLETG+I K   KP+
Sbjct  121  DPDSGYVFRSKKDVICYLETGEISKHAFKPR  151



>ref|XP_002466890.1| hypothetical protein SORBIDRAFT_01g015930 [Sorghum bicolor]
 gb|EER93888.1| hypothetical protein SORBIDRAFT_01g015930 [Sorghum bicolor]
Length=278

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 71/162 (44%), Gaps = 41/162 (25%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYI-SPSGRKFYSKAQVSQFLNSAANSNTPIsnen  192
            +WLP GW +E+  R+ G      YK Y+ S +G +  SK  V  ++N A  S        
Sbjct  100  EWLPKGWVMEI--RAGGEKTDKMYKFYVHSITGVRLLSKQDVLLYINEAKIS--------  149

Query  193  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  372
                            +     Q  TS +     DN         +A  DI   GLP GW
Sbjct  150  ----------------RCDTNGQCDTSSE-----DN--------ILAKVDIRPSGLPEGW  180

Query  373  VKELRTRTCPSGI-RKDPYYIDPVSGYEFRSKRDVMRYLETG  495
            VKE+  R    G+ R+DPYY DP S Y FR+ +  + +LETG
Sbjct  181  VKEIVYRKTKDGLTRRDPYYTDPASSYTFRTLKSALSFLETG  222



>ref|XP_002444304.1| hypothetical protein SORBIDRAFT_07g019900 [Sorghum bicolor]
 gb|EES13799.1| hypothetical protein SORBIDRAFT_07g019900 [Sorghum bicolor]
Length=317

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 80/189 (42%), Gaps = 42/189 (22%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYI-SPSGRKFYSKAQVSQFLNSAANSNTPIsnen  192
            +WLP GW +E+  R+ G      YK Y+ S +G +  SK  V  ++N A  S        
Sbjct  100  EWLPKGWVLEI--RAGGEKTDKMYKFYVHSITGVRLLSKQDVLLYINEAIVSGCDT----  153

Query  193  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  372
                                  Q   S +     DN         +A  D+   GLP GW
Sbjct  154  --------------------HGQCDISSE-----DN--------ILAQVDLWPSGLPEGW  180

Query  373  VKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI-KKCVIKPKKRDESAS  546
            VKEL  R    G IRKD YY DP S Y FR+ +  + +LETG I ++  I+     +  S
Sbjct  181  VKELVYRKTKEGLIRKDRYYTDPASSYTFRTLKSALSFLETGKIPRRAFIQKTSVHDLYS  240

Query  547  KDIHHNIEE  573
             +I  N+ E
Sbjct  241  FEISTNLHE  249



>ref|XP_008796743.1| PREDICTED: uncharacterized protein LOC103712110 isoform X8 [Phoenix 
dactylifera]
Length=600

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 72/141 (51%), Gaps = 26/141 (18%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnen  192
            DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    + N       
Sbjct  38   DWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMSCNP------  91

Query  193  knnieesssnleVPQNQTPKENQSRTSRK--RKSVMDNQTPKTVSPAVAAQ-DISADGLP  363
                  +     V    T     S + RK  ++S M+N         V +Q + + DGLP
Sbjct  92   -----RAKRKRSVVTKVTENACSSTSQRKGIKRSTMEN---------VRSQIEYTPDGLP  137

Query  364  AGWVKELRTRTCPS--GIRKD  420
            +GW+KE+R R   S  G ++D
Sbjct  138  SGWIKEIRYRKTSSRCGAKRD  158


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +1

Query  352  DGLPAGWVKELRTRTCPSGI---RKDPYYIDPVSGYEFRSKRDVMRYLETG  495
            D LPAGWV E +TR   SG    R+   YIDPV+G+ F SK +V+RY++ G
Sbjct  38   DWLPAGWVLEFKTRK--SGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDG  86



>ref|XP_002447565.1| hypothetical protein SORBIDRAFT_06g004050 [Sorghum bicolor]
 gb|EES11893.1| hypothetical protein SORBIDRAFT_06g004050 [Sorghum bicolor]
Length=295

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +1

Query  328  VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  507
            +A  + S DGLP GWVKE   R C  GIRKDPYY DPVS   FR+ + V+ YL TG+I K
Sbjct  20   LAQVEFSPDGLPDGWVKETIFRKCNDGIRKDPYYTDPVSRRVFRTLKSVLSYLGTGEISK  79

Query  508  CVIKPKK  528
                P++
Sbjct  80   HSYLPRR  86



>ref|XP_002448522.1| hypothetical protein SORBIDRAFT_06g028360 [Sorghum bicolor]
 gb|EES12850.1| hypothetical protein SORBIDRAFT_06g028360 [Sorghum bicolor]
Length=431

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 44/64 (69%), Gaps = 2/64 (3%)
 Frame = +1

Query  346  SADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
            + +GLP GW+KE R R    G  ++ D +YIDP++GY+F S +DV RYLE+GDI +C   
Sbjct  32   AGEGLPDGWLKEYRPRKNLYGSRVKGDTFYIDPINGYKFHSLKDVHRYLESGDINQCFRL  91

Query  520  PKKR  531
            P KR
Sbjct  92   PNKR  95



>ref|XP_008665005.1| PREDICTED: uncharacterized protein LOC103643620 [Zea mays]
Length=343

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 69/164 (42%), Gaps = 41/164 (25%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYI-SPSGRKFYSKAQVSQFLNSAANSNTPIsnen  192
            +WLP GW +E+  R+ G      YK Y+ S +G +  SK  V  ++N A  S    +   
Sbjct  101  EWLPKGWVMEV--RAGGEKADKMYKFYVHSITGLRLLSKQDVLLYINEAKVSGCDTNE--  156

Query  193  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  372
                          Q  T  E             DN   K         D    GLP GW
Sbjct  157  --------------QCDTTSE-------------DNILSKV--------DFRPSGLPEGW  181

Query  373  VKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  501
            VKEL  R    G IR+DPYY DP S Y FR+ +  + +LETG +
Sbjct  182  VKELVYRKTKEGLIRRDPYYTDPASSYTFRTLKSALSFLETGKV  225



>tpg|DAA59672.1| TPA: hypothetical protein ZEAMMB73_581852 [Zea mays]
Length=393

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 86/198 (43%), Gaps = 42/198 (21%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYI-SPSGRKFYSKAQVSQFLNSAANSNTPIsnen  192
            +WLP GW +E+  R+ G      YK Y+ S +G +  SK  V  ++N A  S    +   
Sbjct  171  EWLPKGWVMEV--RAGGEKADKMYKFYVHSITGLRLLSKQDVLLYINEAKVSGCDTNG--  226

Query  193  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  372
                          Q  T  E             DN   K         D    GLP GW
Sbjct  227  --------------QCDTTSE-------------DNILSKV--------DFRPSGLPEGW  251

Query  373  VKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI-KKCVIKPKKRDESAS  546
            VKEL  R    G I++DPYY DP S Y FR+ +  + +LETG + ++  I+     +  S
Sbjct  252  VKELVYRKTMEGLIKRDPYYTDPASSYTFRTLKSALSFLETGKVSERAFIQRTSVHDLYS  311

Query  547  KDIHHNIEEVSPNEKSVE  600
             +I  ++E+    +++++
Sbjct  312  FEISADMEQALLKKEAIQ  329



>ref|XP_003580540.1| PREDICTED: uncharacterized protein LOC100838054 [Brachypodium 
distachyon]
 ref|XP_010240414.1| PREDICTED: uncharacterized protein LOC100838054 [Brachypodium 
distachyon]
 ref|XP_010240415.1| PREDICTED: uncharacterized protein LOC100838054 [Brachypodium 
distachyon]
 ref|XP_010240416.1| PREDICTED: uncharacterized protein LOC100838054 [Brachypodium 
distachyon]
 ref|XP_010240417.1| PREDICTED: uncharacterized protein LOC100838054 [Brachypodium 
distachyon]
Length=400

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 57/104 (55%), Gaps = 8/104 (8%)
 Frame = +1

Query  304  TPKTVSPAVAAQ---DISADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKR  468
            TP    P V      + + +GLP GW K  R R    G  IR D +YIDP + YEFRS +
Sbjct  11   TPNGAKPTVMVDSKIEPAGEGLPDGWSKGCRPRKSRPGSRIRGDKFYIDPTNSYEFRSLK  70

Query  469  DVMRYLETGDIKKCVIKPKKR---DESASKDIHHNIEEVSPNEK  591
            DV RY+E+ DI  CV+ P KR   D   +++  H++  +S N +
Sbjct  71   DVYRYIESQDISNCVVTPIKRKTEDLQIARNQSHDVGRLSGNSQ  114



>ref|XP_002461981.1| hypothetical protein SORBIDRAFT_02g011480 [Sorghum bicolor]
 gb|EER98502.1| hypothetical protein SORBIDRAFT_02g011480 [Sorghum bicolor]
Length=249

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 71/164 (43%), Gaps = 45/164 (27%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYI-SPSGRKFYSKAQVSQFLNSA--ANSNTPIsn  186
            +WLP GW +E+  R+ G      YK Y+ S +G +  SK  V  ++N A  +  NT    
Sbjct  61   EWLPKGWVMEI--RAAGEKTDKMYKFYVHSITGVRLLSKQDVLLYINEANVSGCNT----  114

Query  187  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  366
                                    Q  TS +     DN         +A  D    GLP 
Sbjct  115  ----------------------NGQCDTSSE-----DN--------ILAKVDFRPSGLPE  139

Query  367  GWVKELRTRTCPSGI-RKDPYYIDPVSGYEFRSKRDVMRYLETG  495
            GW+KE+  R    G+ R+DPYY DP S Y FR+ +  + +LETG
Sbjct  140  GWIKEIVYRKTKEGLTRRDPYYTDPASSYTFRTLKSALSFLETG  183



>tpg|DAA50117.1| TPA: hypothetical protein ZEAMMB73_042225 [Zea mays]
Length=320

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 68/162 (42%), Gaps = 41/162 (25%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYI-SPSGRKFYSKAQVSQFLNSAANSNTPIsnen  192
            +WLP GW +E+  R+ G      YK Y+ S +G +  SK  V  ++N A  S    +   
Sbjct  102  EWLPKGWVMEV--RAGGEKADKMYKFYVHSITGLRLLSKQDVLLYINEAKVSGCDTNE--  157

Query  193  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  372
                          Q  T  E             DN   K         D    GLP GW
Sbjct  158  --------------QCDTTSE-------------DNILSKV--------DFRPSGLPEGW  182

Query  373  VKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETG  495
            VKEL  R    G IR+DPYY DP S Y FR+ +  + +LETG
Sbjct  183  VKELVYRKTKEGLIRRDPYYTDPASSYTFRTLKSALSFLETG  224



>gb|AFW80349.1| hypothetical protein ZEAMMB73_827373 [Zea mays]
Length=407

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 86/198 (43%), Gaps = 42/198 (21%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYI-SPSGRKFYSKAQVSQFLNSAANSNTPIsnen  192
            +WLP GW +E+  R+ G      YK Y+ S +G +  SK  V  ++N A  S    +   
Sbjct  185  EWLPKGWVMEV--RAGGEKANKMYKFYVHSITGLRLLSKQDVLLYINEAKVSGCDTNG--  240

Query  193  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  372
                          Q  T  E             DN   K         D    GLP GW
Sbjct  241  --------------QCDTTSE-------------DNILSKV--------DFRPSGLPEGW  265

Query  373  VKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI-KKCVIKPKKRDESAS  546
            VKEL  R    G I++DPYY DP S Y FR+ +  + +LETG + ++  I+     +  S
Sbjct  266  VKELVYRKTMEGLIKRDPYYTDPASSYTFRTLKSALSFLETGKVSERAFIQRTSVHDLYS  325

Query  547  KDIHHNIEEVSPNEKSVE  600
             +I  ++E+    +++++
Sbjct  326  FEISADMEQALLKKEAIQ  343



>gb|AGT16604.1| hypothetical protein SHCRBa_016_K03_R_160 [Saccharum hybrid cultivar 
R570]
Length=431

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 50/83 (60%), Gaps = 5/83 (6%)
 Frame = +1

Query  346  SADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
            + +GLP GW+KE R R    G  ++ D +YIDPV+GY+F S +DV  YLE+GDI +C   
Sbjct  32   AGEGLPDGWLKEYRPRKNQYGSRVKGDTFYIDPVNGYKFHSLKDVHFYLESGDISQCFRL  91

Query  520  PKKR---DESASKDIHHNIEEVS  579
            P KR   D     D  H+  ++S
Sbjct  92   PNKRKIGDLHTEGDQSHHTGKLS  114



>ref|XP_002444202.1| hypothetical protein SORBIDRAFT_07g014920 [Sorghum bicolor]
 gb|EES13697.1| hypothetical protein SORBIDRAFT_07g014920 [Sorghum bicolor]
Length=317

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 85/200 (43%), Gaps = 47/200 (24%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYI-SPSGRKFYSKAQVSQFLNSAANSNTPIsnen  192
            +WLP GW +E+  R+ G      YK Y+ S +G +  SK  V  ++N A  S        
Sbjct  100  EWLPKGWVMEI--RAGGEKTDKMYKFYVHSITGVRLLSKQDVLLYINEAIVSGCDT----  153

Query  193  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  372
                                  Q   S +     DN         +A  D+   GLP GW
Sbjct  154  --------------------HGQCDISSE-----DN--------ILAKVDLWPSGLPEGW  180

Query  373  VKELRTRTCPSGI-RKDPYYIDPVSGYEFRSKRDVMRYLETGDI-KKCVIKPKKRDESAS  546
            VKEL  R    G+ RKD Y+ DP S Y FR+ +  + +LETG I ++  I+     +  S
Sbjct  181  VKELVFRKTKEGLMRKDRYFTDPASSYTFRTLKSALSFLETGKIPRRAFIQKTSVHDLYS  240

Query  547  KDIHHNIEE-----VSPNEK  591
             +I  ++ E     ++ NEK
Sbjct  241  FEISTDLHESLRTRLTVNEK  260



>gb|KHN28399.1| Methyl-CpG-binding domain-containing protein 13, partial [Glycine 
soja]
Length=612

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 52/97 (54%), Gaps = 0/97 (0%)
 Frame = +1

Query  250  KENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDPYY  429
            K N     R   +V +  + + +SP +  +    +GLP GWVK+ R  T    +R+D +Y
Sbjct  76   KFNSKEVFRYLDNVQNKVSIQKISPNIIVEKAIVEGLPPGWVKKTRITTNGDSVRRDTFY  135

Query  430  IDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDES  540
            IDPV+GY F S  DV  YLETG I +     K +D S
Sbjct  136  IDPVNGYTFCSIEDVDHYLETGKIGRNEFTSKDKDGS  172



>ref|XP_010317585.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Solanum lycopersicum]
 ref|XP_010317586.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Solanum lycopersicum]
 ref|XP_010317587.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Solanum lycopersicum]
Length=523

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 56/100 (56%), Gaps = 18/100 (18%)
 Frame = +1

Query  346  SADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLET---GDIK----  504
            +++GLP GW+KEL+ R     IRKDPYYIDPVSG  FRS + V R+LET   G  +    
Sbjct  15   ASEGLPPGWIKELKVRKKGRKIRKDPYYIDPVSGQTFRSLKQVSRFLETREPGRFESKPD  74

Query  505  -KC----------VIKPKKRDESASKDIHHNIEEVSPNEK  591
             KC           + P + DE  S D   + +EV+ N+K
Sbjct  75   DKCPDTLELEEPSSLFPAEADEQISLDCDASCKEVNSNQK  114



>ref|XP_010934848.1| PREDICTED: uncharacterized protein LOC105054908 isoform X3 [Elaeis 
guineensis]
Length=638

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 47/140 (34%), Positives = 64/140 (46%), Gaps = 36/140 (26%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsn  186
            S  WLPPGW +E++T+  GS     YK Y  PS R +FYSK  V QF+ S          
Sbjct  79   SFKWLPPGWLLEIRTQRCGSKARQIYKSYFDPSTRSRFYSKGDVLQFVKSG---------  129

Query  187  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  366
                            +  +P  +Q R         ++++P+ V   +A  +   DGLP 
Sbjct  130  ----------------KIYSPTSDQKRH-------CESESPEHV---IAQIEFYPDGLPD  163

Query  367  GWVKELRTRTCPSGIRKDPY  426
            GW KE R +   SGIRKDP 
Sbjct  164  GWYKETRIKKNRSGIRKDPL  183



>ref|XP_003572272.2| PREDICTED: uncharacterized protein LOC100826562 [Brachypodium 
distachyon]
Length=328

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 68/163 (42%), Gaps = 41/163 (25%)
 Frame = +1

Query  19   WLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsnenk  195
            WLP GW +E+  R+ G +    +K YI P    + +SK  V  ++     S         
Sbjct  107  WLPKGWFIEI--RAGGENMDKMFKFYIYPPMEIRLFSKEDVLLYVKEMVVS---------  155

Query  196  nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKT-VSPAVAAQDISADGLPAGW  372
                               E Q  TS +     DN       +P+V         LP GW
Sbjct  156  ---------------ACDTEGQCDTSSQ-----DNILALVEFNPSVL--------LPEGW  187

Query  373  VKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  501
            VKE+  R    GIRKDPY+ DPV+ Y FR+ +  M YL TG I
Sbjct  188  VKEIVYRKTKEGIRKDPYFTDPVNHYVFRTLKAAMTYLSTGKI  230



>ref|XP_010089148.1| Methyl-CpG-binding domain-containing protein 5 [Morus notabilis]
 gb|EXB37395.1| Methyl-CpG-binding domain-containing protein 5 [Morus notabilis]
Length=171

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 52/165 (32%), Positives = 80/165 (48%), Gaps = 37/165 (22%)
 Frame = +1

Query  4    NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYI-SPSGRKFYSKAQVSQFLNSAANSNTPI  180
            N SSDWLP GWTV+ K   +G   G     Y  + +G+   SK +V Q +++ ++ +T  
Sbjct  4    NDSSDWLPSGWTVQFKVLKSGRKVG----IYTNTETGKIVLSKHEVFQLISAGSSCST--  57

Query  181  snenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGL  360
                                      Q +TS    S+   +TP  + P V  +D+  + L
Sbjct  58   --------------------------QPQTSNTHVSLQAERTP--LQP-VNEKDLLPEWL  88

Query  361  PAGWVKELRTRTCPSGIRKD-PYYIDPVSGYEFRSKRDVMRYLET  492
            P GW  E+RTR   +   K+   YIDP++G +F SK +V+RYL+T
Sbjct  89   PKGWKVEVRTRKSGTLAGKEYKSYIDPLNGSKFYSKLEVLRYLKT  133


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  159
            +WLP GW VE++TR +G+  G  YK YI P +G KFYSK +V ++L + 
Sbjct  86   EWLPKGWKVEVRTRKSGTLAGKEYKSYIDPLNGSKFYSKLEVLRYLKTV  134



>ref|XP_010255468.1| PREDICTED: uncharacterized protein LOC104596134 isoform X2 [Nelumbo 
nucifera]
Length=572

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 83/162 (51%), Gaps = 17/162 (10%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIs  183
            +S DWLP GW +++K R TG  +    K YI   +GRKF SK  V +++ +  + N  + 
Sbjct  5    KSPDWLPDGWVMDVKVRKTGQKD----KYYIHLKTGRKFRSKDGVLRYIETGESHNC-MP  59

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
             + +      SS+ +VP   +  ++   T  + K  M  + P   SP         D LP
Sbjct  60   LQIERQANTCSSDKDVPNTCSSDKDMPNTCSRDKD-MPLEMPMEDSP---------DWLP  109

Query  364  AGWVKELRTRTCPSGI-RKDPYYIDPVSGYEFRSKRDVMRYL  486
            AGWV E++TR   S + +K   YI P++G    SKRDV RYL
Sbjct  110  AGWVVEIKTRRGGSKVGQKYKCYIAPITGCRLYSKRDVYRYL  151


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (62%), Gaps = 3/60 (5%)
 Frame = +1

Query  334  AQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCV  513
            A + S D LP GWV +++ R      +KD YYI   +G +FRSK  V+RY+ETG+   C+
Sbjct  2    AAEKSPDWLPDGWVMDVKVRKTG---QKDKYYIHLKTGRKFRSKDGVLRYIETGESHNCM  58



>gb|EEC76836.1| hypothetical protein OsI_14986 [Oryza sativa Indica Group]
Length=247

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 69/167 (41%), Gaps = 41/167 (25%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIs  183
            ++ +WLP GW VE+  R+ G +    YK Y+ P  R + YSK  V  ++     S     
Sbjct  31   RTHEWLPKGWLVEI--RAGGDNMDKMYKFYVYPPHRVRLYSKDDVLLYIKEMKISGFD--  86

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
                                   + Q  TS             T    +A  + +  GLP
Sbjct  87   ----------------------TDGQCNTS-------------TQENILAILEFNPKGLP  111

Query  364  AGWVKELRTR-TCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  501
             GWVKE+  R T   GIR+D +Y DP+  Y FR  R    Y+ETG +
Sbjct  112  QGWVKEVVFRKTNTGGIRRDRHYTDPIKNYVFRIMRSAALYVETGKV  158



>ref|XP_010255467.1| PREDICTED: uncharacterized protein LOC104596134 isoform X1 [Nelumbo 
nucifera]
Length=577

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 83/162 (51%), Gaps = 17/162 (10%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIs  183
            +S DWLP GW +++K R TG  +    K YI   +GRKF SK  V +++ +  + N  + 
Sbjct  5    KSPDWLPDGWVMDVKVRKTGQKD----KYYIHLKTGRKFRSKDGVLRYIETGESHNC-MP  59

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
             + +      SS+ +VP   +  ++   T  + K  M  + P   SP         D LP
Sbjct  60   LQIERQANTCSSDKDVPNTCSSDKDMPNTCSRDKD-MPLEMPMEDSP---------DWLP  109

Query  364  AGWVKELRTRTCPSGI-RKDPYYIDPVSGYEFRSKRDVMRYL  486
            AGWV E++TR   S + +K   YI P++G    SKRDV RYL
Sbjct  110  AGWVVEIKTRRGGSKVGQKYKCYIAPITGCRLYSKRDVYRYL  151


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (62%), Gaps = 3/60 (5%)
 Frame = +1

Query  334  AQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCV  513
            A + S D LP GWV +++ R      +KD YYI   +G +FRSK  V+RY+ETG+   C+
Sbjct  2    AAEKSPDWLPDGWVMDVKVRKTG---QKDKYYIHLKTGRKFRSKDGVLRYIETGESHNCM  58



>gb|EEE60561.1| hypothetical protein OsJ_13923 [Oryza sativa Japonica Group]
Length=325

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 70/167 (42%), Gaps = 41/167 (25%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIs  183
            ++ +WLP GW VE+  R+ G +    YK Y+ P  R + YSK  V  ++     S     
Sbjct  103  RTHEWLPKGWLVEI--RAGGDNMDKMYKFYVYPPHRVRLYSKDDVLLYIKEMKISGFDT-  159

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
                                   + Q  TS             T    +A  + +  GLP
Sbjct  160  -----------------------DGQCNTS-------------TQENILAILEFNPKGLP  183

Query  364  AGWVKELRTR-TCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  501
             GWVKE+  R T   GIR+D +Y DP+  Y FR+ R    Y+ETG +
Sbjct  184  QGWVKEVVFRKTNTGGIRRDRHYTDPIKNYVFRTMRSAALYVETGKV  230



>emb|CAE04540.2| OSJNBa0040D17.8 [Oryza sativa Japonica Group]
Length=377

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/168 (29%), Positives = 72/168 (43%), Gaps = 41/168 (24%)
 Frame = +1

Query  4    NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPI  180
             ++ +WLP GW VE+  R+ G +    YK Y+ P  R + +SK  V  ++     S    
Sbjct  68   TRTHEWLPKGWLVEI--RAGGDNMDKMYKFYVYPPNRVRLFSKDDVLLYIKEMKISGFD-  124

Query  181  snenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGL  360
                                    + Q  TS             T    +A  + + +GL
Sbjct  125  -----------------------TDGQCNTS-------------TQENILAILEFNPEGL  148

Query  361  PAGWVKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  501
            P GWVKE+  R   +G IR+D +Y DP+  Y FR+KR    Y+ETG +
Sbjct  149  PQGWVKEVVFRKTHTGRIRRDRHYTDPIKSYVFRTKRSAAFYVETGKV  196



>emb|CAE01997.2| OSJNBb0033G08.13 [Oryza sativa Japonica Group]
 emb|CAE04535.2| OSJNBa0040D17.1 [Oryza sativa Japonica Group]
Length=336

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 70/167 (42%), Gaps = 41/167 (25%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIs  183
            ++ +WLP GW VE+  R+ G +    YK Y+ P  R + YSK  V  ++     S     
Sbjct  92   RTHEWLPKGWLVEI--RAGGDNMDKMYKFYVYPPHRVRLYSKDDVLLYIKEMKISGFD--  147

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
                                   + Q  TS             T    +A  + +  GLP
Sbjct  148  ----------------------TDGQCNTS-------------TQENILAILEFNPKGLP  172

Query  364  AGWVKELRTR-TCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  501
             GWVKE+  R T   GIR+D +Y DP+  Y FR+ R    Y+ETG +
Sbjct  173  QGWVKEVVFRKTNTGGIRRDRHYTDPIKNYVFRTMRSAALYVETGKV  219



>gb|EAZ29862.1| hypothetical protein OsJ_13921 [Oryza sativa Japonica Group]
Length=411

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/167 (29%), Positives = 72/167 (43%), Gaps = 41/167 (25%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIs  183
            ++ +WLP GW VE+  R+ G +    YK Y+ P  R + +SK  V  ++     S     
Sbjct  103  RTHEWLPKGWLVEI--RAGGDNMDKMYKFYVYPPNRVRLFSKDDVLLYIKEMKISGFD--  158

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
                                   + Q  TS             T    +A  + + +GLP
Sbjct  159  ----------------------TDGQCNTS-------------TQENILAILEFNPEGLP  183

Query  364  AGWVKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  501
             GWVKE+  R   +G IR+D +Y DP+  Y FR+KR    Y+ETG +
Sbjct  184  QGWVKEVVFRKTHTGRIRRDRHYTDPIKSYVFRTKRSAAFYVETGKV  230



>gb|EMT11132.1| hypothetical protein F775_24324 [Aegilops tauschii]
Length=387

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  328  VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  507
            +A  + +  GLP GWVKE+  R    GIRKDPYY DPV+ Y FR+    +RYLETG + K
Sbjct  205  LAEVEFNPFGLPHGWVKEIVYRKTSEGIRKDPYYTDPVNQYVFRTLTSAVRYLETGKVTK  264



>emb|CAH67758.1| H0124E07.5 [Oryza sativa Indica Group]
Length=332

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 72/167 (43%), Gaps = 41/167 (25%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIs  183
            ++ +WLP GW VE+  R+ G +    YK Y+ P  R + +SK  V  ++     S     
Sbjct  92   RTHEWLPKGWLVEI--RAGGDNMDKMYKFYVYPPNRVRLFSKDDVLIYIKEMKISGFDTD  149

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
             +                N   +EN                       +A  + + +GLP
Sbjct  150  GQC---------------NTNTQEN----------------------ILAILEFNPEGLP  172

Query  364  AGWVKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  501
             GWVKE+  R   +G IR+D +Y DP+  Y FR+KR    Y+ETG +
Sbjct  173  QGWVKEVVFRKTNTGKIRRDRHYTDPIKNYVFRTKRSAALYVETGKV  219



>gb|EAZ30036.1| hypothetical protein OsJ_14093 [Oryza sativa Japonica Group]
Length=319

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 79/165 (48%), Gaps = 27/165 (16%)
 Frame = +1

Query  19   WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnenk  195
            WLP GW +E+        +G+ Y+ Y SP SG  F  K++   +  +       +   +K
Sbjct  44   WLPDGWIMEVYQ----GDDGTIYRYYTSPISGLTFTMKSEFYVYPPAG------VRLFSK  93

Query  196  nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWV  375
             ++    +  E+    T  E  +RT        DN         +A  + +   LP GWV
Sbjct  94   EDVLLYINKSEITGFDTNGECDTRTK-------DN--------ILANVEFNPHSLPEGWV  138

Query  376  KELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  507
            KE+  R   +G IRKDPY+ DPV+ Y FR+++  M Y++TG + K
Sbjct  139  KEVVFRKTKTGVIRKDPYFTDPVNNYSFRTRKSAMLYVQTGKVPK  183



>ref|XP_010521336.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010521337.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010521338.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Tarenaya hassleriana]
Length=713

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  SADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPK  525
            +A+GLP GW+KEL  R     +RKDP +IDP SGY F S +D  RY+ TG I     KPK
Sbjct  35   AAEGLPEGWIKELMIRRKARKLRKDPLFIDPKSGYIFLSFKDASRYVRTGVIGNHARKPK  94

Query  526  KRDES  540
            +   S
Sbjct  95   ENSHS  99



>gb|ABO69709.1| MBD3 [Triticum aestivum]
Length=180

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (63%), Gaps = 2/64 (3%)
 Frame = +1

Query  346  SADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
            + +GLP GW+KE R R    G   R+D +YIDP + YEFRS ++   YLE+ D    V+ 
Sbjct  9    AGEGLPDGWLKEYRPRKPRPGSRFRRDKFYIDPTNSYEFRSLKEAHHYLESQDTSDSVVT  68

Query  520  PKKR  531
            PKK+
Sbjct  69   PKKK  72



>gb|EEE60563.1| hypothetical protein OsJ_13925 [Oryza sativa Japonica Group]
Length=337

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/167 (28%), Positives = 71/167 (43%), Gaps = 41/167 (25%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIs  183
            ++ +WLP GW VE+  R+ G +    YK Y+ P  R + +SK  V  ++     S     
Sbjct  103  RTHEWLPKGWLVEI--RAGGDNMDKMYKFYVYPPNRVRLFSKDDVLIYIKEMKISGFDTD  160

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
             +                N   +EN                       +A  + + +GLP
Sbjct  161  GQC---------------NTNTQEN----------------------ILAILEFNPEGLP  183

Query  364  AGWVKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  501
             GWVKE+  R   +G IR+D +Y DP+  Y F +KR    Y+ETG +
Sbjct  184  QGWVKEVVFRKTNTGKIRRDRHYTDPIKNYVFHTKRSAALYVETGKV  230



>ref|NP_001105290.1| LOC542207 [Zea mays]
 gb|AAW56446.1| methyl-binding domain protein MBD113 [Zea mays]
 gb|AFW57949.1| methyl-binding domain MBD113 protein [Zea mays]
Length=292

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +1

Query  328  VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  507
            +A  + + DGLP GWVKE  +R    GIRKD YY DPVS   FR+ + V+ YL TG+I +
Sbjct  20   LAHVEFNPDGLPDGWVKETISRKFNDGIRKDQYYTDPVSHRVFRTLKSVLSYLGTGEISR  79

Query  508  CVIKPKK  528
                P++
Sbjct  80   HSYLPRR  86



>emb|CAE01991.2| OSJNBb0033G08.7 [Oryza sativa Japonica Group]
Length=418

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/167 (28%), Positives = 71/167 (43%), Gaps = 41/167 (25%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIs  183
            ++ +WLP GW VE+  R+ G +    YK Y+ P  R + +SK  V  ++     S     
Sbjct  92   RTHEWLPKGWLVEI--RAGGDNMDKMYKFYVYPPNRVRLFSKDDVLIYIKEMKISGFDTD  149

Query  184  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  363
             +                N   +EN                       +A  + + +GLP
Sbjct  150  GQC---------------NTNTQEN----------------------ILAILEFNPEGLP  172

Query  364  AGWVKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  501
             GWVKE+  R   +G IR+D +Y DP+  Y F +KR    Y+ETG +
Sbjct  173  QGWVKEVVFRKTNTGKIRRDRHYTDPIKNYVFHTKRSAALYVETGKV  219



>ref|XP_010482573.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Camelina sativa]
Length=804

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +1

Query  328  VAAQDISADGLPAGWVKELR-TRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  501
            V  +  +A GLP GW+K+L  T      IR+DP++IDP SGY F+S +D  RY+ETGDI
Sbjct  25   VIVEKSAAKGLPEGWIKKLEITNRSSRKIRRDPFFIDPKSGYIFQSFKDASRYVETGDI  83



>ref|XP_010482572.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Camelina sativa]
Length=808

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +1

Query  328  VAAQDISADGLPAGWVKELR-TRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  501
            V  +  +A GLP GW+K+L  T      IR+DP++IDP SGY F+S +D  RY+ETGDI
Sbjct  25   VIVEKSAAKGLPEGWIKKLEITNRSSRKIRRDPFFIDPKSGYIFQSFKDASRYVETGDI  83



>gb|KFK26832.1| hypothetical protein AALP_AA8G299600 [Arabis alpina]
Length=702

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 3/60 (5%)
 Frame = +1

Query  328  VAAQDISADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  501
            V  +  +A+GLP GW+K+L   T  +G  IR+DP++IDP SGY F+S RD  RY+ETG I
Sbjct  24   VIVEQSAAEGLPEGWIKKLEL-TIRTGRKIRRDPFFIDPKSGYIFQSFRDASRYVETGRI  82



>ref|XP_010444604.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Camelina sativa]
Length=697

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 3/60 (5%)
 Frame = +1

Query  328  VAAQDISADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  501
            V  +  +A GLP GW+K+L   T  SG  IR+DP++IDP SGY F+S +D  RY++TGDI
Sbjct  25   VIVEKSAAKGLPEGWIKKLEI-TNRSGRKIRRDPFFIDPKSGYIFQSFKDASRYVKTGDI  83



>ref|XP_010444597.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Camelina sativa]
Length=701

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 3/60 (5%)
 Frame = +1

Query  328  VAAQDISADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  501
            V  +  +A GLP GW+K+L   T  SG  IR+DP++IDP SGY F+S +D  RY++TGDI
Sbjct  25   VIVEKSAAKGLPEGWIKKLEI-TNRSGRKIRRDPFFIDPKSGYIFQSFKDASRYVKTGDI  83



>ref|XP_007209689.1| hypothetical protein PRUPE_ppa012392mg [Prunus persica]
 gb|EMJ10888.1| hypothetical protein PRUPE_ppa012392mg [Prunus persica]
Length=171

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 35/54 (65%), Gaps = 1/54 (2%)
 Frame = +1

Query  1    TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSA  159
            T +  +WLP GW VE++TR TG H G  YKCYI PS    FYSK +V ++L + 
Sbjct  81   TTEYPEWLPKGWKVEVRTRKTGVHVGKEYKCYIDPSTECSFYSKPEVFRYLKTV  134



>ref|XP_002299872.1| methyl-CpG-binding domain-containing family protein [Populus 
trichocarpa]
 gb|ABK93437.1| unknown [Populus trichocarpa]
 gb|EEE84677.1| methyl-CpG-binding domain-containing family protein [Populus 
trichocarpa]
Length=214

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 3/52 (6%)
 Frame = +1

Query  358  LPAGWVKELRTRT--CPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  507
            LP GWV E R RT    +G R D YYI+PVSG  FRSK+DV  YLETG +KK
Sbjct  74   LPPGWVVEDRVRTSGATAGTR-DKYYIEPVSGRRFRSKKDVQYYLETGTLKK  124


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = +1

Query  19   WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  159
            WLPPGW VE + R++G+  G+  K YI P SGR+F SK  V  +L + 
Sbjct  73   WLPPGWVVEDRVRTSGATAGTRDKYYIEPVSGRRFRSKKDVQYYLETG  120



>gb|EMT08445.1| hypothetical protein F775_07512 [Aegilops tauschii]
Length=247

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 69/170 (41%), Gaps = 40/170 (24%)
 Frame = +1

Query  1    TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYI-SPSGRKFYSKAQVSQFLNSAANSNTP  177
            T  + +WLP GW VE+  R+ G      YK Y+ SP   + +SK  V  +          
Sbjct  90   TPHAHEWLPDGWLVEV--RAGGEKMEKMYKFYLFSPLEVRVFSKEDVLLY----------  137

Query  178  IsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADG  357
                                  T ++   +     +   D+Q        +A  + +  G
Sbjct  138  ----------------------TKEKKIFKCDTDGQCDTDSQ-----DNILATVEFNPHG  170

Query  358  LPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  507
            LP GWVKE+  R     IRKD Y+ DPVS   FRS      Y+ TG++KK
Sbjct  171  LPQGWVKEVVYRKSEERIRKDSYFTDPVSHKVFRSLNYATHYINTGEVKK  220



>dbj|BAJ99501.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=380

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (61%), Gaps = 2/64 (3%)
 Frame = +1

Query  346  SADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
            + + LP GW+ E R R    G  +R+D +YIDP + YEFRS R+V  YLE+ D    V+ 
Sbjct  9    AGEELPDGWLVEYRPRKTRPGSRVRRDKFYIDPTNSYEFRSLREVHHYLESQDTNDSVVT  68

Query  520  PKKR  531
            P KR
Sbjct  69   PNKR  72



>ref|XP_006369524.1| hypothetical protein POPTR_0001s24690g [Populus trichocarpa]
 gb|ERP66093.1| hypothetical protein POPTR_0001s24690g [Populus trichocarpa]
Length=167

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 3/52 (6%)
 Frame = +1

Query  358  LPAGWVKELRTRT--CPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  507
            LP GWV E R RT    +G R D YYI+PVSG  FRSK+DV  YLETG +KK
Sbjct  74   LPPGWVVEDRVRTSGATAGTR-DKYYIEPVSGRRFRSKKDVQYYLETGTLKK  124


 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 1/54 (2%)
 Frame = +1

Query  1    TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  159
            T   + WLPPGW VE + R++G+  G+  K YI P SGR+F SK  V  +L + 
Sbjct  67   TAVDTSWLPPGWVVEDRVRTSGATAGTRDKYYIEPVSGRRFRSKKDVQYYLETG  120



>ref|XP_006369523.1| hypothetical protein POPTR_0001s24690g [Populus trichocarpa]
 gb|ERP66092.1| hypothetical protein POPTR_0001s24690g [Populus trichocarpa]
Length=162

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 3/52 (6%)
 Frame = +1

Query  358  LPAGWVKELRTRT--CPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  507
            LP GWV E R RT    +G R D YYI+PVSG  FRSK+DV  YLETG +KK
Sbjct  74   LPPGWVVEDRVRTSGATAGTR-DKYYIEPVSGRRFRSKKDVQYYLETGTLKK  124


 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = +1

Query  19   WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  159
            WLPPGW VE + R++G+  G+  K YI P SGR+F SK  V  +L + 
Sbjct  73   WLPPGWVVEDRVRTSGATAGTRDKYYIEPVSGRRFRSKKDVQYYLETG  120



>ref|XP_010107428.1| Methyl-CpG-binding domain-containing protein 13 [Morus notabilis]
 gb|EXC15966.1| Methyl-CpG-binding domain-containing protein 13 [Morus notabilis]
Length=574

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +1

Query  328  VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  501
            V  +   A+GLP GW+KE+R R     IRKDP+Y DPVS   FRS + V R+L+T ++
Sbjct  29   VVVEKGEAEGLPPGWIKEIRVRKRGDSIRKDPFYFDPVSKNVFRSLKAVNRHLKTEEL  86



>ref|XP_006279588.1| hypothetical protein CARUB_v10026033mg [Capsella rubella]
 gb|EOA12486.1| hypothetical protein CARUB_v10026033mg [Capsella rubella]
Length=659

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 3/60 (5%)
 Frame = +1

Query  328  VAAQDISADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  501
            V  +  +A GLP GW+K+L   +  SG  +R+DP++IDP SGY F S +D  RY+ETGDI
Sbjct  24   VIVEKSAAKGLPEGWIKKLEI-SNRSGRKLRRDPFFIDPKSGYIFHSFKDASRYVETGDI  82



>ref|XP_006279589.1| hypothetical protein CARUB_v10026033mg [Capsella rubella]
 gb|EOA12487.1| hypothetical protein CARUB_v10026033mg [Capsella rubella]
Length=667

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 3/60 (5%)
 Frame = +1

Query  328  VAAQDISADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  501
            V  +  +A GLP GW+K+L   +  SG  +R+DP++IDP SGY F S +D  RY+ETGDI
Sbjct  24   VIVEKSAAKGLPEGWIKKLEI-SNRSGRKLRRDPFFIDPKSGYIFHSFKDASRYVETGDI  82



>gb|KDP34493.1| hypothetical protein JCGZ_11043 [Jatropha curcas]
Length=237

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 51/87 (59%), Gaps = 8/87 (9%)
 Frame = +1

Query  301  QTPKTVSPAVAAQDISADGLPAGWVKELRTRTC-PSGIRKDPYYIDPVSGYEFRSKRDVM  477
            + P T++P  A    SA  LP GW+ E R RT   +    D YYI+P +G +FRSKR+V 
Sbjct  87   KVPVTMAPGSAE---SASWLPPGWLVEDRVRTSGATAGTVDKYYIEPTTGRKFRSKREVQ  143

Query  478  RYLETGDIKKCVIKPKKRDESASKDIH  558
             YLETG +KK     KK  ES+  D++
Sbjct  144  YYLETGTLKKR----KKGAESSEADVN  166


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  159
            +S+ WLPPGW VE + R++G+  G+  K YI P +GRKF SK +V  +L + 
Sbjct  98   ESASWLPPGWLVEDRVRTSGATAGTVDKYYIEPTTGRKFRSKREVQYYLETG  149



>ref|XP_011042705.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Populus euphratica]
Length=214

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 54/103 (52%), Gaps = 12/103 (12%)
 Frame = +1

Query  229  VPQNQTPKENQSRTSR----KRKSVMDNQTPKTVSPAVAAQ-----DISADGLPAGWVKE  381
            +PQN +     +RT+      R +   NQ P  V+P  A +      I    LP GWV E
Sbjct  24   IPQNGSVINPSTRTTAVENLTRPNNKGNQQP--VTPVRAKRRSSETTIETSWLPPGWVVE  81

Query  382  LRTRTC-PSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  507
             R RT   +    D YYIDP SG +FRSK+DV  YLETG IKK
Sbjct  82   DRIRTSGATAGTVDKYYIDPASGRKFRSKKDVQYYLETGTIKK  124


 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = +1

Query  19   WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  159
            WLPPGW VE + R++G+  G+  K YI P SGRKF SK  V  +L + 
Sbjct  73   WLPPGWVVEDRIRTSGATAGTVDKYYIDPASGRKFRSKKDVQYYLETG  120



>dbj|BAK04695.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=423

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (61%), Gaps = 2/64 (3%)
 Frame = +1

Query  346  SADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK  519
            + + LP GW+ E R R    G  +R+D +YIDP + YEFRS R+V  YLE+ D    V+ 
Sbjct  52   AGEELPDGWLIEYRPRKTRPGSRVRRDKFYIDPTNSYEFRSLREVHHYLESQDTNDSVVT  111

Query  520  PKKR  531
            P KR
Sbjct  112  PNKR  115



>emb|CBI16127.3| unnamed protein product [Vitis vinifera]
Length=135

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 54/93 (58%), Gaps = 10/93 (11%)
 Frame = +1

Query  352  DGLPAGWVKELRTRTC-PSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK  528
            D LP GW+ E R R+   S   +D Y+I+P++G  FRSK++V  YLETG+++K   KPKK
Sbjct  8    DWLPPGWIVEGRVRSSGASAGSRDKYFIEPITGRRFRSKKEVRYYLETGEVRK---KPKK  64

Query  529  RDESA------SKDIHHNIEEVSPNEKSVEDNS  609
              +++      S  ++ N E+V    K V   S
Sbjct  65   NPDNSPEKGTKSPPLNFNFEDVPDTVKWVRTGS  97


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = +1

Query  7    QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTP  177
            +  DWLPPGW VE + RS+G+  GS  K +I P +GR+F SK +V  +L +      P
Sbjct  5    EREDWLPPGWIVEGRVRSSGASAGSRDKYFIEPITGRRFRSKKEVRYYLETGEVRKKP  62



>ref|XP_008674081.1| PREDICTED: uncharacterized protein LOC103650258 [Zea mays]
Length=182

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = +1

Query  340  DISADGLPAGWVKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  501
            D    GLP GWVKEL  R    G I++DPYY DP S Y FR+ +  + +LETG +
Sbjct  63   DFRPSGLPEGWVKELVYRKTKEGLIKRDPYYTDPASFYTFRTLKSALSFLETGKV  117



>ref|XP_010934847.1| PREDICTED: uncharacterized protein LOC105054908 isoform X2 [Elaeis 
guineensis]
Length=654

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 59/220 (27%), Positives = 86/220 (39%), Gaps = 90/220 (41%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnen  192
            +WLP GWT+E++   TG+     Y+ Y SP S   F SK  V ++LN             
Sbjct  8    EWLPDGWTMEVRRGKTGN----IYRYYTSPLSSYTFCSKEAVMRYLN-------------  50

Query  193  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI--SADGLPA  366
                        V  +    E  +R+         +++P+ V      Q +  S   LP 
Sbjct  51   -----------VVKVDGHESELSARSG--------DESPRPV------QQVKNSFKWLPP  85

Query  367  GWVKELRTRTCPSGIRK------DP-----------------------------------  423
            GW+ E+RT+ C S  R+      DP                                   
Sbjct  86   GWLLEIRTQRCGSKARQIYKSYFDPSTRSRFYSKGDVLQFVKSGKIYSPTSDQKRHCESE  145

Query  424  ----YYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKR  531
                YY DPVSGY FR+ +DV RY ETG+I +   +P+K+
Sbjct  146  SPEHYYADPVSGYVFRTLKDVQRYTETGEISRHAFRPRKK  185


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 31/51 (61%), Gaps = 1/51 (2%)
 Frame = +1

Query  10   SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSA  159
            S  WLPPGW +E++T+  GS     YK Y  PS R +FYSK  V QF+ S 
Sbjct  79   SFKWLPPGWLLEIRTQRCGSKARQIYKSYFDPSTRSRFYSKGDVLQFVKSG  129



>ref|XP_003632148.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Vitis vinifera]
Length=297

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 64/115 (56%), Gaps = 19/115 (17%)
 Frame = +1

Query  253  ENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTC-PSGIRKDPYY  429
            E+Q R  RKR S        T S A   ++   D LP GW+ E R R+   S   +D Y+
Sbjct  146  ESQPRRGRKRASEA------TASMASVERE---DWLPPGWIVEGRVRSSGASAGSRDKYF  196

Query  430  IDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESA------SKDIHHNIEEV  576
            I+P++G  FRSK++V  YLETG+++K   KPKK  +++      S  ++ N E+V
Sbjct  197  IEPITGRRFRSKKEVRYYLETGEVRK---KPKKNPDNSPEKGTKSPPLNFNFEDV  248


 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 33/49 (67%), Gaps = 1/49 (2%)
 Frame = +1

Query  16   DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  159
            DWLPPGW VE + RS+G+  GS  K +I P +GR+F SK +V  +L + 
Sbjct  170  DWLPPGWIVEGRVRSSGASAGSRDKYFIEPITGRRFRSKKEVRYYLETG  218



>ref|XP_002466891.1| hypothetical protein SORBIDRAFT_01g015940 [Sorghum bicolor]
 gb|EER93889.1| hypothetical protein SORBIDRAFT_01g015940 [Sorghum bicolor]
Length=219

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +1

Query  328  VAAQDISADGLPAGWVKELRTRTCPSGI-RKDPYYIDPVSGYEFRSKRDVMRYLETG  495
            +A  DI   GLP GWV E+  R    G+ R+DPYY DP S Y FR+ +  + +LETG
Sbjct  107  LAKVDIRPSGLPEGWVNEIVYRKTKEGLTRRDPYYTDPASSYTFRTLKSALSFLETG  163



>ref|XP_002314180.1| methyl-CpG-binding domain-containing family protein [Populus 
trichocarpa]
 gb|EEE88135.1| methyl-CpG-binding domain-containing family protein [Populus 
trichocarpa]
Length=214

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 53/117 (45%), Gaps = 26/117 (22%)
 Frame = +1

Query  229  VPQNQTPKENQSRTSRKRKSVMD------------------NQTPKTVSPAVAAQ-----  339
             P    P  NQ    R+  SV+D                  NQ P  V+P  A +     
Sbjct  10   FPGTDQPVPNQDDALRQNGSVIDPNTRTTAVETLTRPNNKGNQQP--VTPVRAKRRSSET  67

Query  340  DISADGLPAGWVKELRTRTC-PSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  507
             I    LP GWV E R RT   +    D YYIDP SG +FRSK+DV  YLETG +KK
Sbjct  68   TIETSWLPPGWVVEDRIRTSGATAGTVDKYYIDPASGRKFRSKKDVQYYLETGTLKK  124


 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = +1

Query  19   WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  159
            WLPPGW VE + R++G+  G+  K YI P SGRKF SK  V  +L + 
Sbjct  73   WLPPGWVVEDRIRTSGATAGTVDKYYIDPASGRKFRSKKDVQYYLETG  120



>emb|CBI34714.3| unnamed protein product [Vitis vinifera]
Length=936

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  406  GIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  507
            GIR+DPYY DPVSGY FRS++DV RYL+TG+I +
Sbjct  5    GIRRDPYYTDPVSGYVFRSRKDVFRYLKTGEISR  38



>gb|KHN35006.1| hypothetical protein glysoja_004772 [Glycine soja]
Length=188

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 72/169 (43%), Gaps = 39/169 (23%)
 Frame = +1

Query  1    TNQSSDWLPPGWTVELKTRSTGSHNG----------------------------STYKCY  96
            +N+  +WLP  W V+ +TR +G++ G                                CY
Sbjct  28   SNEHPEWLPDDWNVDFRTRKSGANMGHGQSKGPLAKCSILRLFMAGTSQGHPQICIEYCY  87

Query  97   ISPSGRKFYSKAQVSQFLNSA-ANSNTPIsnenknnieesssnleVPQNQTPKENQSRTS  273
            I+PSG KFYSK +V ++L++   NSN+  S + K      +      ++  P   Q +  
Sbjct  88   IAPSGHKFYSKPEVLRYLDTVNINSNSHTSKKEKICKSNDTVEKSTIEDLPP--GQIKEV  145

Query  274  RKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKD  420
            + RK   DN+     SP         + LP GW+ E + R   +G RKD
Sbjct  146  KIRKGSNDNRDVVEKSP--------VEDLPPGWITEAKVRKGDTGNRKD  186



>ref|XP_010693525.1| PREDICTED: uncharacterized protein LOC104906467 [Beta vulgaris 
subsp. vulgaris]
Length=308

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 55/95 (58%), Gaps = 5/95 (5%)
 Frame = +1

Query  328  VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  507
            +  Q  S + LP GW  E+R R   SG +KD YY DPV+GY FRS +D+ RYL +G + K
Sbjct  1    MGEQIRSEEWLPEGWKIEIRVRK--SG-KKDRYYTDPVNGYIFRSLKDIDRYLLSGKLGK  57

Query  508  CVI--KPKKRDESASKDIHHNIEEVSPNEKSVEDN  606
             V   KPK  D  +++ I     +V   +KS++ N
Sbjct  58   HVTKNKPKGLDSDSTEMISIQHTDVPKKKKSIKSN  92



>ref|XP_010685830.1| PREDICTED: methyl-CpG-binding domain-containing protein 7 [Beta 
vulgaris subsp. vulgaris]
Length=308

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 71/172 (41%), Gaps = 40/172 (23%)
 Frame = +1

Query  22   LPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnenkn  198
            LP  W VE++ R   S    + K Y  P SGR+F S   V ++L+   +   P       
Sbjct  52   LPEDWVVEVRPRGPNSSLKISDKYYYEPGSGRQFRSLISVKRYLSGEEHIEIP-------  104

Query  199  nieesssnleVPQNQ-TPKENQSRTSR---------------KRKSVMDNQTPKTVSPAV  330
                     + P N   P +N     R                R+  +D+  P+T+ P  
Sbjct  105  --------RKKPSNSLVPYQNSGSFRRIAYGGKILRPDELEEARQGDLDDIYPETIQPK-  155

Query  331  AAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYL  486
                 SA  LP GW+ E   R C  G R D YYI+P +G  FRS  +V RYL
Sbjct  156  -----SASILPDGWIVEEIPRRC--GFRSDRYYIEPGTGQRFRSVPEVQRYL  200



>ref|XP_010264450.1| PREDICTED: uncharacterized protein LOC104602459 isoform X1 [Nelumbo 
nucifera]
Length=304

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 48/73 (66%), Gaps = 4/73 (5%)
 Frame = +1

Query  331  AAQDISADGLPAGWVKELRTRT--CPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIK  504
            A+QD+  D LP GW  E R R+    +G+R D Y+ DPVSG +FRSKR+V+ +LETG   
Sbjct  153  ASQDLP-DWLPPGWRMESRVRSSGVTAGMR-DRYFYDPVSGRQFRSKREVLCFLETGMSG  210

Query  505  KCVIKPKKRDESA  543
            +   K KK+D +A
Sbjct  211  RQRAKSKKKDTNA  223



>ref|XP_010264451.1| PREDICTED: uncharacterized protein LOC104602459 isoform X2 [Nelumbo 
nucifera]
Length=303

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 48/73 (66%), Gaps = 4/73 (5%)
 Frame = +1

Query  331  AAQDISADGLPAGWVKELRTRT--CPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIK  504
            A+QD+  D LP GW  E R R+    +G+R D Y+ DPVSG +FRSKR+V+ +LETG   
Sbjct  153  ASQDLP-DWLPPGWRMESRVRSSGVTAGMR-DRYFYDPVSGRQFRSKREVLCFLETGMSG  210

Query  505  KCVIKPKKRDESA  543
            +   K KK+D +A
Sbjct  211  RQRAKSKKKDTNA  223



>ref|XP_006401848.1| hypothetical protein EUTSA_v10012954mg [Eutrema salsugineum]
 gb|ESQ43301.1| hypothetical protein EUTSA_v10012954mg [Eutrema salsugineum]
Length=633

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +1

Query  328  VAAQDISADGLPAGWVKELRTRTCPS-GIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIK  504
            V  +  +A+GLP GW+K+L     P    R+DP++IDP S Y F+S +D  RY ETGD+ 
Sbjct  29   VIVEKSTAEGLPEGWIKKLVISNRPGRKSRRDPFFIDPKSEYIFQSFKDASRYAETGDLG  88

Query  505  KCVIKPKKRD  534
                K K+ D
Sbjct  89   NYARKLKESD  98



>ref|XP_011015295.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like, 
partial [Populus euphratica]
Length=182

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 35/52 (67%), Gaps = 3/52 (6%)
 Frame = +1

Query  358  LPAGWVKELRTRT--CPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  507
            LP GW+ E R R+    +G R D YY +PVSG  FRSK+DV  YLETG +KK
Sbjct  62   LPPGWIVEDRVRSSGATAGTR-DKYYFEPVSGRRFRSKKDVQYYLETGTLKK  112


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 30/48 (63%), Gaps = 1/48 (2%)
 Frame = +1

Query  19   WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  159
            WLPPGW VE + RS+G+  G+  K Y  P SGR+F SK  V  +L + 
Sbjct  61   WLPPGWIVEDRVRSSGATAGTRDKYYFEPVSGRRFRSKKDVQYYLETG  108



>emb|CDY31911.1| BnaC09g28330D [Brassica napus]
Length=617

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = +1

Query  328  VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  507
            V  +  +A+GLP GW+K+L         R+DP++IDP S Y F S R   RY+ETGDI  
Sbjct  27   VIVEKSAAEGLPEGWIKKLVISNRSGRKRRDPFFIDPQSEYIFPSFRAASRYVETGDIGH  86

Query  508  CVIKPKKRD  534
               K K+ D
Sbjct  87   YARKFKESD  95



>ref|XP_009106826.1| PREDICTED: LOW QUALITY PROTEIN: methyl-CpG-binding domain-containing 
protein 13 [Brassica rapa]
Length=628

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = +1

Query  328  VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  507
            V  +  +A+GLP GW+K+L         R+DP++IDP S Y F S R   RY+ETGDI  
Sbjct  27   VIVEKSAAEGLPEGWIKKLVISNRSGRKRRDPFFIDPQSEYIFPSFRAASRYVETGDIGH  86

Query  508  CVIKPKKRD  534
               K K+ D
Sbjct  87   YARKFKESD  95



>ref|XP_006846186.1| hypothetical protein AMTR_s00012p00212320 [Amborella trichopoda]
 gb|ERN07861.1| hypothetical protein AMTR_s00012p00212320 [Amborella trichopoda]
Length=425

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 45/71 (63%), Gaps = 9/71 (13%)
 Frame = +1

Query  334  AQDISA----DGLPAGWVKELRTRTCPSGIR---KDPYYIDPVSGYEFRSKRDVMRYLET  492
            A D+SA    D LPAGW+ E++ R   +G+    KD Y+ DPVS  +FRSK++V  +LET
Sbjct  116  ANDLSAVSSPDWLPAGWITEIKVRA--NGLTAGTKDKYFYDPVSKRKFRSKKEVFSFLET  173

Query  493  GDIKKCVIKPK  525
            G + +   KPK
Sbjct  174  GKLGRYKPKPK  184



>gb|AAM97069.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15545.1| unknown protein [Arabidopsis thaliana]
Length=746

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 40/60 (67%), Gaps = 3/60 (5%)
 Frame = +1

Query  328  VAAQDISADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  501
            V  +  +A GLP GW+K+L   T  SG   R+DP++IDP S Y F+S +D  RY+ETG+I
Sbjct  29   VIVEKSAAQGLPEGWIKKLEI-TNRSGRKTRRDPFFIDPKSEYIFQSFKDASRYVETGNI  87



>ref|NP_200036.1| methyl-CPG-binding domain protein 13 [Arabidopsis thaliana]
 ref|NP_001190520.1| methyl-CPG-binding domain protein 13 [Arabidopsis thaliana]
 sp|Q9LTJ8.1|MBD13_ARATH RecName: Full=Methyl-CpG-binding domain-containing protein 13; 
Short=AtMBD13; Short=MBD13; AltName: Full=Methyl-CpG-binding 
protein MBD13 [Arabidopsis thaliana]
 dbj|BAA97466.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96188.1| methyl-CPG-binding domain protein 13 [Arabidopsis thaliana]
 gb|AED96189.1| methyl-CPG-binding domain protein 13 [Arabidopsis thaliana]
Length=746

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 40/60 (67%), Gaps = 3/60 (5%)
 Frame = +1

Query  328  VAAQDISADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  501
            V  +  +A GLP GW+K+L   T  SG   R+DP++IDP S Y F+S +D  RY+ETG+I
Sbjct  29   VIVEKSAAQGLPEGWIKKLEI-TNRSGRKTRRDPFFIDPKSEYIFQSFKDASRYVETGNI  87



>ref|XP_006418884.1| hypothetical protein EUTSA_v10002683mg [Eutrema salsugineum]
 gb|ESQ37320.1| hypothetical protein EUTSA_v10002683mg [Eutrema salsugineum]
Length=184

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 45/78 (58%), Gaps = 3/78 (4%)
 Frame = +1

Query  307  PKTVSPAVAAQDISADGLPAGWVKELRTRT--CPSGIRKDPYYIDPVSGYEFRSKRDVMR  480
            P   +P   A    ++ LP+GW  E R RT    +GI  D +Y +PV+G +FRSK++VM 
Sbjct  18   PAVSTPRKRASPGDSNWLPSGWTTEDRVRTSGTKAGIV-DKFYYEPVTGRKFRSKKEVMY  76

Query  481  YLETGDIKKCVIKPKKRD  534
            YLE G  KK + K K  D
Sbjct  77   YLEHGTPKKTIKKAKNGD  94



>ref|XP_002865903.1| hypothetical protein ARALYDRAFT_495292 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42162.1| hypothetical protein ARALYDRAFT_495292 [Arabidopsis lyrata subsp. 
lyrata]
Length=680

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 44/71 (62%), Gaps = 3/71 (4%)
 Frame = +1

Query  328  VAAQDISADGLPAGWVKELRTRTCPSGI--RKDPYYIDPVSGYEFRSKRDVMRYLETGDI  501
            V  +  +A GLP GW+K+L   T  SG   R+DP++IDP S Y F+S +D  RY+ETG++
Sbjct  31   VIVEKSAAQGLPEGWIKKLEI-TSRSGRKNRRDPFFIDPKSEYIFQSFKDASRYVETGNV  89

Query  502  KKCVIKPKKRD  534
                 K K+ D
Sbjct  90   GHYARKLKESD  100



>ref|XP_010089149.1| hypothetical protein L484_024324 [Morus notabilis]
 gb|EXB37396.1| hypothetical protein L484_024324 [Morus notabilis]
Length=676

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  424  YYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESASKDIHHNI  567
            +Y DPVSGY FRSKRD +RY+ETG+I +  I+PK+   +A + +   I
Sbjct  5    FYKDPVSGYVFRSKRDALRYIETGEISRSAIRPKESGSNAPELVKDEI  52



Lambda      K        H        a         alpha
   0.309    0.125    0.366    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660