BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS014E04

Length=615
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO98898.1|  unnamed protein product                                146   3e-38   Coffea canephora [robusta coffee]
ref|XP_011090921.1|  PREDICTED: acyl-CoA-binding domain-containin...    145   6e-38   Sesamum indicum [beniseed]
ref|XP_009629069.1|  PREDICTED: acyl-CoA-binding domain-containin...    134   4e-35   Nicotiana tomentosiformis
ref|XP_009770759.1|  PREDICTED: acyl-CoA-binding domain-containin...    132   2e-34   Nicotiana sylvestris
gb|EYU43915.1|  hypothetical protein MIMGU_mgv1a002202mg                130   2e-34   Erythranthe guttata [common monkey flower]
ref|XP_006342766.1|  PREDICTED: acyl-CoA-binding domain-containin...    131   5e-34   Solanum tuberosum [potatoes]
ref|XP_006342764.1|  PREDICTED: acyl-CoA-binding domain-containin...    131   5e-34   Solanum tuberosum [potatoes]
ref|XP_010321161.1|  PREDICTED: acyl-CoA-binding domain-containin...    130   6e-34   Solanum lycopersicum
ref|XP_004229210.1|  PREDICTED: acyl-CoA-binding domain-containin...    130   6e-34   Solanum lycopersicum
ref|XP_003631976.1|  PREDICTED: acyl-CoA-binding domain-containin...    124   6e-32   Vitis vinifera
ref|XP_006419645.1|  hypothetical protein CICLE_v10004439mg             117   2e-30   Citrus clementina [clementine]
ref|XP_007154239.1|  hypothetical protein PHAVU_003G102100g             117   2e-30   Phaseolus vulgaris [French bean]
ref|XP_004486043.1|  PREDICTED: acyl-CoA-binding domain-containin...    124   2e-30   Cicer arietinum [garbanzo]
ref|XP_006489135.1|  PREDICTED: acyl-CoA-binding domain-containin...    115   5e-30   Citrus sinensis [apfelsine]
gb|KDO75106.1|  hypothetical protein CISIN_1g0050431mg                  115   1e-29   Citrus sinensis [apfelsine]
ref|XP_008340834.1|  PREDICTED: acyl-CoA-binding domain-containin...    117   3e-29   
ref|XP_008223119.1|  PREDICTED: acyl-CoA-binding domain-containin...    117   3e-29   Prunus mume [ume]
ref|XP_009369118.1|  PREDICTED: acyl-CoA-binding domain-containin...    119   3e-29   Pyrus x bretschneideri [bai li]
gb|AES64218.2|  acyl-CoA-binding domain protein                         118   7e-29   Medicago truncatula
ref|XP_003550179.1|  PREDICTED: acyl-CoA-binding domain-containin...    111   7e-29   Glycine max [soybeans]
ref|XP_003593967.1|  Acyl-CoA-binding domain-containing protein         117   8e-29   
ref|XP_009339843.1|  PREDICTED: acyl-CoA-binding domain-containin...    117   8e-29   Pyrus x bretschneideri [bai li]
gb|KHN03383.1|  Acyl-CoA-binding domain-containing protein 4            111   8e-29   Glycine soja [wild soybean]
ref|XP_006597532.1|  PREDICTED: acyl-CoA-binding domain-containin...    111   8e-28   
ref|XP_006597533.1|  PREDICTED: acyl-CoA-binding domain-containin...    111   8e-28   
gb|EPS67095.1|  hypothetical protein M569_07681                         110   2e-27   Genlisea aurea
ref|XP_010243563.1|  PREDICTED: acyl-CoA-binding domain-containin...    109   2e-27   Nelumbo nucifera [Indian lotus]
ref|XP_011462696.1|  PREDICTED: acyl-CoA-binding domain-containin...    112   2e-27   Fragaria vesca subsp. vesca
gb|KHN02994.1|  Acyl-CoA-binding domain-containing protein 4            107   1e-26   Glycine soja [wild soybean]
ref|XP_010241693.1|  PREDICTED: acyl-CoA-binding domain-containin...    105   6e-26   Nelumbo nucifera [Indian lotus]
ref|XP_010241717.1|  PREDICTED: acyl-CoA-binding domain-containin...    105   6e-26   Nelumbo nucifera [Indian lotus]
ref|XP_010241724.1|  PREDICTED: acyl-CoA-binding domain-containin...    105   6e-26   Nelumbo nucifera [Indian lotus]
ref|XP_010241732.1|  PREDICTED: acyl-CoA-binding domain-containin...    105   1e-25   Nelumbo nucifera [Indian lotus]
ref|XP_008438824.1|  PREDICTED: acyl-CoA-binding domain-containin...    105   2e-25   Cucumis melo [Oriental melon]
ref|XP_007147881.1|  hypothetical protein PHAVU_006G162800g             105   3e-25   Phaseolus vulgaris [French bean]
ref|XP_006594495.1|  PREDICTED: acyl-CoA-binding domain-containin...    103   3e-25   Glycine max [soybeans]
ref|XP_006594496.1|  PREDICTED: acyl-CoA-binding domain-containin...    103   4e-25   Glycine max [soybeans]
ref|XP_004134196.1|  PREDICTED: acyl-CoA-binding domain-containin...    103   5e-25   Cucumis sativus [cucumbers]
ref|XP_010098333.1|  hypothetical protein L484_023581                   100   8e-25   
gb|KDP40010.1|  hypothetical protein JCGZ_02008                         100   9e-24   Jatropha curcas
ref|XP_002516884.1|  acyl-CoA binding protein, putative               97.1    2e-23   Ricinus communis
ref|XP_010683938.1|  PREDICTED: acyl-CoA-binding domain-containin...  97.1    4e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007035506.1|  Galactose oxidase/kelch repeat superfamily p...  95.5    7e-23   
ref|XP_007035509.1|  Galactose oxidase/kelch repeat superfamily p...  95.5    7e-23   
ref|XP_007035508.1|  Galactose oxidase/kelch repeat superfamily p...  95.5    8e-23   
ref|XP_008813362.1|  PREDICTED: acyl-CoA-binding domain-containin...    105   2e-22   Phoenix dactylifera
emb|CDY13903.1|  BnaC09g39230D                                        94.4    5e-22   Brassica napus [oilseed rape]
ref|XP_009120961.1|  PREDICTED: acyl-CoA-binding domain-containin...  93.2    1e-21   Brassica rapa
emb|CDX92598.1|  BnaA10g16370D                                        93.2    1e-21   
ref|XP_002315566.1|  hypothetical protein POPTR_0010s02240g           92.4    2e-21   
ref|XP_011005541.1|  PREDICTED: acyl-CoA-binding domain-containin...  92.4    2e-21   Populus euphratica
ref|XP_011015380.1|  PREDICTED: acyl-CoA-binding domain-containin...  92.4    2e-21   Populus euphratica
ref|XP_011015377.1|  PREDICTED: acyl-CoA-binding domain-containin...  92.4    2e-21   Populus euphratica
ref|XP_011005544.1|  PREDICTED: acyl-CoA-binding domain-containin...  92.0    3e-21   Populus euphratica
gb|KHG01869.1|  Acyl-CoA-binding domain-containing protein 4          91.3    3e-21   Gossypium arboreum [tree cotton]
ref|XP_006380198.1|  hypothetical protein POPTR_0008s22830g           88.6    2e-20   
ref|XP_011012822.1|  PREDICTED: acyl-CoA-binding domain-containin...  87.0    5e-20   Populus euphratica
gb|KJB72598.1|  hypothetical protein B456_011G187500                  87.0    7e-20   Gossypium raimondii
gb|KJB72599.1|  hypothetical protein B456_011G187500                  87.0    7e-20   Gossypium raimondii
gb|KJB72596.1|  hypothetical protein B456_011G187500                  87.0    8e-20   Gossypium raimondii
gb|KJB72597.1|  hypothetical protein B456_011G187500                  87.0    8e-20   Gossypium raimondii
gb|KHG01870.1|  Acyl-CoA-binding domain-containing protein 4          86.7    1e-19   Gossypium arboreum [tree cotton]
gb|KJB38635.1|  hypothetical protein B456_006G264600                  83.2    1e-19   Gossypium raimondii
dbj|BAH19562.1|  AT5G18590                                            87.4    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197360.2|  kelch repeat-containing protein                     87.4    1e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AAM78582.1|  RanGAP1 interacting protein                           87.4    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006400408.1|  hypothetical protein EUTSA_v10012828mg           85.1    5e-19   Eutrema salsugineum [saltwater cress]
gb|KHG00526.1|  Acyl-CoA-binding domain-containing 4 -like protein    83.2    5e-19   Gossypium arboreum [tree cotton]
ref|XP_004508299.1|  PREDICTED: acyl-CoA-binding domain-containin...  82.4    9e-19   Cicer arietinum [garbanzo]
ref|XP_010024637.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-bin...  85.1    1e-18   
ref|XP_010492874.1|  PREDICTED: acyl-CoA-binding domain-containin...  82.8    1e-18   Camelina sativa [gold-of-pleasure]
gb|KCW61088.1|  hypothetical protein EUGRSUZ_H03862                   84.3    2e-18   Eucalyptus grandis [rose gum]
ref|XP_006287583.1|  hypothetical protein CARUB_v10000793mg           83.2    3e-18   
ref|XP_002873905.1|  kelch repeat-containing protein                  80.9    1e-17   
ref|XP_010420635.1|  PREDICTED: acyl-CoA-binding domain-containin...  79.7    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010420634.1|  PREDICTED: acyl-CoA-binding domain-containin...  79.7    1e-17   Camelina sativa [gold-of-pleasure]
gb|AES91803.2|  acyl-CoA-binding domain protein                       79.7    1e-17   Medicago truncatula
ref|XP_003609607.1|  Acyl-CoA-binding domain-containing protein       79.7    1e-17   
ref|XP_003609606.1|  Acyl-CoA-binding domain-containing protein       79.7    1e-17   
gb|AES91804.2|  acyl-CoA-binding domain protein                       80.1    1e-17   Medicago truncatula
ref|XP_010524753.1|  PREDICTED: acyl-CoA-binding domain-containin...  81.6    2e-17   
ref|XP_010904791.1|  PREDICTED: acyl-CoA-binding domain-containin...  90.5    2e-17   
ref|XP_010454111.1|  PREDICTED: acyl-CoA-binding domain-containin...  82.0    3e-17   
ref|XP_008804572.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-bin...  90.1    3e-17   
ref|XP_009393228.1|  PREDICTED: acyl-CoA-binding domain-containin...  89.0    7e-17   
ref|XP_010904792.1|  PREDICTED: tip elongation aberrant protein 3...  88.2    1e-16   
ref|XP_010904789.1|  PREDICTED: acyl-CoA-binding domain-containin...  88.2    1e-16   Elaeis guineensis
ref|XP_010904790.1|  PREDICTED: acyl-CoA-binding domain-containin...  88.2    1e-16   Elaeis guineensis
ref|XP_010931595.1|  PREDICTED: tip elongation aberrant protein 3...  87.8    2e-16   Elaeis guineensis
ref|XP_010931593.1|  PREDICTED: tip elongation aberrant protein 3...  87.8    2e-16   
ref|XP_010931591.1|  PREDICTED: tip elongation aberrant protein 3...  87.8    2e-16   Elaeis guineensis
ref|XP_010931592.1|  PREDICTED: tip elongation aberrant protein 3...  87.4    2e-16   Elaeis guineensis
ref|XP_009402527.1|  PREDICTED: kelch repeat-containing protein 1...  82.8    4e-16   
ref|XP_004979880.1|  PREDICTED: acyl-CoA-binding domain-containin...  80.9    5e-16   Setaria italica
ref|XP_009402528.1|  PREDICTED: acyl-CoA-binding domain-containin...  82.0    7e-16   
ref|XP_004508300.1|  PREDICTED: acyl-CoA-binding domain-containin...  85.5    1e-15   Cicer arietinum [garbanzo]
ref|XP_004508297.1|  PREDICTED: acyl-CoA-binding domain-containin...  82.4    2e-14   
ref|XP_004508298.1|  PREDICTED: acyl-CoA-binding domain-containin...  82.4    2e-14   
gb|EEE52499.1|  hypothetical protein OsJ_34700                        74.3    2e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663088.1|  PREDICTED: acyl-CoA-binding domain-containin...  73.6    3e-13   
gb|ABA95166.1|  Kelch motif family protein, expressed                 73.6    3e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003577276.1|  PREDICTED: acyl-CoA-binding domain-containin...  74.3    3e-13   Brachypodium distachyon [annual false brome]
ref|XP_010237468.1|  PREDICTED: uncharacterized protein LOC100836...  74.3    3e-13   
gb|EEC68565.1|  hypothetical protein OsI_36893                        74.3    4e-13   Oryza sativa Indica Group [Indian rice]
gb|AFW60226.1|  hypothetical protein ZEAMMB73_572222                  72.0    6e-13   
ref|XP_008677101.1|  PREDICTED: uncharacterized protein LOC100279...  72.0    6e-13   Zea mays [maize]
ref|NP_001145999.1|  uncharacterized protein LOC100279529             71.6    7e-13   
gb|AFW60227.1|  LOW QUALITY PROTEIN: hypothetical protein ZEAMMB7...  72.0    7e-13   
ref|XP_002449932.1|  hypothetical protein SORBIDRAFT_05g025915        71.6    9e-13   
ref|XP_006663087.1|  PREDICTED: acyl-CoA-binding domain-containin...  71.2    1e-12   Oryza brachyantha
gb|KEH32273.1|  acyl-CoA-binding domain protein                       58.2    4e-11   Medicago truncatula
dbj|BAK00700.1|  predicted protein                                    65.9    5e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ86800.1|  predicted protein                                    65.9    5e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003575710.1|  PREDICTED: acyl-CoA-binding domain-containin...  65.1    2e-10   Brachypodium distachyon [annual false brome]
ref|XP_004962837.1|  PREDICTED: acyl-CoA-binding domain-containin...  62.4    3e-08   
ref|XP_004962833.1|  PREDICTED: acyl-CoA-binding domain-containin...  62.4    4e-08   Setaria italica
gb|AFW56515.1|  hypothetical protein ZEAMMB73_667685                  58.9    6e-08   
ref|NP_001146281.1|  uncharacterized protein LOC100279856             58.9    6e-08   Zea mays [maize]
gb|AFW56516.1|  hypothetical protein ZEAMMB73_667685                  58.5    6e-08   
gb|EMS52652.1|  Acyl-CoA-binding domain-containing protein 4          50.1    6e-08   Triticum urartu
gb|AFW56518.1|  hypothetical protein ZEAMMB73_667685                  58.5    7e-08   
ref|XP_006664610.1|  PREDICTED: acyl-CoA-binding domain-containin...  53.5    1e-07   Oryza brachyantha
ref|NP_001066944.1|  Os12g0538800                                     51.6    4e-07   
gb|EEC69433.1|  hypothetical protein OsI_38606                        51.6    4e-07   Oryza sativa Indica Group [Indian rice]
gb|EEE53353.1|  hypothetical protein OsJ_36377                        51.6    5e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002442260.1|  hypothetical protein SORBIDRAFT_08g017180        58.2    1e-06   
gb|KJB72601.1|  hypothetical protein B456_011G187500                  42.0    1e-06   Gossypium raimondii
gb|KJB38636.1|  hypothetical protein B456_006G264600                  40.0    4e-05   Gossypium raimondii



>emb|CDO98898.1| unnamed protein product [Coffea canephora]
Length=710

 Score =   146 bits (368),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  319
            MFGFSRRRMKLGRLKVQLSD+AQGT+SPIRHPKR SS +G+ +  ++N S ES+CQ S+G
Sbjct  1    MFGFSRRRMKLGRLKVQLSDSAQGTRSPIRHPKRVSSYSGQGLAPALNASHESNCQTSSG  60

Query  320  ASEFNNCTSGSSENWMVLSIAGDKPIPR  403
            A EFNNCTSGSSENWMVLS+ GDKP PR
Sbjct  61   APEFNNCTSGSSENWMVLSVTGDKPAPR  88


 Score = 39.3 bits (90),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAVVGNKMVVVGGESG+ LL+DVQVL+FDR SW++ SSK
Sbjct  91   HAAAVVGNKMVVVGGESGNKLLDDVQVLHFDRFSWSTASSK  131



>ref|XP_011090921.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Sesamum 
indicum]
 ref|XP_011090922.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Sesamum 
indicum]
 ref|XP_011090923.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Sesamum 
indicum]
Length=712

 Score =   145 bits (365),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  319
            MFGFSRRRMKLGRL+VQLSD+AQGT+SPIRHPKRFS+S GE V  + ++++E +CQ S+ 
Sbjct  1    MFGFSRRRMKLGRLRVQLSDSAQGTRSPIRHPKRFSNSNGEGVAAASSEADELNCQSSSN  60

Query  320  ASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            A E NNCTSGSSENWMVLSI+G+KP PRFN
Sbjct  61   APELNNCTSGSSENWMVLSISGEKPTPRFN  90


 Score = 40.0 bits (92),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAVVGNKMVVVGGES +GLLEDVQVL+FDR SWT  SSK
Sbjct  91   HAAAVVGNKMVVVGGESANGLLEDVQVLSFDRFSWTMASSK  131



>ref|XP_009629069.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Nicotiana 
tomentosiformis]
Length=707

 Score =   134 bits (338),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 75/90 (83%), Gaps = 5/90 (6%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  319
            MFGFS+RRMKLGRL      + QGT+SP+RHPKRFS+S+GEAV +S NDSEE SCQ S+G
Sbjct  1    MFGFSKRRMKLGRL-----SSPQGTRSPMRHPKRFSNSSGEAVPHSNNDSEEKSCQCSSG  55

Query  320  ASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            A EFNNC SG SENWM+LSIAG+KP PRFN
Sbjct  56   APEFNNCASGGSENWMLLSIAGEKPTPRFN  85


 Score = 40.4 bits (93),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAVVGNKMVVVGGESGS LLEDVQVLNFD  SWT+ SSK
Sbjct  86   HAAAVVGNKMVVVGGESGSRLLEDVQVLNFDSFSWTTASSK  126



>ref|XP_009770759.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Nicotiana sylvestris]
Length=214

 Score =   132 bits (333),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 75/90 (83%), Gaps = 5/90 (6%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  319
            MFGFS+RRMKLGRL      + QGT+SP+RHPKRFS+S+GEAV +S NDSEE SCQ S+G
Sbjct  1    MFGFSKRRMKLGRL-----SSPQGTRSPMRHPKRFSNSSGEAVPHSNNDSEEKSCQCSSG  55

Query  320  ASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            A EFNNC SG +ENWM+LSIAG+KP PRFN
Sbjct  56   APEFNNCASGGTENWMLLSIAGEKPTPRFN  85


 Score = 40.4 bits (93),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAVVGNKMVVVGGE+GS LLEDVQVLNFD  SWT+ SSK
Sbjct  86   HAAAVVGNKMVVVGGETGSRLLEDVQVLNFDSFSWTTASSK  126



>gb|EYU43915.1| hypothetical protein MIMGU_mgv1a002202mg [Erythranthe guttata]
Length=702

 Score =   130 bits (327),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  319
            MFGFSRR+MK+GR+KVQLSD++QGT+SPIRH KRFSSS GE V  + ++S+E +C  S+ 
Sbjct  1    MFGFSRRKMKIGRVKVQLSDSSQGTRSPIRHAKRFSSSNGEGVALASSESDELNCHSSSN  60

Query  320  ASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
              E NNC+SGSSENWMV SI+G+KP PRFN
Sbjct  61   TPELNNCSSGSSENWMVPSISGEKPTPRFN  90


 Score = 42.4 bits (98),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAVVGNKMVVVGGES SGLLEDVQVLNFDR SWT  SSK
Sbjct  91   HAAAVVGNKMVVVGGESASGLLEDVQVLNFDRYSWTKSSSK  131



>ref|XP_006342766.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Solanum tuberosum]
Length=662

 Score =   131 bits (329),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 75/90 (83%), Gaps = 5/90 (6%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  319
            MFGFS+RRMKLGRL     ++AQGT+SP+RHPKR S+S+GEAV  S NDSEE SCQ S+G
Sbjct  1    MFGFSKRRMKLGRL-----NSAQGTRSPMRHPKRSSNSSGEAVPPSNNDSEEKSCQCSSG  55

Query  320  ASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            A EFN+C SG SENWM+LSIAG+KP PRFN
Sbjct  56   APEFNDCASGGSENWMLLSIAGEKPTPRFN  85


 Score = 40.8 bits (94),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAVVGNKMVVVGGE+GS +LEDVQVLNFD  SWT+ SSK
Sbjct  86   HAAAVVGNKMVVVGGETGSRMLEDVQVLNFDSFSWTTASSK  126



>ref|XP_006342764.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006342765.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Solanum tuberosum]
Length=701

 Score =   131 bits (329),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 75/90 (83%), Gaps = 5/90 (6%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  319
            MFGFS+RRMKLGRL     ++AQGT+SP+RHPKR S+S+GEAV  S NDSEE SCQ S+G
Sbjct  1    MFGFSKRRMKLGRL-----NSAQGTRSPMRHPKRSSNSSGEAVPPSNNDSEEKSCQCSSG  55

Query  320  ASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            A EFN+C SG SENWM+LSIAG+KP PRFN
Sbjct  56   APEFNDCASGGSENWMLLSIAGEKPTPRFN  85


 Score = 40.4 bits (93),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAVVGNKMVVVGGE+GS +LEDVQVLNFD  SWT+ SSK
Sbjct  86   HAAAVVGNKMVVVGGETGSRMLEDVQVLNFDSFSWTTASSK  126



>ref|XP_010321161.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010321165.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X1 [Solanum lycopersicum]
Length=700

 Score =   130 bits (328),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 75/90 (83%), Gaps = 5/90 (6%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  319
            MFGFS+RRMKLGRL     ++AQGT+SP+RHPKR S+S+GEAV  S NDSEE SCQ S+G
Sbjct  1    MFGFSKRRMKLGRL-----NSAQGTRSPMRHPKRSSNSSGEAVPPSNNDSEEKSCQCSSG  55

Query  320  ASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            A EFN+C SG SENWM+LSIAG+KP PRFN
Sbjct  56   APEFNDCASGGSENWMLLSIAGEKPTPRFN  85


 Score = 40.4 bits (93),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAVVGNKMVVVGGE+GS +LEDVQVLNFD  SWT+ SSK
Sbjct  86   HAAAVVGNKMVVVGGETGSRMLEDVQVLNFDSFSWTTASSK  126



>ref|XP_004229210.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 isoform 
X2 [Solanum lycopersicum]
Length=661

 Score =   130 bits (328),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 75/90 (83%), Gaps = 5/90 (6%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  319
            MFGFS+RRMKLGRL     ++AQGT+SP+RHPKR S+S+GEAV  S NDSEE SCQ S+G
Sbjct  1    MFGFSKRRMKLGRL-----NSAQGTRSPMRHPKRSSNSSGEAVPPSNNDSEEKSCQCSSG  55

Query  320  ASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            A EFN+C SG SENWM+LSIAG+KP PRFN
Sbjct  56   APEFNDCASGGSENWMLLSIAGEKPTPRFN  85


 Score = 40.4 bits (93),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAVVGNKMVVVGGE+GS +LEDVQVLNFD  SWT+ SSK
Sbjct  86   HAAAVVGNKMVVVGGETGSRMLEDVQVLNFDSFSWTTASSK  126



>ref|XP_003631976.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Vitis 
vinifera]
 emb|CBI26099.3| unnamed protein product [Vitis vinifera]
Length=717

 Score =   124 bits (312),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 74/91 (81%), Gaps = 1/91 (1%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSST-GEAVGNSINDSEESSCQHST  316
            MFGFSRRRMKLGRLKVQL+D+AQGT+SPI+  KR S++  GE+ G +   S+E +CQ+S+
Sbjct  1    MFGFSRRRMKLGRLKVQLADSAQGTRSPIKQSKRTSNTNNGESGGRASGQSDELNCQYSS  60

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
             A E NN T+G SENWMVLSIAGDKP PRFN
Sbjct  61   DAPEANNTTTGKSENWMVLSIAGDKPTPRFN  91


 Score = 40.0 bits (92),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAV+GNKMVVVGGES +GLLEDVQVLNFDR +W++ SSK
Sbjct  92   HAAAVIGNKMVVVGGESENGLLEDVQVLNFDRFTWSAPSSK  132



>ref|XP_006419645.1| hypothetical protein CICLE_v10004439mg [Citrus clementina]
 gb|ESR32885.1| hypothetical protein CICLE_v10004439mg [Citrus clementina]
Length=717

 Score =   117 bits (293),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 69/91 (76%), Gaps = 1/91 (1%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MFGFSRRRMKLGR+K VQLSD+AQ  +SPIR PKR S+   E V  S N ++E  C+ + 
Sbjct  1    MFGFSRRRMKLGRVKKVQLSDSAQAIRSPIRPPKRNSNPNSECVAPSSNHADERDCECTI  60

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
               E +N TSG+SENWMVLSIAGDKPIPRFN
Sbjct  61   AGPEVSNGTSGNSENWMVLSIAGDKPIPRFN  91


 Score = 42.4 bits (98),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAV+GNKM+VVGGESG+GLL+DVQVLNFDR SWT+ SSK
Sbjct  92   HAAAVIGNKMIVVGGESGNGLLDDVQVLNFDRFSWTAASSK  132



>ref|XP_007154239.1| hypothetical protein PHAVU_003G102100g [Phaseolus vulgaris]
 gb|ESW26233.1| hypothetical protein PHAVU_003G102100g [Phaseolus vulgaris]
Length=709

 Score =   117 bits (294),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 67/90 (74%), Gaps = 3/90 (3%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  319
            MFGFSRRRMKLGRLKVQLS+  QGT++PIRHPKR  +S GE    S   S+E  C  ST 
Sbjct  1    MFGFSRRRMKLGRLKVQLSEANQGTRTPIRHPKRNGNSNGEGDAGSSGHSDEVDCLPST-  59

Query  320  ASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
              E ++C SGSSENWMVLSIAGDKP PR N
Sbjct  60   --EISSCASGSSENWMVLSIAGDKPTPRSN  87


 Score = 42.0 bits (97),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAV+GNKMVVVGGESG+GLL+DVQVLNFDR SWT  SSK
Sbjct  88   HAAAVIGNKMVVVGGESGTGLLDDVQVLNFDRFSWTKASSK  128



>ref|XP_004486043.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Cicer arietinum]
Length=709

 Score =   124 bits (312),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  319
            MFGFSRR  KL R+KVQLSDT QGT+SPIR+PKR  +S G+ V  +   SEE  CQ S+ 
Sbjct  1    MFGFSRRHKKLSRVKVQLSDTTQGTRSPIRYPKRNGNSNGDGVAGTSGHSEEIDCQFSST  60

Query  320  ASEFNNCTSGSSENWMVLSIAGDKPIPR-FNVVCI  421
            A E +NC SGSSENWMVLSIAGDKP PR ++  C+
Sbjct  61   APEISNCVSGSSENWMVLSIAGDKPTPRSYHAACV  95


 Score = 34.7 bits (78),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+A V+ NKM+VVGGESG+GLL+DVQVLNFD  SWT+ SSK
Sbjct  91   HAACVIENKMIVVGGESGNGLLDDVQVLNFDTFSWTTASSK  131



>ref|XP_006489135.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Citrus sinensis]
Length=717

 Score =   115 bits (289),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 69/91 (76%), Gaps = 1/91 (1%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MFGFSRRRMKLGR+K VQLSD+AQ  +SPIR PKR S+   E V  S N +++  C+ + 
Sbjct  1    MFGFSRRRMKLGRVKKVQLSDSAQAIRSPIRPPKRNSNPNSECVAPSSNHADDRDCECTI  60

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
               E +N TSG+SENWMVLSIAGDKPIPRFN
Sbjct  61   AGPEVSNGTSGNSENWMVLSIAGDKPIPRFN  91


 Score = 42.4 bits (98),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAV+GNKM+VVGGESG+GLL+DVQVLNFDR SWT+ SSK
Sbjct  92   HAAAVIGNKMIVVGGESGNGLLDDVQVLNFDRFSWTAASSK  132



>gb|KDO75106.1| hypothetical protein CISIN_1g0050431mg, partial [Citrus sinensis]
 gb|KDO75107.1| hypothetical protein CISIN_1g0050431mg, partial [Citrus sinensis]
 gb|KDO75108.1| hypothetical protein CISIN_1g0050431mg, partial [Citrus sinensis]
 gb|KDO75109.1| hypothetical protein CISIN_1g0050431mg, partial [Citrus sinensis]
Length=352

 Score =   115 bits (287),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 69/91 (76%), Gaps = 1/91 (1%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MFGFSRRRMKLGR+K VQLSD+AQ  +SPIR PKR S+   E V  S N +++  C+ + 
Sbjct  1    MFGFSRRRMKLGRVKKVQLSDSAQAIRSPIRPPKRNSNPNSECVAPSSNHADDRDCECTI  60

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
               E +N TSG+SENWMVLSIAGDKPIPRFN
Sbjct  61   AGPEVSNGTSGNSENWMVLSIAGDKPIPRFN  91


 Score = 42.0 bits (97),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAV+GNKM+VVGGESG+GLL+DVQVLNFDR SWT+ SSK
Sbjct  92   HAAAVIGNKMIVVGGESGNGLLDDVQVLNFDRFSWTAASSK  132



>ref|XP_008340834.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Malus 
domestica]
Length=715

 Score =   117 bits (292),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  319
            MFGFSRRRMKLGRLKVQLSD+AQGT+SPIRHPKR +SS  E    + ++S+E   Q  + 
Sbjct  1    MFGFSRRRMKLGRLKVQLSDSAQGTRSPIRHPKRNNSSNNECDVPATSNSDELDSQCLSA  60

Query  320  ASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
              E +N  +GSSENWMVL I+GD+P PRFN
Sbjct  61   VPEISNSATGSSENWMVLLISGDQPTPRFN  90


 Score = 38.9 bits (89),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAV+GNKM+VVGGESG+ LL+DVQVLNFD  +WT+ SSK
Sbjct  91   HAAAVIGNKMIVVGGESGNELLDDVQVLNFDSFTWTTASSK  131



>ref|XP_008223119.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Prunus 
mume]
Length=714

 Score =   117 bits (292),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  319
            MFGFSRRR+KLGRLKVQLSD+AQGT+SPIR PK   SS  E    + ++S+E   Q S+ 
Sbjct  1    MFGFSRRRLKLGRLKVQLSDSAQGTRSPIRQPKPNKSSNSECDAPASSNSDEPDHQCSSA  60

Query  320  ASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            A E +N T GSSENWMVLS++GDKP PRFN
Sbjct  61   APEISNSTMGSSENWMVLSVSGDKPTPRFN  90


 Score = 38.9 bits (89),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAV+GNKM+VVGGESG+ LL+DVQVLNFD  +WT+ SSK
Sbjct  91   HAAAVIGNKMIVVGGESGNELLDDVQVLNFDSFTWTTASSK  131



>ref|XP_009369118.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
 ref|XP_009369119.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
Length=711

 Score =   119 bits (298),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  319
            MFGFSRRRMKLGRLKVQLSD+AQGT+SPIRHPKR +SS  E    + ++S+E   Q  + 
Sbjct  1    MFGFSRRRMKLGRLKVQLSDSAQGTRSPIRHPKRNNSSNNECDAPASSNSDELDGQCLSA  60

Query  320  ASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
              E +N  +GSSENWMVLSI+GDKP PRFN
Sbjct  61   VPEISNSATGSSENWMVLSISGDKPSPRFN  90


 Score = 36.2 bits (82),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAV+GNKM+VVGGESG+ LL+DVQVL FD  +WT+ SSK
Sbjct  91   HAAAVIGNKMIVVGGESGNELLDDVQVLKFDSFTWTTASSK  131



>gb|AES64218.2| acyl-CoA-binding domain protein [Medicago truncatula]
Length=699

 Score =   118 bits (295),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MFGFSR+  KLGR+K VQLSDT QGT+SP+RHPKR ++S  + V  S   SEE  CQ ++
Sbjct  1    MFGFSRKHKKLGRVKKVQLSDTTQGTRSPLRHPKRNANSNDDGVEGSSGHSEEIDCQFTS  60

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPR-FNVVCI  421
               E +NC SGSSENWMVLSIAGDKP PR ++  C+
Sbjct  61   TGPEISNCASGSSENWMVLSIAGDKPTPRSYHAACV  96


 Score = 36.2 bits (82),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+A V+ NKM+VVGGESG+GLL+DVQVLNFD  SWT+VSSK
Sbjct  92   HAACVIENKMIVVGGESGNGLLDDVQVLNFDTFSWTTVSSK  132



>ref|XP_003550179.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Glycine max]
Length=708

 Score =   111 bits (278),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 66/90 (73%), Gaps = 5/90 (6%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  319
            MFGFSRRRMKLGRLKVQLS+   GT++P+R PKR  +  G+A G S   S+E  CQ ST 
Sbjct  1    MFGFSRRRMKLGRLKVQLSEANPGTRTPVRPPKRNGTEIGDAAGGSSGHSDEVDCQPST-  59

Query  320  ASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
              E  +C  GSSENWMVLSIAGDKPIPR N
Sbjct  60   --EITSC--GSSENWMVLSIAGDKPIPRSN  85


 Score = 42.7 bits (99),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAV+GNKM+VVGGESG+GLL+DVQVLNFDR SWT+ SSK
Sbjct  86   HAAAVIGNKMIVVGGESGTGLLDDVQVLNFDRFSWTTASSK  126



>ref|XP_003593967.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula]
Length=764

 Score =   117 bits (294),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MFGFSR+  KLGR+K VQLSDT QGT+SP+RHPKR ++S  + V  S   SEE  CQ ++
Sbjct  1    MFGFSRKHKKLGRVKKVQLSDTTQGTRSPLRHPKRNANSNDDGVEGSSGHSEEIDCQFTS  60

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPR-FNVVCI  421
               E +NC SGSSENWMVLSIAGDKP PR ++  C+
Sbjct  61   TGPEISNCASGSSENWMVLSIAGDKPTPRSYHAACV  96


 Score = 36.2 bits (82),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+A V+ NKM+VVGGESG+GLL+DVQVLNFD  SWT+VSSK
Sbjct  92   HAACVIENKMIVVGGESGNGLLDDVQVLNFDTFSWTTVSSK  132



>ref|XP_009339843.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
 ref|XP_009339844.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
Length=711

 Score =   117 bits (294),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  319
            MFGFSRRRMKLGRLKVQLSD+AQGT+SPIRHPKR +SS  E    + ++S+E   Q  + 
Sbjct  1    MFGFSRRRMKLGRLKVQLSDSAQGTRSPIRHPKRNNSSNNECDVLASSNSDELDGQCLSA  60

Query  320  ASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
              E +N  +GSSENWMVLSI+GDKP PRFN
Sbjct  61   VPEISNSATGSSENWMVLSISGDKPSPRFN  90


 Score = 36.6 bits (83),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAV+GNKM+VVGGESG+ LL+DVQVL FD  +WT+ SSK
Sbjct  91   HAAAVIGNKMIVVGGESGNELLDDVQVLKFDSFTWTTASSK  131



>gb|KHN03383.1| Acyl-CoA-binding domain-containing protein 4 [Glycine soja]
Length=736

 Score =   111 bits (277),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 66/90 (73%), Gaps = 5/90 (6%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  319
            MFGFSRRRMKLGRLKVQLS+   GT++P+R PKR  +  G+A G S   S+E  CQ ST 
Sbjct  1    MFGFSRRRMKLGRLKVQLSEANPGTRTPVRPPKRNGTEIGDAAGGSSGHSDEVDCQPST-  59

Query  320  ASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
              E  +C  GSSENWMVLSIAGDKPIPR N
Sbjct  60   --EITSC--GSSENWMVLSIAGDKPIPRSN  85


 Score = 42.7 bits (99),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAV+GNKM+VVGGESG+GLL+DVQVLNFDR SWT+ SSK
Sbjct  86   HAAAVIGNKMIVVGGESGTGLLDDVQVLNFDRFSWTTASSK  126



>ref|XP_006597532.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Glycine max]
 gb|KHN33131.1| Acyl-CoA-binding domain-containing protein 4 [Glycine soja]
Length=715

 Score =   111 bits (278),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 65/89 (73%), Gaps = 5/89 (6%)
 Frame = +2

Query  140  MFGFSRRRMKLG-RLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MFGFSRR MKLG RLKVQLSDT QGT+SPIRH KR     G+ V  +   SEE  C  S+
Sbjct  1    MFGFSRRHMKLGSRLKVQLSDTTQGTRSPIRHHKR----NGDRVAGTSGHSEEIDCPLSS  56

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPR  403
             A E + CT+GSSENWMVLSIAG+KP PR
Sbjct  57   AAPEMHTCTAGSSENWMVLSIAGNKPTPR  85


 Score = 38.9 bits (89),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAV+ NKM+VVGGESGSGLL+ VQVLNFDR SWT+ SSK
Sbjct  88   HAAAVIQNKMIVVGGESGSGLLDGVQVLNFDRFSWTTASSK  128



>ref|XP_006597533.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Glycine max]
Length=711

 Score =   111 bits (278),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 65/89 (73%), Gaps = 5/89 (6%)
 Frame = +2

Query  140  MFGFSRRRMKLG-RLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MFGFSRR MKLG RLKVQLSDT QGT+SPIRH KR     G+ V  +   SEE  C  S+
Sbjct  1    MFGFSRRHMKLGSRLKVQLSDTTQGTRSPIRHHKR----NGDRVAGTSGHSEEIDCPLSS  56

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPR  403
             A E + CT+GSSENWMVLSIAG+KP PR
Sbjct  57   AAPEMHTCTAGSSENWMVLSIAGNKPTPR  85


 Score = 38.9 bits (89),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAV+ NKM+VVGGESGSGLL+ VQVLNFDR SWT+ SSK
Sbjct  88   HAAAVIQNKMIVVGGESGSGLLDGVQVLNFDRFSWTTASSK  128



>gb|EPS67095.1| hypothetical protein M569_07681 [Genlisea aurea]
Length=238

 Score =   110 bits (274),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 71/90 (79%), Gaps = 3/90 (3%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  319
            MFGFS+RRMKLGRLKV LSD++QG +SP R  KRFS +  E    ++ ++++ + Q S+ 
Sbjct  1    MFGFSKRRMKLGRLKVHLSDSSQGLRSPHRPAKRFSHTNVEG---AVAENDDLNRQSSSA  57

Query  320  ASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
             SEF++CTSGSSENWMVLSI+G+KP PRFN
Sbjct  58   VSEFSHCTSGSSENWMVLSISGEKPTPRFN  87


 Score = 39.3 bits (90),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAVVGNKMVVVGGES +GLLEDVQVLNFDR SW   S+K
Sbjct  88   HAAAVVGNKMVVVGGESANGLLEDVQVLNFDRFSWIKASTK  128



>ref|XP_010243563.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Nelumbo 
nucifera]
Length=707

 Score =   109 bits (272),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  319
            MFGFSRRRMKLGRLKVQLSD+ QGT+SPIR  KR   S GE    + + ++E +CQ S+ 
Sbjct  1    MFGFSRRRMKLGRLKVQLSDSTQGTRSPIRPAKRVGHSNGENTAPTSSHTDELNCQCSS-  59

Query  320  ASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
             SE +N T G+SENWMVLS  GDKP PRFN
Sbjct  60   RSETDNRTPGNSENWMVLSTIGDKPKPRFN  89


 Score = 40.0 bits (92),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAV+GNKMVVVGGESG  LL+DVQVLNF+R +WT+ SSK
Sbjct  90   HAAAVIGNKMVVVGGESGHELLDDVQVLNFERFTWTTASSK  130



>ref|XP_011462696.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Fragaria 
vesca subsp. vesca]
Length=709

 Score =   112 bits (281),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 69/90 (77%), Gaps = 1/90 (1%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  319
            MFGFSR+RMK+GRLKVQLSD+ QGT+SPIR PKR +SS  ++   + + S+E  CQ    
Sbjct  1    MFGFSRKRMKIGRLKVQLSDSTQGTRSPIRQPKRNNSSNNDSDAPASSLSDELDCQ-CPS  59

Query  320  ASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            A E +N T GSSENWMVLSI+GDKP PRFN
Sbjct  60   APEISNSTMGSSENWMVLSISGDKPKPRFN  89


 Score = 36.6 bits (83),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAV+GNKM+VVGGESGS LL+DVQVLNFD  +WT+  SK
Sbjct  90   HAAAVIGNKMIVVGGESGSELLDDVQVLNFDSFTWTTALSK  130



>gb|KHN02994.1| Acyl-CoA-binding domain-containing protein 4 [Glycine soja]
Length=715

 Score =   107 bits (268),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 65/93 (70%), Gaps = 9/93 (10%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGN---SINDSEESSCQH  310
            MFG SRRRMKLGRLKVQLS+   GT++PIRHPKR  +S GE  G+   S   S+E  CQ 
Sbjct  1    MFGISRRRMKLGRLKVQLSEANPGTRTPIRHPKRNGNSNGEGEGDAGGSSGHSDEVDCQP  60

Query  311  STGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            ST        TSGSSENWMVLSIAGDKP PR N
Sbjct  61   ST------EITSGSSENWMVLSIAGDKPTPRSN  87


 Score = 38.9 bits (89),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAV+GNKM+VVGGESG+GLL+DVQVL FDR SWT  SSK
Sbjct  88   HAAAVIGNKMIVVGGESGTGLLDDVQVLTFDRFSWTMASSK  128



>ref|XP_010241693.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010241702.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010241709.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
Length=710

 Score =   105 bits (263),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 65/90 (72%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  319
            MFGFSRRR+KLGR KVQLSD+ +GT+SPIR  KR + S GE+   + +  +E   Q S  
Sbjct  1    MFGFSRRRLKLGRXKVQLSDSTEGTRSPIRSTKRLNHSNGESAAPASSHCDELKRQCS--  58

Query  320  ASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
              E +NCTSG+SENWMVLS  GDKP PRFN
Sbjct  59   GPEIDNCTSGNSENWMVLSTIGDKPEPRFN  88


 Score = 38.5 bits (88),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAV+G+KM+VVGGESG GLLEDVQVLNFDR +WT+ SS+
Sbjct  89   HAAAVIGSKMIVVGGESGHGLLEDVQVLNFDRFTWTTASSR  129



>ref|XP_010241717.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Nelumbo nucifera]
Length=705

 Score =   105 bits (263),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 65/90 (72%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  319
            MFGFSRRR+KLGR KVQLSD+ +GT+SPIR  KR + S GE+   + +  +E   Q S  
Sbjct  1    MFGFSRRRLKLGRXKVQLSDSTEGTRSPIRSTKRLNHSNGESAAPASSHCDELKRQCS--  58

Query  320  ASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
              E +NCTSG+SENWMVLS  GDKP PRFN
Sbjct  59   GPEIDNCTSGNSENWMVLSTIGDKPEPRFN  88


 Score = 38.5 bits (88),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAV+G+KM+VVGGESG GLLEDVQVLNFDR +WT+ SS+
Sbjct  89   HAAAVIGSKMIVVGGESGHGLLEDVQVLNFDRFTWTTASSR  129



>ref|XP_010241724.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Nelumbo nucifera]
Length=704

 Score =   105 bits (263),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 65/90 (72%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  319
            MFGFSRRR+KLGR KVQLSD+ +GT+SPIR  KR + S GE+   + +  +E   Q S  
Sbjct  1    MFGFSRRRLKLGRXKVQLSDSTEGTRSPIRSTKRLNHSNGESAAPASSHCDELKRQCS--  58

Query  320  ASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
              E +NCTSG+SENWMVLS  GDKP PRFN
Sbjct  59   GPEIDNCTSGNSENWMVLSTIGDKPEPRFN  88


 Score = 38.5 bits (88),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAV+G+KM+VVGGESG GLLEDVQVLNFDR +WT+ SS+
Sbjct  89   HAAAVIGSKMIVVGGESGHGLLEDVQVLNFDRFTWTTASSR  129



>ref|XP_010241732.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X4 [Nelumbo nucifera]
Length=576

 Score =   105 bits (261),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 65/90 (72%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  319
            MFGFSRRR+KLGR KVQLSD+ +GT+SPIR  KR + S GE+   + +  +E   Q S  
Sbjct  1    MFGFSRRRLKLGRXKVQLSDSTEGTRSPIRSTKRLNHSNGESAAPASSHCDELKRQCS--  58

Query  320  ASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
              E +NCTSG+SENWMVLS  GDKP PRFN
Sbjct  59   GPEIDNCTSGNSENWMVLSTIGDKPEPRFN  88


 Score = 38.5 bits (88),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAV+G+KM+VVGGESG GLLEDVQVLNFDR +WT+ SS+
Sbjct  89   HAAAVIGSKMIVVGGESGHGLLEDVQVLNFDRFTWTTASSR  129



>ref|XP_008438824.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Cucumis 
melo]
Length=677

 Score =   105 bits (262),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 66/92 (72%), Gaps = 3/92 (3%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEE-SSCQHST  316
            MFGF RRRMKLGRLKVQLSD AQGT+SPIR+PKR SSS  E    +   SEE    Q ++
Sbjct  1    MFGF-RRRMKLGRLKVQLSDPAQGTRSPIRNPKRGSSSNSECAAPASRHSEEHDEGQRAS  59

Query  317  GASEF-NNCTSGSSENWMVLSIAGDKPIPRFN  409
               +  NN  SG SENWMVLSIAG+KP PRFN
Sbjct  60   DVPDISNNGASGQSENWMVLSIAGEKPAPRFN  91


 Score = 37.7 bits (86),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+A V+GNKM+VVGGESGSGLL+DVQVLNFD+ +WT  SSK
Sbjct  92   HAATVIGNKMIVVGGESGSGLLDDVQVLNFDKFTWTRASSK  132



>ref|XP_007147881.1| hypothetical protein PHAVU_006G162800g [Phaseolus vulgaris]
 gb|ESW19875.1| hypothetical protein PHAVU_006G162800g [Phaseolus vulgaris]
Length=710

 Score =   105 bits (263),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 64/89 (72%), Gaps = 4/89 (4%)
 Frame = +2

Query  140  MFGFSRRRMKLG-RLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MFGFSRR MKLG RLKVQLSDT QGT+SPIRH ++     G+ V  +   SEE   Q  +
Sbjct  1    MFGFSRRHMKLGSRLKVQLSDTPQGTRSPIRHHQK---RNGDGVARTSGHSEEIDRQFLS  57

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPR  403
              +E + CTSGSSENWMVLSIAG+KP PR
Sbjct  58   ATAEMHTCTSGSSENWMVLSIAGEKPTPR  86


 Score = 36.6 bits (83),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAVV NKMVVVGGESGSGLL+DVQVLNFDR  WT  SSK
Sbjct  89   HAAAVVENKMVVVGGESGSGLLDDVQVLNFDRFLWTKASSK  129



>ref|XP_006594495.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Glycine max]
Length=710

 Score =   103 bits (258),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 65/89 (73%), Gaps = 4/89 (4%)
 Frame = +2

Query  140  MFGFSRRRMKLG-RLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MFGFSRR MKLG RLKVQLSDT  GT+SPIRH KR  +S G+ V  +   SE+     S+
Sbjct  1    MFGFSRRHMKLGSRLKVQLSDTTLGTRSPIRHHKRNVNSNGDRVTGTSGHSEK---MLSS  57

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPR  403
             A + + CTSGSSENWMVLSI+GDKP PR
Sbjct  58   AAPDMHTCTSGSSENWMVLSISGDKPTPR  86


 Score = 38.1 bits (87),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAV+ NKM+VVGGESGSGLL+DVQVLNFDR SWT  SSK
Sbjct  89   HAAAVIQNKMIVVGGESGSGLLDDVQVLNFDRFSWTMASSK  129



>ref|XP_006594496.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Glycine max]
Length=699

 Score =   103 bits (258),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 65/89 (73%), Gaps = 4/89 (4%)
 Frame = +2

Query  140  MFGFSRRRMKLG-RLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MFGFSRR MKLG RLKVQLSDT  GT+SPIRH KR  +S G+ V  +   SE+     S+
Sbjct  1    MFGFSRRHMKLGSRLKVQLSDTTLGTRSPIRHHKRNVNSNGDRVTGTSGHSEK---MLSS  57

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPR  403
             A + + CTSGSSENWMVLSI+GDKP PR
Sbjct  58   AAPDMHTCTSGSSENWMVLSISGDKPTPR  86


 Score = 38.1 bits (87),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAV+ NKM+VVGGESGSGLL+DVQVLNFDR SWT  SSK
Sbjct  89   HAAAVIQNKMIVVGGESGSGLLDDVQVLNFDRFSWTMASSK  129



>ref|XP_004134196.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Cucumis sativus]
 ref|XP_004171907.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Cucumis sativus]
 gb|KGN57083.1| hypothetical protein Csa_3G152100 [Cucumis sativus]
Length=678

 Score =   103 bits (258),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 65/92 (71%), Gaps = 3/92 (3%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEE-SSCQHST  316
            MFGF RRRMKLGRLKVQLSD AQGT+SPIR+PKR S S  E    +   SEE    Q ++
Sbjct  1    MFGF-RRRMKLGRLKVQLSDPAQGTRSPIRNPKRGSGSNSECAAPASRHSEEHDEGQRAS  59

Query  317  GASEF-NNCTSGSSENWMVLSIAGDKPIPRFN  409
               +  NN  SG SENWMVLSIAG+KP PRFN
Sbjct  60   DVPDISNNGASGQSENWMVLSIAGEKPAPRFN  91


 Score = 37.7 bits (86),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+A V+GNKM+VVGGESGSGLL+DVQVLNFD+ +WT  SSK
Sbjct  92   HAATVIGNKMIVVGGESGSGLLDDVQVLNFDKFTWTRASSK  132



>ref|XP_010098333.1| hypothetical protein L484_023581 [Morus notabilis]
 gb|EXB74837.1| hypothetical protein L484_023581 [Morus notabilis]
Length=674

 Score =   100 bits (248),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 62/90 (69%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  319
            MFGFSRRRMKLGRLKVQL+++A GT  PIR PKR  +S  E  G     S E   Q S+ 
Sbjct  1    MFGFSRRRMKLGRLKVQLNESANGT--PIRQPKRTGNSNSECDGPVSRKSNEVDAQCSSA  58

Query  320  ASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            A E  +   G+SENWM+LSI+GDKP PRFN
Sbjct  59   APENGSSAMGNSENWMMLSISGDKPTPRFN  88


 Score = 40.4 bits (93),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+A V+GNKM+VVGGESG+GLL+DVQVLNFDR SWT+ SSK
Sbjct  89   HAATVIGNKMIVVGGESGNGLLDDVQVLNFDRFSWTTASSK  129



>gb|KDP40010.1| hypothetical protein JCGZ_02008 [Jatropha curcas]
Length=709

 Score =   100 bits (249),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 66/91 (73%), Gaps = 3/91 (3%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MFGFSRRRMKLGR+K VQLSD+   T+SP+R  KR  +  GE    + +  +E  CQ S+
Sbjct  1    MFGFSRRRMKLGRVKKVQLSDSTLVTRSPVRTQKR--NPNGEGAAPTTSHFDELDCQCSS  58

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
               E N+ TSGSSENWMVLS++G+KP+PRFN
Sbjct  59   APPEINSSTSGSSENWMVLSVSGEKPMPRFN  89


 Score = 36.6 bits (83),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+A V+G KM+VVGGESG+GLL+DVQVLNFD+ +WT++SSK
Sbjct  90   HAATVIGKKMIVVGGESGNGLLDDVQVLNFDQFTWTAISSK  130



>ref|XP_002516884.1| acyl-CoA binding protein, putative [Ricinus communis]
 gb|EEF45498.1| acyl-CoA binding protein, putative [Ricinus communis]
Length=713

 Score = 97.1 bits (240),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 65/92 (71%), Gaps = 2/92 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MF FS RRMKLGR+K VQLSD+A  T+SPIR  KR ++   E V  + + S+E  CQ  +
Sbjct  1    MFSFSGRRMKLGRVKKVQLSDSALVTRSPIRPQKRTNNPNSEGVAPTTSHSDELDCQCPS  60

Query  317  GASEFNN-CTSGSSENWMVLSIAGDKPIPRFN  409
               E N+  TSG+SENWMVLSIAGDKP PRFN
Sbjct  61   APPETNSSTTSGNSENWMVLSIAGDKPTPRFN  92


 Score = 39.3 bits (90),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+A V+GNKM+VVGGESG+GLL+DVQVLNFD+ +WT++SSK
Sbjct  93   HAATVIGNKMIVVGGESGNGLLDDVQVLNFDQFTWTTISSK  133



>ref|XP_010683938.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Beta 
vulgaris subsp. vulgaris]
Length=708

 Score = 97.1 bits (240),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 63/90 (70%), Gaps = 5/90 (6%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  319
            MF FSRRR KLGR+KV LSD  QGTKSP+R  KR S+S  E+   + +   E S    + 
Sbjct  3    MFSFSRRRTKLGRMKV-LSDPTQGTKSPLRPLKRASNSNVESFVATADRVSEPS----SA  57

Query  320  ASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
              + NNCTSGSSE+WMVLSIAGDKP PRFN
Sbjct  58   PQDINNCTSGSSESWMVLSIAGDKPKPRFN  87


 Score = 37.7 bits (86),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+A VVGNKMVVVGGE   G+L+DVQVL+FD+ SWTS SSK
Sbjct  88   HAATVVGNKMVVVGGECTDGMLDDVQVLSFDQFSWTSASSK  128



>ref|XP_007035506.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 ref|XP_007035507.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY06432.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY06433.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
Length=716

 Score = 95.5 bits (236),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 66/91 (73%), Gaps = 3/91 (3%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MF FSRRRMKLGR+K VQLS++A G KSPIR PKR +++ GE+   +   S+       +
Sbjct  3    MFSFSRRRMKLGRVKKVQLSESAHGIKSPIRPPKRSNNTNGESAMPAGGHSDAFDSHCPS  62

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
             A E N  +SG+SENWMVLS+AG+KP+PRFN
Sbjct  63   TAPEIN--SSGNSENWMVLSVAGEKPVPRFN  91


 Score = 38.5 bits (88),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAVVGNKM+VVGGESG+GLL+DVQVLNFD  SW++ SSK
Sbjct  92   HAAAVVGNKMIVVGGESGNGLLDDVQVLNFDNFSWSTASSK  132



>ref|XP_007035509.1| Galactose oxidase/kelch repeat superfamily protein isoform 4 
[Theobroma cacao]
 gb|EOY06435.1| Galactose oxidase/kelch repeat superfamily protein isoform 4 
[Theobroma cacao]
Length=701

 Score = 95.5 bits (236),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 66/91 (73%), Gaps = 3/91 (3%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MF FSRRRMKLGR+K VQLS++A G KSPIR PKR +++ GE+   +   S+       +
Sbjct  3    MFSFSRRRMKLGRVKKVQLSESAHGIKSPIRPPKRSNNTNGESAMPAGGHSDAFDSHCPS  62

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
             A E N  +SG+SENWMVLS+AG+KP+PRFN
Sbjct  63   TAPEIN--SSGNSENWMVLSVAGEKPVPRFN  91


 Score = 38.5 bits (88),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAVVGNKM+VVGGESG+GLL+DVQVLNFD  SW++ SSK
Sbjct  92   HAAAVVGNKMIVVGGESGNGLLDDVQVLNFDNFSWSTASSK  132



>ref|XP_007035508.1| Galactose oxidase/kelch repeat superfamily protein isoform 3, 
partial [Theobroma cacao]
 gb|EOY06434.1| Galactose oxidase/kelch repeat superfamily protein isoform 3, 
partial [Theobroma cacao]
Length=679

 Score = 95.5 bits (236),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 66/91 (73%), Gaps = 3/91 (3%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MF FSRRRMKLGR+K VQLS++A G KSPIR PKR +++ GE+   +   S+       +
Sbjct  3    MFSFSRRRMKLGRVKKVQLSESAHGIKSPIRPPKRSNNTNGESAMPAGGHSDAFDSHCPS  62

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
             A E N  +SG+SENWMVLS+AG+KP+PRFN
Sbjct  63   TAPEIN--SSGNSENWMVLSVAGEKPVPRFN  91


 Score = 38.5 bits (88),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAVVGNKM+VVGGESG+GLL+DVQVLNFD  SW++ SSK
Sbjct  92   HAAAVVGNKMIVVGGESGNGLLDDVQVLNFDNFSWSTASSK  132



>ref|XP_008813362.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Phoenix dactylifera]
 ref|XP_008813363.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Phoenix dactylifera]
Length=728

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 64/92 (70%), Gaps = 2/92 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  313
            MFGFSRRRMKLGRLKV L D +QGT+SPIRH KR S S GE  V  S+N  S++ +C+  
Sbjct  4    MFGFSRRRMKLGRLKVHLGDPSQGTRSPIRHTKRASQSNGENVVSASVNGRSDDINCRCP  63

Query  314  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
             GA + + C  GSSENW VL   G KP PRFN
Sbjct  64   LGAFDLSKCGLGSSENWTVLPTEGHKPAPRFN  95



>emb|CDY13903.1| BnaC09g39230D [Brassica napus]
Length=674

 Score = 94.4 bits (233),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 62/91 (68%), Gaps = 11/91 (12%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVG-NSINDSEESSCQHST  316
            MF FS+RRMKLGR+KVQLSD+AQGTKSP+R  KR  +ST EA    + + S+E   Q S 
Sbjct  1    MFSFSKRRMKLGRVKVQLSDSAQGTKSPLRVTKRVDNSTNEAAALAATSHSDELDFQPS-  59

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
                     SG+SENWM LS+ GDKP PRFN
Sbjct  60   ---------SGNSENWMGLSVGGDKPAPRFN  81


 Score = 37.0 bits (84),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA +GNKM+VVGGESG+GLL+DVQVLNFD  +W++VSSK
Sbjct  82   HAAAAIGNKMIVVGGESGNGLLDDVQVLNFDSFTWSTVSSK  122



>ref|XP_009120961.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Brassica 
rapa]
Length=700

 Score = 93.2 bits (230),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 63/91 (69%), Gaps = 11/91 (12%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVG-NSINDSEESSCQHST  316
            MF FS+RRMKLGR+KVQLSD++QGTKSP+R  KR  +ST EA    + + S+E   Q S 
Sbjct  1    MFSFSKRRMKLGRVKVQLSDSSQGTKSPLRVTKRVDNSTNEAAALAATSHSDELDFQPS-  59

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
                     SG+SENWM LS++GDKP PRFN
Sbjct  60   ---------SGNSENWMGLSVSGDKPAPRFN  81


 Score = 37.0 bits (84),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA +GNKM+VVGGESG+GLL+DVQVLNFD  +W++VSSK
Sbjct  82   HAAAAIGNKMIVVGGESGNGLLDDVQVLNFDSFTWSTVSSK  122



>emb|CDX92598.1| BnaA10g16370D [Brassica napus]
Length=700

 Score = 93.2 bits (230),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 63/91 (69%), Gaps = 11/91 (12%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVG-NSINDSEESSCQHST  316
            MF FS+RRMKLGR+KVQLSD++QGTKSP+R  KR  +ST EA    + + S+E   Q S 
Sbjct  1    MFSFSKRRMKLGRVKVQLSDSSQGTKSPLRVTKRVDNSTNEAAALAATSHSDELDFQPS-  59

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
                     SG+SENWM LS++GDKP PRFN
Sbjct  60   ---------SGNSENWMGLSVSGDKPAPRFN  81


 Score = 37.0 bits (84),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA +GNKM+VVGGESG+GLL+DVQVLNFD  +W++VSSK
Sbjct  82   HAAAAIGNKMIVVGGESGNGLLDDVQVLNFDSFTWSTVSSK  122



>ref|XP_002315566.1| hypothetical protein POPTR_0010s02240g [Populus trichocarpa]
 gb|EEF01737.1| hypothetical protein POPTR_0010s02240g [Populus trichocarpa]
Length=663

 Score = 92.4 bits (228),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 66/95 (69%), Gaps = 5/95 (5%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTG---EAVGNSINDSEESSCQ  307
            MFGFS+RR KLGR+K VQLSD+  G +SPIR PKR  SS     E V  + N+S+E    
Sbjct  1    MFGFSKRRTKLGRVKKVQLSDSTPGIRSPIRPPKRIISSNNANSEGVALTTNNSDELDYN  60

Query  308  HSTGAS-EFNNCTSGSSENWMVLSIAGDKPIPRFN  409
             S+ A  + +  TSG++ENWMVLSI+GD+P PRFN
Sbjct  61   CSSSAPLDISASTSGNAENWMVLSISGDEPTPRFN  95


 Score = 36.6 bits (83),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+A V+GNKM+VVGG+SGSGLL+DVQVL FD+ +WT++SSK
Sbjct  96   HAATVIGNKMIVVGGDSGSGLLDDVQVLKFDQFTWTTISSK  136



>ref|XP_011005541.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011005542.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011005543.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
Length=720

 Score = 92.4 bits (228),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 66/96 (69%), Gaps = 7/96 (7%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSST-----GEAVGNSINDSEESS  301
            MFGFS+RR KLGR+K VQLSD+  G +SPIR PKR  SS      G A+  + +D  + +
Sbjct  1    MFGFSKRRAKLGRVKKVQLSDSTPGIRSPIRPPKRIISSNNVNSEGAALTTNNSDELDYN  60

Query  302  CQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            C  S+   + +  TSG++ENWMVLSI+GDKP PRFN
Sbjct  61   CS-SSAPLDISASTSGNAENWMVLSISGDKPTPRFN  95


 Score = 36.6 bits (83),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+A V+GNKM+VVGG+SGSGLL+DVQVL FD+ +WT++SSK
Sbjct  96   HAATVIGNKMIVVGGDSGSGLLDDVQVLKFDQFTWTTISSK  136



>ref|XP_011015380.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Populus euphratica]
Length=700

 Score = 92.4 bits (228),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 66/96 (69%), Gaps = 7/96 (7%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSST-----GEAVGNSINDSEESS  301
            MFGFS+RR KLGR+K VQLSD+  G +SPIR PKR  SS      G A+  + +D  + +
Sbjct  1    MFGFSKRRAKLGRVKKVQLSDSTPGIRSPIRPPKRIISSNNVNSEGAALTTNNSDELDYN  60

Query  302  CQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            C  S+   + +  TSG++ENWMVLSI+GDKP PRFN
Sbjct  61   CS-SSAPLDISASTSGNAENWMVLSISGDKPTPRFN  95


 Score = 36.6 bits (83),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+A V+GNKM+VVGG+SGSGLL+DVQVL FD+ +WT++SSK
Sbjct  96   HAATVIGNKMIVVGGDSGSGLLDDVQVLKFDQFTWTTISSK  136



>ref|XP_011015377.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011015378.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011015379.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
Length=720

 Score = 92.4 bits (228),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 66/96 (69%), Gaps = 7/96 (7%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSST-----GEAVGNSINDSEESS  301
            MFGFS+RR KLGR+K VQLSD+  G +SPIR PKR  SS      G A+  + +D  + +
Sbjct  1    MFGFSKRRAKLGRVKKVQLSDSTPGIRSPIRPPKRIISSNNVNSEGAALTTNNSDELDYN  60

Query  302  CQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            C  S+   + +  TSG++ENWMVLSI+GDKP PRFN
Sbjct  61   CS-SSAPLDISASTSGNAENWMVLSISGDKPTPRFN  95


 Score = 36.6 bits (83),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+A V+GNKM+VVGG+SGSGLL+DVQVL FD+ +WT++SSK
Sbjct  96   HAATVIGNKMIVVGGDSGSGLLDDVQVLKFDQFTWTTISSK  136



>ref|XP_011005544.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Populus euphratica]
Length=700

 Score = 92.0 bits (227),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 66/96 (69%), Gaps = 7/96 (7%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSST-----GEAVGNSINDSEESS  301
            MFGFS+RR KLGR+K VQLSD+  G +SPIR PKR  SS      G A+  + +D  + +
Sbjct  1    MFGFSKRRAKLGRVKKVQLSDSTPGIRSPIRPPKRIISSNNVNSEGAALTTNNSDELDYN  60

Query  302  CQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            C  S+   + +  TSG++ENWMVLSI+GDKP PRFN
Sbjct  61   CS-SSAPLDISASTSGNAENWMVLSISGDKPTPRFN  95


 Score = 36.6 bits (83),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+A V+GNKM+VVGG+SGSGLL+DVQVL FD+ +WT++SSK
Sbjct  96   HAATVIGNKMIVVGGDSGSGLLDDVQVLKFDQFTWTTISSK  136



>gb|KHG01869.1| Acyl-CoA-binding domain-containing protein 4 [Gossypium arboreum]
Length=709

 Score = 91.3 bits (225),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 66/91 (73%), Gaps = 4/91 (4%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MF FSRRRMKLGR+K VQLS++A G KSP+R PK+ ++S  E+   ++N S+E    H  
Sbjct  1    MFSFSRRRMKLGRVKKVQLSESANGIKSPMRPPKQSNNSNVESAMLAVNHSDELE-SHCP  59

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
             A   N  +SG+SENWMVLS+AG+ P+PRFN
Sbjct  60   PAPVIN--SSGNSENWMVLSVAGETPVPRFN  88


 Score = 37.0 bits (84),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+A VVGNKM+VVGGES +GLL+DVQVLNFD  SWT  SSK
Sbjct  89   HAATVVGNKMIVVGGESANGLLDDVQVLNFDTFSWTMASSK  129



>ref|XP_006380198.1| hypothetical protein POPTR_0008s22830g [Populus trichocarpa]
 gb|ERP57995.1| hypothetical protein POPTR_0008s22830g [Populus trichocarpa]
Length=707

 Score = 88.6 bits (218),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 63/96 (66%), Gaps = 6/96 (6%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSS-----STGEAVGNSINDSEESS  301
            MFGFS+RRMKLGR+K VQLSD++ G +SPIR PKR  S     S G A+  S +D  +  
Sbjct  1    MFGFSKRRMKLGRVKKVQLSDSSPGIRSPIRPPKRIISNNNANSEGVALTASNSDDLDYH  60

Query  302  CQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            C  S      ++    ++ENWMVLSI+GDKP PRFN
Sbjct  61   CSSSAPPVISSSTAGNNAENWMVLSISGDKPNPRFN  96


 Score = 37.7 bits (86),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+A V+GNKM+VVGGESGSGLL+DVQVL FD+ +WTS+SSK
Sbjct  97   HAATVIGNKMIVVGGESGSGLLDDVQVLKFDQFTWTSISSK  137



>ref|XP_011012822.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011012823.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011012825.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
Length=721

 Score = 87.0 bits (214),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 62/96 (65%), Gaps = 6/96 (6%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSS-----STGEAVGNSINDSEESS  301
            MFGFS+RRMKLGR+K VQLSD++ G +SPIR PKR  S     S   A+  S +D  +  
Sbjct  1    MFGFSKRRMKLGRVKKVQLSDSSPGIRSPIRPPKRIISNNNANSEDVALTASNSDDLDYH  60

Query  302  CQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            C  S      ++    ++ENWMVLSI+GDKP PRFN
Sbjct  61   CSSSAPPVISSSTAGNNAENWMVLSISGDKPTPRFN  96


 Score = 37.7 bits (86),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+A V+GNKM+VVGGESGSGLL+DVQVL FD+ +WTS+SSK
Sbjct  97   HAATVIGNKMIVVGGESGSGLLDDVQVLKFDQFTWTSISSK  137



>gb|KJB72598.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=679

 Score = 87.0 bits (214),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 64/91 (70%), Gaps = 4/91 (4%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MF FSRRRMKLGR+K VQLS++A G KSP+R PK+ ++   E+   ++N S+E    H  
Sbjct  1    MFSFSRRRMKLGRVKKVQLSESANGIKSPMRPPKQSNNPNVESAMLAVNHSDELE-SHCP  59

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
             A   N  +SG+SENWMVLS+AG+ P PRFN
Sbjct  60   PAPVIN--SSGNSENWMVLSVAGETPEPRFN  88


 Score = 37.4 bits (85),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+A VVGNKM+VVGGES +GLL+DVQVLNFD  SWT  SSK
Sbjct  89   HAATVVGNKMIVVGGESANGLLDDVQVLNFDTFSWTMASSK  129



>gb|KJB72599.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=706

 Score = 87.0 bits (214),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 64/91 (70%), Gaps = 4/91 (4%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MF FSRRRMKLGR+K VQLS++A G KSP+R PK+ ++   E+   ++N S+E    H  
Sbjct  1    MFSFSRRRMKLGRVKKVQLSESANGIKSPMRPPKQSNNPNVESAMLAVNHSDELES-HCP  59

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
             A   N  +SG+SENWMVLS+AG+ P PRFN
Sbjct  60   PAPVIN--SSGNSENWMVLSVAGETPEPRFN  88


 Score = 37.0 bits (84),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+A VVGNKM+VVGGES +GLL+DVQVLNFD  SWT  SSK
Sbjct  89   HAATVVGNKMIVVGGESANGLLDDVQVLNFDTFSWTMASSK  129



>gb|KJB72596.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
 gb|KJB72600.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=709

 Score = 87.0 bits (214),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 64/91 (70%), Gaps = 4/91 (4%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MF FSRRRMKLGR+K VQLS++A G KSP+R PK+ ++   E+   ++N S+E    H  
Sbjct  1    MFSFSRRRMKLGRVKKVQLSESANGIKSPMRPPKQSNNPNVESAMLAVNHSDELES-HCP  59

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
             A   N  +SG+SENWMVLS+AG+ P PRFN
Sbjct  60   PAPVIN--SSGNSENWMVLSVAGETPEPRFN  88


 Score = 37.0 bits (84),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+A VVGNKM+VVGGES +GLL+DVQVLNFD  SWT  SSK
Sbjct  89   HAATVVGNKMIVVGGESANGLLDDVQVLNFDTFSWTMASSK  129



>gb|KJB72597.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=606

 Score = 87.0 bits (214),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 64/91 (70%), Gaps = 4/91 (4%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MF FSRRRMKLGR+K VQLS++A G KSP+R PK+ ++   E+   ++N S+E    H  
Sbjct  1    MFSFSRRRMKLGRVKKVQLSESANGIKSPMRPPKQSNNPNVESAMLAVNHSDELE-SHCP  59

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
             A   N  +SG+SENWMVLS+AG+ P PRFN
Sbjct  60   PAPVIN--SSGNSENWMVLSVAGETPEPRFN  88


 Score = 37.0 bits (84),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+A VVGNKM+VVGGES +GLL+DVQVLNFD  SWT  SSK
Sbjct  89   HAATVVGNKMIVVGGESANGLLDDVQVLNFDTFSWTMASSK  129



>gb|KHG01870.1| Acyl-CoA-binding domain-containing protein 4 [Gossypium arboreum]
Length=733

 Score = 86.7 bits (213),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 64/88 (73%), Gaps = 4/88 (5%)
 Frame = +2

Query  149  FSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTGAS  325
            FSRRRMKLGR+K VQLS++A G KSP+R PK+ ++S  E+   ++N S+E    H   A 
Sbjct  28   FSRRRMKLGRVKKVQLSESANGIKSPMRPPKQSNNSNVESAMLAVNHSDELES-HCPPAP  86

Query  326  EFNNCTSGSSENWMVLSIAGDKPIPRFN  409
              N  +SG+SENWMVLS+AG+ P+PRFN
Sbjct  87   VIN--SSGNSENWMVLSVAGETPVPRFN  112


 Score = 37.0 bits (84),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+A VVGNKM+VVGGES +GLL+DVQVLNFD  SWT  SSK
Sbjct  113  HAATVVGNKMIVVGGESANGLLDDVQVLNFDTFSWTMASSK  153



>gb|KJB38635.1| hypothetical protein B456_006G264600 [Gossypium raimondii]
 gb|KJB38637.1| hypothetical protein B456_006G264600 [Gossypium raimondii]
Length=706

 Score = 83.2 bits (204),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 66/95 (69%), Gaps = 13/95 (14%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAV---GNS-INDSEESSC  304
            MF FSRRRMKL R+K VQLS++  GT+SPIR  KR +++  E+    G S  ND + S+ 
Sbjct  3    MFSFSRRRMKLNRVKKVQLSESVHGTRSPIRPSKRNNNTIVESALPAGTSHCNDFDPST-  61

Query  305  QHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
                 A E N  +SG+SENWMVLS+AG+KP+PRFN
Sbjct  62   -----APEIN--SSGNSENWMVLSVAGEKPVPRFN  89


 Score = 40.0 bits (92),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAVVGN+M+VVGGESG+GLL+DVQVLNFD  SWTS SSK
Sbjct  90   HAAAVVGNRMIVVGGESGNGLLDDVQVLNFDNFSWTSASSK  130



>dbj|BAH19562.1| AT5G18590 [Arabidopsis thaliana]
Length=708

 Score = 87.4 bits (215),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 61/91 (67%), Gaps = 11/91 (12%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MF FS+RRM+LGR+K VQLSD+ QG KSP+R  KR  SS+ EA   + + S+E   Q S 
Sbjct  1    MFSFSKRRMRLGRVKKVQLSDSVQGYKSPLRVTKRADSSSNEAAVAATSYSDELDFQPS-  59

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
                     SG+SENWMVLS+ G+KP PRFN
Sbjct  60   ---------SGNSENWMVLSVNGEKPAPRFN  81


 Score = 35.8 bits (81),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA +GNKM+VVGGESGSGLL+DVQVLNFD  +W++ SSK
Sbjct  82   HAAATIGNKMIVVGGESGSGLLDDVQVLNFDSCTWSTASSK  122



>ref|NP_197360.2| kelch repeat-containing protein [Arabidopsis thaliana]
 ref|NP_850846.1| kelch repeat-containing protein [Arabidopsis thaliana]
 dbj|BAE98374.1| RanGAP1 interacting protein [Arabidopsis thaliana]
 gb|AED92582.1| kelch repeat-containing protein [Arabidopsis thaliana]
 gb|AED92583.1| kelch repeat-containing protein [Arabidopsis thaliana]
Length=708

 Score = 87.4 bits (215),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 61/91 (67%), Gaps = 11/91 (12%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MF FS+RRM+LGR+K VQLSD+ QG KSP+R  KR  SS+ EA   + + S+E   Q S 
Sbjct  1    MFSFSKRRMRLGRVKKVQLSDSVQGYKSPLRVTKRADSSSNEAAVAATSYSDELDFQPS-  59

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
                     SG+SENWMVLS+ G+KP PRFN
Sbjct  60   ---------SGNSENWMVLSVNGEKPAPRFN  81


 Score = 35.8 bits (81),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA +GNKM+VVGGESGSGLL+DVQVLNFD  +W++ SSK
Sbjct  82   HAAATIGNKMIVVGGESGSGLLDDVQVLNFDSCTWSTASSK  122



>gb|AAM78582.1| RanGAP1 interacting protein [Arabidopsis thaliana]
Length=708

 Score = 87.4 bits (215),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 61/91 (67%), Gaps = 11/91 (12%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MF FS+RRM+LGR+K VQLSD+ QG KSP+R  KR  SS+ EA   + + S+E   Q S 
Sbjct  1    MFSFSKRRMRLGRVKKVQLSDSVQGYKSPLRVTKRADSSSNEAAVAATSYSDELDFQPS-  59

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
                     SG+SENWMVLS+ G+KP PRFN
Sbjct  60   ---------SGNSENWMVLSVNGEKPAPRFN  81


 Score = 35.8 bits (81),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA +GNKM+VVGGESGSGLL+DVQVLNFD  +W++ SSK
Sbjct  82   HAAATIGNKMIVVGGESGSGLLDDVQVLNFDSCTWSTASSK  122



>ref|XP_006400408.1| hypothetical protein EUTSA_v10012828mg [Eutrema salsugineum]
 gb|ESQ41861.1| hypothetical protein EUTSA_v10012828mg [Eutrema salsugineum]
Length=701

 Score = 85.1 bits (209),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 61/91 (67%), Gaps = 11/91 (12%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MF FS+RRM+LGR+K VQLSD+ QG KSP+R  KR  +S+ EA   + + S+E   Q S 
Sbjct  1    MFSFSKRRMRLGRVKKVQLSDSVQGFKSPLRATKRADNSSNEAALAATSYSDELDFQPS-  59

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
                     SG+ ENWMVLS++G+KP PRFN
Sbjct  60   ---------SGNYENWMVLSVSGEKPAPRFN  81


 Score = 36.2 bits (82),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA +GNKM++VGGESG+G L+DVQVLNFD  +W+S SSK
Sbjct  82   HAAAAIGNKMIIVGGESGNGFLDDVQVLNFDSFTWSSASSK  122



>gb|KHG00526.1| Acyl-CoA-binding domain-containing 4 -like protein [Gossypium 
arboreum]
Length=703

 Score = 83.2 bits (204),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 66/95 (69%), Gaps = 13/95 (14%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAV---GNS-INDSEESSC  304
            MF FSRRRMKL R+K VQLS++  GT+SPIR  KR +++  E+    G S  ND + S+ 
Sbjct  3    MFSFSRRRMKLNRVKKVQLSESVHGTRSPIRPSKRNNNTIVESALPAGTSHCNDFDPST-  61

Query  305  QHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
                 A E N  +SG+SENWMVLS+AG+KP+PRFN
Sbjct  62   -----APEIN--SSGNSENWMVLSVAGEKPVPRFN  89


 Score = 38.1 bits (87),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAV+GN+M+VVGGESG+GLL+DVQVLNFD  SWT+ SSK
Sbjct  90   HAAAVLGNRMIVVGGESGNGLLDDVQVLNFDNFSWTTASSK  130



>ref|XP_004508299.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Cicer arietinum]
Length=716

 Score = 82.4 bits (202),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 64/100 (64%), Gaps = 18/100 (18%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPI--RHPKRFSSST--------GEAVGNSINDS  289
            MFGFSRRR KLGRLKVQ    ++GT+SPI  RHPKR  +S         G+AV  S   S
Sbjct  1    MFGFSRRRTKLGRLKVQ--QLSEGTRSPIIVRHPKRIPNSILNGEEEEDGDAVAGSSGHS  58

Query  290  EESSCQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            +E+ C   + +      +S  S+NW++LSI+GDKPIPRFN
Sbjct  59   DENVCSDISSS------SSAGSDNWVLLSISGDKPIPRFN  92


 Score = 38.1 bits (87),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAV+GNK++VVGGES +GLL+DVQVLNFD  SWT+ SSK
Sbjct  93   HAAAVIGNKIIVVGGESATGLLDDVQVLNFDTFSWTTASSK  133



>ref|XP_010024637.1| PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-binding domain-containing 
protein 4 [Eucalyptus grandis]
Length=696

 Score = 85.1 bits (209),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 61/91 (67%), Gaps = 6/91 (7%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MFG SRRRMK+GR+K VQLSD  QGT+SP+R  KR ++   E    + + S E+  Q  +
Sbjct  1    MFGISRRRMKIGRVKKVQLSDATQGTRSPMRQIKRGNNQNNEGAVPASDCSNENDSQSPS  60

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
             A E +     SSENW VLSI+G+KP+PRFN
Sbjct  61   SAPEIS-----SSENWKVLSISGEKPMPRFN  86


 Score = 35.0 bits (79),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+A V+ NKM+VVGGESG+GLL+DVQVL FDR SWT+ SSK
Sbjct  87   HAATVIENKMIVVGGESGNGLLDDVQVLRFDRFSWTAASSK  127



>ref|XP_010492874.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Camelina sativa]
 ref|XP_010492875.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Camelina sativa]
Length=707

 Score = 82.8 bits (203),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 60/91 (66%), Gaps = 11/91 (12%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MF FS+RRM+LGR+K VQL+++ QG KSP+R  KR  +S+ EAV  + + S+E   Q S 
Sbjct  1    MFSFSKRRMRLGRVKKVQLAESVQGYKSPLRTIKRADNSSNEAVLAATSYSDEVDFQPS-  59

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
                     S +SENWMVL + GDKP PRFN
Sbjct  60   ---------SRNSENWMVLPVGGDKPAPRFN  81


 Score = 37.0 bits (84),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA +GNKM+VVGGESG+GLL+DVQVLNFD  +W++VSSK
Sbjct  82   HAAAAIGNKMIVVGGESGNGLLDDVQVLNFDSFTWSTVSSK  122



>gb|KCW61088.1| hypothetical protein EUGRSUZ_H03862 [Eucalyptus grandis]
Length=510

 Score = 84.3 bits (207),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 61/91 (67%), Gaps = 6/91 (7%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MFG SRRRMK+GR+K VQLSD  QGT+SP+R  KR ++   E    + + S E+  Q  +
Sbjct  1    MFGISRRRMKIGRVKKVQLSDATQGTRSPMRQIKRGNNQNNEGAVPASDCSNENDSQSPS  60

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
             A E +     SSENW VLSI+G+KP+PRFN
Sbjct  61   SAPEIS-----SSENWKVLSISGEKPMPRFN  86


 Score = 34.7 bits (78),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+A V+ NKM+VVGGESG+GLL+DVQVL FDR SWT+ SSK
Sbjct  87   HAATVIENKMIVVGGESGNGLLDDVQVLRFDRFSWTAASSK  127



>ref|XP_006287583.1| hypothetical protein CARUB_v10000793mg [Capsella rubella]
 gb|EOA20481.1| hypothetical protein CARUB_v10000793mg [Capsella rubella]
Length=498

 Score = 83.2 bits (204),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 61/91 (67%), Gaps = 11/91 (12%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MF FS+RRM+LGR+K VQL+++ QG KSP+R  KR  +S+ EA   + + S+E   Q S 
Sbjct  1    MFSFSKRRMRLGRVKKVQLAESVQGYKSPLRTIKRADNSSSEAPVAATSYSDEHDFQPS-  59

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
                     SG+SENWMV+S+ GDKP PRFN
Sbjct  60   ---------SGNSENWMVVSVGGDKPAPRFN  81


 Score = 35.4 bits (80),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA +GNKM+VVGGES +GLL+DVQVLNFD  +W++ SSK
Sbjct  82   HAAAAIGNKMIVVGGESSNGLLDDVQVLNFDTFTWSTASSK  122



>ref|XP_002873905.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50164.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=709

 Score = 80.9 bits (198),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 59/91 (65%), Gaps = 11/91 (12%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MF FS+RRM+LGR+K VQLS++ QG KSP+R  K   +S+ EA   + + S+E   Q S 
Sbjct  1    MFSFSKRRMRLGRVKKVQLSESVQGYKSPLRVTKLADNSSNEAAVAATSYSDEFDFQPS-  59

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
                     SG+SENWMVLS+ G KP PRFN
Sbjct  60   ---------SGNSENWMVLSVGGAKPAPRFN  81


 Score = 35.8 bits (81),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA +GNKM+VVGGESGSGLL+DVQVLNFD  +W++ SSK
Sbjct  82   HAAAAIGNKMIVVGGESGSGLLDDVQVLNFDSCTWSTASSK  122



>ref|XP_010420635.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Camelina sativa]
Length=691

 Score = 79.7 bits (195),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 59/91 (65%), Gaps = 11/91 (12%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MF FS+RRM+LGR+K VQL+++ QG KSP+R  KR  +S+ EAV  + + S+E     S 
Sbjct  1    MFSFSKRRMRLGRVKKVQLAESVQGYKSPLRTIKRADNSSNEAVLAATSYSDEVDFLPS-  59

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
                     S ++ENWMVL + GDKP PRFN
Sbjct  60   ---------SRTTENWMVLPVGGDKPAPRFN  81


 Score = 37.0 bits (84),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA +GNKM+VVGGESG+GLL+DVQVLNFD  +W++VSSK
Sbjct  82   HAAAAIGNKMIVVGGESGNGLLDDVQVLNFDSFTWSTVSSK  122



>ref|XP_010420634.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Camelina sativa]
Length=707

 Score = 79.7 bits (195),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 59/91 (65%), Gaps = 11/91 (12%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MF FS+RRM+LGR+K VQL+++ QG KSP+R  KR  +S+ EAV  + + S+E     S 
Sbjct  1    MFSFSKRRMRLGRVKKVQLAESVQGYKSPLRTIKRADNSSNEAVLAATSYSDEVDFLPS-  59

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
                     S ++ENWMVL + GDKP PRFN
Sbjct  60   ---------SRTTENWMVLPVGGDKPAPRFN  81


 Score = 37.0 bits (84),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA +GNKM+VVGGESG+GLL+DVQVLNFD  +W++VSSK
Sbjct  82   HAAAAIGNKMIVVGGESGNGLLDDVQVLNFDSFTWSTVSSK  122



>gb|AES91803.2| acyl-CoA-binding domain protein [Medicago truncatula]
Length=719

 Score = 79.7 bits (195),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 64/105 (61%), Gaps = 21/105 (20%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQ-LSDTAQGTKSPI--RHPKRFSSST--GEAVGNSINDSEESSC  304
            MFGFSRRR K GR KVQ LSD   GT+SP+  RHPKR  +S   GE   + I D+   S 
Sbjct  1    MFGFSRRRTKFGRFKVQQLSD---GTRSPVSVRHPKRIPNSILNGEGEEDGIGDAVTGSS  57

Query  305  QHSTGASEFNN----------CTSGSSENWMVLSIAGDKPIPRFN  409
             HS    E +N          C+SG SENW++LSI+GDKP PRFN
Sbjct  58   GHS---HEIDNEIVSSTDISSCSSGGSENWVLLSISGDKPAPRFN  99


 Score = 36.6 bits (83),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAV+GNK++VVGGES +GLL+DVQVLNF+  SWT+ SSK
Sbjct  100  HAAAVIGNKIIVVGGESSTGLLDDVQVLNFETFSWTTASSK  140



>ref|XP_003609607.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula]
Length=735

 Score = 79.7 bits (195),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 64/105 (61%), Gaps = 21/105 (20%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQ-LSDTAQGTKSPI--RHPKRFSSST--GEAVGNSINDSEESSC  304
            MFGFSRRR K GR KVQ LSD   GT+SP+  RHPKR  +S   GE   + I D+   S 
Sbjct  1    MFGFSRRRTKFGRFKVQQLSD---GTRSPVSVRHPKRIPNSILNGEGEEDGIGDAVTGSS  57

Query  305  QHSTGASEFNN----------CTSGSSENWMVLSIAGDKPIPRFN  409
             HS    E +N          C+SG SENW++LSI+GDKP PRFN
Sbjct  58   GHS---HEIDNEIVSSTDISSCSSGGSENWVLLSISGDKPAPRFN  99


 Score = 36.6 bits (83),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAV+GNK++VVGGES +GLL+DVQVLNF+  SWT+ SSK
Sbjct  100  HAAAVIGNKIIVVGGESSTGLLDDVQVLNFETFSWTTASSK  140



>ref|XP_003609606.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula]
Length=743

 Score = 79.7 bits (195),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 64/105 (61%), Gaps = 21/105 (20%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQ-LSDTAQGTKSPI--RHPKRFSSST--GEAVGNSINDSEESSC  304
            MFGFSRRR K GR KVQ LSD   GT+SP+  RHPKR  +S   GE   + I D+   S 
Sbjct  1    MFGFSRRRTKFGRFKVQQLSD---GTRSPVSVRHPKRIPNSILNGEGEEDGIGDAVTGSS  57

Query  305  QHSTGASEFNN----------CTSGSSENWMVLSIAGDKPIPRFN  409
             HS    E +N          C+SG SENW++LSI+GDKP PRFN
Sbjct  58   GHS---HEIDNEIVSSTDISSCSSGGSENWVLLSISGDKPAPRFN  99


 Score = 36.6 bits (83),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAV+GNK++VVGGES +GLL+DVQVLNF+  SWT+ SSK
Sbjct  100  HAAAVIGNKIIVVGGESSTGLLDDVQVLNFETFSWTTASSK  140



>gb|AES91804.2| acyl-CoA-binding domain protein [Medicago truncatula]
Length=711

 Score = 80.1 bits (196),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 64/105 (61%), Gaps = 21/105 (20%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQ-LSDTAQGTKSPI--RHPKRFSSST--GEAVGNSINDSEESSC  304
            MFGFSRRR K GR KVQ LSD   GT+SP+  RHPKR  +S   GE   + I D+   S 
Sbjct  1    MFGFSRRRTKFGRFKVQQLSD---GTRSPVSVRHPKRIPNSILNGEGEEDGIGDAVTGSS  57

Query  305  QHSTGASEFNN----------CTSGSSENWMVLSIAGDKPIPRFN  409
             HS    E +N          C+SG SENW++LSI+GDKP PRFN
Sbjct  58   GHS---HEIDNEIVSSTDISSCSSGGSENWVLLSISGDKPAPRFN  99


 Score = 36.6 bits (83),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAV+GNK++VVGGES +GLL+DVQVLNF+  SWT+ SSK
Sbjct  100  HAAAVIGNKIIVVGGESSTGLLDDVQVLNFETFSWTTASSK  140



>ref|XP_010524753.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Tarenaya 
hassleriana]
 ref|XP_010524754.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Tarenaya 
hassleriana]
 ref|XP_010524755.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Tarenaya 
hassleriana]
Length=698

 Score = 81.6 bits (200),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 58/92 (63%), Gaps = 13/92 (14%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MF FSRRR KLGR+K VQLSD+A G  SP+R  KR        V NS N+  E+  +HS 
Sbjct  1    MFSFSRRRTKLGRVKKVQLSDSASGRASPLRQTKR--------VNNSTNEGAETEARHS-  51

Query  317  GASEFN-NCTSGSSENWMVLSIAGDKPIPRFN  409
               E +     G++ENWMVLS+ G+KP PRFN
Sbjct  52   --DELDFQSPPGNAENWMVLSVGGEKPSPRFN  81


 Score = 34.7 bits (78),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA +GNKM+VVGGESG+GLL+DVQVLNFD  +W + SSK
Sbjct  82   HAAAAIGNKMIVVGGESGNGLLDDVQVLNFDTFTWAAASSK  122



>ref|XP_010904791.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Elaeis guineensis]
Length=706

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 62/96 (65%), Gaps = 2/96 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSINDSE-ESSCQHS  313
            MFGFSRRRMKLGRLKV L D +QGT+SP+R  KR S + GE  V  S++    + + Q S
Sbjct  4    MFGFSRRRMKLGRLKVHLGDPSQGTRSPVRPTKRASQANGENVVPASVSGRPGDINYQCS  63

Query  314  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFNVVCI  421
             G  + + C  GSSENW VL   G KP  RFN++ +
Sbjct  64   LGTFDLSKCGLGSSENWTVLPTEGHKPASRFNILSL  99



>ref|XP_010454111.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Camelina sativa]
Length=707

 Score = 82.0 bits (201),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 60/91 (66%), Gaps = 11/91 (12%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  316
            MF FS+RRM+LGR+K VQL+++ QG KSP+R  KR  +S+ EAV  + + S+E   Q S 
Sbjct  1    MFSFSKRRMRLGRVKKVQLAESVQGYKSPLRTIKRADNSSNEAVLAATSYSDEVGFQPS-  59

Query  317  GASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
                     S ++ENWMVL + GDKP PRFN
Sbjct  60   ---------SRTTENWMVLPVGGDKPAPRFN  81


 Score = 33.1 bits (74),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA +GNKM+VVGGESG+GLL+DVQVL FD  +W++V SK
Sbjct  82   HAAAAIGNKMIVVGGESGNGLLDDVQVLKFDSFTWSTVPSK  122



>ref|XP_008804572.1| PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-binding domain-containing 
protein 5 [Phoenix dactylifera]
Length=715

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 63/92 (68%), Gaps = 2/92 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  313
            MFGFSRRRMKLGRLKV L D +QGT+SP R  KR + S GE  V  S++  S++ +C  S
Sbjct  4    MFGFSRRRMKLGRLKVHLGDPSQGTRSPSRPTKRVNQSDGENVVSASVSGRSDDINCPCS  63

Query  314  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
             GA + +  + GSS+NWMVL   G KP PRF+
Sbjct  64   VGAFDPSKRSLGSSDNWMVLPTEGHKPAPRFH  95



>ref|XP_009393228.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009393229.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Musa 
acuminata subsp. malaccensis]
Length=730

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 60/92 (65%), Gaps = 2/92 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSST--GEAVGNSINDSEESSCQHS  313
            +FGFSRRR KLGRLKV L+D  QGT+SPIR  KR S S    E + +S   S++ +C  S
Sbjct  4    IFGFSRRRTKLGRLKVHLADPVQGTRSPIRPSKRHSQSNEENEVLPSSSGRSDDHNCHCS  63

Query  314  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            +   + + C+  SSENW VL   G+KP PRF+
Sbjct  64   SRTFDLHKCSVDSSENWKVLPTYGNKPTPRFH  95



>ref|XP_010904792.1| PREDICTED: tip elongation aberrant protein 3-like isoform X4 
[Elaeis guineensis]
Length=705

 Score = 88.2 bits (217),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 59/92 (64%), Gaps = 2/92 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSINDSE-ESSCQHS  313
            MFGFSRRRMKLGRLKV L D +QGT+SP+R  KR S + GE  V  S++    + + Q S
Sbjct  4    MFGFSRRRMKLGRLKVHLGDPSQGTRSPVRPTKRASQANGENVVPASVSGRPGDINYQCS  63

Query  314  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
             G  + + C  GSSENW VL   G KP  RFN
Sbjct  64   LGTFDLSKCGLGSSENWTVLPTEGHKPASRFN  95


 Score = 25.4 bits (54),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAVVG+KMVVVGG+SG GL++D  +L+ D  +W + ++K
Sbjct  96   HAAAVVGSKMVVVGGDSGHGLMDDTLILSLDNLTWAAAATK  136



>ref|XP_010904789.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Elaeis guineensis]
Length=732

 Score = 88.2 bits (217),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 59/92 (64%), Gaps = 2/92 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSINDSE-ESSCQHS  313
            MFGFSRRRMKLGRLKV L D +QGT+SP+R  KR S + GE  V  S++    + + Q S
Sbjct  4    MFGFSRRRMKLGRLKVHLGDPSQGTRSPVRPTKRASQANGENVVPASVSGRPGDINYQCS  63

Query  314  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
             G  + + C  GSSENW VL   G KP  RFN
Sbjct  64   LGTFDLSKCGLGSSENWTVLPTEGHKPASRFN  95


 Score = 25.0 bits (53),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAVVG+KMVVVGG+SG GL++D  +L+ D  +W + ++K
Sbjct  96   HAAAVVGSKMVVVGGDSGHGLMDDTLILSLDNLTWAAAATK  136



>ref|XP_010904790.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Elaeis guineensis]
Length=729

 Score = 88.2 bits (217),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 59/92 (64%), Gaps = 2/92 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSINDSE-ESSCQHS  313
            MFGFSRRRMKLGRLKV L D +QGT+SP+R  KR S + GE  V  S++    + + Q S
Sbjct  4    MFGFSRRRMKLGRLKVHLGDPSQGTRSPVRPTKRASQANGENVVPASVSGRPGDINYQCS  63

Query  314  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
             G  + + C  GSSENW VL   G KP  RFN
Sbjct  64   LGTFDLSKCGLGSSENWTVLPTEGHKPASRFN  95


 Score = 25.0 bits (53),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAVVG+KMVVVGG+SG GL++D  +L+ D  +W + ++K
Sbjct  96   HAAAVVGSKMVVVGGDSGHGLMDDTLILSLDNLTWAAAATK  136



>ref|XP_010931595.1| PREDICTED: tip elongation aberrant protein 3 isoform X4 [Elaeis 
guineensis]
Length=717

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 60/92 (65%), Gaps = 2/92 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  313
            MFGFSRRRMKLGR+KV L D +QG +SP R   R + S GE  V  S++  S++ +C  S
Sbjct  4    MFGFSRRRMKLGRMKVHLGDPSQGIRSPSRPTNRVNQSNGENVVSTSVSGRSDDINCMCS  63

Query  314  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            +GA +  N   GSSENW VL   G KP PRF+
Sbjct  64   SGAFDLGNRILGSSENWTVLPTEGLKPAPRFH  95



>ref|XP_010931593.1| PREDICTED: tip elongation aberrant protein 3 isoform X3 [Elaeis 
guineensis]
Length=727

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 60/92 (65%), Gaps = 2/92 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  313
            MFGFSRRRMKLGR+KV L D +QG +SP R   R + S GE  V  S++  S++ +C  S
Sbjct  4    MFGFSRRRMKLGRMKVHLGDPSQGIRSPSRPTNRVNQSNGENVVSTSVSGRSDDINCMCS  63

Query  314  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            +GA +  N   GSSENW VL   G KP PRF+
Sbjct  64   SGAFDLGNRILGSSENWTVLPTEGLKPAPRFH  95



>ref|XP_010931591.1| PREDICTED: tip elongation aberrant protein 3 isoform X1 [Elaeis 
guineensis]
Length=733

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 60/92 (65%), Gaps = 2/92 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  313
            MFGFSRRRMKLGR+KV L D +QG +SP R   R + S GE  V  S++  S++ +C  S
Sbjct  4    MFGFSRRRMKLGRMKVHLGDPSQGIRSPSRPTNRVNQSNGENVVSTSVSGRSDDINCMCS  63

Query  314  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            +GA +  N   GSSENW VL   G KP PRF+
Sbjct  64   SGAFDLGNRILGSSENWTVLPTEGLKPAPRFH  95



>ref|XP_010931592.1| PREDICTED: tip elongation aberrant protein 3 isoform X2 [Elaeis 
guineensis]
Length=730

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 60/92 (65%), Gaps = 2/92 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  313
            MFGFSRRRMKLGR+KV L D +QG +SP R   R + S GE  V  S++  S++ +C  S
Sbjct  4    MFGFSRRRMKLGRMKVHLGDPSQGIRSPSRPTNRVNQSNGENVVSTSVSGRSDDINCMCS  63

Query  314  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            +GA +  N   GSSENW VL   G KP PRF+
Sbjct  64   SGAFDLGNRILGSSENWTVLPTEGLKPAPRFH  95



>ref|XP_009402527.1| PREDICTED: kelch repeat-containing protein 1-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=733

 Score = 82.8 bits (203),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 58/91 (64%), Gaps = 2/91 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE--AVGNSINDSEESSCQHS  313
            +FGFSRRR K+GRLKV L D  QGT+SPIR   + S +  E   + +S   S++ +C  S
Sbjct  4    IFGFSRRRKKIGRLKVHLKDPLQGTRSPIRSSNQLSQTNEENGGLASSSGRSDDPNCHFS  63

Query  314  TGASEFNNCTSGSSENWMVLSIAGDKPIPRF  406
            +   + +NC+  SS+NW +L   G+KP PRF
Sbjct  64   SHTCDLHNCSLESSKNWNLLPTYGNKPTPRF  94


 Score = 28.5 bits (62),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+A VVG+KMVVVGG+S   LL+D Q+L+ D  +W S +SK
Sbjct  96   HAATVVGSKMVVVGGDSSHDLLDDTQILSLDSLTWASATSK  136



>ref|XP_004979880.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Setaria italica]
Length=685

 Score = 80.9 bits (198),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 58/92 (63%), Gaps = 2/92 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  313
            MFGFSRRRMKLGRLK  L D   G++SP R  KRFS   GE  V  S++  +++ + + S
Sbjct  4    MFGFSRRRMKLGRLKGHLHDPFHGSRSPSRQTKRFSHPNGEDPVTTSVSGRADDLAWRCS  63

Query  314  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            +   + N     SSENW VLS  GDKP PRF+
Sbjct  64   SDTFDLNGRAFESSENWAVLSTEGDKPTPRFD  95


 Score = 30.0 bits (66),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA+VG+KMVV GG+SG  LL+D ++L+ D+ SW SVS K
Sbjct  96   HAAAMVGSKMVVFGGDSGHRLLDDTKILSLDKLSWDSVSPK  136



>ref|XP_009402528.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=553

 Score = 82.0 bits (201),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 58/91 (64%), Gaps = 2/91 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE--AVGNSINDSEESSCQHS  313
            +FGFSRRR K+GRLKV L D  QGT+SPIR   + S +  E   + +S   S++ +C  S
Sbjct  4    IFGFSRRRKKIGRLKVHLKDPLQGTRSPIRSSNQLSQTNEENGGLASSSGRSDDPNCHFS  63

Query  314  TGASEFNNCTSGSSENWMVLSIAGDKPIPRF  406
            +   + +NC+  SS+NW +L   G+KP PRF
Sbjct  64   SHTCDLHNCSLESSKNWNLLPTYGNKPTPRF  94


 Score = 28.5 bits (62),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+A VVG+KMVVVGG+S   LL+D Q+L+ D  +W S +SK
Sbjct  96   HAATVVGSKMVVVGGDSSHDLLDDTQILSLDSLTWASATSK  136



>ref|XP_004508300.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X4 [Cicer arietinum]
Length=690

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 67/107 (63%), Gaps = 18/107 (17%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPI--RHPKRFSSST--------GEAVGNSINDS  289
            MFGFSRRR KLGRLKVQ    ++GT+SPI  RHPKR  +S         G+AV  S   S
Sbjct  1    MFGFSRRRTKLGRLKVQ--QLSEGTRSPIIVRHPKRIPNSILNGEEEEDGDAVAGSSGHS  58

Query  290  EESSCQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFNVVCIKYF  430
            +E+ C   + +      +S  S+NW++LSI+GDKPIPRFNV+    F
Sbjct  59   DENVCSDISSS------SSAGSDNWVLLSISGDKPIPRFNVLNFDTF  99



>ref|XP_004508297.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Cicer arietinum]
Length=782

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 64/100 (64%), Gaps = 18/100 (18%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPI--RHPKRFSSST--------GEAVGNSINDS  289
            MFGFSRRR KLGRLKVQ    ++GT+SPI  RHPKR  +S         G+AV  S   S
Sbjct  1    MFGFSRRRTKLGRLKVQ--QLSEGTRSPIIVRHPKRIPNSILNGEEEEDGDAVAGSSGHS  58

Query  290  EESSCQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            +E+ C   + +      +S  S+NW++LSI+GDKPIPRFN
Sbjct  59   DENVCSDISSS------SSAGSDNWVLLSISGDKPIPRFN  92



>ref|XP_004508298.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Cicer arietinum]
Length=776

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 64/100 (64%), Gaps = 18/100 (18%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPI--RHPKRFSSST--------GEAVGNSINDS  289
            MFGFSRRR KLGRLKVQ    ++GT+SPI  RHPKR  +S         G+AV  S   S
Sbjct  1    MFGFSRRRTKLGRLKVQ--QLSEGTRSPIIVRHPKRIPNSILNGEEEEDGDAVAGSSGHS  58

Query  290  EESSCQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            +E+ C   + +      +S  S+NW++LSI+GDKPIPRFN
Sbjct  59   DENVCSDISSS------SSAGSDNWVLLSISGDKPIPRFN  92



>gb|EEE52499.1| hypothetical protein OsJ_34700 [Oryza sativa Japonica Group]
Length=685

 Score = 74.3 bits (181),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 58/92 (63%), Gaps = 3/92 (3%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  313
            MFGFSRRRMKLGRLK  L D   G++SP R  KR S   GE  V  S++  +++ + + S
Sbjct  4    MFGFSRRRMKLGRLKGHLHDPFHGSRSPAR-TKRSSHPNGEDQVTTSVSGRADDLAWRCS  62

Query  314  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            +   + N     +SENW VLS  GDKPIPRF+
Sbjct  63   SDTFDLNGRAFENSENWAVLSTEGDKPIPRFD  94


 Score = 28.1 bits (61),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA+VG+KMVV GG+SG  LL+D ++L+ D+ +W SV+ K
Sbjct  95   HAAAMVGSKMVVFGGDSGHHLLDDTKILSLDKLTWDSVAPK  135



>ref|XP_006663088.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X2 [Oryza brachyantha]
Length=684

 Score = 73.6 bits (179),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 58/92 (63%), Gaps = 3/92 (3%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  313
            MFGFSRRRMKLGRLK  L D   G++SP R  KR S   GE  V  S++  +++ + + S
Sbjct  4    MFGFSRRRMKLGRLKGHLHDPFHGSRSPAR-TKRPSYPNGEDQVTTSVSGRADDLAWRCS  62

Query  314  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            +   + N     +SENW VLS  GDKPIPRF+
Sbjct  63   SDTFDLNGRAFENSENWAVLSTDGDKPIPRFD  94


 Score = 28.1 bits (61),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA+VG+KMVV GG+SG  LL+D ++L+ D+ +W SV+ K
Sbjct  95   HAAAMVGSKMVVFGGDSGHHLLDDTKILSLDKLTWDSVAPK  135



>gb|ABA95166.1| Kelch motif family protein, expressed [Oryza sativa Japonica 
Group]
Length=647

 Score = 73.6 bits (179),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 55/97 (57%), Gaps = 7/97 (7%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIR-----HPK--RFSSSTGEAVGNSINDSEES  298
            MFGFSRRRMKLGRLK  L D   G++SP R     HP   RF     +   +    +++ 
Sbjct  4    MFGFSRRRMKLGRLKGHLHDPFHGSRSPARTKRSSHPNFSRFVQGEDQVTTSVSGRADDL  63

Query  299  SCQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            + + S+   + N     +SENW VLS  GDKPIPRF+
Sbjct  64   AWRCSSDTFDLNGRAFENSENWAVLSTEGDKPIPRFD  100


 Score = 28.1 bits (61),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA+VG+KMVV GG+SG  LL+D ++L+ D+ +W SV+ K
Sbjct  101  HAAAMVGSKMVVFGGDSGHHLLDDTKILSLDKLTWDSVAPK  141



>ref|XP_003577276.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X1 [Brachypodium distachyon]
Length=685

 Score = 74.3 bits (181),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 58/92 (63%), Gaps = 2/92 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTG-EAVGNSIND-SEESSCQHS  313
            MFGFSRRRMKLGRLK  L D   G++SP R  KR S   G E V  S++  ++E++ + S
Sbjct  4    MFGFSRRRMKLGRLKGHLHDPFHGSRSPARLTKRSSYPNGEEPVATSVSGRADENAWRCS  63

Query  314  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            +   + +     +SENW VLS  GDKP PR++
Sbjct  64   SDTFDLSGRAFENSENWAVLSTEGDKPSPRYD  95


 Score = 27.3 bits (59),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA+VG+KM+V GG+SG  LL+D  +L+ D+ +W SV+ K
Sbjct  96   HAAAMVGSKMIVFGGDSGHHLLDDTMILSLDKLTWDSVAPK  136



>ref|XP_010237468.1| PREDICTED: uncharacterized protein LOC100836074 isoform X2 [Brachypodium 
distachyon]
Length=682

 Score = 74.3 bits (181),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 58/92 (63%), Gaps = 2/92 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTG-EAVGNSIND-SEESSCQHS  313
            MFGFSRRRMKLGRLK  L D   G++SP R  KR S   G E V  S++  ++E++ + S
Sbjct  4    MFGFSRRRMKLGRLKGHLHDPFHGSRSPARLTKRSSYPNGEEPVATSVSGRADENAWRCS  63

Query  314  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            +   + +     +SENW VLS  GDKP PR++
Sbjct  64   SDTFDLSGRAFENSENWAVLSTEGDKPSPRYD  95


 Score = 27.3 bits (59),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA+VG+KM+V GG+SG  LL+D  +L+ D+ +W SV+ K
Sbjct  96   HAAAMVGSKMIVFGGDSGHHLLDDTMILSLDKLTWDSVAPK  136



>gb|EEC68565.1| hypothetical protein OsI_36893 [Oryza sativa Indica Group]
Length=685

 Score = 74.3 bits (181),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 58/92 (63%), Gaps = 3/92 (3%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  313
            MFGFSRRRMKLGRLK  L D   G++SP R  KR S   GE  V  S++  +++ + + S
Sbjct  4    MFGFSRRRMKLGRLKGHLHDPFHGSRSPAR-TKRSSHPNGEDQVTTSVSGRADDLAWRCS  62

Query  314  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            +   + N     +SENW VLS  GDKPIPRF+
Sbjct  63   SDTFDLNGRAFENSENWAVLSTEGDKPIPRFD  94


 Score = 26.9 bits (58),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA+VG+KMVV GG+SG  LL+D ++L+ D+ +W S++ K
Sbjct  95   HAAAMVGSKMVVFGGDSGHHLLDDTKILSLDKLTWDSMAPK  135



>gb|AFW60226.1| hypothetical protein ZEAMMB73_572222 [Zea mays]
Length=695

 Score = 72.0 bits (175),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 3/93 (3%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSS--STGEAVGNSIND-SEESSCQH  310
            MFGFSRRRMKLGRLK  L D   G +SP R  KR SS  +  + +  S++  +++ + + 
Sbjct  4    MFGFSRRRMKLGRLKGHLHDHFHGPRSPSRTTKRSSSHHNAEDPLATSVSGRADDLAWRC  63

Query  311  STGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            S+   + N     SSENW VLS  GDKP PRF+
Sbjct  64   SSDTFDLNGRDFESSENWAVLSTEGDKPAPRFD  96


 Score = 28.5 bits (62),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA+VG+KMVV GG+SG  LL+D ++L+ D+ +W SV+ K
Sbjct  97   HAAAMVGSKMVVFGGDSGQSLLDDTKILSLDKLTWDSVAPK  137



>ref|XP_008677101.1| PREDICTED: uncharacterized protein LOC100279529 isoform X1 [Zea 
mays]
Length=695

 Score = 72.0 bits (175),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 3/93 (3%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSS--STGEAVGNSIND-SEESSCQH  310
            MFGFSRRRMKLGRLK  L D   G +SP R  KR SS  +  + +  S++  +++ + + 
Sbjct  4    MFGFSRRRMKLGRLKGHLHDHFHGPRSPSRTTKRSSSHHNAEDPLATSVSGRADDLAWRC  63

Query  311  STGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            S+   + N     SSENW VLS  GDKP PRF+
Sbjct  64   SSDTFDLNGRDFESSENWAVLSTEGDKPAPRFD  96


 Score = 28.5 bits (62),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA+VG+KMVV GG+SG  LL+D ++L+ D+ +W SV+ K
Sbjct  97   HAAAMVGSKMVVFGGDSGQSLLDDTKILSLDKLTWDSVAPK  137



>ref|NP_001145999.1| uncharacterized protein LOC100279529 [Zea mays]
 gb|ACL53010.1| unknown [Zea mays]
Length=717

 Score = 71.6 bits (174),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 3/93 (3%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSS--STGEAVGNSIND-SEESSCQH  310
            MFGFSRRRMKLGRLK  L D   G +SP R  KR SS  +  + +  S++  +++ + + 
Sbjct  4    MFGFSRRRMKLGRLKGHLHDHFHGPRSPSRTTKRSSSHHNAEDPLATSVSGRADDLAWRC  63

Query  311  STGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            S+   + N     SSENW VLS  GDKP PRF+
Sbjct  64   SSDTFDLNGRDFESSENWAVLSTEGDKPAPRFD  96


 Score = 28.5 bits (62),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA+VG+KMVV GG+SG  LL+D ++L+ D+ +W SV+ K
Sbjct  97   HAAAMVGSKMVVFGGDSGQSLLDDTKILSLDKLTWDSVAPK  137



>gb|AFW60227.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_572222 [Zea 
mays]
Length=716

 Score = 72.0 bits (175),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 3/93 (3%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSS--STGEAVGNSIND-SEESSCQH  310
            MFGFSRRRMKLGRLK  L D   G +SP R  KR SS  +  + +  S++  +++ + + 
Sbjct  4    MFGFSRRRMKLGRLKGHLHDHFHGPRSPSRTTKRSSSHHNAEDPLATSVSGRADDLAWRC  63

Query  311  STGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            S+   + N     SSENW VLS  GDKP PRF+
Sbjct  64   SSDTFDLNGRDFESSENWAVLSTEGDKPAPRFD  96


 Score = 28.5 bits (62),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA+VG+KMVV GG+SG  LL+D ++L+ D+ +W SV+ K
Sbjct  97   HAAAMVGSKMVVFGGDSGQSLLDDTKILSLDKLTWDSVAPK  137



>ref|XP_002449932.1| hypothetical protein SORBIDRAFT_05g025915 [Sorghum bicolor]
 gb|EES08920.1| hypothetical protein SORBIDRAFT_05g025915 [Sorghum bicolor]
Length=649

 Score = 71.6 bits (174),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 57/98 (58%), Gaps = 8/98 (8%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSST------GE-AVGNSIND-SEE  295
            MFGFSRRRMKLGRLK  L D    ++SP R  KRFS         GE  +  S++   ++
Sbjct  4    MFGFSRRRMKLGRLKGHLHDHFHASRSPSRTTKRFSHPNVCRFVQGEDPLTTSVSGRPDD  63

Query  296  SSCQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
             S + S+   + N     SSENW VLS  GDKP+PRF+
Sbjct  64   HSWRCSSDTFDINGRAFESSENWAVLSTEGDKPVPRFD  101


 Score = 28.5 bits (62),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA+VG+KMVV GG+SG  LL+D ++L+ D+ +W SV+ K
Sbjct  102  HAAAMVGSKMVVFGGDSGQCLLDDTKILSLDKLTWDSVAPK  142



>ref|XP_006663087.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X1 [Oryza brachyantha]
Length=690

 Score = 71.2 bits (173),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 55/97 (57%), Gaps = 7/97 (7%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIR-----HPK--RFSSSTGEAVGNSINDSEES  298
            MFGFSRRRMKLGRLK  L D   G++SP R     +P   RF     +   +    +++ 
Sbjct  4    MFGFSRRRMKLGRLKGHLHDPFHGSRSPARTKRPSYPNFSRFVQGEDQVTTSVSGRADDL  63

Query  299  SCQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            + + S+   + N     +SENW VLS  GDKPIPRF+
Sbjct  64   AWRCSSDTFDLNGRAFENSENWAVLSTDGDKPIPRFD  100


 Score = 28.1 bits (61),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA+VG+KMVV GG+SG  LL+D ++L+ D+ +W SV+ K
Sbjct  101  HAAAMVGSKMVVFGGDSGHHLLDDTKILSLDKLTWDSVAPK  141



>gb|KEH32273.1| acyl-CoA-binding domain protein [Medicago truncatula]
Length=718

 Score = 58.2 bits (139),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 54/93 (58%), Gaps = 21/93 (23%)
 Frame = +2

Query  176  RLKVQ-LSDTAQGTKSPI--RHPKRFSSST--GEAVGNSINDSEESSCQHSTGASEFNN-  337
            R KVQ LSD   GT+SP+  RHPKR  +S   GE   + I D+   S  HS    E +N 
Sbjct  12   RFKVQQLSD---GTRSPVSVRHPKRIPNSILNGEGEEDGIGDAVTGSSGHS---HEIDNE  65

Query  338  ---------CTSGSSENWMVLSIAGDKPIPRFN  409
                     C+SG SENW++LSI+GDKP PRFN
Sbjct  66   IVSSTDISSCSSGGSENWVLLSISGDKPAPRFN  98


 Score = 36.6 bits (83),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAV+GNK++VVGGES +GLL+DVQVLNF+  SWT+ SSK
Sbjct  99   HAAAVIGNKIIVVGGESSTGLLDDVQVLNFETFSWTTASSK  139



>dbj|BAK00700.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=690

 Score = 65.9 bits (159),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 57/92 (62%), Gaps = 3/92 (3%)
 Frame = +2

Query  137  NMFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSIND-SEESSCQHS  313
            NMFGFSRRRMKLGR K   SD   G++SP  H     S+ G+ +  S++  +++ + + S
Sbjct  4    NMFGFSRRRMKLGRSKGNKSDPLHGSRSPGGHLSL--SNGGDPITASVSGRADDLAYRCS  61

Query  314  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            + + + +     SSENW VLS  GDKP PRF+
Sbjct  62   SDSFDLDARALDSSENWAVLSTEGDKPAPRFS  93


 Score = 28.1 bits (61),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA+VG+KMVV GG+SG  LL+D ++LN ++ +W S + K
Sbjct  94   HAAAIVGSKMVVFGGDSGQHLLDDTKILNLEKLTWDSTTPK  134



>dbj|BAJ86800.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=690

 Score = 65.9 bits (159),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 57/92 (62%), Gaps = 3/92 (3%)
 Frame = +2

Query  137  NMFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSIND-SEESSCQHS  313
            NMFGFSRRRMKLGR K   SD   G++SP  H     S+ G+ +  S++  +++ + + S
Sbjct  4    NMFGFSRRRMKLGRSKGNKSDPLHGSRSPGGHLSL--SNGGDPITASVSGRADDLAYRCS  61

Query  314  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFN  409
            + + + +     SSENW VLS  GDKP PRF+
Sbjct  62   SDSFDLDARALDSSENWAVLSTEGDKPAPRFS  93


 Score = 28.1 bits (61),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA+VG+KMVV GG+SG  LL+D ++LN ++ +W S + K
Sbjct  94   HAAAIVGSKMVVFGGDSGQHLLDDTKILNLEKLTWDSTTPK  134



>ref|XP_003575710.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Brachypodium distachyon]
 ref|XP_010237192.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Brachypodium distachyon]
 ref|XP_010237193.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Brachypodium distachyon]
Length=693

 Score = 65.1 bits (157),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 56/91 (62%), Gaps = 3/91 (3%)
 Frame = +2

Query  137  NMFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSIND-SEESSCQHS  313
            NMFGFSRRR+KLGR K   SD   G+++P RH     ++ G+ +  S++  +++ +   S
Sbjct  3    NMFGFSRRRIKLGRSKGHQSDPLHGSRTPGRHLSL--TNGGDPITTSVSGRADDLAYLCS  60

Query  314  TGASEFNNCTSGSSENWMVLSIAGDKPIPRF  406
            + + + +     SSENW VLS  GDKP PRF
Sbjct  61   SDSFDLDARALDSSENWAVLSTEGDKPNPRF  91


 Score = 26.9 bits (58),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA+VG+KMVV GG+SG G L+D ++LN ++  W S + K
Sbjct  93   HAAAIVGSKMVVFGGDSGHGFLDDTKILNLEKLQWDSAAPK  133



>ref|XP_004962837.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X5 [Setaria italica]
Length=688

 Score = 62.4 bits (150),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 55/91 (60%), Gaps = 2/91 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTG-EAVGNSIND-SEESSCQHS  313
            MFGFSRRR+KLGRLK   SD    ++S     K+ S   G +AV  S++  +++ S + S
Sbjct  1    MFGFSRRRVKLGRLKGDQSDPLNSSRSTTGPAKQLSLPNGDDAVTTSVSGRADDLSYRCS  60

Query  314  TGASEFNNCTSGSSENWMVLSIAGDKPIPRF  406
            +   + +  +   SENW VLS  G+KPIPRF
Sbjct  61   SDTFDLDGRSFNISENWTVLSTEGEKPIPRF  91


 Score = 21.9 bits (45),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA+V +KMVV GG+SG  LL+D ++LN ++  W     K
Sbjct  93   HAAAIVSSKMVVFGGDSGHHLLDDTKILNLEKLIWDPAPPK  133



>ref|XP_004962833.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X1 [Setaria italica]
 ref|XP_004962834.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X2 [Setaria italica]
 ref|XP_004962835.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X3 [Setaria italica]
 ref|XP_004962836.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X4 [Setaria italica]
Length=695

 Score = 62.4 bits (150),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 55/91 (60%), Gaps = 2/91 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTG-EAVGNSIND-SEESSCQHS  313
            MFGFSRRR+KLGRLK   SD    ++S     K+ S   G +AV  S++  +++ S + S
Sbjct  1    MFGFSRRRVKLGRLKGDQSDPLNSSRSTTGPAKQLSLPNGDDAVTTSVSGRADDLSYRCS  60

Query  314  TGASEFNNCTSGSSENWMVLSIAGDKPIPRF  406
            +   + +  +   SENW VLS  G+KPIPRF
Sbjct  61   SDTFDLDGRSFNISENWTVLSTEGEKPIPRF  91


 Score = 21.9 bits (45),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA+V +KMVV GG+SG  LL+D ++LN ++  W     K
Sbjct  93   HAAAIVSSKMVVFGGDSGHHLLDDTKILNLEKLIWDPAPPK  133



>gb|AFW56515.1| hypothetical protein ZEAMMB73_667685 [Zea mays]
Length=202

 Score = 58.9 bits (141),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 52/91 (57%), Gaps = 2/91 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTG-EAVGNSIN-DSEESSCQHS  313
            MFGFSRRR+KLGR K   SD    ++S +   K  S   G +A   S++  +++ S + S
Sbjct  1    MFGFSRRRVKLGRSKGDPSDPLNSSRSSVGPSKHLSLPNGNDATMTSVSGHADDLSYRCS  60

Query  314  TGASEFNNCTSGSSENWMVLSIAGDKPIPRF  406
            +   +    T   SENW VLS  GDKPIPRF
Sbjct  61   SDTFDPQGRTFDISENWTVLSTEGDKPIPRF  91


 Score = 25.0 bits (53),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA+V +KMVV GG+SG+ LL+D ++LN ++ +W S   K
Sbjct  93   HAAAIVSSKMVVFGGDSGNRLLDDTKILNLEKLTWDSAPPK  133



>ref|NP_001146281.1| uncharacterized protein LOC100279856 [Zea mays]
 gb|ACL53624.1| unknown [Zea mays]
 gb|ACN34064.1| unknown [Zea mays]
 gb|AFW56517.1| hypothetical protein ZEAMMB73_667685 [Zea mays]
Length=690

 Score = 58.9 bits (141),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 52/91 (57%), Gaps = 2/91 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTG-EAVGNSIN-DSEESSCQHS  313
            MFGFSRRR+KLGR K   SD    ++S +   K  S   G +A   S++  +++ S + S
Sbjct  1    MFGFSRRRVKLGRSKGDPSDPLNSSRSSVGPSKHLSLPNGNDATMTSVSGHADDLSYRCS  60

Query  314  TGASEFNNCTSGSSENWMVLSIAGDKPIPRF  406
            +   +    T   SENW VLS  GDKPIPRF
Sbjct  61   SDTFDPQGRTFDISENWTVLSTEGDKPIPRF  91


 Score = 25.0 bits (53),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA+V +KMVV GG+SG+ LL+D ++LN ++ +W S   K
Sbjct  93   HAAAIVSSKMVVFGGDSGNRLLDDTKILNLEKLTWDSAPPK  133



>gb|AFW56516.1| hypothetical protein ZEAMMB73_667685 [Zea mays]
Length=566

 Score = 58.5 bits (140),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 52/91 (57%), Gaps = 2/91 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTG-EAVGNSIN-DSEESSCQHS  313
            MFGFSRRR+KLGR K   SD    ++S +   K  S   G +A   S++  +++ S + S
Sbjct  1    MFGFSRRRVKLGRSKGDPSDPLNSSRSSVGPSKHLSLPNGNDATMTSVSGHADDLSYRCS  60

Query  314  TGASEFNNCTSGSSENWMVLSIAGDKPIPRF  406
            +   +    T   SENW VLS  GDKPIPRF
Sbjct  61   SDTFDPQGRTFDISENWTVLSTEGDKPIPRF  91


 Score = 25.0 bits (53),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA+V +KMVV GG+SG+ LL+D ++LN ++ +W S   K
Sbjct  93   HAAAIVSSKMVVFGGDSGNRLLDDTKILNLEKLTWDSAPPK  133



>gb|EMS52652.1| Acyl-CoA-binding domain-containing protein 4 [Triticum urartu]
Length=1002

 Score = 50.1 bits (118),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 50/95 (53%), Gaps = 4/95 (4%)
 Frame = +2

Query  137  NMFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQH  310
            N  G +RR  +   LK  L D   G +SP    KR S  TGE  V  S++   ++ + + 
Sbjct  102  NANGLTRRFAR--PLKGHLHDPFHGPRSPAHPTKRSSHLTGEEPVATSVSGRPDDLAWRC  159

Query  311  STGASEFNNCTSGSSENWMVLSIAGDKPIPRFNVV  415
            S+   + N     +SENW VLS  GDKP PRF+V+
Sbjct  160  SSDTFDLNGRAFENSENWAVLSTDGDKPSPRFDVI  194


 Score = 33.5 bits (75),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 26/62 (42%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +1

Query  430  LVQFYGYSM*SKSQSFIFPE*HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVS  609
            ++ FY  +  + S  + F + H+AA+VG+KM+V GG+SG+ LL+D ++L+ D+ +W SV+
Sbjct  212  IIGFYTEASITHSSGYHFKQ-HAAAMVGSKMIVFGGDSGNHLLDDTKILSLDKLTWDSVA  270

Query  610  SK  615
            SK
Sbjct  271  SK  272



>gb|AFW56518.1| hypothetical protein ZEAMMB73_667685 [Zea mays]
Length=442

 Score = 58.5 bits (140),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 52/91 (57%), Gaps = 2/91 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTG-EAVGNSIN-DSEESSCQHS  313
            MFGFSRRR+KLGR K   SD    ++S +   K  S   G +A   S++  +++ S + S
Sbjct  1    MFGFSRRRVKLGRSKGDPSDPLNSSRSSVGPSKHLSLPNGNDATMTSVSGHADDLSYRCS  60

Query  314  TGASEFNNCTSGSSENWMVLSIAGDKPIPRF  406
            +   +    T   SENW VLS  GDKPIPRF
Sbjct  61   SDTFDPQGRTFDISENWTVLSTEGDKPIPRF  91


 Score = 25.0 bits (53),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA+V +KMVV GG+SG+ LL+D ++LN ++ +W S   K
Sbjct  93   HAAAIVSSKMVVFGGDSGNRLLDDTKILNLEKLTWDSAPPK  133



>ref|XP_006664610.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Oryza brachyantha]
Length=698

 Score = 53.5 bits (127),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 51/92 (55%), Gaps = 2/92 (2%)
 Frame = +2

Query  137  NMFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTG-EAVGNSIND-SEESSCQH  310
            NMFGFSR RMK+GR K   +D    +KSP    K  S   G + +  S++  +++ + + 
Sbjct  3    NMFGFSRSRMKIGRSKGHSTDPLDSSKSPSGLVKHLSLPNGDDQITTSVSGRADDLAFRC  62

Query  311  STGASEFNNCTSGSSENWMVLSIAGDKPIPRF  406
            S+   + ++    SS NW VLS  G +P PRF
Sbjct  63   SSDTYDLDDRALVSSRNWAVLSTEGSRPSPRF  94


 Score = 28.9 bits (63),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA++G+KMVV GG++G  LL+D ++LN ++ +W SV+ K
Sbjct  96   HAAAILGSKMVVFGGDAGHQLLDDTKILNLEKLTWDSVTPK  136



>ref|NP_001066944.1| Os12g0538800 [Oryza sativa Japonica Group]
 gb|ABA99338.1| Kelch motif family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29963.1| Os12g0538800 [Oryza sativa Japonica Group]
Length=698

 Score = 51.6 bits (122),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 49/95 (52%), Gaps = 8/95 (8%)
 Frame = +2

Query  137  NMFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-----AVGNSINDSEESS  301
            NMFGFSR RM++GR K   +D    +KSP    K  S   G+     +V   ++D    +
Sbjct  3    NMFGFSRSRMRIGRSKGHSTDPLDSSKSPSGLVKHLSLPNGDDQITTSVSGRVDD---LA  59

Query  302  CQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRF  406
             + S+   + ++    SS NW VLS  G +P PRF
Sbjct  60   FRCSSDTYDLDDRALVSSRNWAVLSTEGSRPSPRF  94


 Score = 28.9 bits (63),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA+VG+KMVV GG+SG  LL+D ++LN ++ +W SV+ K
Sbjct  96   HAAALVGSKMVVFGGDSGDQLLDDTKILNLEKLTWDSVAPK  136



>gb|EEC69433.1| hypothetical protein OsI_38606 [Oryza sativa Indica Group]
Length=698

 Score = 51.6 bits (122),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 49/95 (52%), Gaps = 8/95 (8%)
 Frame = +2

Query  137  NMFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-----AVGNSINDSEESS  301
            NMFGFSR RM++GR K   +D    +KSP    K  S   G+     +V   ++D    +
Sbjct  3    NMFGFSRSRMRIGRSKGHSTDPLDSSKSPSGLVKHLSLPNGDDQITTSVSGRVDD---LA  59

Query  302  CQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRF  406
             + S+   + ++    SS NW VLS  G +P PRF
Sbjct  60   FRCSSDTYDLDDRALVSSRNWAVLSTEGSRPSPRF  94


 Score = 28.9 bits (63),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA+VG+KMVV GG+SG  LL+D ++LN ++ +W SV+ K
Sbjct  96   HAAALVGSKMVVFGGDSGDQLLDDTKILNLEKLTWDSVAPK  136



>gb|EEE53353.1| hypothetical protein OsJ_36377 [Oryza sativa Japonica Group]
Length=549

 Score = 51.6 bits (122),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 50/92 (54%), Gaps = 2/92 (2%)
 Frame = +2

Query  137  NMFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTG-EAVGNSIND-SEESSCQH  310
            NMFGFSR RM++GR K   +D    +KSP    K  S   G + +  S++   ++ + + 
Sbjct  3    NMFGFSRSRMRIGRSKGHSTDPLDSSKSPSGLVKHLSLPNGDDQITTSVSGRVDDLAFRC  62

Query  311  STGASEFNNCTSGSSENWMVLSIAGDKPIPRF  406
            S+   + ++    SS NW VLS  G +P PRF
Sbjct  63   SSDTYDLDDRALVSSRNWAVLSTEGSRPSPRF  94


 Score = 29.3 bits (64),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AA+VG+KMVV GG+SG  LL+D ++LN ++ +W SV+ K
Sbjct  96   HAAALVGSKMVVFGGDSGDQLLDDTKILNLEKLTWDSVAPK  136



>ref|XP_002442260.1| hypothetical protein SORBIDRAFT_08g017180 [Sorghum bicolor]
 gb|EES16098.1| hypothetical protein SORBIDRAFT_08g017180 [Sorghum bicolor]
Length=620

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 55/93 (59%), Gaps = 2/93 (2%)
 Frame = +2

Query  140  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFS-SSTGEAVGNSIN-DSEESSCQHS  313
            MFGFSRRR KLGR K   SD+   ++SP+   K  S  +  +AV  S++  +++ S + S
Sbjct  1    MFGFSRRRGKLGRSKGDPSDSLNSSRSPVGPSKHLSLPNVYDAVMTSVSGGADDLSNRCS  60

Query  314  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFNV  412
            +   + +  T   SENW VLS  G+KP PRF V
Sbjct  61   SDTFDPDGRTFNISENWTVLSTEGNKPTPRFYV  93



>gb|KJB72601.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=665

 Score = 42.0 bits (97),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +2

Query  341  TSGSSENWMVLSIAGDKPIPRFN  409
            +SG+SENWMVLS+AG+ P PRFN
Sbjct  22   SSGNSENWMVLSVAGETPEPRFN  44


 Score = 37.4 bits (85),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+A VVGNKM+VVGGES +GLL+DVQVLNFD  SWT  SSK
Sbjct  45   HAATVVGNKMIVVGGESANGLLDDVQVLNFDTFSWTMASSK  85



>gb|KJB38636.1| hypothetical protein B456_006G264600 [Gossypium raimondii]
Length=632

 Score = 40.0 bits (92),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  493  HSAAVVGNKMvvvggesgsglledvQVLNFDRXSWTSVSSK  615
            H+AAVVGN+M+VVGGESG+GLL+DVQVLNFD  SWTS SSK
Sbjct  16   HAAAVVGNRMIVVGGESGNGLLDDVQVLNFDNFSWTSASSK  56


 Score = 33.9 bits (76),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  365  MVLSIAGDKPIPRFN  409
            MVLS+AG+KP+PRFN
Sbjct  1    MVLSVAGEKPVPRFN  15



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090