BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS017E08

Length=641
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009764792.1|  PREDICTED: uncharacterized protein LOC104216...    244   7e-71   Nicotiana sylvestris
ref|XP_009764791.1|  PREDICTED: uncharacterized protein LOC104216...    244   8e-71   Nicotiana sylvestris
ref|XP_009764793.1|  PREDICTED: uncharacterized protein LOC104216...    244   1e-70   Nicotiana sylvestris
ref|XP_011097014.1|  PREDICTED: uncharacterized protein LOC105176035    241   9e-70   
ref|XP_009616231.1|  PREDICTED: uncharacterized protein LOC104108...    239   5e-69   Nicotiana tomentosiformis
ref|XP_009616230.1|  PREDICTED: uncharacterized protein LOC104108...    239   5e-69   Nicotiana tomentosiformis
ref|XP_009616232.1|  PREDICTED: uncharacterized protein LOC104108...    239   5e-69   Nicotiana tomentosiformis
gb|EYU33022.1|  hypothetical protein MIMGU_mgv1a000375mg                239   6e-69   Erythranthe guttata [common monkey flower]
ref|XP_006341624.1|  PREDICTED: uncharacterized protein LOC102599875    234   3e-67   Solanum tuberosum [potatoes]
ref|XP_003532497.1|  PREDICTED: uncharacterized protein LOC100818...    232   2e-66   Glycine max [soybeans]
ref|XP_007036482.1|  Stomatal cytokinesis defective / SCD1 protei...    231   3e-66   
ref|XP_010318604.1|  PREDICTED: uncharacterized protein LOC101262...    231   3e-66   Solanum lycopersicum
ref|XP_010318603.1|  PREDICTED: uncharacterized protein LOC101262...    231   3e-66   Solanum lycopersicum
ref|XP_002322040.1|  STOMATAL CYTOKINESIS-DEFECTIVE 1 family protein    229   2e-65   
ref|XP_004512863.1|  PREDICTED: uncharacterized protein LOC101507...    229   3e-65   Cicer arietinum [garbanzo]
ref|XP_004512862.1|  PREDICTED: uncharacterized protein LOC101507...    229   3e-65   Cicer arietinum [garbanzo]
ref|XP_010094783.1|  hypothetical protein L484_019994                   221   3e-65   
ref|XP_003634188.1|  PREDICTED: uncharacterized protein LOC100254...    228   4e-65   Vitis vinifera
gb|AIG51125.1|  stomatal cytokinesis defective 1                        228   5e-65   Gossypium hirsutum [American cotton]
ref|XP_011011805.1|  PREDICTED: uncharacterized protein LOC105116...    228   6e-65   Populus euphratica
ref|XP_011011807.1|  PREDICTED: uncharacterized protein LOC105116...    228   6e-65   Populus euphratica
ref|XP_011011804.1|  PREDICTED: uncharacterized protein LOC105116...    228   6e-65   Populus euphratica
emb|CBI15432.3|  unnamed protein product                                228   6e-65   Vitis vinifera
emb|CAN64735.1|  hypothetical protein VITISV_022618                     216   8e-65   Vitis vinifera
ref|XP_006485772.1|  PREDICTED: uncharacterized protein LOC102621...    228   8e-65   Citrus sinensis [apfelsine]
ref|XP_006440944.1|  hypothetical protein CICLE_v10018557mg             226   2e-64   Citrus clementina [clementine]
gb|KJB37240.1|  hypothetical protein B456_006G195200                    226   2e-64   Gossypium raimondii
gb|KJB37239.1|  hypothetical protein B456_006G195200                    226   2e-64   Gossypium raimondii
gb|KDP20097.1|  hypothetical protein JCGZ_05866                         226   3e-64   Jatropha curcas
gb|KJB37238.1|  hypothetical protein B456_006G195200                    225   3e-64   Gossypium raimondii
gb|KJB37237.1|  hypothetical protein B456_006G195200                    226   4e-64   Gossypium raimondii
gb|AGG55718.1|  stomatal cytokinesis defective 1                        225   6e-64   Gossypium arboreum [tree cotton]
ref|XP_002511967.1|  F-box and wd40 domain protein, putative            225   7e-64   
ref|XP_011072936.1|  PREDICTED: uncharacterized protein LOC105158031    224   9e-64   Sesamum indicum [beniseed]
emb|CDO98446.1|  unnamed protein product                                224   1e-63   Coffea canephora [robusta coffee]
gb|EPS64327.1|  hypothetical protein M569_10454                         222   1e-63   Genlisea aurea
ref|XP_011009995.1|  PREDICTED: uncharacterized protein LOC105114...    223   2e-63   Populus euphratica
ref|XP_007036483.1|  Stomatal cytokinesis defective / SCD1 protei...    221   4e-63   
ref|XP_008457689.1|  PREDICTED: uncharacterized protein LOC103497299    222   6e-63   Cucumis melo [Oriental melon]
ref|XP_010265189.1|  PREDICTED: uncharacterized protein LOC104602...    221   1e-62   Nelumbo nucifera [Indian lotus]
ref|XP_010265188.1|  PREDICTED: uncharacterized protein LOC104602...    221   2e-62   Nelumbo nucifera [Indian lotus]
ref|XP_004137469.1|  PREDICTED: uncharacterized protein LOC101212131    221   2e-62   
gb|KGN64112.1|  hypothetical protein Csa_1G042240                       221   2e-62   Cucumis sativus [cucumbers]
gb|KDO41981.1|  hypothetical protein CISIN_1g0010392mg                  215   2e-62   Citrus sinensis [apfelsine]
ref|XP_010943311.1|  PREDICTED: uncharacterized protein LOC105061...    220   3e-62   Elaeis guineensis
ref|XP_010943385.1|  PREDICTED: uncharacterized protein LOC105061...    220   3e-62   
ref|XP_009383583.1|  PREDICTED: uncharacterized protein LOC103971285    219   1e-61   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH21369.1|  stomatal cytokinesis defective protein, putative        217   3e-61   Medicago truncatula
gb|KJB37236.1|  hypothetical protein B456_006G195200                    215   4e-61   Gossypium raimondii
ref|XP_008797770.1|  PREDICTED: uncharacterized protein LOC103712...    217   6e-61   
ref|XP_008797769.1|  PREDICTED: uncharacterized protein LOC103712...    217   6e-61   Phoenix dactylifera
ref|XP_007160364.1|  hypothetical protein PHAVU_002G3153000g            213   8e-61   Phaseolus vulgaris [French bean]
ref|XP_011465682.1|  PREDICTED: DENN domain and WD repeat-contain...    216   1e-60   Fragaria vesca subsp. vesca
ref|XP_002317936.2|  STOMATAL CYTOKINESIS-DEFECTIVE 1 family protein    216   1e-60   
ref|XP_009337275.1|  PREDICTED: myotubularin-related protein 13-like    215   3e-60   Pyrus x bretschneideri [bai li]
ref|XP_009337189.1|  PREDICTED: myotubularin-related protein 13-like    215   3e-60   Pyrus x bretschneideri [bai li]
ref|XP_008244008.1|  PREDICTED: uncharacterized protein LOC103342...    214   4e-60   Prunus mume [ume]
ref|XP_008244009.1|  PREDICTED: uncharacterized protein LOC103342...    214   4e-60   Prunus mume [ume]
ref|XP_010031872.1|  PREDICTED: uncharacterized protein LOC104421573    214   4e-60   Eucalyptus grandis [rose gum]
ref|XP_007210443.1|  hypothetical protein PRUPE_ppa000437m1g            213   5e-60   
ref|XP_008393296.1|  PREDICTED: uncharacterized protein LOC103455486    212   3e-59   
ref|XP_010549132.1|  PREDICTED: uncharacterized protein LOC104820400    211   4e-59   Tarenaya hassleriana [spider flower]
ref|XP_009346964.1|  PREDICTED: LOW QUALITY PROTEIN: myotubularin...    209   4e-58   
ref|XP_010677974.1|  PREDICTED: uncharacterized protein LOC104893555    207   1e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006837773.1|  hypothetical protein AMTR_s00104p00054580          207   1e-57   
gb|EEE54850.1|  hypothetical protein OsJ_02315                          205   8e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008672456.1|  PREDICTED: uncharacterized protein LOC100273...    205   8e-57   Zea mays [maize]
ref|XP_008672455.1|  PREDICTED: uncharacterized protein LOC100273...    205   8e-57   
ref|NP_001043390.1|  Os01g0575500                                       205   1e-56   
ref|XP_004969033.1|  PREDICTED: uncharacterized protein LOC101781233    202   9e-56   Setaria italica
ref|XP_010479332.1|  PREDICTED: myotubularin-related protein 13-like    201   1e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010461711.1|  PREDICTED: myotubularin-related protein 13-l...    201   2e-55   
ref|XP_010500445.1|  PREDICTED: myotubularin-related protein 13-like    201   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_002894154.1|  stomatal cytokinesis-defective 1                   201   2e-55   
ref|XP_010231941.1|  PREDICTED: uncharacterized protein LOC100845189    200   3e-55   Brachypodium distachyon [annual false brome]
ref|NP_850959.1|  protein STOMATAL CYTOKINESIS-DEFECTIVE 1              199   6e-55   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185177.1|  protein STOMATAL CYTOKINESIS-DEFECTIVE 1           199   6e-55   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA58649.1|  TPA: hypothetical protein ZEAMMB73_444537              195   2e-54   
ref|XP_006306610.1|  hypothetical protein CARUB_v10008124mg             197   3e-54   Capsella rubella
ref|XP_006393316.1|  hypothetical protein EUTSA_v10011186mg             196   9e-54   
emb|CDY48854.1|  BnaA06g03280D                                          179   3e-53   Brassica napus [oilseed rape]
emb|CDY48589.1|  BnaCnng16480D                                          194   3e-53   Brassica napus [oilseed rape]
emb|CDM83276.1|  unnamed protein product                                194   4e-53   Triticum aestivum [Canadian hard winter wheat]
gb|KFK36043.1|  hypothetical protein AALP_AA4G070500                    194   4e-53   Arabis alpina [alpine rockcress]
ref|NP_175333.3|  protein STOMATAL CYTOKINESIS-DEFECTIVE 1              191   1e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009147917.1|  PREDICTED: myotubularin-related protein 13 i...    192   2e-52   Brassica rapa
ref|XP_006646026.1|  PREDICTED: uncharacterized protein LOC102710652    191   8e-52   
gb|EEC70939.1|  hypothetical protein OsI_02530                          187   2e-50   Oryza sativa Indica Group [Indian rice]
ref|XP_009147918.1|  PREDICTED: DENN domain-containing protein 4B...    184   7e-50   Brassica rapa
gb|AAF69702.1|AC016041_7  F27J15.16                                     178   1e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002989051.1|  hypothetical protein SELMODRAFT_129087             176   1e-46   
ref|XP_002983722.1|  hypothetical protein SELMODRAFT_118822             175   2e-46   
ref|XP_010677977.1|  PREDICTED: myotubularin-related protein 13-l...    165   9e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010677976.1|  PREDICTED: uncharacterized protein LOC104893...    165   1e-42   Beta vulgaris subsp. vulgaris [field beet]
gb|EMT33100.1|  hypothetical protein F775_01878                         150   9e-41   
ref|XP_008349874.1|  PREDICTED: uncharacterized protein LOC103413159    145   1e-40   
ref|XP_010677975.1|  PREDICTED: uncharacterized protein LOC104893...    154   6e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001752748.1|  predicted protein                                  146   3e-36   
ref|XP_011470710.1|  PREDICTED: DENN domain and WD repeat-contain...    129   2e-31   Fragaria vesca subsp. vesca
ref|XP_008351915.1|  PREDICTED: uncharacterized protein LOC103415353    104   7e-25   
ref|XP_008356651.1|  PREDICTED: uncharacterized protein LOC103420...    105   1e-24   
emb|CDX98751.1|  BnaA03g45360D                                          107   2e-24   
ref|XP_008356653.1|  PREDICTED: uncharacterized protein LOC103420...    103   2e-24   
gb|EMS55158.1|  hypothetical protein TRIUR3_14216                       107   4e-24   Triticum urartu
emb|CDY72592.1|  BnaAnng41570D                                        87.4    2e-17   Brassica napus [oilseed rape]
gb|KIY96716.1|  hypothetical protein MNEG_11246                       78.2    6e-14   Monoraphidium neglectum
emb|CDY28853.1|  BnaC06g26410D                                        76.6    4e-13   Brassica napus [oilseed rape]
ref|XP_002507362.1|  predicted protein                                66.2    4e-09   Micromonas commoda
ref|XP_001415729.1|  predicted protein                                50.1    8e-04   Ostreococcus lucimarinus CCE9901



>ref|XP_009764792.1| PREDICTED: uncharacterized protein LOC104216452 isoform X2 [Nicotiana 
sylvestris]
Length=1213

 Score =   244 bits (624),  Expect = 7e-71, Method: Composition-based stats.
 Identities = 125/140 (89%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFEYFVVCGIGPEIRTL+G RGY+G+G+MYL SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNRGYHGSGVMYLPSLLDQYPPSNHTLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEFY SGFDSN+PSTFP+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN
Sbjct  61   LPAGVEFYGSGFDSNDPSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            S+ADKCICLVSRSPSF ILR
Sbjct  121  SYADKCICLVSRSPSFGILR  140



>ref|XP_009764791.1| PREDICTED: uncharacterized protein LOC104216452 isoform X1 [Nicotiana 
sylvestris]
Length=1215

 Score =   244 bits (623),  Expect = 8e-71, Method: Composition-based stats.
 Identities = 125/140 (89%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFEYFVVCGIGPEIRTL+G RGY+G+G+MYL SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNRGYHGSGVMYLPSLLDQYPPSNHTLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEFY SGFDSN+PSTFP+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN
Sbjct  61   LPAGVEFYGSGFDSNDPSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            S+ADKCICLVSRSPSF ILR
Sbjct  121  SYADKCICLVSRSPSFGILR  140



>ref|XP_009764793.1| PREDICTED: uncharacterized protein LOC104216452 isoform X3 [Nicotiana 
sylvestris]
Length=1205

 Score =   244 bits (622),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 125/140 (89%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFEYFVVCGIGPEIRTL+G RGY+G+G+MYL SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNRGYHGSGVMYLPSLLDQYPPSNHTLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEFY SGFDSN+PSTFP+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN
Sbjct  61   LPAGVEFYGSGFDSNDPSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            S+ADKCICLVSRSPSF ILR
Sbjct  121  SYADKCICLVSRSPSFGILR  140



>ref|XP_011097014.1| PREDICTED: uncharacterized protein LOC105176035 [Sesamum indicum]
Length=1205

 Score =   241 bits (616),  Expect = 9e-70, Method: Composition-based stats.
 Identities = 123/140 (88%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFEYFVVCGIGPEIRTL+G RGY+GTGIMYL SLLDQYP  NHSLYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNRGYHGTGIMYLPSLLDQYPSSNHSLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGV+FY SGFDS++PS+FP+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN
Sbjct  61   LPAGVQFYASGFDSSDPSSFPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCICL+SR+PSF ILR
Sbjct  121  SFADKCICLISRAPSFSILR  140



>ref|XP_009616231.1| PREDICTED: uncharacterized protein LOC104108811 isoform X2 [Nicotiana 
tomentosiformis]
Length=1213

 Score =   239 bits (610),  Expect = 5e-69, Method: Composition-based stats.
 Identities = 124/140 (89%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFEYFVVCGIGPEIRTL+G RGY+G+G MYL SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNRGYHGSGTMYLPSLLDQYPPSNHTLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEFY SGFDS +PSTFP+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN
Sbjct  61   LPAGVEFYGSGFDSYDPSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            S+ADKCICLVSRSPSF ILR
Sbjct  121  SYADKCICLVSRSPSFGILR  140



>ref|XP_009616230.1| PREDICTED: uncharacterized protein LOC104108811 isoform X1 [Nicotiana 
tomentosiformis]
Length=1215

 Score =   239 bits (610),  Expect = 5e-69, Method: Composition-based stats.
 Identities = 124/140 (89%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFEYFVVCGIGPEIRTL+G RGY+G+G MYL SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNRGYHGSGTMYLPSLLDQYPPSNHTLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEFY SGFDS +PSTFP+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN
Sbjct  61   LPAGVEFYGSGFDSYDPSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            S+ADKCICLVSRSPSF ILR
Sbjct  121  SYADKCICLVSRSPSFGILR  140



>ref|XP_009616232.1| PREDICTED: uncharacterized protein LOC104108811 isoform X3 [Nicotiana 
tomentosiformis]
Length=1205

 Score =   239 bits (610),  Expect = 5e-69, Method: Composition-based stats.
 Identities = 124/140 (89%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFEYFVVCGIGPEIRTL+G RGY+G+G MYL SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNRGYHGSGTMYLPSLLDQYPPSNHTLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEFY SGFDS +PSTFP+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN
Sbjct  61   LPAGVEFYGSGFDSYDPSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            S+ADKCICLVSRSPSF ILR
Sbjct  121  SYADKCICLVSRSPSFGILR  140



>gb|EYU33022.1| hypothetical protein MIMGU_mgv1a000375mg [Erythranthe guttata]
Length=1207

 Score =   239 bits (610),  Expect = 6e-69, Method: Composition-based stats.
 Identities = 122/140 (87%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFEYFVVCGIGPEIRTL+G RG++GTGIMYL+SLLDQYP LNH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNRGFHGTGIMYLSSLLDQYPSLNHTLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGV+FY SGFDS +PS+FP+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN
Sbjct  61   LPAGVQFYASGFDSTDPSSFPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCIC VSR+PSF ILR
Sbjct  121  SFADKCICFVSRAPSFGILR  140



>ref|XP_006341624.1| PREDICTED: uncharacterized protein LOC102599875 [Solanum tuberosum]
Length=1215

 Score =   234 bits (597),  Expect = 3e-67, Method: Composition-based stats.
 Identities = 119/140 (85%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFEYFVVCGIG EIRTL+G RGY+G G+MY+ +LLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGTEIRTLDGNRGYHGAGVMYMPALLDQYPPSNHTLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEFY SGFDSN+PST P+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIP N
Sbjct  61   LPAGVEFYGSGFDSNDPSTLPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPVN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            S+ADKCIC+VSRSPSF+ILR
Sbjct  121  SYADKCICIVSRSPSFQILR  140



>ref|XP_003532497.1| PREDICTED: uncharacterized protein LOC100818305 isoform X1 [Glycine 
max]
 gb|KHN16584.1| DENN domain-containing protein 5B [Glycine soja]
Length=1208

 Score =   232 bits (592),  Expect = 2e-66, Method: Composition-based stats.
 Identities = 116/140 (83%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            M+ IFEYFVVCGIGPEIRT++G +GY+GTG +YL SLLDQYPP NH+LYP PPPQLSTCV
Sbjct  1    MSRIFEYFVVCGIGPEIRTMDGNKGYHGTGCLYLPSLLDQYPPPNHTLYPSPPPQLSTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEFY SGFDSN+P++FP+SYPIVLTEGDGSKIYVSCI+FRDPVCEDIAEAYRI AN
Sbjct  61   LPAGVEFYSSGFDSNDPASFPRSYPIVLTEGDGSKIYVSCISFRDPVCEDIAEAYRIQAN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            S+ADKCICLVSR PSFR+L+
Sbjct  121  SYADKCICLVSRLPSFRVLK  140



>ref|XP_007036482.1| Stomatal cytokinesis defective / SCD1 protein (SCD1) isoform 
1 [Theobroma cacao]
 gb|EOY20983.1| Stomatal cytokinesis defective / SCD1 protein (SCD1) isoform 
1 [Theobroma cacao]
Length=1201

 Score =   231 bits (590),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 121/140 (86%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFEYFVVCG+GPEIRTL+G +GY+GT  MYL SLLDQYPP NHSLYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGLGPEIRTLDGTKGYHGTEYMYLPSLLDQYPPPNHSLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEFY SGFDSN+PST+P+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAYRIP N
Sbjct  61   LPAGVEFYSSGFDSNDPSTYPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYRIPTN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCICLVSRSP FR+LR
Sbjct  121  SFADKCICLVSRSPCFRVLR  140



>ref|XP_010318604.1| PREDICTED: uncharacterized protein LOC101262196 isoform X2 [Solanum 
lycopersicum]
Length=1212

 Score =   231 bits (590),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 119/140 (85%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFEYFVVCGIG EIRTL+G RGY+G G+MY+ +LLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGTEIRTLDGNRGYHGAGVMYMPALLDQYPPSNHTLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEFY SGFDSN+PST P+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY IP N
Sbjct  61   LPAGVEFYGSGFDSNDPSTLPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYCIPVN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            S+ADKCICLVSRSPSF+ILR
Sbjct  121  SYADKCICLVSRSPSFQILR  140



>ref|XP_010318603.1| PREDICTED: uncharacterized protein LOC101262196 isoform X1 [Solanum 
lycopersicum]
Length=1215

 Score =   231 bits (590),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 119/140 (85%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFEYFVVCGIG EIRTL+G RGY+G G+MY+ +LLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGTEIRTLDGNRGYHGAGVMYMPALLDQYPPSNHTLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEFY SGFDSN+PST P+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY IP N
Sbjct  61   LPAGVEFYGSGFDSNDPSTLPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYCIPVN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            S+ADKCICLVSRSPSF+ILR
Sbjct  121  SYADKCICLVSRSPSFQILR  140



>ref|XP_002322040.1| STOMATAL CYTOKINESIS-DEFECTIVE 1 family protein [Populus trichocarpa]
 gb|EEF06167.1| STOMATAL CYTOKINESIS-DEFECTIVE 1 family protein [Populus trichocarpa]
Length=1197

 Score =   229 bits (585),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 118/140 (84%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MAGIFEYFVVCG+GPE+RT++G +GY+G  ++YL SLLDQYPP NHSLYPPPPPQL TCV
Sbjct  1    MAGIFEYFVVCGLGPEMRTMDGNKGYHGMRVLYLPSLLDQYPPDNHSLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEFYPSG D+N+ STFPKSYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAYRIP N
Sbjct  61   LPAGVEFYPSGLDANDSSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYRIPPN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCICLVSRSPSF +LR
Sbjct  121  SFADKCICLVSRSPSFGVLR  140



>ref|XP_004512863.1| PREDICTED: uncharacterized protein LOC101507359 isoform X2 [Cicer 
arietinum]
Length=1210

 Score =   229 bits (583),  Expect = 3e-65, Method: Composition-based stats.
 Identities = 116/140 (83%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            M+ IFEYFVVCGIGPEIR+++G +GY GTG MY  SLLDQYPP  HSLYPPPPPQL TCV
Sbjct  1    MSRIFEYFVVCGIGPEIRSIDGTKGYQGTGCMYFPSLLDQYPPSTHSLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEF+ SGFD N+PSTFP+SYPIVLTEGDGSKIYVSCI+FRDPVCEDIAEAYRI AN
Sbjct  61   LPAGVEFHSSGFDPNDPSTFPRSYPIVLTEGDGSKIYVSCISFRDPVCEDIAEAYRIQAN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            S+ADKCICLVSRSPSF +LR
Sbjct  121  SYADKCICLVSRSPSFSVLR  140



>ref|XP_004512862.1| PREDICTED: uncharacterized protein LOC101507359 isoform X1 [Cicer 
arietinum]
Length=1211

 Score =   229 bits (583),  Expect = 3e-65, Method: Composition-based stats.
 Identities = 116/140 (83%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            M+ IFEYFVVCGIGPEIR+++G +GY GTG MY  SLLDQYPP  HSLYPPPPPQL TCV
Sbjct  1    MSRIFEYFVVCGIGPEIRSIDGTKGYQGTGCMYFPSLLDQYPPSTHSLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEF+ SGFD N+PSTFP+SYPIVLTEGDGSKIYVSCI+FRDPVCEDIAEAYRI AN
Sbjct  61   LPAGVEFHSSGFDPNDPSTFPRSYPIVLTEGDGSKIYVSCISFRDPVCEDIAEAYRIQAN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            S+ADKCICLVSRSPSF +LR
Sbjct  121  SYADKCICLVSRSPSFSVLR  140



>ref|XP_010094783.1| hypothetical protein L484_019994 [Morus notabilis]
 gb|EXB56948.1| hypothetical protein L484_019994 [Morus notabilis]
Length=526

 Score =   221 bits (564),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFEYFVVCGIGPEIRTL+G +G++GTGIMYL SLLDQYPPLNHSLYPPPPPQL TCV
Sbjct  1    MAPIFEYFVVCGIGPEIRTLDGNKGFHGTGIMYLPSLLDQYPPLNHSLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEFYP GFDS++  TFP+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAY IPAN
Sbjct  61   LPAGVEFYPLGFDSSDALTFPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYHIPAN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCICLVSRSPSFR+LR
Sbjct  121  SFADKCICLVSRSPSFRVLR  140



>ref|XP_003634188.1| PREDICTED: uncharacterized protein LOC100254135 isoform X1 [Vitis 
vinifera]
Length=1215

 Score =   228 bits (582),  Expect = 4e-65, Method: Composition-based stats.
 Identities = 118/140 (84%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MAGIFEYFVVCG+GPE+RTL+G +G++G G+MYL+SLLDQYPP NHSLYPPPPPQL TCV
Sbjct  1    MAGIFEYFVVCGLGPEVRTLDGNKGFHGMGVMYLSSLLDQYPPSNHSLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEFY SGFDSN+ STFP+SYPIVLTEGDGSKIYVSCIAFRDPV +DIAEAYRIP N
Sbjct  61   LPAGVEFYSSGFDSNDVSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVSDDIAEAYRIPPN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCICLVSR PSF +LR
Sbjct  121  SFADKCICLVSRLPSFCMLR  140



>gb|AIG51125.1| stomatal cytokinesis defective 1 [Gossypium hirsutum]
Length=1135

 Score =   228 bits (580),  Expect = 5e-65, Method: Composition-based stats.
 Identities = 116/140 (83%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFEYFVVCG+GPEIRTL+G +GY+GT  +YL SLLDQYPPLNH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGLGPEIRTLDGTKGYHGTEYLYLPSLLDQYPPLNHTLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVE +PSGFDSN+P ++P+SYPIVLTEGDGSKIYVSCI FRDPVCEDIAEAYRIP N
Sbjct  61   LPAGVELFPSGFDSNDPLSYPRSYPIVLTEGDGSKIYVSCITFRDPVCEDIAEAYRIPPN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCIC+VSRSP FR+LR
Sbjct  121  SFADKCICVVSRSPCFRVLR  140



>ref|XP_011011805.1| PREDICTED: uncharacterized protein LOC105116250 isoform X2 [Populus 
euphratica]
Length=1206

 Score =   228 bits (581),  Expect = 6e-65, Method: Composition-based stats.
 Identities = 117/140 (84%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            M GIFEYFVVCG+GPE+RT++G +GY+G  ++YL SLLDQYPP NHSLYPPPPPQL TCV
Sbjct  1    MGGIFEYFVVCGLGPEMRTMDGNKGYHGMRVLYLPSLLDQYPPDNHSLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEFYPSGFD+N+ STFPKSYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAYRIP N
Sbjct  61   LPAGVEFYPSGFDANDSSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYRIPPN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCICLVS SPSF +LR
Sbjct  121  SFADKCICLVSHSPSFGVLR  140



>ref|XP_011011807.1| PREDICTED: uncharacterized protein LOC105116251 isoform X1 [Populus 
euphratica]
Length=1207

 Score =   228 bits (581),  Expect = 6e-65, Method: Composition-based stats.
 Identities = 117/140 (84%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            M GIFEYFVVCG+GPE+RT++G +GY+G  ++YL SLLDQYPP NHSLYPPPPPQL TCV
Sbjct  1    MGGIFEYFVVCGLGPEMRTMDGNKGYHGMRVLYLPSLLDQYPPDNHSLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEFYPSGFD+N+ STFPKSYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAYRIP N
Sbjct  61   LPAGVEFYPSGFDANDSSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYRIPPN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCICLVS SPSF +LR
Sbjct  121  SFADKCICLVSHSPSFGVLR  140



>ref|XP_011011804.1| PREDICTED: uncharacterized protein LOC105116250 isoform X1 [Populus 
euphratica]
Length=1207

 Score =   228 bits (581),  Expect = 6e-65, Method: Composition-based stats.
 Identities = 117/140 (84%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            M GIFEYFVVCG+GPE+RT++G +GY+G  ++YL SLLDQYPP NHSLYPPPPPQL TCV
Sbjct  1    MGGIFEYFVVCGLGPEMRTMDGNKGYHGMRVLYLPSLLDQYPPDNHSLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEFYPSGFD+N+ STFPKSYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAYRIP N
Sbjct  61   LPAGVEFYPSGFDANDSSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYRIPPN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCICLVS SPSF +LR
Sbjct  121  SFADKCICLVSHSPSFGVLR  140



>emb|CBI15432.3| unnamed protein product [Vitis vinifera]
Length=1254

 Score =   228 bits (581),  Expect = 6e-65, Method: Composition-based stats.
 Identities = 118/140 (84%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MAGIFEYFVVCG+GPE+RTL+G +G++G G+MYL+SLLDQYPP NHSLYPPPPPQL TCV
Sbjct  1    MAGIFEYFVVCGLGPEVRTLDGNKGFHGMGVMYLSSLLDQYPPSNHSLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEFY SGFDSN+ STFP+SYPIVLTEGDGSKIYVSCIAFRDPV +DIAEAYRIP N
Sbjct  61   LPAGVEFYSSGFDSNDVSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVSDDIAEAYRIPPN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCICLVSR PSF +LR
Sbjct  121  SFADKCICLVSRLPSFCMLR  140



>emb|CAN64735.1| hypothetical protein VITISV_022618 [Vitis vinifera]
Length=371

 Score =   216 bits (550),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MAGIFEYFVVCG+GPE+RTL+G +G++G G+MYLASLLDQYPP NHSLYPPPPPQL TCV
Sbjct  1    MAGIFEYFVVCGLGPEVRTLDGNKGFHGMGVMYLASLLDQYPPSNHSLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEFY SGFDSN+ STFP+SYPIVLTEGDGSKIYVSCIAFRDPV +DIAEAYRIP N
Sbjct  61   LPAGVEFYSSGFDSNDVSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVSDDIAEAYRIPPN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCICLVSR PSF +LR
Sbjct  121  SFADKCICLVSRLPSFCMLR  140



>ref|XP_006485772.1| PREDICTED: uncharacterized protein LOC102621506 isoform X1 [Citrus 
sinensis]
Length=1206

 Score =   228 bits (580),  Expect = 8e-65, Method: Composition-based stats.
 Identities = 118/140 (84%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA +FEYFVVCGIGPEIRTL+G +GY+G    YL+S+LDQ+PPLNHSLY PPPPQLSTCV
Sbjct  1    MARVFEYFVVCGIGPEIRTLDGSKGYHGPEYYYLSSVLDQFPPLNHSLYTPPPPQLSTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGV+FY SGFDS++PSTFP++YPIVLTEGDGSKIYVSCI+FRDPV EDIAEAYRIPAN
Sbjct  61   LPAGVQFYSSGFDSDDPSTFPRTYPIVLTEGDGSKIYVSCISFRDPVSEDIAEAYRIPAN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCICLVSRSPSFRILR
Sbjct  121  SFADKCICLVSRSPSFRILR  140



>ref|XP_006440944.1| hypothetical protein CICLE_v10018557mg [Citrus clementina]
 gb|ESR54184.1| hypothetical protein CICLE_v10018557mg [Citrus clementina]
Length=1206

 Score =   226 bits (577),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 117/140 (84%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA +FEYFVVCGIGPEIRTL+G +GY+G    YL+S+LDQ+PPLNHSLYP PPPQLSTCV
Sbjct  1    MARVFEYFVVCGIGPEIRTLDGSKGYHGPEYYYLSSVLDQFPPLNHSLYPHPPPQLSTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGV+FY SGFDS++PSTFP++YPIVLTEGDGSKIYVSCI+FRDPV EDIAEAYRIPAN
Sbjct  61   LPAGVQFYSSGFDSDDPSTFPRTYPIVLTEGDGSKIYVSCISFRDPVSEDIAEAYRIPAN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCICLVSRSPSFR+LR
Sbjct  121  SFADKCICLVSRSPSFRVLR  140



>gb|KJB37240.1| hypothetical protein B456_006G195200 [Gossypium raimondii]
Length=1199

 Score =   226 bits (577),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 116/140 (83%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFEYFVVCG+GPEIRTL+G +GY+GT  +YL SLLDQYPPLNH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGLGPEIRTLDGTKGYHGTEYLYLPSLLDQYPPLNHTLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVE +PSGFDSN+P + P+SYPIVLTEGDGSKIYVSCI FRDPVCEDIAEAYRIP N
Sbjct  61   LPAGVELFPSGFDSNDPLSHPRSYPIVLTEGDGSKIYVSCITFRDPVCEDIAEAYRIPPN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCIC+VSRSP FR+LR
Sbjct  121  SFADKCICVVSRSPCFRVLR  140



>gb|KJB37239.1| hypothetical protein B456_006G195200 [Gossypium raimondii]
Length=1191

 Score =   226 bits (576),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 116/140 (83%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFEYFVVCG+GPEIRTL+G +GY+GT  +YL SLLDQYPPLNH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGLGPEIRTLDGTKGYHGTEYLYLPSLLDQYPPLNHTLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVE +PSGFDSN+P + P+SYPIVLTEGDGSKIYVSCI FRDPVCEDIAEAYRIP N
Sbjct  61   LPAGVELFPSGFDSNDPLSHPRSYPIVLTEGDGSKIYVSCITFRDPVCEDIAEAYRIPPN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCIC+VSRSP FR+LR
Sbjct  121  SFADKCICVVSRSPCFRVLR  140



>gb|KDP20097.1| hypothetical protein JCGZ_05866 [Jatropha curcas]
Length=1205

 Score =   226 bits (576),  Expect = 3e-64, Method: Composition-based stats.
 Identities = 117/140 (84%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFEYFVVCG+GPEIRTL+G +GY+G  +MYL SLLDQYPP  H+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGLGPEIRTLDGNKGYHGKEVMYLPSLLDQYPPDYHTLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGV FY SGFD+N+ STFP+SYPIVLTEGDGSKIYVSCI+FRDPV EDIAEAYRIPAN
Sbjct  61   LPAGVLFYSSGFDANDASTFPRSYPIVLTEGDGSKIYVSCISFRDPVSEDIAEAYRIPAN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCICLVSRSPSF ILR
Sbjct  121  SFADKCICLVSRSPSFGILR  140



>gb|KJB37238.1| hypothetical protein B456_006G195200 [Gossypium raimondii]
Length=1129

 Score =   225 bits (574),  Expect = 3e-64, Method: Composition-based stats.
 Identities = 116/140 (83%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFEYFVVCG+GPEIRTL+G +GY+GT  +YL SLLDQYPPLNH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGLGPEIRTLDGTKGYHGTEYLYLPSLLDQYPPLNHTLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVE +PSGFDSN+P + P+SYPIVLTEGDGSKIYVSCI FRDPVCEDIAEAYRIP N
Sbjct  61   LPAGVELFPSGFDSNDPLSHPRSYPIVLTEGDGSKIYVSCITFRDPVCEDIAEAYRIPPN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCIC+VSRSP FR+LR
Sbjct  121  SFADKCICVVSRSPCFRVLR  140



>gb|KJB37237.1| hypothetical protein B456_006G195200 [Gossypium raimondii]
Length=1197

 Score =   226 bits (575),  Expect = 4e-64, Method: Composition-based stats.
 Identities = 116/140 (83%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFEYFVVCG+GPEIRTL+G +GY+GT  +YL SLLDQYPPLNH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGLGPEIRTLDGTKGYHGTEYLYLPSLLDQYPPLNHTLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVE +PSGFDSN+P + P+SYPIVLTEGDGSKIYVSCI FRDPVCEDIAEAYRIP N
Sbjct  61   LPAGVELFPSGFDSNDPLSHPRSYPIVLTEGDGSKIYVSCITFRDPVCEDIAEAYRIPPN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCIC+VSRSP FR+LR
Sbjct  121  SFADKCICVVSRSPCFRVLR  140



>gb|AGG55718.1| stomatal cytokinesis defective 1 [Gossypium arboreum]
Length=1181

 Score =   225 bits (573),  Expect = 6e-64, Method: Composition-based stats.
 Identities = 115/140 (82%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            M  IFEYFVVCG+GPEIRTL+G +GY+GT  +YL SLLDQYPPLNH+LYPPPPPQL TCV
Sbjct  1    MTRIFEYFVVCGLGPEIRTLDGTKGYHGTEYLYLPSLLDQYPPLNHTLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVE +PSGFDSN+P ++P+SYPIVLTEGDGSKIYVSCI FRDPVCEDIAEAYRIP N
Sbjct  61   LPAGVELFPSGFDSNDPLSYPRSYPIVLTEGDGSKIYVSCITFRDPVCEDIAEAYRIPPN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCIC+VSRSP FR+LR
Sbjct  121  SFADKCICVVSRSPCFRVLR  140



>ref|XP_002511967.1| F-box and wd40 domain protein, putative [Ricinus communis]
 gb|EEF50636.1| F-box and wd40 domain protein, putative [Ricinus communis]
Length=1204

 Score =   225 bits (573),  Expect = 7e-64, Method: Composition-based stats.
 Identities = 112/140 (80%), Positives = 123/140 (88%), Gaps = 2/140 (1%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFEYFVVCG+G E+RTL+G +GY+G G+MYLASLLDQYPP NH   PPP     TCV
Sbjct  1    MARIFEYFVVCGLGAELRTLDGNKGYHGRGVMYLASLLDQYPPDNHHSPPPPQL--PTCV  58

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEFY SGFD+N+ S+FP+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAYRIPAN
Sbjct  59   LPAGVEFYSSGFDANDASSFPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYRIPAN  118

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCICLVSRSPSF +LR
Sbjct  119  SFADKCICLVSRSPSFSVLR  138



>ref|XP_011072936.1| PREDICTED: uncharacterized protein LOC105158031 [Sesamum indicum]
Length=1198

 Score =   224 bits (572),  Expect = 9e-64, Method: Composition-based stats.
 Identities = 117/140 (84%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            M  IFEYFVVCGIGPEIRTL+G RGY+GT  MYL +LLDQYP  N+SLYPPPPPQLSTCV
Sbjct  1    MPQIFEYFVVCGIGPEIRTLDGSRGYHGTDTMYLPALLDQYPHSNNSLYPPPPPQLSTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGV+F+ SG DSN+ ++FP+SYPIVLTEGDGSKIYVSCIAFRD VCEDIAEAYRIPA+
Sbjct  61   LPAGVQFHSSGCDSNDLTSFPRSYPIVLTEGDGSKIYVSCIAFRDRVCEDIAEAYRIPAD  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCICLVSRSPSFRILR
Sbjct  121  SFADKCICLVSRSPSFRILR  140



>emb|CDO98446.1| unnamed protein product [Coffea canephora]
Length=1209

 Score =   224 bits (571),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 115/137 (84%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  231  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  410
            IFEYFVVCGIGPEIRTL+G+RGY+G+  +YL SLLDQYPP +H+LYPPPPPQL TCVLPA
Sbjct  5    IFEYFVVCGIGPEIRTLDGERGYHGSEFIYLPSLLDQYPPTDHTLYPPPPPQLPTCVLPA  64

Query  411  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  590
            GV+F+ SGFDS +PSTFP++YPIVLTEGDGSKIYVSCIAFRDPVCEDI EAYRI ANSFA
Sbjct  65   GVQFHASGFDSKDPSTFPRNYPIVLTEGDGSKIYVSCIAFRDPVCEDIVEAYRIAANSFA  124

Query  591  DKCICLVSRSPSFRILR  641
            DKCICLVSRSPSF ILR
Sbjct  125  DKCICLVSRSPSFHILR  141



>gb|EPS64327.1| hypothetical protein M569_10454 [Genlisea aurea]
Length=885

 Score =   222 bits (565),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 111/140 (79%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            M  IFEYFVVCGIGP+IRTL+G RGY+GT  +YL S+LDQYP  N+SLYPPPPPQL TC+
Sbjct  1    MPQIFEYFVVCGIGPDIRTLDGSRGYHGTSTVYLPSVLDQYPASNNSLYPPPPPQLPTCI  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAG++FY SG+DSN+ STFP+SYPIVLTEGDGSKIYVSCIAFRDPVC+DI EAYRIP +
Sbjct  61   LPAGIQFYSSGYDSNDASTFPRSYPIVLTEGDGSKIYVSCIAFRDPVCQDICEAYRIPGH  120

Query  582  SFADKCICLVSRSPSFRILR  641
            +FADKCICLVSRSPSFR LR
Sbjct  121  TFADKCICLVSRSPSFRTLR  140



>ref|XP_011009995.1| PREDICTED: uncharacterized protein LOC105114954 isoform X1 [Populus 
euphratica]
Length=1207

 Score =   223 bits (569),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 115/140 (82%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            M  +FEYFVVCG+GPEIRT++G +GY+G  + Y +SLLDQYPP NHSLYPPPPPQL  CV
Sbjct  1    MGRLFEYFVVCGLGPEIRTVDGNKGYHGMRVFYQSSLLDQYPPDNHSLYPPPPPQLPICV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEFYPSGFD+N+ STFP+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAYRIPAN
Sbjct  61   LPAGVEFYPSGFDANDSSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYRIPAN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCICLVSRSPSF +LR
Sbjct  121  SFADKCICLVSRSPSFGVLR  140



>ref|XP_007036483.1| Stomatal cytokinesis defective / SCD1 protein (SCD1) isoform 
2 [Theobroma cacao]
 gb|EOY20984.1| Stomatal cytokinesis defective / SCD1 protein (SCD1) isoform 
2 [Theobroma cacao]
Length=1035

 Score =   221 bits (564),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFEYFVVCG+GPEIRTL+G +GY+GT  MYL SLLDQYPP NHSLYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGLGPEIRTLDGTKGYHGTEYMYLPSLLDQYPPPNHSLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEFY SGFDSN+PST+P+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAYRIP N
Sbjct  61   LPAGVEFYSSGFDSNDPSTYPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYRIPTN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCICLVSRSP FR+LR
Sbjct  121  SFADKCICLVSRSPCFRVLR  140



>ref|XP_008457689.1| PREDICTED: uncharacterized protein LOC103497299 [Cucumis melo]
 ref|XP_008457770.1| PREDICTED: uncharacterized protein LOC103497299 [Cucumis melo]
Length=1209

 Score =   222 bits (566),  Expect = 6e-63, Method: Composition-based stats.
 Identities = 112/140 (80%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFEYFVVCGIGPEIRTL+G +G++G G +YL SLLDQYPP N+S   PPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNKGFHGFGYLYLPSLLDQYPPSNNSRCSPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEF+ SGFDS++ STFP+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAYRIP N
Sbjct  61   LPAGVEFFSSGFDSSDASTFPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYRIPPN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            S+ADKCIC+VSRSPSFR+L+
Sbjct  121  SYADKCICIVSRSPSFRVLK  140



>ref|XP_010265189.1| PREDICTED: uncharacterized protein LOC104602996 isoform X2 [Nelumbo 
nucifera]
Length=1195

 Score =   221 bits (563),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            M  IFEYFVVCGIGPEI TL+G +GY+GTG+MYL S+LDQYPP N++LYPPPPPQLSTCV
Sbjct  1    MTRIFEYFVVCGIGPEISTLDGNKGYHGTGVMYLPSVLDQYPPSNNALYPPPPPQLSTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEFY SG + N+ STFPKSYPIVLTEGDGSKIYVSCIAFRDPVC+DIAEAYRIPAN
Sbjct  61   LPAGVEFYSSGLNPNDASTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCDDIAEAYRIPAN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCICLVSRSPSFR+LR
Sbjct  121  SFADKCICLVSRSPSFRVLR  140



>ref|XP_010265188.1| PREDICTED: uncharacterized protein LOC104602996 isoform X1 [Nelumbo 
nucifera]
Length=1209

 Score =   221 bits (563),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            M  IFEYFVVCGIGPEI TL+G +GY+GTG+MYL S+LDQYPP N++LYPPPPPQLSTCV
Sbjct  1    MTRIFEYFVVCGIGPEISTLDGNKGYHGTGVMYLPSVLDQYPPSNNALYPPPPPQLSTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEFY SG + N+ STFPKSYPIVLTEGDGSKIYVSCIAFRDPVC+DIAEAYRIPAN
Sbjct  61   LPAGVEFYSSGLNPNDASTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCDDIAEAYRIPAN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCICLVSRSPSFR+LR
Sbjct  121  SFADKCICLVSRSPSFRVLR  140



>ref|XP_004137469.1| PREDICTED: uncharacterized protein LOC101212131 [Cucumis sativus]
 ref|XP_004157419.1| PREDICTED: uncharacterized LOC101212131 [Cucumis sativus]
Length=1212

 Score =   221 bits (563),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 112/140 (80%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFEYFVVCGIGPEIRTL+G +G++G G +YL SLLDQYPP N+S  PPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNKGFHGFGYLYLPSLLDQYPPSNNSRCPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEF+ SG+DS++ STFP+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAYRIP N
Sbjct  61   LPAGVEFFSSGYDSSDASTFPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYRIPPN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            S+ADKCIC+VSRSPSFR+L+
Sbjct  121  SYADKCICIVSRSPSFRVLK  140



>gb|KGN64112.1| hypothetical protein Csa_1G042240 [Cucumis sativus]
Length=1209

 Score =   221 bits (563),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 112/140 (80%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFEYFVVCGIGPEIRTL+G +G++G G +YL SLLDQYPP N+S  PPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNKGFHGFGYLYLPSLLDQYPPSNNSRCPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEF+ SG+DS++ STFP+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAYRIP N
Sbjct  61   LPAGVEFFSSGYDSSDASTFPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYRIPPN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            S+ADKCIC+VSRSPSFR+L+
Sbjct  121  SYADKCICIVSRSPSFRVLK  140



>gb|KDO41981.1| hypothetical protein CISIN_1g0010392mg, partial [Citrus sinensis]
 gb|KDO41982.1| hypothetical protein CISIN_1g0010392mg, partial [Citrus sinensis]
Length=583

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA +FEYFVVCGIGPEIRTL+G +GY+G    YL+S+LDQ+PPLNHSLY PPPPQLSTCV
Sbjct  1    MARVFEYFVVCGIGPEIRTLDGSKGYHGPEYYYLSSVLDQFPPLNHSLYTPPPPQLSTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGV+FY SGFDS++PSTFP++YPIVLTEGDGSKIYVSCI+FRDPV EDIAEAYRIPAN
Sbjct  61   LPAGVQFYSSGFDSDDPSTFPRTYPIVLTEGDGSKIYVSCISFRDPVSEDIAEAYRIPAN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCICLVSRSPSFRILR
Sbjct  121  SFADKCICLVSRSPSFRILR  140



>ref|XP_010943311.1| PREDICTED: uncharacterized protein LOC105061043 isoform X1 [Elaeis 
guineensis]
Length=1211

 Score =   220 bits (561),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 113/137 (82%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +3

Query  231  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  410
            IFEYFVVCGIGPEIR+L+G +G+ G G+MY+ SLLDQYPP NHSLYPPPPPQL TCVLPA
Sbjct  6    IFEYFVVCGIGPEIRSLDGNKGFQGMGVMYMPSLLDQYPPSNHSLYPPPPPQLPTCVLPA  65

Query  411  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  590
            GVEFY SGFDSN+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY++P NS A
Sbjct  66   GVEFYSSGFDSNDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYQVPTNSSA  125

Query  591  DKCICLVSRSPSFRILR  641
            DKCICLVS SPSF+ LR
Sbjct  126  DKCICLVSHSPSFQALR  142



>ref|XP_010943385.1| PREDICTED: uncharacterized protein LOC105061043 isoform X2 [Elaeis 
guineensis]
Length=1194

 Score =   220 bits (561),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 113/137 (82%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +3

Query  231  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  410
            IFEYFVVCGIGPEIR+L+G +G+ G G+MY+ SLLDQYPP NHSLYPPPPPQL TCVLPA
Sbjct  6    IFEYFVVCGIGPEIRSLDGNKGFQGMGVMYMPSLLDQYPPSNHSLYPPPPPQLPTCVLPA  65

Query  411  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  590
            GVEFY SGFDSN+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY++P NS A
Sbjct  66   GVEFYSSGFDSNDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYQVPTNSSA  125

Query  591  DKCICLVSRSPSFRILR  641
            DKCICLVS SPSF+ LR
Sbjct  126  DKCICLVSHSPSFQALR  142



>ref|XP_009383583.1| PREDICTED: uncharacterized protein LOC103971285 [Musa acuminata 
subsp. malaccensis]
Length=1211

 Score =   219 bits (557),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 112/141 (79%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +3

Query  219  AMAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTC  398
            A + IFEYFVVCGIGPEIRTLEG +G+ G  +MY+ SLLDQYPP NHSLYPPPPPQL TC
Sbjct  4    ASSRIFEYFVVCGIGPEIRTLEGNKGFQGMEVMYMPSLLDQYPPSNHSLYPPPPPQLPTC  63

Query  399  VLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPA  578
            VLPAGVEFY SGF+S++ +T+P+SYPIVLTEGDGSKIYV+CIAFRDPVCEDI EAY+IPA
Sbjct  64   VLPAGVEFYSSGFNSDDVTTYPRSYPIVLTEGDGSKIYVACIAFRDPVCEDIIEAYQIPA  123

Query  579  NSFADKCICLVSRSPSFRILR  641
            NSFADKCIC+VSRSPSF++L+
Sbjct  124  NSFADKCICVVSRSPSFQVLK  144



>gb|KEH21369.1| stomatal cytokinesis defective protein, putative [Medicago truncatula]
Length=1209

 Score =   217 bits (553),  Expect = 3e-61, Method: Composition-based stats.
 Identities = 111/140 (79%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            M+ IFEYFVVCGIGPEIR+++G +GY+G G MYL SLLDQ+PP  HSLYPPPPPQLSTCV
Sbjct  1    MSRIFEYFVVCGIGPEIRSIDGNKGYHGPGWMYLPSLLDQFPPSTHSLYPPPPPQLSTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEF+ SGFD N+PSTFP+SYPIVLTEGDGSKIYVSCI+FRD VCED+ EAYRI  N
Sbjct  61   LPAGVEFHASGFDPNDPSTFPRSYPIVLTEGDGSKIYVSCISFRDHVCEDVIEAYRIQGN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            S+ADKCICLVSRSP F +LR
Sbjct  121  SYADKCICLVSRSPCFSVLR  140



>gb|KJB37236.1| hypothetical protein B456_006G195200 [Gossypium raimondii]
Length=838

 Score =   215 bits (547),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFEYFVVCG+GPEIRTL+G +GY+GT  +YL SLLDQYPPLNH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGLGPEIRTLDGTKGYHGTEYLYLPSLLDQYPPLNHTLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVE +PSGFDSN+P + P+SYPIVLTEGDGSKIYVSCI FRDPVCEDIAEAYRIP N
Sbjct  61   LPAGVELFPSGFDSNDPLSHPRSYPIVLTEGDGSKIYVSCITFRDPVCEDIAEAYRIPPN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCIC+VSRSP FR+LR
Sbjct  121  SFADKCICVVSRSPCFRVLR  140



>ref|XP_008797770.1| PREDICTED: uncharacterized protein LOC103712861 isoform X2 [Phoenix 
dactylifera]
Length=1189

 Score =   217 bits (552),  Expect = 6e-61, Method: Composition-based stats.
 Identities = 111/137 (81%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +3

Query  231  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  410
            IFEYFVVCGIGPEIR+L+  +G+ G G+MY+ SLLDQYP  NHSLYPPPPPQL  CVLPA
Sbjct  6    IFEYFVVCGIGPEIRSLDENKGFQGMGVMYMPSLLDQYPSSNHSLYPPPPPQLPMCVLPA  65

Query  411  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  590
            GVEFY SGFDSN+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEA++IPA SFA
Sbjct  66   GVEFYSSGFDSNDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAHQIPATSFA  125

Query  591  DKCICLVSRSPSFRILR  641
            DKCICLVS SPSF+ LR
Sbjct  126  DKCICLVSHSPSFQALR  142



>ref|XP_008797769.1| PREDICTED: uncharacterized protein LOC103712861 isoform X1 [Phoenix 
dactylifera]
Length=1211

 Score =   217 bits (552),  Expect = 6e-61, Method: Composition-based stats.
 Identities = 111/137 (81%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +3

Query  231  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  410
            IFEYFVVCGIGPEIR+L+  +G+ G G+MY+ SLLDQYP  NHSLYPPPPPQL  CVLPA
Sbjct  6    IFEYFVVCGIGPEIRSLDENKGFQGMGVMYMPSLLDQYPSSNHSLYPPPPPQLPMCVLPA  65

Query  411  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  590
            GVEFY SGFDSN+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEA++IPA SFA
Sbjct  66   GVEFYSSGFDSNDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAHQIPATSFA  125

Query  591  DKCICLVSRSPSFRILR  641
            DKCICLVS SPSF+ LR
Sbjct  126  DKCICLVSHSPSFQALR  142



>ref|XP_007160364.1| hypothetical protein PHAVU_002G3153000g, partial [Phaseolus vulgaris]
 gb|ESW32358.1| hypothetical protein PHAVU_002G3153000g, partial [Phaseolus vulgaris]
Length=690

 Score =   213 bits (541),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            M+ +FEYFVVCGIGPEIRT++G +GY+G G MYL SLLDQYPP NH+LYPPPPPQLSTCV
Sbjct  1    MSRMFEYFVVCGIGPEIRTIDGSKGYHGPGWMYLPSLLDQYPPPNHALYPPPPPQLSTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEFY SGFDSN+PS+FP+SYPIVLTEGDGSKIYVSCI+FRD VCEDIAEAYRI AN
Sbjct  61   LPAGVEFYSSGFDSNDPSSFPRSYPIVLTEGDGSKIYVSCISFRDLVCEDIAEAYRIQAN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            S+ADKCICLVSR PSF ILR
Sbjct  121  SYADKCICLVSRLPSFSILR  140



>ref|XP_011465682.1| PREDICTED: DENN domain and WD repeat-containing protein SCD1 
[Fragaria vesca subsp. vesca]
Length=1157

 Score =   216 bits (549),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 113/140 (81%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFE+FVVCGIGPEIRTL+G RG++G   MYL SLLDQ+PP NH+LYPPPPPQL TCV
Sbjct  1    MAQIFEHFVVCGIGPEIRTLDGGRGFHGFAEMYLPSLLDQFPPANHTLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGV FY SGFD+N+ +TFP+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAY IPAN
Sbjct  61   LPAGVSFYSSGFDANDATTFPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYCIPAN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFA+KCICLVSRSPS R+L+
Sbjct  121  SFAEKCICLVSRSPSLRLLK  140



>ref|XP_002317936.2| STOMATAL CYTOKINESIS-DEFECTIVE 1 family protein [Populus trichocarpa]
 gb|EEE96156.2| STOMATAL CYTOKINESIS-DEFECTIVE 1 family protein [Populus trichocarpa]
Length=1197

 Score =   216 bits (550),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 111/140 (79%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            M  +FEYFVVCG+GPE+RT++  +GY+G  + Y +SLLDQYPP NHSLYPPPPPQL  CV
Sbjct  1    MGRLFEYFVVCGLGPEMRTVDRNKGYHGMRVFYQSSLLDQYPPDNHSLYPPPPPQLPICV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGV+FYPSGFD+++ STFP+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAYRIPAN
Sbjct  61   LPAGVQFYPSGFDADDSSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYRIPAN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCICLVSRSPSF +LR
Sbjct  121  SFADKCICLVSRSPSFGVLR  140



>ref|XP_009337275.1| PREDICTED: myotubularin-related protein 13-like [Pyrus x bretschneideri]
Length=1207

 Score =   215 bits (547),  Expect = 3e-60, Method: Composition-based stats.
 Identities = 114/140 (81%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFE+FVVCGIGPEIRTL+G +G++G    YL SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEHFVVCGIGPEIRTLDGAKGFHGFDTYYLPSLLDQYPPPNHTLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGV FY SGFDSN+  TFP+SYPIVLTEGDG+KIYVSCIAFRDPV EDIAEAY IPAN
Sbjct  61   LPAGVLFYSSGFDSNDAYTFPRSYPIVLTEGDGTKIYVSCIAFRDPVSEDIAEAYCIPAN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCICLVSRSPSFR+L+
Sbjct  121  SFADKCICLVSRSPSFRLLK  140



>ref|XP_009337189.1| PREDICTED: myotubularin-related protein 13-like [Pyrus x bretschneideri]
Length=1208

 Score =   215 bits (547),  Expect = 3e-60, Method: Composition-based stats.
 Identities = 114/140 (81%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFE+FVVCGIGPEIRTL+G +G++G    YL SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEHFVVCGIGPEIRTLDGAKGFHGFDTYYLPSLLDQYPPPNHTLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGV FY SGFDSN+  TFP+SYPIVLTEGDG+KIYVSCIAFRDPV EDIAEAY IPAN
Sbjct  61   LPAGVLFYSSGFDSNDAYTFPRSYPIVLTEGDGTKIYVSCIAFRDPVSEDIAEAYCIPAN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCICLVSRSPSFR+L+
Sbjct  121  SFADKCICLVSRSPSFRLLK  140



>ref|XP_008244008.1| PREDICTED: uncharacterized protein LOC103342183 isoform X1 [Prunus 
mume]
Length=1207

 Score =   214 bits (546),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 113/140 (81%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFE+ VVCGIGPEIRTL+G +G++G G  Y+ SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEHLVVCGIGPEIRTLDGSKGFHGFGTYYMPSLLDQYPPPNHTLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGV FY SG+DSN+ ST P+SYPIVLTEGDG+KIYVSCIAFRDPV EDIAEAY IPAN
Sbjct  61   LPAGVLFYSSGYDSNDASTIPRSYPIVLTEGDGTKIYVSCIAFRDPVSEDIAEAYCIPAN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCICLVSRSPSFR+LR
Sbjct  121  SFADKCICLVSRSPSFRLLR  140



>ref|XP_008244009.1| PREDICTED: uncharacterized protein LOC103342183 isoform X2 [Prunus 
mume]
Length=1193

 Score =   214 bits (546),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 113/140 (81%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFE+ VVCGIGPEIRTL+G +G++G G  Y+ SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEHLVVCGIGPEIRTLDGSKGFHGFGTYYMPSLLDQYPPPNHTLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGV FY SG+DSN+ ST P+SYPIVLTEGDG+KIYVSCIAFRDPV EDIAEAY IPAN
Sbjct  61   LPAGVLFYSSGYDSNDASTIPRSYPIVLTEGDGTKIYVSCIAFRDPVSEDIAEAYCIPAN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCICLVSRSPSFR+LR
Sbjct  121  SFADKCICLVSRSPSFRLLR  140



>ref|XP_010031872.1| PREDICTED: uncharacterized protein LOC104421573 [Eucalyptus grandis]
 gb|KCW83843.1| hypothetical protein EUGRSUZ_B00711 [Eucalyptus grandis]
Length=1213

 Score =   214 bits (546),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 110/137 (80%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +3

Query  231  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  410
            IFEYFVVCG+GPEIRTL+  +G++GT ++Y+ S LDQ+P  +HSLYPPPPPQLSTCVLPA
Sbjct  5    IFEYFVVCGLGPEIRTLDMDKGFHGTEVLYMPSQLDQFPSSDHSLYPPPPPQLSTCVLPA  64

Query  411  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  590
            GVE Y SGFD N P+TFP+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAYRIP+NSFA
Sbjct  65   GVEVYSSGFDPNIPATFPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYRIPSNSFA  124

Query  591  DKCICLVSRSPSFRILR  641
            DKCICLVS SPSFR+LR
Sbjct  125  DKCICLVSHSPSFRVLR  141



>ref|XP_007210443.1| hypothetical protein PRUPE_ppa000437m1g, partial [Prunus persica]
 gb|EMJ11642.1| hypothetical protein PRUPE_ppa000437m1g, partial [Prunus persica]
Length=1016

 Score =   213 bits (542),  Expect = 5e-60, Method: Composition-based stats.
 Identities = 113/140 (81%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFE+ VVCGIGPEIRTL+G +G++G G  Y+ SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEHLVVCGIGPEIRTLDGSKGFHGFGTYYMPSLLDQYPPPNHTLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGV FY SG+DSN+ ST P+SYPIVLTEGDG+KIYVSCIAFRDPV EDIAEAY IPAN
Sbjct  61   LPAGVLFYSSGYDSNDASTIPRSYPIVLTEGDGTKIYVSCIAFRDPVSEDIAEAYCIPAN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCICLVSRSPSFR+LR
Sbjct  121  SFADKCICLVSRSPSFRLLR  140



>ref|XP_008393296.1| PREDICTED: uncharacterized protein LOC103455486 [Malus domestica]
Length=1208

 Score =   212 bits (539),  Expect = 3e-59, Method: Composition-based stats.
 Identities = 113/140 (81%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFE+FVVCGIGPEIRTL+G +G++G    YL SLLDQYPP NH LYPPPPPQL TCV
Sbjct  1    MARIFEHFVVCGIGPEIRTLDGAKGFHGFDTYYLPSLLDQYPPPNHXLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGV FY SGFDSN+  TFP+SYPIVLTEGDG+KIYVSCIAFRDPV ED+AEAY IPAN
Sbjct  61   LPAGVLFYSSGFDSNDAYTFPRSYPIVLTEGDGTKIYVSCIAFRDPVSEDVAEAYCIPAN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCICLVSRSPSFR+L+
Sbjct  121  SFADKCICLVSRSPSFRLLK  140



>ref|XP_010549132.1| PREDICTED: uncharacterized protein LOC104820400 [Tarenaya hassleriana]
Length=1186

 Score =   211 bits (538),  Expect = 4e-59, Method: Composition-based stats.
 Identities = 109/140 (78%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            M  IFEYFVVCG+GPEIRTL+G  G++GT  +YL SLLDQ+PP +HSLYPPPPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEIRTLDGDIGFHGTQTLYLPSLLDQFPPSDHSLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEF+ SGFDS++P++FP+SYPIVLTEGDGSKIYVSCIAFRDPV EDI EAYR+P  
Sbjct  61   LPAGVEFHSSGFDSSDPASFPRSYPIVLTEGDGSKIYVSCIAFRDPVAEDIIEAYRLPPK  120

Query  582  SFADKCICLVSRSPSFRILR  641
             +ADKCICLVS SPSFRILR
Sbjct  121  VYADKCICLVSHSPSFRILR  140



>ref|XP_009346964.1| PREDICTED: LOW QUALITY PROTEIN: myotubularin-related protein 
13-like [Pyrus x bretschneideri]
Length=1207

 Score =   209 bits (531),  Expect = 4e-58, Method: Composition-based stats.
 Identities = 103/140 (74%), Positives = 114/140 (81%), Gaps = 2/140 (1%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFE+FVVCGIGPEIRTL+G +G++G G  Y  SLLDQYP       PPP     TCV
Sbjct  1    MARIFEHFVVCGIGPEIRTLDGAKGFHGFGTYYQTSLLDQYPXHTLYPPPPPQL--PTCV  58

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGV FY SGFDSN+  TFP+SYPIVLTEGDG+KIYVSCIAFRDPV EDIAEAY IPAN
Sbjct  59   LPAGVLFYSSGFDSNDAYTFPRSYPIVLTEGDGTKIYVSCIAFRDPVSEDIAEAYCIPAN  118

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCICL+SRSPSF +L+
Sbjct  119  SFADKCICLISRSPSFHLLK  138



>ref|XP_010677974.1| PREDICTED: uncharacterized protein LOC104893555 [Beta vulgaris 
subsp. vulgaris]
Length=1198

 Score =   207 bits (528),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 107/141 (76%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlST-C  398
            MA IFEYF+VCGIGPEIRTL+G +G+ GT   YL SLLDQYPP N SL PPPPP     C
Sbjct  1    MAPIFEYFIVCGIGPEIRTLDGDKGFYGTNYRYLPSLLDQYPPSNPSLRPPPPPPQLPIC  60

Query  399  VLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPA  578
            VLPAGVEFY SGFD N+P T+P++YPIVLTEGDGSKIYV+CIAFRDPV EDI EA+RIP 
Sbjct  61   VLPAGVEFYASGFDGNDPLTYPRTYPIVLTEGDGSKIYVTCIAFRDPVDEDIVEAHRIPL  120

Query  579  NSFADKCICLVSRSPSFRILR  641
            NSFADKCICLVSR PSF +LR
Sbjct  121  NSFADKCICLVSRLPSFYVLR  141



>ref|XP_006837773.1| hypothetical protein AMTR_s00104p00054580 [Amborella trichopoda]
 gb|ERN00342.1| hypothetical protein AMTR_s00104p00054580 [Amborella trichopoda]
Length=1221

 Score =   207 bits (527),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 104/137 (76%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = +3

Query  231  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  410
            +FEY VVCG+GPE+R+L+G RG+ GT +MY+ SLLDQ+P    +LYPPPPPQL TCVLPA
Sbjct  8    LFEYVVVCGLGPELRSLDGTRGFQGTNVMYMPSLLDQFPSSKDALYPPPPPQLPTCVLPA  67

Query  411  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  590
            GVEFY SG +  + ST P+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAYRIP NSFA
Sbjct  68   GVEFYSSGLNPIDVSTHPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYRIPPNSFA  127

Query  591  DKCICLVSRSPSFRILR  641
            DKCICLVSRSPSF +LR
Sbjct  128  DKCICLVSRSPSFHVLR  144



>gb|EEE54850.1| hypothetical protein OsJ_02315 [Oryza sativa Japonica Group]
Length=1202

 Score =   205 bits (521),  Expect = 8e-57, Method: Composition-based stats.
 Identities = 104/137 (76%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  231  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  410
            IFEYFVVCG+GPEIRTL+G +GY+G   MY+ + LDQ PP +H+LYPPPPPQL TCVLPA
Sbjct  5    IFEYFVVCGMGPEIRTLDGVKGYHGVDDMYMPAFLDQLPPSSHALYPPPPPQLPTCVLPA  64

Query  411  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  590
            GV  Y SG D+N+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY+IPANSFA
Sbjct  65   GVRIYSSGLDANDFSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDILEAYQIPANSFA  124

Query  591  DKCICLVSRSPSFRILR  641
            DKCIC VS SPSF++LR
Sbjct  125  DKCICFVSHSPSFQVLR  141



>ref|XP_008672456.1| PREDICTED: uncharacterized protein LOC100273771 isoform X2 [Zea 
mays]
Length=1185

 Score =   205 bits (521),  Expect = 8e-57, Method: Composition-based stats.
 Identities = 103/137 (75%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +3

Query  231  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  410
            IFEYFVVCG+GPEIR+L+G +G++G   MY+++ LDQ+PP NH+LYPPPPPQL TCVLPA
Sbjct  7    IFEYFVVCGLGPEIRSLDGIKGFHGVEEMYMSAFLDQFPPSNHALYPPPPPQLPTCVLPA  66

Query  411  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  590
            GV  Y SG D+++ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY+IPANSFA
Sbjct  67   GVRIYSSGLDTDDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDIIEAYQIPANSFA  126

Query  591  DKCICLVSRSPSFRILR  641
            DKCICLVS SPSF++LR
Sbjct  127  DKCICLVSHSPSFQVLR  143



>ref|XP_008672455.1| PREDICTED: uncharacterized protein LOC100273771 isoform X1 [Zea 
mays]
Length=1201

 Score =   205 bits (521),  Expect = 8e-57, Method: Composition-based stats.
 Identities = 103/137 (75%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +3

Query  231  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  410
            IFEYFVVCG+GPEIR+L+G +G++G   MY+++ LDQ+PP NH+LYPPPPPQL TCVLPA
Sbjct  7    IFEYFVVCGLGPEIRSLDGIKGFHGVEEMYMSAFLDQFPPSNHALYPPPPPQLPTCVLPA  66

Query  411  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  590
            GV  Y SG D+++ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY+IPANSFA
Sbjct  67   GVRIYSSGLDTDDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDIIEAYQIPANSFA  126

Query  591  DKCICLVSRSPSFRILR  641
            DKCICLVS SPSF++LR
Sbjct  127  DKCICLVSHSPSFQVLR  143



>ref|NP_001043390.1| Os01g0575500 [Oryza sativa Japonica Group]
 dbj|BAF05304.1| Os01g0575500 [Oryza sativa Japonica Group]
Length=1248

 Score =   205 bits (521),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 104/137 (76%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  231  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  410
            IFEYFVVCG+GPEIRTL+G +GY+G   MY+ + LDQ PP +H+LYPPPPPQL TCVLPA
Sbjct  5    IFEYFVVCGMGPEIRTLDGVKGYHGVDDMYMPAFLDQLPPSSHALYPPPPPQLPTCVLPA  64

Query  411  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  590
            GV  Y SG D+N+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY+IPANSFA
Sbjct  65   GVRIYSSGLDANDFSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDILEAYQIPANSFA  124

Query  591  DKCICLVSRSPSFRILR  641
            DKCIC VS SPSF++LR
Sbjct  125  DKCICFVSHSPSFQVLR  141



>ref|XP_004969033.1| PREDICTED: uncharacterized protein LOC101781233 [Setaria italica]
Length=1205

 Score =   202 bits (514),  Expect = 9e-56, Method: Composition-based stats.
 Identities = 102/137 (74%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  231  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  410
            IFEYFVVCG+GPEIR L+G +G++G   MY+ + L+Q+PP NH+LYPPPPPQL TCVLPA
Sbjct  7    IFEYFVVCGLGPEIRALDGAKGFHGVEDMYMPAFLEQFPPSNHALYPPPPPQLPTCVLPA  66

Query  411  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  590
            GV  Y SG D+++ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY+IPANSFA
Sbjct  67   GVRIYSSGLDTDDISTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDIIEAYQIPANSFA  126

Query  591  DKCICLVSRSPSFRILR  641
            DKCICLVS SPSF++LR
Sbjct  127  DKCICLVSHSPSFQVLR  143



>ref|XP_010479332.1| PREDICTED: myotubularin-related protein 13-like [Camelina sativa]
Length=1185

 Score =   201 bits (512),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 98/140 (70%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            M  IFEYFVVCG+GPE+RT++G  G++G    YL S LDQ+P  + S YP PPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTVDGDLGFHGMQTFYLPSPLDQFPSTDQSPYPAPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEF+ SGF SN+P++FP+SYPIVLTEGDGSKI+VSCIAFRD VCEDI EAYR+P N
Sbjct  61   LPAGVEFHSSGFASNDPASFPRSYPIVLTEGDGSKIFVSCIAFRDRVCEDIIEAYRLPPN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            ++ADKCICLVS +P+FR+LR
Sbjct  121  TYADKCICLVSHAPNFRVLR  140



>ref|XP_010461711.1| PREDICTED: myotubularin-related protein 13-like isoform X1 [Camelina 
sativa]
 ref|XP_010461712.1| PREDICTED: myotubularin-related protein 13-like isoform X2 [Camelina 
sativa]
 ref|XP_010461713.1| PREDICTED: myotubularin-related protein 13-like isoform X3 [Camelina 
sativa]
Length=1185

 Score =   201 bits (511),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 99/140 (71%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            M  IFEYFVVCG+GPE+RT++G  G++G    YL S LDQ+PP + S YP PPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTVDGDLGFHGMQTFYLPSPLDQFPPTDQSPYPAPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEF+ SGF SN+P++FP+SYPIVLTEGDGSKI+VSCIAFRD VCEDI EAYR+P N
Sbjct  61   LPAGVEFHSSGFASNDPASFPRSYPIVLTEGDGSKIFVSCIAFRDRVCEDIIEAYRLPPN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            ++ADKCICLVS +P+FR+LR
Sbjct  121  TYADKCICLVSHAPNFRVLR  140



>ref|XP_010500445.1| PREDICTED: myotubularin-related protein 13-like [Camelina sativa]
Length=1185

 Score =   201 bits (511),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 99/140 (71%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            M  IFEYFVVCG+GPE+RT++G  G++G    YL S LDQ+PP + S YP PPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTVDGDLGFHGMQTFYLPSPLDQFPPTDQSPYPAPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEF+ SGF SN+P++FP+SYPIVLTEGDGSKI+VSCIAFRD VCEDI EAYR+P N
Sbjct  61   LPAGVEFHSSGFASNDPASFPRSYPIVLTEGDGSKIFVSCIAFRDRVCEDIIEAYRLPPN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            ++ADKCICLVS +P+FR+LR
Sbjct  121  TYADKCICLVSHAPNFRVLR  140



>ref|XP_002894154.1| stomatal cytokinesis-defective 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70413.1| stomatal cytokinesis-defective 1 [Arabidopsis lyrata subsp. lyrata]
Length=1187

 Score =   201 bits (511),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 99/140 (71%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            M  IFEYFVVCG+GPEIRT++G  G++G    YL +LLDQ+PP + S YP PPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEIRTVDGDLGFHGMQTFYLPALLDQFPPTDQSPYPAPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEF+ SGF S++P++FP+SYPIVLTEGDGSKI+VSCIAFRD VCEDI EAYR+P N
Sbjct  61   LPAGVEFHSSGFVSSDPASFPRSYPIVLTEGDGSKIFVSCIAFRDRVCEDIIEAYRLPPN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            ++ADKCICLVS +P+FR+LR
Sbjct  121  TYADKCICLVSHAPNFRVLR  140



>ref|XP_010231941.1| PREDICTED: uncharacterized protein LOC100845189 [Brachypodium 
distachyon]
Length=1205

 Score =   200 bits (509),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 99/137 (72%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = +3

Query  231  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  410
            IFEYFVVCG+GPEIR L+G +G++G   MY+ + +DQ+P   H+LYPPPPPQL TCVLPA
Sbjct  7    IFEYFVVCGLGPEIRALDGVKGFHGADEMYMPAFIDQFPHSGHALYPPPPPQLPTCVLPA  66

Query  411  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  590
            GV  Y SG D+N+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY+IP NSFA
Sbjct  67   GVRVYSSGLDANDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDIIEAYQIPVNSFA  126

Query  591  DKCICLVSRSPSFRILR  641
            DKCIC VS SPSF++LR
Sbjct  127  DKCICFVSHSPSFQVLR  143



>ref|NP_850959.1| protein STOMATAL CYTOKINESIS-DEFECTIVE 1 [Arabidopsis thaliana]
 sp|Q8RXA7.1|SCD1_ARATH RecName: Full=DENN domain and WD repeat-containing protein SCD1; 
AltName: Full=Protein STOMATAL CYTOKINESIS DEFECTIVE 1 [Arabidopsis 
thaliana]
 gb|AAL92456.1| stomatal cytokinesis defective [Arabidopsis thaliana]
 gb|AEE32385.1| stomatal cytokinesis defective / SCD1 protein (SCD1) [Arabidopsis 
thaliana]
Length=1187

 Score =   199 bits (507),  Expect = 6e-55, Method: Composition-based stats.
 Identities = 98/140 (70%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            M  IFEYFVVCG+GPE+RT++G  G++G    YL +LLDQ+PP + S YP PPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTVDGDLGFHGMQTFYLPALLDQFPPTDQSPYPAPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEF+ SGF S++P++FP+SYPIVLTEGDGSKI+VSCIAFRD VCEDI EAYR+P N
Sbjct  61   LPAGVEFHSSGFVSSDPASFPRSYPIVLTEGDGSKIFVSCIAFRDRVCEDIIEAYRLPPN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            ++ADKCICLVS +P+FR+LR
Sbjct  121  TYADKCICLVSHAPNFRVLR  140



>ref|NP_001185177.1| protein STOMATAL CYTOKINESIS-DEFECTIVE 1 [Arabidopsis thaliana]
 gb|AEE32387.1| stomatal cytokinesis defective / SCD1 protein (SCD1) [Arabidopsis 
thaliana]
Length=1040

 Score =   199 bits (505),  Expect = 6e-55, Method: Composition-based stats.
 Identities = 98/140 (70%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            M  IFEYFVVCG+GPE+RT++G  G++G    YL +LLDQ+PP + S YP PPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTVDGDLGFHGMQTFYLPALLDQFPPTDQSPYPAPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEF+ SGF S++P++FP+SYPIVLTEGDGSKI+VSCIAFRD VCEDI EAYR+P N
Sbjct  61   LPAGVEFHSSGFVSSDPASFPRSYPIVLTEGDGSKIFVSCIAFRDRVCEDIIEAYRLPPN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            ++ADKCICLVS +P+FR+LR
Sbjct  121  TYADKCICLVSHAPNFRVLR  140



>tpg|DAA58649.1| TPA: hypothetical protein ZEAMMB73_444537 [Zea mays]
Length=695

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +3

Query  231  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  410
            IFEYFVVCG+GPEIR+L+G +G++G   MY+++ LDQ+PP NH+LYPPPPPQL TCVLPA
Sbjct  7    IFEYFVVCGLGPEIRSLDGIKGFHGVEEMYMSAFLDQFPPSNHALYPPPPPQLPTCVLPA  66

Query  411  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  590
            GV  Y SG D+++ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY+IPANSFA
Sbjct  67   GVRIYSSGLDTDDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDIIEAYQIPANSFA  126

Query  591  DKCICLVSRSPSFRILR  641
            DKCICLVS SPSF++LR
Sbjct  127  DKCICLVSHSPSFQVLR  143



>ref|XP_006306610.1| hypothetical protein CARUB_v10008124mg [Capsella rubella]
 gb|EOA39508.1| hypothetical protein CARUB_v10008124mg [Capsella rubella]
Length=1185

 Score =   197 bits (502),  Expect = 3e-54, Method: Composition-based stats.
 Identities = 98/140 (70%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            M  IFEYFVVCG+GPE+RT++G  G++G    YL SLLDQ+PP + S YP PPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTVDGDPGFHGIQTFYLPSLLDQFPPTDQSPYPAPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGV F+ SGF S++P++FP+SYPIVLTEGDGSKI+VSCIAFRD VCEDI EAYR+P N
Sbjct  61   LPAGVVFHSSGFVSSDPASFPRSYPIVLTEGDGSKIFVSCIAFRDRVCEDIIEAYRLPPN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            ++ADKCICLVS +P+FR+LR
Sbjct  121  TYADKCICLVSHAPNFRVLR  140



>ref|XP_006393316.1| hypothetical protein EUTSA_v10011186mg [Eutrema salsugineum]
 gb|ESQ30602.1| hypothetical protein EUTSA_v10011186mg [Eutrema salsugineum]
Length=1248

 Score =   196 bits (499),  Expect = 9e-54, Method: Composition-based stats.
 Identities = 101/140 (72%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            M  IFEYFVVCG+GPE+RTL+G  G++G    YL SLLDQ+PP +HSLYPPPPPQL TCV
Sbjct  60   MGRIFEYFVVCGLGPEMRTLDGDLGFHGLETHYLPSLLDQFPPSDHSLYPPPPPQLPTCV  119

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGV F+ SGF S++P+ FP+SYPIVLTEGDGSKI+VSCIAFRD VCEDI EAYR+P N
Sbjct  120  LPAGVAFHSSGFVSSDPANFPRSYPIVLTEGDGSKIFVSCIAFRDRVCEDITEAYRLPPN  179

Query  582  SFADKCICLVSRSPSFRILR  641
            ++ADKCIC+VS +P+FR LR
Sbjct  180  TYADKCICIVSHAPNFRALR  199



>emb|CDY48854.1| BnaA06g03280D [Brassica napus]
Length=157

 Score =   179 bits (455),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            M  IFEYFVVCG+GPE+RTL+G  G++G    YL SLLDQ+PP +HSLYPPPPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTLDGDLGFHGLDTNYLPSLLDQFPPSDHSLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGV F+ SGF S++P +FP+SYPIVLTEGDG+KI+VSCIAFRD VCED+ EAY++P N
Sbjct  61   LPAGVAFHSSGFVSSDPVSFPRSYPIVLTEGDGAKIFVSCIAFRDRVCEDVTEAYQLPPN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            ++ADKCIC+VS +P+FR LR
Sbjct  121  TYADKCICIVSHAPNFRALR  140



>emb|CDY48589.1| BnaCnng16480D [Brassica napus]
Length=1187

 Score =   194 bits (494),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 98/140 (70%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            M  IFEYFVVCG+GPE+RTL+G  G++G    YL SLLDQ+P  +HSLYPPPPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTLDGDLGFHGLDTNYLPSLLDQFPSSDHSLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGV F+ SGF S++P +FP+SYPIVLTEGDG+KI+VSCIAFRD VCED+ EAYR+P N
Sbjct  61   LPAGVAFHSSGFVSSDPVSFPRSYPIVLTEGDGAKIFVSCIAFRDRVCEDVTEAYRLPPN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            ++ADKCIC+VS +P+FR LR
Sbjct  121  TYADKCICIVSHAPNFRALR  140



>emb|CDM83276.1| unnamed protein product [Triticum aestivum]
Length=1205

 Score =   194 bits (494),  Expect = 4e-53, Method: Composition-based stats.
 Identities = 97/137 (71%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = +3

Query  231  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  410
            IFEYFVVCG+GPEIR L+G +G++G   MY+ + +DQ+P   H+LYPPPPPQL TCVLPA
Sbjct  7    IFEYFVVCGLGPEIRALDGLKGFHGAEEMYMPAFIDQFPHSGHALYPPPPPQLPTCVLPA  66

Query  411  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  590
            GV  Y S  D+N+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY+IP NSFA
Sbjct  67   GVRIYSSRLDANDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDIIEAYQIPVNSFA  126

Query  591  DKCICLVSRSPSFRILR  641
            DKCIC VS SP F++LR
Sbjct  127  DKCICFVSHSPCFQVLR  143



>gb|KFK36043.1| hypothetical protein AALP_AA4G070500 [Arabis alpina]
Length=1188

 Score =   194 bits (494),  Expect = 4e-53, Method: Composition-based stats.
 Identities = 99/140 (71%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            M  IFEYFVVCG+GPE+RTL+G  G++G    YL SLLDQ+PP +HSLYPPPPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTLDGDLGFHGLEANYLPSLLDQFPPSDHSLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEF  +GF S++P++FP+SYP+VLTEGDG+KI+VSC+AFRD VCEDI EAYR+P N
Sbjct  61   LPAGVEFRTTGFVSSDPASFPRSYPLVLTEGDGAKIFVSCVAFRDRVCEDIVEAYRLPPN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            ++ADKCICLVS +P+FR LR
Sbjct  121  TYADKCICLVSHAPNFRALR  140



>ref|NP_175333.3| protein STOMATAL CYTOKINESIS-DEFECTIVE 1 [Arabidopsis thaliana]
 gb|AEE32386.1| stomatal cytokinesis defective / SCD1 protein (SCD1) [Arabidopsis 
thaliana]
Length=909

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            M  IFEYFVVCG+GPE+RT++G  G++G    YL +LLDQ+PP + S YP PPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTVDGDLGFHGMQTFYLPALLDQFPPTDQSPYPAPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGVEF+ SGF S++P++FP+SYPIVLTEGDGSKI+VSCIAFRD VCEDI EAYR+P N
Sbjct  61   LPAGVEFHSSGFVSSDPASFPRSYPIVLTEGDGSKIFVSCIAFRDRVCEDIIEAYRLPPN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            ++ADKCICLVS +P+FR+LR
Sbjct  121  TYADKCICLVSHAPNFRVLR  140



>ref|XP_009147917.1| PREDICTED: myotubularin-related protein 13 isoform X1 [Brassica 
rapa]
Length=1187

 Score =   192 bits (489),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 98/140 (70%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            M  IFEYFVVCG+GPE+RTL+G  G++G    YL SLLDQ+PP +HSLYPPPPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTLDGDLGFHGLDTNYLPSLLDQFPPSDHSLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGV F+ SGF S++P +FP+SYPIVLTEGDG+KI+VSCIAFRD VCED+ EAY++P N
Sbjct  61   LPAGVAFHSSGFVSSDPVSFPRSYPIVLTEGDGAKIFVSCIAFRDRVCEDVTEAYQLPPN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            ++ADKCIC+VS +P+FR LR
Sbjct  121  TYADKCICIVSHAPNFRALR  140



>ref|XP_006646026.1| PREDICTED: uncharacterized protein LOC102710652 [Oryza brachyantha]
Length=1210

 Score =   191 bits (485),  Expect = 8e-52, Method: Composition-based stats.
 Identities = 91/140 (65%), Positives = 107/140 (76%), Gaps = 3/140 (2%)
 Frame = +3

Query  231  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASL---LDQYpplnhslypppppqlSTCV  401
            IFEYFVVCG+GPEIRTL+G +G++G   M L S+   L+      H L          CV
Sbjct  9    IFEYFVVCGLGPEIRTLDGVKGFHGADDMDLNSVYLWLESLYREGHYLVHHDAAVAEMCV  68

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGV  Y SG D+N+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY+IPAN
Sbjct  69   LPAGVRIYSSGLDANDLSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDIIEAYQIPAN  128

Query  582  SFADKCICLVSRSPSFRILR  641
            S+ADKCICLVS SPSF++LR
Sbjct  129  SYADKCICLVSHSPSFQVLR  148



>gb|EEC70939.1| hypothetical protein OsI_02530 [Oryza sativa Indica Group]
Length=1118

 Score =   187 bits (474),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 100/148 (68%), Positives = 117/148 (79%), Gaps = 11/148 (7%)
 Frame = +3

Query  231  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  410
            IFEYFVVCG+GPEIRTL+G +GY+G   MY+ + LDQ PP +H+LYPPPPPQL TCVLPA
Sbjct  5    IFEYFVVCGMGPEIRTLDGVKGYHGVDDMYMPAFLDQLPPSSHALYPPPPPQLPTCVLPA  64

Query  411  GVEFYPSGFDSNNPSTFPKSYPIVLTE-----------GDGSKIYVSCIAFRDPVCEDIA  557
            GV  Y SG D+N+ ST+P+SYPIVLT+           G   KIYVSCIAFRDP+CEDI 
Sbjct  65   GVRIYSSGLDANDFSTYPRSYPIVLTDCSLTFVLTSCRGRWLKIYVSCIAFRDPICEDIL  124

Query  558  EAYRIPANSFADKCICLVSRSPSFRILR  641
            EAY+IPANSFADKCIC VS SPSF++LR
Sbjct  125  EAYQIPANSFADKCICFVSHSPSFQVLR  152



>ref|XP_009147918.1| PREDICTED: DENN domain-containing protein 4B isoform X2 [Brassica 
rapa]
Length=880

 Score =   184 bits (466),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            M  IFEYFVVCG+GPE+RTL+G  G++G    YL SLLDQ+PP +HSLYPPPPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTLDGDLGFHGLDTNYLPSLLDQFPPSDHSLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGV F+ SGF S++P +FP+SYPIVLTEGDG+KI+VSCIAFRD VCED+ EAY++P N
Sbjct  61   LPAGVAFHSSGFVSSDPVSFPRSYPIVLTEGDGAKIFVSCIAFRDRVCEDVTEAYQLPPN  120

Query  582  SFADKCICLVSRSPSFRILR  641
            ++ADKCIC+VS +P+FR LR
Sbjct  121  TYADKCICIVSHAPNFRALR  140



>gb|AAF69702.1|AC016041_7 F27J15.16 [Arabidopsis thaliana]
Length=931

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 120/164 (73%), Gaps = 24/164 (15%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlST--  395
            M  IFEYFVVCG+GPE+RT++G  G++G    YL +LLDQ+PP + S YP PPPQL T  
Sbjct  1    MGRIFEYFVVCGLGPEMRTVDGDLGFHGMQTFYLPALLDQFPPTDQSPYPAPPPQLPTVK  60

Query  396  ----------------------CVLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKI  509
                                  CVLPAGVEF+ SGF S++P++FP+SYPIVLTEGDGSKI
Sbjct  61   FFTTSFVILVEIRILIGFRSMLCVLPAGVEFHSSGFVSSDPASFPRSYPIVLTEGDGSKI  120

Query  510  YVSCIAFRDPVCEDIAEAYRIPANSFADKCICLVSRSPSFRILR  641
            +VSCIAFRD VCEDI EAYR+P N++ADKCICLVS +P+FR+LR
Sbjct  121  FVSCIAFRDRVCEDIIEAYRLPPNTYADKCICLVSHAPNFRVLR  164



>ref|XP_002989051.1| hypothetical protein SELMODRAFT_129087 [Selaginella moellendorffii]
 gb|EFJ09845.1| hypothetical protein SELMODRAFT_129087 [Selaginella moellendorffii]
Length=1180

 Score =   176 bits (447),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 88/140 (63%), Positives = 108/140 (77%), Gaps = 2/140 (1%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNG-TGIMYLASLLDQYpplnhslypppppqlSTC  398
            MA + EYF+VCG+GPE++   G RGY+G TG+ Y  SLLDQ+PP +    PPPP     C
Sbjct  1    MAKLVEYFLVCGLGPEVQASNGARGYHGSTGVSYSPSLLDQFPPASTDRPPPPPQL-PMC  59

Query  399  VLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPA  578
            VLP GV F+ +GF   + S++P+SYPI+LT+GDGSKIYVSC+AFRDPV EDIAEAYRIPA
Sbjct  60   VLPGGVAFHSTGFIITDESSYPRSYPIILTDGDGSKIYVSCVAFRDPVDEDIAEAYRIPA  119

Query  579  NSFADKCICLVSRSPSFRIL  638
            NS+ DKCICLVS SP FR+ 
Sbjct  120  NSYVDKCICLVSHSPCFRLF  139



>ref|XP_002983722.1| hypothetical protein SELMODRAFT_118822 [Selaginella moellendorffii]
 gb|EFJ15218.1| hypothetical protein SELMODRAFT_118822 [Selaginella moellendorffii]
Length=1180

 Score =   175 bits (444),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 87/140 (62%), Positives = 108/140 (77%), Gaps = 2/140 (1%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGT-GIMYLASLLDQYpplnhslypppppqlSTC  398
            MA + EYF+VCG+GPE++   G RGY+G+ G+ Y  SLLDQ+PP +    PPPP     C
Sbjct  1    MAKLVEYFLVCGLGPEVQASNGARGYHGSSGVSYSPSLLDQFPPASTDRPPPPPQL-PMC  59

Query  399  VLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPA  578
            VLP GV F+ +GF   + S++P+SYPI+LT+GDGSKIYVSC+AFRDPV EDIAEAYRIPA
Sbjct  60   VLPGGVAFHSTGFIITDESSYPRSYPIILTDGDGSKIYVSCVAFRDPVDEDIAEAYRIPA  119

Query  579  NSFADKCICLVSRSPSFRIL  638
            NS+ DKCICLVS SP FR+ 
Sbjct  120  NSYVDKCICLVSHSPCFRLF  139



>ref|XP_010677977.1| PREDICTED: myotubularin-related protein 13-like isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=1175

 Score =   165 bits (417),  Expect = 9e-43, Method: Composition-based stats.
 Identities = 94/141 (67%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTL-EGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTC  398
            MA +FEYFVVCG+GPEIRTL E   GY G    Y  SL+DQYPPL HSLY P PP+L  C
Sbjct  1    MAPLFEYFVVCGLGPEIRTLYESSSGYYGIDCTYEPSLIDQYPPLGHSLYAPLPPELPMC  60

Query  399  VLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPA  578
            V+P GVEF  SGFD+ + S++P+SYPIVLT GDGSKIYVSCIAF D V EDI +AY IP 
Sbjct  61   VMPEGVEFCKSGFDAKDSSSYPRSYPIVLTAGDGSKIYVSCIAFWDSVDEDIGKAYGIPP  120

Query  579  NSFADKCICLVSRSPSFRILR  641
            NSF  KCI LVSR P F +LR
Sbjct  121  NSFTRKCISLVSRIPCFCVLR  141



>ref|XP_010677976.1| PREDICTED: uncharacterized protein LOC104893556 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1200

 Score =   165 bits (417),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 94/141 (67%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTL-EGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTC  398
            MA +FEYFVVCG+GPEIRTL E   GY G    Y  SL+DQYPPL HSLY P PP+L  C
Sbjct  1    MAPLFEYFVVCGLGPEIRTLYESSSGYYGIDCTYEPSLIDQYPPLGHSLYAPLPPELPMC  60

Query  399  VLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPA  578
            V+P GVEF  SGFD+ + S++P+SYPIVLT GDGSKIYVSCIAF D V EDI +AY IP 
Sbjct  61   VMPEGVEFCKSGFDAKDSSSYPRSYPIVLTAGDGSKIYVSCIAFWDSVDEDIGKAYGIPP  120

Query  579  NSFADKCICLVSRSPSFRILR  641
            NSF  KCI LVSR P F +LR
Sbjct  121  NSFTRKCISLVSRIPCFCVLR  141



>gb|EMT33100.1| hypothetical protein F775_01878 [Aegilops tauschii]
Length=231

 Score =   150 bits (378),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 101/126 (80%), Gaps = 1/126 (1%)
 Frame = +3

Query  231  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  410
            IFEYFVVCG+GPEIR L+G +G++G   MY+ + +DQ+P   H+LYPPPPPQL TCVLPA
Sbjct  7    IFEYFVVCGLGPEIRALDGLKGFHGAEEMYMPAFIDQFPHSGHALYPPPPPQLPTCVLPA  66

Query  411  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  590
            GV  Y S  D+N+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY+IP  SF 
Sbjct  67   GVRIYSSRLDANDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDIIEAYQIPI-SFQ  125

Query  591  DKCICL  608
                CL
Sbjct  126  PLVQCL  131



>ref|XP_008349874.1| PREDICTED: uncharacterized protein LOC103413159 [Malus domestica]
Length=123

 Score =   145 bits (367),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFE+FVVCGIGP IRT +G +G +G    Y  SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEHFVVCGIGPXIRTJDGAKGXHGFXTYYQTSLLDQYPPPNHTLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
            LPAGV FY SGFDSN+  TFP+SYPIVLTEGD +KIYVSCIAFR  V EDIAEA  IPAN
Sbjct  61   LPAGVLFYSSGFDSNDAYTFPRSYPIVLTEGDTTKIYVSCIAFRGTVSEDIAEANCIPAN  120

Query  582  S  584
            S
Sbjct  121  S  121



>ref|XP_010677975.1| PREDICTED: uncharacterized protein LOC104893556 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1232

 Score =   154 bits (389),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTL-EGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTC  398
            MA +FEYFVVCG+GPEIRTL E   GY G    Y  SL+DQYPPL HSLY P PP+L  C
Sbjct  1    MAPLFEYFVVCGLGPEIRTLYESSSGYYGIDCTYEPSLIDQYPPLGHSLYAPLPPELPMC  60

Query  399  VLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPA  578
            V+P GVEF  SGFD+ + S++P+SYPIVLT GDGSKIYVSCIAF D V EDI +AY IP 
Sbjct  61   VMPEGVEFCKSGFDAKDSSSYPRSYPIVLTAGDGSKIYVSCIAFWDSVDEDIGKAYGIPP  120

Query  579  NSFADKCICLVSRSPSFRILR  641
            NSF  KCI LVSR P F +LR
Sbjct  121  NSFTRKCISLVSRIPCFCVLR  141



>ref|XP_001752748.1| predicted protein [Physcomitrella patens]
 gb|EDQ82252.1| predicted protein [Physcomitrella patens]
Length=1149

 Score =   146 bits (368),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 82/142 (58%), Positives = 102/142 (72%), Gaps = 2/142 (1%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRT--LEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlST  395
            M  + EYF+VCG+GP+++T  +   RGY GT   Y  +LLDQ+PP   +  P PP QL  
Sbjct  1    MGRLLEYFLVCGLGPDLQTTYIPPTRGYFGTNAYYQPALLDQFPPSELAACPDPPDQLPV  60

Query  396  CVLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIP  575
            CVLP GV  Y  G  S +PS+ P+SYPIVLTEGDGSKIY+SCIAFRDPV +D+A+AY IP
Sbjct  61   CVLPDGVRIYSQGPSSQDPSSSPRSYPIVLTEGDGSKIYLSCIAFRDPVDDDVAQAYNIP  120

Query  576  ANSFADKCICLVSRSPSFRILR  641
            AN + DKCIC +SRSP F + R
Sbjct  121  ANYYVDKCICFLSRSPCFELFR  142



>ref|XP_011470710.1| PREDICTED: DENN domain and WD repeat-containing protein SCD1-like 
[Fragaria vesca subsp. vesca]
Length=440

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 84/140 (60%), Gaps = 32/140 (23%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFE+FVVCGIGPEIRTL+G RG++G   MYL                      +   
Sbjct  1    MAQIFEHFVVCGIGPEIRTLDGGRGFHGFAEMYLPH---------------SLSSSAASA  45

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  581
               GV FY SGFD+N+ +TFP+SYPIVLTEG                 EDIAE Y IPAN
Sbjct  46   PHPGVSFYSSGFDANDATTFPRSYPIVLTEG-----------------EDIAEDYCIPAN  88

Query  582  SFADKCICLVSRSPSFRILR  641
            SFADKCICLVS+SPS R+L+
Sbjct  89   SFADKCICLVSQSPSLRLLK  108



>ref|XP_008351915.1| PREDICTED: uncharacterized protein LOC103415353 [Malus domestica]
Length=108

 Score =   104 bits (260),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFE+FVVCGIGPEIRTL+G +G++G    YL SLLDQYPP NH LYPPPPPQL TCV
Sbjct  1    MARIFEHFVVCGIGPEIRTLDGAKGFHGFDTYYLPSLLDQYPPPNHXLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLT  488
            LPAGV FY SGFDSN+  TFP+SYPIVLT
Sbjct  61   LPAGVLFYSSGFDSNDAYTFPRSYPIVLT  89



>ref|XP_008356651.1| PREDICTED: uncharacterized protein LOC103420367 isoform X1 [Malus 
domestica]
Length=131

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFE+FVVCGIGPEIRTL+G +G++G    Y  SLLDQYPP NH LYPPPPPQL TCV
Sbjct  1    MARIFEHFVVCGIGPEIRTLDGAKGFHGFRTYYQTSLLDQYPPPNHXLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTE  491
            LPAGV FY SGFDSN+  TFP+SYPIVLT+
Sbjct  61   LPAGVLFYSSGFDSNDAYTFPRSYPIVLTD  90



>emb|CDX98751.1| BnaA03g45360D [Brassica napus]
Length=278

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 83/108 (77%), Gaps = 14/108 (13%)
 Frame = +3

Query  318  YLASLLDQYpplnhslypppppqlSTCVLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGD  497
            YL+SLLDQ+PP +HSLYPPPPPQL TC+LPAGV F+ SGF S++P++FP+SYPI      
Sbjct  50   YLSSLLDQFPPSDHSLYPPPPPQLPTCILPAGVAFHSSGFVSSDPASFPRSYPI------  103

Query  498  GSKIYVSCIAFRDPVCEDIAEAYRIPANSFADKCICLVSRSPSFRILR  641
                    IAFRD VCED+ EAYR+P N++ DKCIC+VS +PSFR LR
Sbjct  104  --------IAFRDRVCEDVTEAYRLPPNTYTDKCICIVSYAPSFRALR  143



>ref|XP_008356653.1| PREDICTED: uncharacterized protein LOC103420367 isoform X2 [Malus 
domestica]
Length=90

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  222  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  401
            MA IFE+FVVCGIGPEIRTL+G +G++G    Y  SLLDQYPP NH LYPPPPPQL TCV
Sbjct  1    MARIFEHFVVCGIGPEIRTLDGAKGFHGFRTYYQTSLLDQYPPPNHXLYPPPPPQLPTCV  60

Query  402  LPAGVEFYPSGFDSNNPSTFPKSYPIVLT  488
            LPAGV FY SGFDSN+  TFP+SYPIVLT
Sbjct  61   LPAGVLFYSSGFDSNDAYTFPRSYPIVLT  89



>gb|EMS55158.1| hypothetical protein TRIUR3_14216 [Triticum urartu]
Length=309

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = +3

Query  390  STCVLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYR  569
             +CVLPAGV  Y SG D+N+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY+
Sbjct  138  KSCVLPAGVRIYSSGLDANDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDIIEAYQ  197

Query  570  IPANSFADKCICL  608
            IP  SF     CL
Sbjct  198  IPI-SFQPLVQCL  209


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  231  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQY  344
            IFEYFVVCG+GPEIR L+G +G++G   MY+ + +DQ+
Sbjct  7    IFEYFVVCGLGPEIRALDGLKGFHGAEEMYMPAFIDQF  44



>emb|CDY72592.1| BnaAnng41570D, partial [Brassica napus]
Length=235

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 70/107 (65%), Gaps = 23/107 (21%)
 Frame = +3

Query  318  YLASLLDQYpplnhslypppppqlSTCVLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGD  497
            YL SLLDQ+PP +HSLYPP PP   TCVLPAGV F+ SGF S++P               
Sbjct  28   YLPSLLDQFPPSDHSLYPPHPPHFPTCVLPAGVAFHSSGFVSSDP---------------  72

Query  498  GSKIYVSCIAFRDPVCEDIAEAYRIPANSFADKCICLVSRSPSFRIL  638
                    IAFRD VCED+ EAYR+P N++ADKCIC+VS +P+FR L
Sbjct  73   --------IAFRDRVCEDVTEAYRLPPNTYADKCICIVSHAPNFRAL  111



>gb|KIY96716.1| hypothetical protein MNEG_11246 [Monoraphidium neglectum]
Length=298

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 86/157 (55%), Gaps = 10/157 (6%)
 Frame = +3

Query  186  VTDLRGFGFW*AMAGIFEYFVVCGI-GPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhs  362
            + D R  G   A   +FE+FVVCG+ G  ++T++G+ G+ GT + Y  S LD+ P  ++ 
Sbjct  7    MVDARAAG---ATLPLFEHFVVCGLSGHGLQTVQGEPGFLGTDVNYKPSFLDRLPHSDNP  63

Query  363  lypppppqlSTCVLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPV  542
               PPP    TC LPAGV       D       P+ Y +VLTEGDG+K+Y SC+A+ D +
Sbjct  64   KRQPPPQL-PTCCLPAGVNII-LKEDIAGAVLNPRMYAVVLTEGDGTKVYASCLAYYDEL  121

Query  543  CEDIAEAYRIPANSFADKCICLVSRSP----SFRILR  641
              ++   +     + A K +CL+S  P    S R+LR
Sbjct  122  PAELRARHEQLCGARALKALCLLSHQPYLACSERVLR  158



>emb|CDY28853.1| BnaC06g26410D [Brassica napus]
Length=378

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +3

Query  489  EGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFADKCICLVSRSPSFRILR  641
            EGDG+KI+VSCIAFRD VC+D+ E YR+P N++A KCIC++S +P+F  LR
Sbjct  163  EGDGAKIFVSCIAFRDRVCDDVTEPYRLPPNTYAYKCICIISHAPNFPALR  213



>ref|XP_002507362.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68620.1| predicted protein [Micromonas sp. RCC299]
Length=2680

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 49/157 (31%), Positives = 70/157 (45%), Gaps = 23/157 (15%)
 Frame = +3

Query  237  EYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlST-------  395
            E FVVCG+     T++G  G+ G G  Y   +L  YPP           +  T       
Sbjct  7    ECFVVCGLPASPVTVDGVAGFVGAGESYRPEVLSSYPPRARPPRGAGTNRGETDEPSTTG  66

Query  396  ---------------CVLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAF  530
                           C +P GV+ + +  D    +  P SYPIVLT+GDG+ +Y +C+AF
Sbjct  67   DDQGSRPPWPPHLALCAMPLGVDVHVAS-DPPRDALAPTSYPIVLTDGDGAPVYCACLAF  125

Query  531  RDPVCEDIAEAYRIPANSFADKCICLVSRSPSFRILR  641
              PV      A     ++ A  C+ LVSR+P   +LR
Sbjct  126  LAPVPSRTRAAVPALRSACARMCVVLVSRAPIIDVLR  162



>ref|XP_001415729.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94021.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=1301

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 39/80 (49%), Gaps = 4/80 (5%)
 Frame = +3

Query  390  STCVLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY-  566
            +T  LP GV+ Y  G D       P  YP +LT+ +G +IYV+C++F     E       
Sbjct  101  ATLALPRGVDAY--GDDERADDEHPTRYPTILTDENGDRIYVACVSFVAATPERSLRTMS  158

Query  567  -RIPANSFADKCICLVSRSP  623
                  + A  C+CLVSR P
Sbjct  159  GETAGATRARACVCLVSRMP  178



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750