BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS014C08

Length=533
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004251694.1|  PREDICTED: uncharacterized protein LOC101250962    266   9e-81   Solanum lycopersicum
ref|XP_006342396.1|  PREDICTED: poly [ADP-ribose] polymerase 4-like     260   1e-78   Solanum tuberosum [potatoes]
ref|XP_006345262.1|  PREDICTED: uncharacterized protein LOC102582049    259   2e-78   Solanum tuberosum [potatoes]
ref|XP_009796968.1|  PREDICTED: uncharacterized protein LOC104243478    258   8e-78   Nicotiana sylvestris
ref|XP_009777936.1|  PREDICTED: uncharacterized protein LOC104227395    256   3e-77   Nicotiana sylvestris
ref|XP_009597215.1|  PREDICTED: uncharacterized protein LOC104093199    255   9e-77   Nicotiana tomentosiformis
gb|EYU25841.1|  hypothetical protein MIMGU_mgv1a001817mg                255   1e-76   Erythranthe guttata [common monkey flower]
ref|XP_009624355.1|  PREDICTED: uncharacterized protein LOC104115430    255   1e-76   Nicotiana tomentosiformis
ref|XP_008450941.1|  PREDICTED: uncharacterized protein LOC103492379    246   1e-73   Cucumis melo [Oriental melon]
emb|CDP03063.1|  unnamed protein product                                246   1e-73   Coffea canephora [robusta coffee]
ref|XP_011078106.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    244   7e-73   Sesamum indicum [beniseed]
ref|XP_004144038.1|  PREDICTED: uncharacterized protein LOC101210279    243   2e-72   Cucumis sativus [cucumbers]
ref|XP_010261798.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    240   4e-71   Nelumbo nucifera [Indian lotus]
ref|XP_011093845.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    239   6e-71   Sesamum indicum [beniseed]
ref|XP_011093846.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    239   7e-71   Sesamum indicum [beniseed]
ref|XP_009149386.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    239   1e-70   Brassica rapa
emb|CDY26699.1|  BnaA06g13230D                                          239   1e-70   Brassica napus [oilseed rape]
ref|XP_002516254.1|  inter-alpha-trypsin inhibitor heavy chain, p...    238   1e-70   Ricinus communis
ref|XP_002277641.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    238   3e-70   Vitis vinifera
emb|CDY41019.1|  BnaC05g14770D                                          237   6e-70   Brassica napus [oilseed rape]
ref|XP_006416537.1|  hypothetical protein EUTSA_v10006890mg             236   1e-69   Eutrema salsugineum [saltwater cress]
gb|EPS65940.1|  hypothetical protein M569_08838                         233   1e-69   Genlisea aurea
ref|XP_010497257.1|  PREDICTED: uncharacterized protein LOC104774321    227   3e-69   Camelina sativa [gold-of-pleasure]
gb|KFK44049.1|  hypothetical protein AALP_AA1G209400                    235   3e-69   Arabis alpina [alpine rockcress]
ref|XP_010273856.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    231   7e-69   Nelumbo nucifera [Indian lotus]
gb|KDP33933.1|  hypothetical protein JCGZ_07504                         233   1e-68   Jatropha curcas
emb|CDX81914.1|  BnaC08g36870D                                          233   2e-68   
ref|XP_010531895.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    232   4e-68   Tarenaya hassleriana [spider flower]
emb|CDY21682.1|  BnaA09g44330D                                          232   4e-68   Brassica napus [oilseed rape]
ref|XP_011007767.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    231   7e-68   Populus euphratica
ref|XP_002324729.2|  inter-alpha-trypsin inhibitor heavy chain-re...    231   1e-67   
ref|XP_009110301.1|  PREDICTED: uncharacterized protein LOC103835866    229   4e-67   Brassica rapa
emb|CDX83787.1|  BnaC08g18580D                                          229   5e-67   
emb|CDX96680.1|  BnaA08g22230D                                          229   5e-67   
ref|XP_010273854.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    227   9e-67   Nelumbo nucifera [Indian lotus]
ref|XP_006306812.1|  hypothetical protein CARUB_v10008355mg             228   1e-66   
ref|XP_010273855.1|  PREDICTED: uncharacterized protein LOC104609...    226   1e-66   Nelumbo nucifera [Indian lotus]
ref|XP_009117566.1|  PREDICTED: uncharacterized protein LOC103842665    228   1e-66   Brassica rapa
ref|XP_010477113.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    228   1e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010498320.1|  PREDICTED: uncharacterized protein LOC104776024    227   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010273853.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    227   2e-66   Nelumbo nucifera [Indian lotus]
ref|XP_010459567.1|  PREDICTED: uncharacterized protein LOC104740606    227   2e-66   Camelina sativa [gold-of-pleasure]
gb|AAF79294.1|AC068602_17  F14D16.26                                    226   3e-66   Arabidopsis thaliana [mouse-ear cress]
gb|KHG11270.1|  von Willebrand factor A domain-containing               226   3e-66   Gossypium arboreum [tree cotton]
ref|NP_173345.2|  inter-alpha-trypsin inhibitor heavy chain-like ...    226   4e-66   Arabidopsis thaliana [mouse-ear cress]
gb|KJB65320.1|  hypothetical protein B456_010G089800                    224   4e-66   Gossypium raimondii
gb|KJB65319.1|  hypothetical protein B456_010G089800                    224   5e-66   Gossypium raimondii
gb|KJB65322.1|  hypothetical protein B456_010G089800                    224   3e-65   Gossypium raimondii
ref|XP_007012610.1|  Inter-alpha-trypsin inhibitor heavy chain-re...    224   4e-65   
gb|KJB65318.1|  hypothetical protein B456_010G089800                    223   5e-65   Gossypium raimondii
ref|XP_010537665.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    223   6e-65   Tarenaya hassleriana [spider flower]
ref|XP_010537668.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    223   8e-65   Tarenaya hassleriana [spider flower]
ref|XP_010537666.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    223   8e-65   Tarenaya hassleriana [spider flower]
ref|XP_010537667.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    223   8e-65   Tarenaya hassleriana [spider flower]
ref|XP_003551107.1|  PREDICTED: von Willebrand factor A domain-co...    222   1e-64   Glycine max [soybeans]
ref|XP_004508009.1|  PREDICTED: uncharacterized protein LOC101514299    222   1e-64   Cicer arietinum [garbanzo]
gb|KDO73865.1|  hypothetical protein CISIN_1g004349mg                   219   2e-64   Citrus sinensis [apfelsine]
ref|XP_006452826.1|  hypothetical protein CICLE_v10007546mg             219   2e-64   
ref|XP_002890318.1|  hypothetical protein ARALYDRAFT_472131             221   2e-64   
ref|XP_010937323.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    221   3e-64   Elaeis guineensis
ref|XP_004287649.1|  PREDICTED: uncharacterized protein LOC101300180    221   4e-64   Fragaria vesca subsp. vesca
ref|XP_007012611.1|  Inter-alpha-trypsin inhibitor heavy chain-re...    220   1e-63   
ref|XP_008388928.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    219   2e-63   
ref|XP_006452827.1|  hypothetical protein CICLE_v10007546mg             219   2e-63   Citrus clementina [clementine]
gb|KDO73864.1|  hypothetical protein CISIN_1g004349mg                   219   2e-63   Citrus sinensis [apfelsine]
ref|XP_007204639.1|  hypothetical protein PRUPE_ppa001864mg             219   2e-63   Prunus persica
ref|XP_008242259.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    219   3e-63   Prunus mume [ume]
ref|XP_008337841.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    218   3e-63   Malus domestica [apple tree]
gb|KHN17734.1|  von Willebrand factor A domain-containing protein       218   4e-63   Glycine soja [wild soybean]
gb|KEH32427.1|  inter-alpha-trypsin inhibitor heavy chain-like pr...    215   5e-63   Medicago truncatula
ref|XP_008782726.1|  PREDICTED: LOW QUALITY PROTEIN: inter alpha-...    218   5e-63   
ref|XP_010666845.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    218   6e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006474710.1|  PREDICTED: uncharacterized protein LOC102609180    217   9e-63   Citrus sinensis [apfelsine]
ref|XP_009359719.1|  PREDICTED: uncharacterized protein LOC103950254    216   3e-62   Pyrus x bretschneideri [bai li]
ref|XP_007154569.1|  hypothetical protein PHAVU_003G129800g             215   5e-62   Phaseolus vulgaris [French bean]
gb|AES92187.2|  inter-alpha-trypsin inhibitor heavy chain-like pr...    215   5e-62   Medicago truncatula
ref|XP_010242255.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    214   8e-62   Nelumbo nucifera [Indian lotus]
ref|XP_003609990.1|  von Willebrand factor A domain-containing pr...    215   1e-61   
gb|KCW79380.1|  hypothetical protein EUGRSUZ_C00792                     211   2e-61   Eucalyptus grandis [rose gum]
ref|XP_003542365.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    213   2e-61   Glycine max [soybeans]
ref|XP_010100827.1|  hypothetical protein L484_000119                   197   7e-61   
ref|XP_002271630.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    211   1e-60   Vitis vinifera
ref|XP_010654417.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    211   1e-60   Vitis vinifera
ref|XP_010047465.1|  PREDICTED: uncharacterized protein LOC104436401    211   1e-60   Eucalyptus grandis [rose gum]
gb|KJB07323.1|  hypothetical protein B456_001G016000                    211   1e-60   Gossypium raimondii
gb|KJB07327.1|  hypothetical protein B456_001G016000                    211   2e-60   Gossypium raimondii
gb|KJB07324.1|  hypothetical protein B456_001G016000                    208   3e-60   Gossypium raimondii
gb|KJB07322.1|  hypothetical protein B456_001G016000                    208   7e-60   Gossypium raimondii
gb|KHG29331.1|  von Willebrand factor A domain-containing               207   3e-59   Gossypium arboreum [tree cotton]
ref|XP_004488095.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    207   4e-59   Cicer arietinum [garbanzo]
ref|XP_009404352.1|  PREDICTED: uncharacterized protein LOC103987694    206   7e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010318476.1|  PREDICTED: von Willebrand factor A domain-co...    203   3e-58   Solanum lycopersicum
ref|XP_003595328.1|  Inter-alpha-trypsin inhibitor heavy chain H3       202   2e-57   Medicago truncatula
ref|XP_009625881.1|  PREDICTED: von Willebrand factor A domain-co...    201   5e-57   Nicotiana tomentosiformis
ref|XP_009625882.1|  PREDICTED: von Willebrand factor A domain-co...    201   6e-57   Nicotiana tomentosiformis
ref|XP_009389548.1|  PREDICTED: uncharacterized protein LOC103976087    201   8e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007138646.1|  hypothetical protein PHAVU_009G226200g             201   8e-57   Phaseolus vulgaris [French bean]
gb|KJB82978.1|  hypothetical protein B456_013G222900                    200   1e-56   Gossypium raimondii
gb|KCW71314.1|  hypothetical protein EUGRSUZ_F04397                     196   3e-56   Eucalyptus grandis [rose gum]
emb|CDO97834.1|  unnamed protein product                                199   4e-56   Coffea canephora [robusta coffee]
ref|XP_004235553.1|  PREDICTED: uncharacterized protein LOC101253...    199   4e-56   Solanum lycopersicum
ref|XP_010318475.1|  PREDICTED: uncharacterized protein LOC101253...    198   5e-56   Solanum lycopersicum
ref|XP_010318474.1|  PREDICTED: uncharacterized protein LOC101253...    198   5e-56   Solanum lycopersicum
ref|XP_009764208.1|  PREDICTED: uncharacterized protein LOC104215...    198   5e-56   Nicotiana sylvestris
ref|XP_009764209.1|  PREDICTED: uncharacterized protein LOC104215...    198   5e-56   Nicotiana sylvestris
gb|KCW71313.1|  hypothetical protein EUGRSUZ_F04397                     196   6e-56   Eucalyptus grandis [rose gum]
gb|KCW71310.1|  hypothetical protein EUGRSUZ_F04397                     196   3e-55   Eucalyptus grandis [rose gum]
ref|XP_010064019.1|  PREDICTED: uncharacterized protein LOC104450974    196   4e-55   Eucalyptus grandis [rose gum]
gb|EYU21307.1|  hypothetical protein MIMGU_mgv1a001939mg                195   7e-55   Erythranthe guttata [common monkey flower]
gb|KJB35007.1|  hypothetical protein B456_006G094900                    194   1e-54   Gossypium raimondii
gb|KJB35006.1|  hypothetical protein B456_006G094900                    194   1e-54   Gossypium raimondii
ref|XP_006342928.1|  PREDICTED: uncharacterized protein LOC102599336    192   1e-53   Solanum tuberosum [potatoes]
ref|XP_007216978.1|  hypothetical protein PRUPE_ppa002885mg             190   3e-53   
ref|XP_011072601.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    190   4e-53   Sesamum indicum [beniseed]
ref|XP_007024661.1|  Inter-alpha-trypsin inhibitor heavy chain-re...    190   5e-53   
ref|XP_008373868.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    189   7e-53   Malus domestica [apple tree]
gb|KDO64974.1|  hypothetical protein CISIN_1g004469mg                   187   1e-52   Citrus sinensis [apfelsine]
ref|XP_006465891.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    189   1e-52   Citrus sinensis [apfelsine]
gb|KDO64973.1|  hypothetical protein CISIN_1g004469mg                   187   1e-52   Citrus sinensis [apfelsine]
ref|XP_007135424.1|  hypothetical protein PHAVU_010G128200g             188   1e-52   Phaseolus vulgaris [French bean]
gb|KEH18486.1|  inter-alpha-trypsin inhibitor heavy chain-like pr...    187   2e-52   Medicago truncatula
ref|XP_009414823.1|  PREDICTED: uncharacterized protein LOC103995...    186   3e-52   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH18485.1|  inter-alpha-trypsin inhibitor heavy chain-like pr...    187   4e-52   Medicago truncatula
ref|XP_004303707.1|  PREDICTED: von Willebrand factor A domain-co...    187   5e-52   Fragaria vesca subsp. vesca
ref|XP_008228173.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    187   6e-52   Prunus mume [ume]
ref|XP_008462285.1|  PREDICTED: uncharacterized protein LOC103500...    187   7e-52   Cucumis melo [Oriental melon]
ref|XP_007135423.1|  hypothetical protein PHAVU_010G128200g             187   7e-52   Phaseolus vulgaris [French bean]
ref|XP_008462286.1|  PREDICTED: uncharacterized protein LOC103500...    187   8e-52   Cucumis melo [Oriental melon]
ref|XP_004141711.1|  PREDICTED: uncharacterized protein LOC101206287    187   8e-52   Cucumis sativus [cucumbers]
gb|KDO64972.1|  hypothetical protein CISIN_1g004469mg                   186   1e-51   Citrus sinensis [apfelsine]
ref|XP_009414822.1|  PREDICTED: uncharacterized protein LOC103995...    186   1e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006426697.1|  hypothetical protein CICLE_v10024980mg             186   1e-51   
ref|XP_004510514.1|  PREDICTED: uncharacterized protein LOC101499440    186   2e-51   Cicer arietinum [garbanzo]
ref|XP_009344471.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    185   3e-51   Pyrus x bretschneideri [bai li]
ref|XP_003528576.1|  PREDICTED: uncharacterized protein LOC100807...    185   3e-51   Glycine max [soybeans]
ref|XP_006587053.1|  PREDICTED: uncharacterized protein LOC100820133    185   3e-51   Glycine max [soybeans]
ref|XP_006583165.1|  PREDICTED: uncharacterized protein LOC100807...    184   4e-51   Glycine max [soybeans]
gb|KDP40680.1|  hypothetical protein JCGZ_24679                         184   5e-51   Jatropha curcas
ref|XP_008342579.1|  PREDICTED: uncharacterized protein LOC103405374    184   6e-51   Malus domestica [apple tree]
ref|XP_010111991.1|  von Willebrand factor A domain-containing pr...    184   6e-51   
ref|XP_002532724.1|  inter-alpha-trypsin inhibitor heavy chain, p...    182   3e-50   Ricinus communis
gb|AET01809.2|  inter-alpha-trypsin inhibitor heavy chain-like pr...    182   3e-50   Medicago truncatula
ref|XP_010685291.1|  PREDICTED: uncharacterized protein LOC104899734    180   2e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009337232.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    179   3e-49   
gb|KHN01425.1|  Inter-alpha-trypsin inhibitor heavy chain H3            178   1e-48   Glycine soja [wild soybean]
gb|KHG04434.1|  von Willebrand factor A domain-containing               174   3e-47   Gossypium arboreum [tree cotton]
ref|XP_011035744.1|  PREDICTED: uncharacterized protein LOC105133...    174   3e-47   Populus euphratica
ref|XP_011035745.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    173   3e-47   Populus euphratica
ref|XP_011035746.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    173   4e-47   Populus euphratica
ref|XP_011035743.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    173   4e-47   Populus euphratica
ref|XP_006385519.1|  hypothetical protein POPTR_0003s06600g             169   3e-46   
gb|KFK41669.1|  hypothetical protein AALP_AA2G157400                    171   4e-46   Arabis alpina [alpine rockcress]
ref|XP_006385520.1|  hypothetical protein POPTR_0003s06600g             169   6e-46   
ref|XP_006385522.1|  hypothetical protein POPTR_0003s06600g             170   6e-46   
ref|XP_006385521.1|  hypothetical protein POPTR_0003s06600g             169   1e-45   Populus trichocarpa [western balsam poplar]
ref|XP_002304123.1|  hypothetical protein POPTR_0003s06600g             169   1e-45   
ref|XP_011036461.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    169   1e-45   Populus euphratica
ref|XP_011036458.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    169   2e-45   Populus euphratica
ref|XP_011036459.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    169   2e-45   Populus euphratica
ref|XP_009105911.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    164   7e-44   Brassica rapa
emb|CDX72920.1|  BnaC06g33680D                                          164   7e-44   
ref|XP_010428136.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    164   8e-44   
ref|XP_006390650.1|  hypothetical protein EUTSA_v10018177mg             164   1e-43   Eutrema salsugineum [saltwater cress]
ref|XP_003627333.1|  hypothetical protein MTR_8g021230                  157   4e-43   
ref|XP_002888881.1|  hypothetical protein ARALYDRAFT_476383             162   5e-43   Arabidopsis lyrata subsp. lyrata
ref|XP_006301970.1|  hypothetical protein CARUB_v10022450mg             161   8e-43   Capsella rubella
ref|XP_010471276.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    161   9e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010416000.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    159   5e-42   Camelina sativa [gold-of-pleasure]
gb|AAG52586.1|AC016529_17  hypothetical protein; 14673-17893            158   1e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177394.2|  uncharacterized protein                               158   1e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010235662.1|  PREDICTED: uncharacterized protein LOC100843408    156   7e-41   Brachypodium distachyon [annual false brome]
ref|XP_010537629.1|  PREDICTED: uncharacterized protein LOC104812256    156   8e-41   Tarenaya hassleriana [spider flower]
gb|KHN39616.1|  Inter-alpha-trypsin inhibitor heavy chain H5            155   9e-41   Glycine soja [wild soybean]
ref|XP_006836596.1|  hypothetical protein AMTR_s00131p00098870          152   2e-39   Amborella trichopoda
gb|EEE67586.1|  hypothetical protein OsJ_25118                          151   4e-39   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ95100.1|  predicted protein                                      151   6e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC82439.1|  hypothetical protein OsI_26857                          149   4e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_004958289.1|  PREDICTED: uncharacterized protein LOC101756562    148   8e-38   
tpg|DAA41434.1|  TPA: hypothetical protein ZEAMMB73_769800              147   2e-37   
ref|XP_002461009.1|  hypothetical protein SORBIDRAFT_02g039160          146   2e-37   Sorghum bicolor [broomcorn]
ref|XP_003557739.1|  PREDICTED: uncharacterized protein LOC100836064    146   3e-37   Brachypodium distachyon [annual false brome]
ref|XP_002465153.1|  hypothetical protein SORBIDRAFT_01g032840          146   4e-37   Sorghum bicolor [broomcorn]
tpg|DAA63586.1|  TPA: hypothetical protein ZEAMMB73_270893              145   4e-37   
gb|ABF96530.1|  von Willebrand factor type A domain containing pr...    144   9e-37   Oryza sativa Japonica Group [Japonica rice]
gb|ABF96529.1|  von Willebrand factor type A domain containing pr...    144   1e-36   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA41433.1|  TPA: hypothetical protein ZEAMMB73_769800              146   1e-36   
ref|XP_006650182.1|  PREDICTED: uncharacterized protein LOC102717967    143   4e-36   Oryza brachyantha
gb|ABF96527.1|  von Willebrand factor type A domain containing pr...    143   4e-36   Oryza sativa Japonica Group [Japonica rice]
gb|AAU89244.1|  von Willebrand factor type A domain containing pr...    143   5e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006658810.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    139   1e-34   
ref|XP_004984064.1|  PREDICTED: uncharacterized protein LOC101774...    135   2e-33   Setaria italica
ref|XP_008667805.1|  PREDICTED: hypothetical protein isoform X1         135   3e-33   
ref|XP_010242206.1|  PREDICTED: uncharacterized protein LOC104586618    114   1e-28   Nelumbo nucifera [Indian lotus]
gb|EEE59232.1|  hypothetical protein OsJ_11214                          103   5e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006593107.1|  PREDICTED: palmitoyl-protein thioesterase 1-...  95.5    2e-20   
gb|KHN07890.1|  von Willebrand factor A domain-containing protein     95.5    2e-19   Glycine soja [wild soybean]
gb|KJB83726.1|  hypothetical protein B456_013G261400                  88.2    6e-17   Gossypium raimondii
ref|XP_006598837.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...  83.6    3e-15   Glycine max [soybeans]
ref|XP_001768544.1|  predicted protein                                82.8    7e-15   
ref|XP_001770617.1|  predicted protein                                81.6    1e-14   
ref|XP_002446722.1|  hypothetical protein SORBIDRAFT_06g021180        67.8    2e-11   
ref|XP_010253846.1|  PREDICTED: protein TIME FOR COFFEE-like          66.2    1e-09   
gb|EEE51525.1|  hypothetical protein OsJ_32720                        58.5    1e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EEC67542.1|  hypothetical protein OsI_34867                        56.2    1e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_001762340.1|  predicted protein                                60.5    1e-07   
ref|XP_011458408.1|  PREDICTED: calcium-dependent protein kinase ...  53.9    2e-05   Fragaria vesca subsp. vesca
gb|KHN12291.1|  Inter-alpha-trypsin inhibitor heavy chain H1          51.6    8e-05   Glycine soja [wild soybean]



>ref|XP_004251694.1| PREDICTED: uncharacterized protein LOC101250962 [Solanum lycopersicum]
Length=753

 Score =   266 bits (679),  Expect = 9e-81, Method: Composition-based stats.
 Identities = 112/139 (81%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  EFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVVDNP  294
            EF  +VEDGLRLSK+I FGKDRAVAPP+ MTAMEKTA SY P++PM+YAVIENPA VDNP
Sbjct  6    EFVKSVEDGLRLSKQIYFGKDRAVAPPKQMTAMEKTAESYFPTSPMMYAVIENPAFVDNP  65

Query  295  DVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCDCRI  474
            D+PSYQPHVHGRCDPPALIPLQMN +S+AA+CY DTAF+TVTGSWR+HCVM SRSCDCRI
Sbjct  66   DIPSYQPHVHGRCDPPALIPLQMNGVSIAADCYFDTAFITVTGSWRLHCVMSSRSCDCRI  125

Query  475  AIPMGEQGSILGLEVEVPR  531
            A+PMGEQGSILG+E+++PR
Sbjct  126  AVPMGEQGSILGVEIQLPR  144



>ref|XP_006342396.1| PREDICTED: poly [ADP-ribose] polymerase 4-like [Solanum tuberosum]
Length=752

 Score =   260 bits (664),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            M GEF  +VEDG+ L+KRI FGKDRAVAPP+ MTAMEK + SYLP +PMLYAVI +PA+V
Sbjct  1    MEGEFVKSVEDGVHLAKRIYFGKDRAVAPPKPMTAMEKASLSYLPESPMLYAVIGDPAIV  60

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+PSYQPHVHGRCDPPALIPLQMN IS+ A+CYLDTAF+TVTGSWRVHCVMGSRSCD
Sbjct  61   DNPDIPSYQPHVHGRCDPPALIPLQMNGISLEADCYLDTAFITVTGSWRVHCVMGSRSCD  120

Query  466  CRIAIPMGEQGSILGLEVEVPR  531
            CRIA+PMGEQGSILG+EVE+PR
Sbjct  121  CRIAVPMGEQGSILGVEVELPR  142



>ref|XP_006345262.1| PREDICTED: uncharacterized protein LOC102582049 [Solanum tuberosum]
Length=754

 Score =   259 bits (662),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  EFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVVDNP  294
            EF  +VEDGLRLSKRI FGKDRAVAPP+ MTAMEKTA SY P++PM+YAVIENPA VDNP
Sbjct  6    EFVKSVEDGLRLSKRIYFGKDRAVAPPKQMTAMEKTAESYFPTSPMMYAVIENPASVDNP  65

Query  295  DVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCDCRI  474
            D+PSYQPHVHGRCDPPALIPLQMN +S+AA+CY DTAF+TV GSWR+HCVM  RSCDCRI
Sbjct  66   DIPSYQPHVHGRCDPPALIPLQMNGVSIAADCYFDTAFITVKGSWRLHCVMSCRSCDCRI  125

Query  475  AIPMGEQGSILGLEVEVPR  531
            A+PMGEQGSILG+E+E+PR
Sbjct  126  AVPMGEQGSILGVEIELPR  144



>ref|XP_009796968.1| PREDICTED: uncharacterized protein LOC104243478 [Nicotiana sylvestris]
Length=753

 Score =   258 bits (658),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 129/143 (90%), Gaps = 1/143 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA EF  AVEDG+ LSKRI FGKDRAVAPP+ MTAMEK + SYLP +PMLYAVI +PA+V
Sbjct  1    MAEEFVKAVEDGVHLSKRIYFGKDRAVAPPKPMTAMEKASQSYLPESPMLYAVINDPAIV  60

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDT-AFVTVTGSWRVHCVMGSRSC  462
            DNPD+PSYQPHVHGRCDPPALIPLQMN IS+ A+CYLD  AF+TVTGSWRVHCVMGSRSC
Sbjct  61   DNPDIPSYQPHVHGRCDPPALIPLQMNGISLEADCYLDNMAFITVTGSWRVHCVMGSRSC  120

Query  463  DCRIAIPMGEQGSILGLEVEVPR  531
            DCRIAIPMGEQGSILG+EVE+PR
Sbjct  121  DCRIAIPMGEQGSILGVEVELPR  143



>ref|XP_009777936.1| PREDICTED: uncharacterized protein LOC104227395 [Nicotiana sylvestris]
Length=757

 Score =   256 bits (654),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  EFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVVDNP  294
            EF   VEDG+RLSKRI FGKDRAVAPP+ MTAM+K A SYLP++PM+YAVIENPA+VDNP
Sbjct  6    EFVKCVEDGIRLSKRIYFGKDRAVAPPKPMTAMDKAAQSYLPTSPMMYAVIENPAIVDNP  65

Query  295  DVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCDCRI  474
            D+PSYQPHVHGRCDPPALIPLQMN ISV A+CY DTA VTVTGSWR+HCVM SRSCDCRI
Sbjct  66   DIPSYQPHVHGRCDPPALIPLQMNGISVVADCYYDTAVVTVTGSWRLHCVMSSRSCDCRI  125

Query  475  AIPMGEQGSILGLEVEVPR  531
            A+PMGEQGSILG++VE+PR
Sbjct  126  AVPMGEQGSILGVDVELPR  144



>ref|XP_009597215.1| PREDICTED: uncharacterized protein LOC104093199 [Nicotiana tomentosiformis]
Length=753

 Score =   255 bits (651),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA EF  AVEDG+ LSKRI FGKDRAVAPP+ MTAMEK + SYLP +PMLYAVI +PA+V
Sbjct  1    MAEEFVKAVEDGVHLSKRIYFGKDRAVAPPKPMTAMEKASQSYLPESPMLYAVINDPAIV  60

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDT-AFVTVTGSWRVHCVMGSRSC  462
            DNPD+PSYQPHVHGRCDPPALIPLQMN IS+ A+CYLD  AF+TVTGSWRVHCVMGSRSC
Sbjct  61   DNPDIPSYQPHVHGRCDPPALIPLQMNGISLEADCYLDNMAFITVTGSWRVHCVMGSRSC  120

Query  463  DCRIAIPMGEQGSILGLEVEVPR  531
            DCRI +PMGEQGSILG+EVE+PR
Sbjct  121  DCRIVVPMGEQGSILGVEVELPR  143



>gb|EYU25841.1| hypothetical protein MIMGU_mgv1a001817mg [Erythranthe guttata]
Length=755

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 132/143 (92%), Gaps = 1/143 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA-HSYLPSAPMLYAVIENPAV  282
            MA +F AAVEDGLRLSKR+ FGKDRAVAPP+  TAME+ A +SYLP++PM+YAVI +PA+
Sbjct  1    MAEDFEAAVEDGLRLSKRVYFGKDRAVAPPKPPTAMERAAGYSYLPNSPMVYAVISDPAI  60

Query  283  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            VDNPD+PSYQPHVHGRCDPPALIPLQMN +S+  +CYLDTAFVTVTG+WRVHCVMGSRSC
Sbjct  61   VDNPDMPSYQPHVHGRCDPPALIPLQMNGVSLEVDCYLDTAFVTVTGTWRVHCVMGSRSC  120

Query  463  DCRIAIPMGEQGSILGLEVEVPR  531
            DCRIA+PMGEQGSILG+EVEVPR
Sbjct  121  DCRIAVPMGEQGSILGVEVEVPR  143



>ref|XP_009624355.1| PREDICTED: uncharacterized protein LOC104115430 [Nicotiana tomentosiformis]
Length=757

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  EFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVVDNP  294
            EF   VEDG+RLSKRI FGKDRAVAPP+ M AM+K A SYLP++PM+YAVIENPA+VDNP
Sbjct  6    EFVKCVEDGIRLSKRIYFGKDRAVAPPKPMAAMDKAAQSYLPTSPMMYAVIENPAIVDNP  65

Query  295  DVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCDCRI  474
            D+PSYQPHVHGRCDPPALIPLQMN +SVAA+CY DTA +TVTGSWR+HCVM SRSCDCR 
Sbjct  66   DIPSYQPHVHGRCDPPALIPLQMNGVSVAADCYFDTAVITVTGSWRLHCVMSSRSCDCRF  125

Query  475  AIPMGEQGSILGLEVEVPR  531
            A+PMGEQGSILG+EVE+PR
Sbjct  126  AVPMGEQGSILGVEVELPR  144



>ref|XP_008450941.1| PREDICTED: uncharacterized protein LOC103492379 [Cucumis melo]
Length=755

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA +FA AV+DGLRLSKR+ FGKDRAVAPPR+   M++  HS+LP+APM+YAVI +P +V
Sbjct  1    MAEDFAKAVDDGLRLSKRLYFGKDRAVAPPRSFPTMDRMDHSFLPTAPMVYAVIHDPGIV  60

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+PSYQPHVHGRCDPPALIPLQMN+I + A+CYLDTA + +TGSWRVHCVMGSRSCD
Sbjct  61   DNPDIPSYQPHVHGRCDPPALIPLQMNAIELQADCYLDTAIIRITGSWRVHCVMGSRSCD  120

Query  466  CRIAIPMGEQGSILGLEVEVPR  531
            CRIAIPMGEQGS+LG EV+ PR
Sbjct  121  CRIAIPMGEQGSVLGCEVDDPR  142



>emb|CDP03063.1| unnamed protein product [Coffea canephora]
Length=748

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHS-YLPSAPMLYAVIENPAV  282
            MA EFA AVEDGLRLSKRI FGKDRAVAPP+ +T M+KT    YLP+A M+YAVI +PA+
Sbjct  1    MAEEFARAVEDGLRLSKRIYFGKDRAVAPPKPITPMDKTPQQMYLPTAVMIYAVIGDPAI  60

Query  283  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            VDNPDVPSYQPHVHGRCDPPALIPLQMN +S+  +C+LDTAFVTV+GSWRVHCVMGSR+C
Sbjct  61   VDNPDVPSYQPHVHGRCDPPALIPLQMNGVSLEVDCFLDTAFVTVSGSWRVHCVMGSRAC  120

Query  463  DCRIAIPMGEQGSILGLEVEVPR  531
            DCRI IPMGEQGSILG+EVEVP+
Sbjct  121  DCRIVIPMGEQGSILGVEVEVPK  143



>ref|XP_011078106.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X1 [Sesamum indicum]
Length=764

 Score =   244 bits (624),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 130/143 (91%), Gaps = 1/143 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA-HSYLPSAPMLYAVIENPAV  282
            MA +F AAVEDGLRLSKRI FGKDRAVAPP+  T M++++ H +LP++PM+YAVI NP++
Sbjct  1    MAEDFQAAVEDGLRLSKRIYFGKDRAVAPPKPPTEMDRSSEHPFLPTSPMVYAVISNPSI  60

Query  283  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            VDNPD+PSYQP+VHG+CDPPAL+PLQMN IS+  ECY+DTAF+TV GSWRVHCVMGSRSC
Sbjct  61   VDNPDMPSYQPYVHGKCDPPALMPLQMNGISMEVECYMDTAFITVNGSWRVHCVMGSRSC  120

Query  463  DCRIAIPMGEQGSILGLEVEVPR  531
            DCRIA+PMGEQGSILG+EVE+PR
Sbjct  121  DCRIAVPMGEQGSILGVEVEIPR  143



>ref|XP_004144038.1| PREDICTED: uncharacterized protein LOC101210279 [Cucumis sativus]
 ref|XP_004170362.1| PREDICTED: uncharacterized protein LOC101231061 [Cucumis sativus]
 gb|KGN66313.1| hypothetical protein Csa_1G597110 [Cucumis sativus]
Length=755

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA +FA AV+DGLRLSKR+ FGKDRAVAPPR+   M++  HS+LP+APM+YAVI +P +V
Sbjct  1    MAEDFAKAVDDGLRLSKRLYFGKDRAVAPPRSFPTMDRMDHSFLPTAPMVYAVIHDPGIV  60

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+PSYQPHVHGRCDPPALIPLQMN++ + A+CYLD A + +TGSWRVHCVMGSRSCD
Sbjct  61   DNPDIPSYQPHVHGRCDPPALIPLQMNAVELQADCYLDKAIIRITGSWRVHCVMGSRSCD  120

Query  466  CRIAIPMGEQGSILGLEVEVPR  531
            CRIAIPMGEQGS+LG EV+ PR
Sbjct  121  CRIAIPMGEQGSVLGCEVDDPR  142



>ref|XP_010261798.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Nelumbo nucifera]
Length=753

 Score =   240 bits (612),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA +F  +VEDGL+L+KRI FG DR+V+PPR + AMEK++H+ LP++PMLYAVI +PA+V
Sbjct  1    MAQQFVKSVEDGLKLAKRIYFGNDRSVSPPRPV-AMEKSSHTLLPTSPMLYAVISDPAIV  59

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+PSYQPHVHGRCDPPALIPLQMN+ISV  +CYLDTAFVTV GSWRVHCV GSRSCD
Sbjct  60   DNPDIPSYQPHVHGRCDPPALIPLQMNAISVEVDCYLDTAFVTVNGSWRVHCVKGSRSCD  119

Query  466  CRIAIPMGEQGSILGLEVEVPR  531
            CR+AIPM EQGSILG+EV+V R
Sbjct  120  CRLAIPMSEQGSILGVEVDVIR  141



>ref|XP_011093845.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Sesamum indicum]
Length=758

 Score =   239 bits (611),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEK-TAHSYLPSAPMLYAVIENPAV  282
            MA +F AAVE+GL LSKR+ FGKDRAVAPP+ +TAM++ T  SYLP++PMLYAVI +PA+
Sbjct  1    MAEDFEAAVEEGLNLSKRVYFGKDRAVAPPKPLTAMDRATGCSYLPTSPMLYAVISDPAI  60

Query  283  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            VDNPD PSYQPHVHGRC+PPALIPLQMN +S+  +C LDTAFVTVTG+WR+HCVM SRSC
Sbjct  61   VDNPDRPSYQPHVHGRCEPPALIPLQMNGVSLEVDCSLDTAFVTVTGTWRLHCVMSSRSC  120

Query  463  DCRIAIPMGEQGSILGLEVEVPR  531
            DCRIA+PMGEQGSILG+EVE+PR
Sbjct  121  DCRIAVPMGEQGSILGVEVELPR  143



>ref|XP_011093846.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X2 [Sesamum indicum]
Length=756

 Score =   239 bits (610),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEK-TAHSYLPSAPMLYAVIENPAV  282
            MA +F AAVE+GL LSKR+ FGKDRAVAPP+ +TAM++ T  SYLP++PMLYAVI +PA+
Sbjct  1    MAEDFEAAVEEGLNLSKRVYFGKDRAVAPPKPLTAMDRATGCSYLPTSPMLYAVISDPAI  60

Query  283  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            VDNPD PSYQPHVHGRC+PPALIPLQMN +S+  +C LDTAFVTVTG+WR+HCVM SRSC
Sbjct  61   VDNPDRPSYQPHVHGRCEPPALIPLQMNGVSLEVDCSLDTAFVTVTGTWRLHCVMSSRSC  120

Query  463  DCRIAIPMGEQGSILGLEVEVPR  531
            DCRIA+PMGEQGSILG+EVE+PR
Sbjct  121  DCRIAVPMGEQGSILGVEVELPR  143



>ref|XP_009149386.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Brassica rapa]
Length=757

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 125/145 (86%), Gaps = 3/145 (2%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA---HSYLPSAPMLYAVIENP  276
            MA +FA AVEDGL+L+KRI FG DRAVA PR  + ME+ A   H++LP+APM+YAVI  P
Sbjct  1    MAEDFARAVEDGLKLAKRIYFGNDRAVAAPRLASPMERAASAAHAHLPTAPMVYAVIHEP  60

Query  277  AVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSR  456
             +VDNPD+PSYQPHVHGRCDPPALIPLQMN+I +  +CYLDTA VTVTGSWRVHCVMGS+
Sbjct  61   GIVDNPDLPSYQPHVHGRCDPPALIPLQMNAIELDVDCYLDTALVTVTGSWRVHCVMGSK  120

Query  457  SCDCRIAIPMGEQGSILGLEVEVPR  531
             CDCRIAIPMGEQGSILG+EVE+PR
Sbjct  121  RCDCRIAIPMGEQGSILGVEVEIPR  145



>emb|CDY26699.1| BnaA06g13230D [Brassica napus]
Length=757

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 125/145 (86%), Gaps = 3/145 (2%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA---HSYLPSAPMLYAVIENP  276
            MA +FA AVEDGL+L+KRI FG DRAVA PR  + ME+ A   H++LP+APM+YAVI  P
Sbjct  1    MAEDFARAVEDGLKLAKRIYFGNDRAVAAPRLASPMERAASAAHAHLPTAPMVYAVIHEP  60

Query  277  AVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSR  456
             +VDNPD+PSYQPHVHGRCDPPALIPLQMN+I +  +CYLDTA VTVTGSWRVHCVMGS+
Sbjct  61   GIVDNPDLPSYQPHVHGRCDPPALIPLQMNAIELDVDCYLDTALVTVTGSWRVHCVMGSK  120

Query  457  SCDCRIAIPMGEQGSILGLEVEVPR  531
             CDCRIAIPMGEQGSILG+EVE+PR
Sbjct  121  RCDCRIAIPMGEQGSILGVEVEIPR  145



>ref|XP_002516254.1| inter-alpha-trypsin inhibitor heavy chain, putative [Ricinus 
communis]
 gb|EEF46256.1| inter-alpha-trypsin inhibitor heavy chain, putative [Ricinus 
communis]
Length=755

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA EF  +VEDGL+LSKR+ +GKDRAVAPPR +  MEK+A +YLP+APM+YAVI +P++V
Sbjct  1    MAEEFGNSVEDGLKLSKRLYYGKDRAVAPPRPVVHMEKSAEAYLPTAPMIYAVISDPSIV  60

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+PSYQPHVHGRCDPPALIPLQMN I + A+ +LD+A V V GSWRVHCVMGS+SCD
Sbjct  61   DNPDMPSYQPHVHGRCDPPALIPLQMNRIELEADSFLDSAIVRVNGSWRVHCVMGSKSCD  120

Query  466  CRIAIPMGEQGSILGLEVEVPR  531
            CRIAIPMGEQGSILG+EVEV R
Sbjct  121  CRIAIPMGEQGSILGVEVEVAR  142



>ref|XP_002277641.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4 [Vitis 
vinifera]
 emb|CBI27786.3| unnamed protein product [Vitis vinifera]
Length=756

 Score =   238 bits (606),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA +F  +VEDGL+L+KRI FGKDR+V PP+ ++ M+K++ SYLP+APM+YAV+ +PA+V
Sbjct  1    MADDFTKSVEDGLKLAKRIYFGKDRSVTPPKPVS-MDKSSKSYLPTAPMVYAVVFDPAIV  59

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+PSYQPHV+GRCDP ALIPLQMN I++  +CYLDTAFVT+TGSWRVHCVMGSRSCD
Sbjct  60   DNPDIPSYQPHVYGRCDPAALIPLQMNGIALEVDCYLDTAFVTLTGSWRVHCVMGSRSCD  119

Query  466  CRIAIPMGEQGSILGLEVEVPR  531
            CR+A+PMGEQGSILG+EV+VPR
Sbjct  120  CRLAVPMGEQGSILGVEVDVPR  141



>emb|CDY41019.1| BnaC05g14770D [Brassica napus]
Length=757

 Score =   237 bits (604),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 125/145 (86%), Gaps = 3/145 (2%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA---HSYLPSAPMLYAVIENP  276
            MA +FA AVEDGL+L+KRI FG DRAVA PR  + ME+ A   H++LP+APM+YAVI  P
Sbjct  1    MAEDFARAVEDGLKLAKRIYFGNDRAVAAPRLASPMERAASAAHAHLPTAPMVYAVIHEP  60

Query  277  AVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSR  456
             +VDNPD+PSYQPHVHGRCDPPALIPLQ+N+I +  +CYLDTA VTVTGSWRVHCVMGS+
Sbjct  61   GIVDNPDLPSYQPHVHGRCDPPALIPLQLNAIELDVDCYLDTALVTVTGSWRVHCVMGSK  120

Query  457  SCDCRIAIPMGEQGSILGLEVEVPR  531
             CDCRIAIPMGEQGSILG+EVE+PR
Sbjct  121  RCDCRIAIPMGEQGSILGVEVEIPR  145



>ref|XP_006416537.1| hypothetical protein EUTSA_v10006890mg [Eutrema salsugineum]
 gb|ESQ34890.1| hypothetical protein EUTSA_v10006890mg [Eutrema salsugineum]
Length=755

 Score =   236 bits (601),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 124/144 (86%), Gaps = 2/144 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKT--AHSYLPSAPMLYAVIENPA  279
            MA +FA AV+DGL+L+KRI FG DRAVA PR    ME++  A +YLPSAPM+YAVI +P 
Sbjct  1    MAEDFARAVDDGLKLAKRIYFGNDRAVAAPRLAAPMERSSPAQAYLPSAPMVYAVIPDPG  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
            +VDNPD+PSYQPHVHGRCDPPALIPLQMN+I +  +CYLDTA VTVTGSWRVHCVMGS+ 
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNAIELDVDCYLDTALVTVTGSWRVHCVMGSKR  120

Query  460  CDCRIAIPMGEQGSILGLEVEVPR  531
            CDCRIAIPMGEQGSIL +EVE+PR
Sbjct  121  CDCRIAIPMGEQGSILSVEVEIPR  144



>gb|EPS65940.1| hypothetical protein M569_08838, partial [Genlisea aurea]
Length=637

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 125/143 (87%), Gaps = 1/143 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA-HSYLPSAPMLYAVIENPAV  282
            MA +F +AVEDGLRLSKRI +GKDRAVAPP+   +M + A  SYLP++PM+YAVI +P+V
Sbjct  1    MAEDFESAVEDGLRLSKRIYYGKDRAVAPPKTSMSMGRDARFSYLPTSPMMYAVISDPSV  60

Query  283  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            VDNPD+PSYQPHVHGR DPPAL+PLQMN IS+  +CY+DTAFVT TGSWRVHCVMGS+ C
Sbjct  61   VDNPDMPSYQPHVHGRLDPPALLPLQMNGISLDVDCYIDTAFVTATGSWRVHCVMGSKFC  120

Query  463  DCRIAIPMGEQGSILGLEVEVPR  531
            DC IA+PMG++GSILG+EVEVPR
Sbjct  121  DCLIAVPMGKEGSILGVEVEVPR  143



>ref|XP_010497257.1| PREDICTED: uncharacterized protein LOC104774321, partial [Camelina 
sativa]
Length=413

 Score =   227 bits (579),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 126/144 (88%), Gaps = 2/144 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHS--YLPSAPMLYAVIENPA  279
            MA +FA AV+DGL+L+KRI FGKDRAVA PR    ME++A +  YLP+APM+YAVI +P 
Sbjct  1    MAEDFARAVDDGLKLAKRIYFGKDRAVAAPRPPAPMERSATTQPYLPTAPMVYAVIPDPG  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
            +VDNPD+PSYQPHVHGRCDPPALIPLQMNSI +  +CYLDTA VTVTGSWRVHCVMGS+ 
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNSIELDVDCYLDTALVTVTGSWRVHCVMGSKR  120

Query  460  CDCRIAIPMGEQGSILGLEVEVPR  531
            CDCRIAIPMGEQGSILG+EVE+PR
Sbjct  121  CDCRIAIPMGEQGSILGVEVEIPR  144



>gb|KFK44049.1| hypothetical protein AALP_AA1G209400 [Arabis alpina]
Length=761

 Score =   235 bits (599),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 126/150 (84%), Gaps = 8/150 (5%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA--------HSYLPSAPMLYA  261
            MA +FA AV+DGL+L+KRI FGKDRAVA PR    M++++         +YLPSAPM+YA
Sbjct  1    MAEDFARAVDDGLKLAKRIYFGKDRAVAAPRPQLTMDRSSTTTSTATTQAYLPSAPMVYA  60

Query  262  VIENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHC  441
            VI +P +VDNPD+PSYQPHVHGRCDPPALIPLQMN+I +  +CYLDTA VTVTGSWRVHC
Sbjct  61   VIPDPGIVDNPDLPSYQPHVHGRCDPPALIPLQMNAIELEVDCYLDTALVTVTGSWRVHC  120

Query  442  VMGSRSCDCRIAIPMGEQGSILGLEVEVPR  531
            VMGS+ CDCRIAIPMGEQGSILG+EVE+PR
Sbjct  121  VMGSKRCDCRIAIPMGEQGSILGVEVEIPR  150



>ref|XP_010273856.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X4 [Nelumbo nucifera]
Length=614

 Score =   231 bits (590),  Expect = 7e-69, Method: Composition-based stats.
 Identities = 101/143 (71%), Positives = 126/143 (88%), Gaps = 2/143 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAH-SYLPSAPMLYAVIENPAV  282
            M   F  +VEDGLRLSKRI FGKDR+V+PPR   +M+K+ H +YLP+APM+YAV+ +PA+
Sbjct  5    MVDYFVESVEDGLRLSKRIYFGKDRSVSPPRP-ASMDKSLHQTYLPTAPMVYAVVSDPAI  63

Query  283  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            VDNPD+PSYQP+VHG+CDPPALIPLQMN I+V A+CYL TAFVTV+GSWRVHC+MGSR+C
Sbjct  64   VDNPDLPSYQPYVHGKCDPPALIPLQMNGIAVEADCYLGTAFVTVSGSWRVHCIMGSRNC  123

Query  463  DCRIAIPMGEQGSILGLEVEVPR  531
            DCR+AIPM E+GS+LG+EV+V R
Sbjct  124  DCRLAIPMSERGSVLGVEVDVIR  146



>gb|KDP33933.1| hypothetical protein JCGZ_07504 [Jatropha curcas]
Length=756

 Score =   233 bits (595),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA EF  AVEDGLRL+KR+ FGKDRAVAPP+ + +ME++   YLP APM+YAVI +PA+V
Sbjct  1    MADEFGKAVEDGLRLAKRLYFGKDRAVAPPKPLLSMERSVDDYLPKAPMVYAVIFDPAIV  60

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+ SYQPHVHGRCDPPALIPLQMN I + A+ YLD+  V ++GSWRVHCVMGS+S D
Sbjct  61   DNPDMASYQPHVHGRCDPPALIPLQMNRIELEADSYLDSVIVRLSGSWRVHCVMGSKSSD  120

Query  466  CRIAIPMGEQGSILGLEVEVPR  531
            CRIAIPMGEQGSILGLEV+VPR
Sbjct  121  CRIAIPMGEQGSILGLEVDVPR  142



>emb|CDX81914.1| BnaC08g36870D [Brassica napus]
Length=754

 Score =   233 bits (593),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 125/144 (87%), Gaps = 2/144 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEK--TAHSYLPSAPMLYAVIENPA  279
            MA +FA AV+DGL+L+KRI FG DRAVA PR    ME+  T+ ++LPSAPM+YAVI +P 
Sbjct  1    MAEDFARAVDDGLKLAKRIYFGHDRAVAAPRLTAPMERSSTSQAHLPSAPMVYAVIPDPG  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
            +VDNPD+PSYQPHVHGRCDPPALIPLQMNSI +  +CYLDTA VTVTGSWRVHCVMGS+ 
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNSIELHVDCYLDTALVTVTGSWRVHCVMGSKK  120

Query  460  CDCRIAIPMGEQGSILGLEVEVPR  531
            CDCRIAIP+G++GSILG+EVE+PR
Sbjct  121  CDCRIAIPIGDKGSILGVEVEIPR  144



>ref|XP_010531895.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
[Tarenaya hassleriana]
Length=756

 Score =   232 bits (591),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 125/144 (87%), Gaps = 2/144 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVA-PPRAMTAMEKTA-HSYLPSAPMLYAVIENPA  279
            MA +FA AVEDGL+ +KR+  GKDRAVA PPR   AME+++  +YLP+APMLYAVI +PA
Sbjct  1    MADDFAKAVEDGLKFAKRVYLGKDRAVAAPPRPSPAMERSSSQAYLPTAPMLYAVISDPA  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
            +VDNPD+PSYQPHVHGRCDPPALIPLQMN+I +  +C+LDTA + VTGSWRVHCVMGSRS
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNAIELEVDCFLDTALIRVTGSWRVHCVMGSRS  120

Query  460  CDCRIAIPMGEQGSILGLEVEVPR  531
            CDC IAIPMGEQG +LG++VE+PR
Sbjct  121  CDCLIAIPMGEQGLVLGVDVEIPR  144



>emb|CDY21682.1| BnaA09g44330D [Brassica napus]
Length=754

 Score =   232 bits (591),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 124/144 (86%), Gaps = 2/144 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEK--TAHSYLPSAPMLYAVIENPA  279
            MA +FA AV+DGL+L+KRI FG DRAVA PR    ME+  T+ ++LPSAPM+YAVI +P 
Sbjct  1    MAEDFARAVDDGLKLAKRIYFGHDRAVAAPRLTAPMERSSTSQAHLPSAPMVYAVIPDPG  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
            +VDNPD+PSYQPHVHGRCDPPALIPLQMN+I +  +CYLDTA VT TGSWRVHCVMGS+ 
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNAIELHVDCYLDTALVTATGSWRVHCVMGSKK  120

Query  460  CDCRIAIPMGEQGSILGLEVEVPR  531
            CDCRIAIP+G+QGSILG+EVE+PR
Sbjct  121  CDCRIAIPIGDQGSILGVEVEIPR  144



>ref|XP_011007767.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 [Populus 
euphratica]
Length=756

 Score =   231 bits (589),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA EF  +V+DGL+LSKRI  GKDRAV PP+  + M+K+  +YLP+APM+YAVI NP +V
Sbjct  1    MAEEFGRSVQDGLKLSKRIYLGKDRAVTPPKPPSHMDKSPVAYLPTAPMVYAVISNPGIV  60

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+PSYQPHVHGRCDPPALIPLQMN I + A+ YLDTAFV + GSWRVHCVMGS SCD
Sbjct  61   DNPDIPSYQPHVHGRCDPPALIPLQMNRIELEADSYLDTAFVKINGSWRVHCVMGSESCD  120

Query  466  CRIAIPMGEQGSILGLEVEVPR  531
            CR+A+PMGEQGSILG+E+E  R
Sbjct  121  CRLAVPMGEQGSILGVEIEASR  142



>ref|XP_002324729.2| inter-alpha-trypsin inhibitor heavy chain-related family protein 
[Populus trichocarpa]
 gb|EEF03294.2| inter-alpha-trypsin inhibitor heavy chain-related family protein 
[Populus trichocarpa]
Length=752

 Score =   231 bits (588),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA EF  +V+DGL+LSKRI  GKDRAV PP+  + M+K+  +YLP+APM+YAVI NPA+V
Sbjct  1    MAEEFGRSVQDGLKLSKRIYLGKDRAVTPPKPPSHMDKSPVAYLPTAPMVYAVISNPAIV  60

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+PSYQPHVHGRCDPPALIPLQM  I + A+ YLDTAFV ++GSWRVHCVMGS SCD
Sbjct  61   DNPDIPSYQPHVHGRCDPPALIPLQMTRIELEADSYLDTAFVKISGSWRVHCVMGSESCD  120

Query  466  CRIAIPMGEQGSILGLEVEVPR  531
            CR+A+PMGEQGSILG+E+E  R
Sbjct  121  CRLAVPMGEQGSILGVEIEASR  142



>ref|XP_009110301.1| PREDICTED: uncharacterized protein LOC103835866 [Brassica rapa]
Length=757

 Score =   229 bits (584),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 124/145 (86%), Gaps = 3/145 (2%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA--HSYLPSAPMLYAVIENPA  279
            MA +FA AVEDGL+L+KRI  G DRAVA PR    ME+T+  H+YLPS+PM+YAVI +P 
Sbjct  1    MAEDFARAVEDGLKLAKRIYLGNDRAVAAPRLAAPMERTSTVHAYLPSSPMVYAVIPDPG  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
            +VDNPD+PSYQPHVHGRCDPPALIPLQMN+I +  +CYLDTA VTVTG+WRVHCVMGS+ 
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNAIELDVDCYLDTALVTVTGTWRVHCVMGSKR  120

Query  460  CDCRIAIPMGEQ-GSILGLEVEVPR  531
            CDCRIA+PMGE+ GSILG+EVE+ R
Sbjct  121  CDCRIAVPMGEEHGSILGVEVEITR  145



>emb|CDX83787.1| BnaC08g18580D [Brassica napus]
Length=756

 Score =   229 bits (583),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 121/144 (84%), Gaps = 2/144 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKT--AHSYLPSAPMLYAVIENPA  279
            MA +FA AVEDGL+L+KRI  G DRAVA PR    ME+T  A +YLPS+PM+YAVI +P 
Sbjct  1    MAEDFARAVEDGLKLAKRIYLGNDRAVAAPRLAAPMERTSTAQAYLPSSPMVYAVIPDPG  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
            +VDNPD+PSYQPHVHGRCDPPALIPLQMN+I +  +CYLDTA VTVTG+WRVHCVMG + 
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNAIELDVDCYLDTALVTVTGTWRVHCVMGRKR  120

Query  460  CDCRIAIPMGEQGSILGLEVEVPR  531
            CDCRIA+PMGE GSILG+EVE+ R
Sbjct  121  CDCRIAVPMGEHGSILGVEVEITR  144



>emb|CDX96680.1| BnaA08g22230D [Brassica napus]
Length=768

 Score =   229 bits (583),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 122/144 (85%), Gaps = 2/144 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA--HSYLPSAPMLYAVIENPA  279
            MA +FA AVEDGL+L+KRI  G DRAVA PR    ME+T+  H+YLPS+PM+YAVI +P 
Sbjct  1    MAEDFARAVEDGLKLAKRIYLGNDRAVAAPRLAPPMERTSTVHAYLPSSPMVYAVIPDPG  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
            +VDNPD+PSYQPHVHGRC PPALIPLQMN+I +  +CYLDTA VTVTG+WRVHCVMGS+ 
Sbjct  61   IVDNPDLPSYQPHVHGRCYPPALIPLQMNAIELNVDCYLDTALVTVTGTWRVHCVMGSKR  120

Query  460  CDCRIAIPMGEQGSILGLEVEVPR  531
            CDCRIA+PMGE GSILG+EVE+ R
Sbjct  121  CDCRIAVPMGEHGSILGVEVEITR  144



>ref|XP_010273854.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X2 [Nelumbo nucifera]
Length=696

 Score =   227 bits (579),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 126/143 (88%), Gaps = 2/143 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAH-SYLPSAPMLYAVIENPAV  282
            M   F  +VEDGLRLSKRI FGKDR+V+PPR   +M+K+ H +YLP+APM+YAV+ +PA+
Sbjct  5    MVDYFVESVEDGLRLSKRIYFGKDRSVSPPRP-ASMDKSLHQTYLPTAPMVYAVVSDPAI  63

Query  283  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            VDNPD+PSYQP+VHG+CDPPALIPLQMN I+V A+CYL TAFVTV+GSWRVHC+MGSR+C
Sbjct  64   VDNPDLPSYQPYVHGKCDPPALIPLQMNGIAVEADCYLGTAFVTVSGSWRVHCIMGSRNC  123

Query  463  DCRIAIPMGEQGSILGLEVEVPR  531
            DCR+AIPM E+GS+LG+EV+V R
Sbjct  124  DCRLAIPMSERGSVLGVEVDVIR  146



>ref|XP_006306812.1| hypothetical protein CARUB_v10008355mg [Capsella rubella]
 gb|EOA39710.1| hypothetical protein CARUB_v10008355mg [Capsella rubella]
Length=780

 Score =   228 bits (581),  Expect = 1e-66, Method: Composition-based stats.
 Identities = 108/144 (75%), Positives = 124/144 (86%), Gaps = 2/144 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEK--TAHSYLPSAPMLYAVIENPA  279
            MA +F+ AV+DG++LSKRI FGKDRAVA PR    ME+  T   YLP+APM+YAVI +P 
Sbjct  1    MAEDFSRAVDDGIKLSKRIYFGKDRAVAAPRPPAPMERSSTTQPYLPTAPMVYAVIPDPG  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
            +VDNPD+PSYQPHVHGRCDPPALIPLQMNSI +  +CYLDTA VTVTGSWRVHCVMGS+ 
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNSIELDVDCYLDTALVTVTGSWRVHCVMGSKR  120

Query  460  CDCRIAIPMGEQGSILGLEVEVPR  531
            CDCRIAIPMGEQGSILG+EVE+PR
Sbjct  121  CDCRIAIPMGEQGSILGVEVEIPR  144



>ref|XP_010273855.1| PREDICTED: uncharacterized protein LOC104609280 isoform X3 [Nelumbo 
nucifera]
Length=663

 Score =   226 bits (576),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 126/143 (88%), Gaps = 2/143 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAH-SYLPSAPMLYAVIENPAV  282
            M   F  +VEDGLRLSKRI FGKDR+V+PPR   +M+K+ H +YLP+APM+YAV+ +PA+
Sbjct  5    MVDYFVESVEDGLRLSKRIYFGKDRSVSPPRP-ASMDKSLHQTYLPTAPMVYAVVSDPAI  63

Query  283  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            VDNPD+PSYQP+VHG+CDPPALIPLQMN I+V A+CYL TAFVTV+GSWRVHC+MGSR+C
Sbjct  64   VDNPDLPSYQPYVHGKCDPPALIPLQMNGIAVEADCYLGTAFVTVSGSWRVHCIMGSRNC  123

Query  463  DCRIAIPMGEQGSILGLEVEVPR  531
            DCR+AIPM E+GS+LG+EV+V R
Sbjct  124  DCRLAIPMSERGSVLGVEVDVIR  146



>ref|XP_009117566.1| PREDICTED: uncharacterized protein LOC103842665 [Brassica rapa]
Length=754

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 123/144 (85%), Gaps = 2/144 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEK--TAHSYLPSAPMLYAVIENPA  279
            MA +FA AV+DGL+L+KRI FG DRAVA PR    ME+  T+ ++LPSAPM+YAVI +P 
Sbjct  1    MAEDFARAVDDGLKLAKRIYFGHDRAVAAPRLTAPMERSSTSQAHLPSAPMVYAVIPDPG  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
            +VDNPD+PSYQPHVHGR DPPALIPLQMN+I +  +CYLDTA VT TGSWRVHCVMGS+ 
Sbjct  61   IVDNPDLPSYQPHVHGRGDPPALIPLQMNAIELHVDCYLDTALVTATGSWRVHCVMGSKK  120

Query  460  CDCRIAIPMGEQGSILGLEVEVPR  531
            CDCRIAIP+G+QGSILG+EVE+PR
Sbjct  121  CDCRIAIPIGDQGSILGVEVEIPR  144



>ref|XP_010477113.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H4-like 
[Camelina sativa]
Length=755

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 126/144 (88%), Gaps = 2/144 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHS--YLPSAPMLYAVIENPA  279
            MA +FA AV+DGL+L+KRI FGKDRAVA PR    ME++A +  YLP+APM+YAVI +P 
Sbjct  1    MAEDFARAVDDGLKLAKRIYFGKDRAVAAPRPPAPMERSATTQPYLPTAPMVYAVIPDPG  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
            +VDNPD+PSYQPHVHGRCDPPALIPLQMNSI +  +CYLDTA VTVTGSWRVHCVMGS+ 
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNSIELDVDCYLDTALVTVTGSWRVHCVMGSKR  120

Query  460  CDCRIAIPMGEQGSILGLEVEVPR  531
            CDCRIAIPMGEQGSILG+EVE+PR
Sbjct  121  CDCRIAIPMGEQGSILGVEVEIPR  144



>ref|XP_010498320.1| PREDICTED: uncharacterized protein LOC104776024 [Camelina sativa]
Length=754

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 126/144 (88%), Gaps = 2/144 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHS--YLPSAPMLYAVIENPA  279
            MA +FA AV+DGL+L+KRI FGKDRAVA PR    ME++A +  YLP+APM+YAVI +P 
Sbjct  1    MAEDFARAVDDGLKLAKRIYFGKDRAVAAPRPPAPMERSATTQPYLPTAPMVYAVIPDPG  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
            +VDNPD+PSYQPHVHGRCDPPALIPLQMNSI +  +CYLDTA VTVTGSWRVHCVMGS+ 
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNSIELDVDCYLDTAIVTVTGSWRVHCVMGSKR  120

Query  460  CDCRIAIPMGEQGSILGLEVEVPR  531
            CDCRIAIPMGEQGSILG+EVE+PR
Sbjct  121  CDCRIAIPMGEQGSILGVEVEIPR  144



>ref|XP_010273853.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Nelumbo nucifera]
Length=753

 Score =   227 bits (578),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 126/143 (88%), Gaps = 2/143 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAH-SYLPSAPMLYAVIENPAV  282
            M   F  +VEDGLRLSKRI FGKDR+V+PPR   +M+K+ H +YLP+APM+YAV+ +PA+
Sbjct  5    MVDYFVESVEDGLRLSKRIYFGKDRSVSPPRP-ASMDKSLHQTYLPTAPMVYAVVSDPAI  63

Query  283  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            VDNPD+PSYQP+VHG+CDPPALIPLQMN I+V A+CYL TAFVTV+GSWRVHC+MGSR+C
Sbjct  64   VDNPDLPSYQPYVHGKCDPPALIPLQMNGIAVEADCYLGTAFVTVSGSWRVHCIMGSRNC  123

Query  463  DCRIAIPMGEQGSILGLEVEVPR  531
            DCR+AIPM E+GS+LG+EV+V R
Sbjct  124  DCRLAIPMSERGSVLGVEVDVIR  146



>ref|XP_010459567.1| PREDICTED: uncharacterized protein LOC104740606 [Camelina sativa]
Length=754

 Score =   227 bits (578),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 126/144 (88%), Gaps = 2/144 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHS--YLPSAPMLYAVIENPA  279
            MA +FA AV+DGL+L+KRI FGKDRAVA PR    ME++A +  YLP+APM+YAVI +P 
Sbjct  1    MAEDFARAVDDGLKLAKRIYFGKDRAVAAPRPPAPMERSATTQPYLPTAPMVYAVIPDPG  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
            +VDNPD+PSYQPHVHGRCDPPALIPLQMNSI +  +CYLDTA VTVTGSWRVHCVMGS+ 
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNSIELDVDCYLDTAIVTVTGSWRVHCVMGSKR  120

Query  460  CDCRIAIPMGEQGSILGLEVEVPR  531
            CDCRIAIPMGEQGSILG+EVE+PR
Sbjct  121  CDCRIAIPMGEQGSILGVEVEIPR  144



>gb|AAF79294.1|AC068602_17 F14D16.26 [Arabidopsis thaliana]
Length=736

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 124/144 (86%), Gaps = 2/144 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEK--TAHSYLPSAPMLYAVIENPA  279
            MA +FA AV+DGL+L+KRI FGKDRAVA PR    M++  T   YLP+APM+YAVI +P 
Sbjct  1    MAEDFARAVDDGLKLAKRIYFGKDRAVAAPRPPAPMDRSSTTQPYLPTAPMVYAVIPDPG  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
            +VDNPD+PSYQPHVHGRCDPPALIPLQMNSI +  +CYLDTA VTVTGSWRVHCVMGS+ 
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNSIELDVDCYLDTALVTVTGSWRVHCVMGSKR  120

Query  460  CDCRIAIPMGEQGSILGLEVEVPR  531
            CDCRIAIPMGEQGSILG+EVE+PR
Sbjct  121  CDCRIAIPMGEQGSILGVEVEIPR  144



>gb|KHG11270.1| von Willebrand factor A domain-containing [Gossypium arboreum]
Length=754

 Score =   226 bits (577),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 97/141 (69%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA +FA AVEDGL+L KRI  GKDRAV PP+ +  ME++ H YLPSAPM+YAVI +P +V
Sbjct  1    MAEDFARAVEDGLKLGKRIYMGKDRAVQPPKPLPLMERSMHFYLPSAPMVYAVISDPRIV  60

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+PSYQPHVHGR DPPALIPLQMN +++  +CY D+AFV V+G WRVHCVM SRSCD
Sbjct  61   DNPDIPSYQPHVHGRLDPPALIPLQMNGVNLDVDCYGDSAFVQVSGMWRVHCVMRSRSCD  120

Query  466  CRIAIPMGEQGSILGLEVEVP  528
            CRIA+PMG++GSILG+E+++P
Sbjct  121  CRIAVPMGDEGSILGVEIDLP  141



>ref|NP_173345.2| inter-alpha-trypsin inhibitor heavy chain-like protein [Arabidopsis 
thaliana]
 gb|AAM97055.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15507.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29803.1| inter-alpha-trypsin inhibitor heavy chain-like protein [Arabidopsis 
thaliana]
Length=754

 Score =   226 bits (577),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 124/144 (86%), Gaps = 2/144 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEK--TAHSYLPSAPMLYAVIENPA  279
            MA +FA AV+DGL+L+KRI FGKDRAVA PR    M++  T   YLP+APM+YAVI +P 
Sbjct  1    MAEDFARAVDDGLKLAKRIYFGKDRAVAAPRPPAPMDRSSTTQPYLPTAPMVYAVIPDPG  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
            +VDNPD+PSYQPHVHGRCDPPALIPLQMNSI +  +CYLDTA VTVTGSWRVHCVMGS+ 
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNSIELDVDCYLDTALVTVTGSWRVHCVMGSKR  120

Query  460  CDCRIAIPMGEQGSILGLEVEVPR  531
            CDCRIAIPMGEQGSILG+EVE+PR
Sbjct  121  CDCRIAIPMGEQGSILGVEVEIPR  144



>gb|KJB65320.1| hypothetical protein B456_010G089800 [Gossypium raimondii]
Length=606

 Score =   224 bits (570),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA +FA AVEDGL+L KRI  GKDRAV PP+ +  ME++ H YLPSAPM+YAVI +P +V
Sbjct  1    MAEDFARAVEDGLKLGKRIYMGKDRAVQPPKPLPLMERSMHFYLPSAPMVYAVISDPRIV  60

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+PSYQPHVHGR DPPALIPLQMN +++  +CY D+AFV V+G WRVHCVM SRSCD
Sbjct  61   DNPDIPSYQPHVHGRLDPPALIPLQMNGVNLDVDCYGDSAFVQVSGMWRVHCVMRSRSCD  120

Query  466  CRIAIPMGEQGSILGLEVEVP  528
            CRIA+PMG++GSILG+E+++P
Sbjct  121  CRIAVPMGDEGSILGVEIDLP  141



>gb|KJB65319.1| hypothetical protein B456_010G089800 [Gossypium raimondii]
Length=646

 Score =   224 bits (571),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA +FA AVEDGL+L KRI  GKDRAV PP+ +  ME++ H YLPSAPM+YAVI +P +V
Sbjct  1    MAEDFARAVEDGLKLGKRIYMGKDRAVQPPKPLPLMERSMHFYLPSAPMVYAVISDPRIV  60

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+PSYQPHVHGR DPPALIPLQMN +++  +CY D+AFV V+G WRVHCVM SRSCD
Sbjct  61   DNPDIPSYQPHVHGRLDPPALIPLQMNGVNLDVDCYGDSAFVQVSGMWRVHCVMRSRSCD  120

Query  466  CRIAIPMGEQGSILGLEVEVP  528
            CRIA+PMG++GSILG+E+++P
Sbjct  121  CRIAVPMGDEGSILGVEIDLP  141



>gb|KJB65322.1| hypothetical protein B456_010G089800 [Gossypium raimondii]
Length=728

 Score =   224 bits (570),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA +FA AVEDGL+L KRI  GKDRAV PP+ +  ME++ H YLPSAPM+YAVI +P +V
Sbjct  1    MAEDFARAVEDGLKLGKRIYMGKDRAVQPPKPLPLMERSMHFYLPSAPMVYAVISDPRIV  60

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+PSYQPHVHGR DPPALIPLQMN +++  +CY D+AFV V+G WRVHCVM SRSCD
Sbjct  61   DNPDIPSYQPHVHGRLDPPALIPLQMNGVNLDVDCYGDSAFVQVSGMWRVHCVMRSRSCD  120

Query  466  CRIAIPMGEQGSILGLEVEVP  528
            CRIA+PMG++GSILG+E+++P
Sbjct  121  CRIAVPMGDEGSILGVEIDLP  141



>ref|XP_007012610.1| Inter-alpha-trypsin inhibitor heavy chain-related isoform 1 [Theobroma 
cacao]
 gb|EOY30229.1| Inter-alpha-trypsin inhibitor heavy chain-related isoform 1 [Theobroma 
cacao]
Length=758

 Score =   224 bits (570),  Expect = 4e-65, Method: Composition-based stats.
 Identities = 100/142 (70%), Positives = 120/142 (85%), Gaps = 1/142 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDR-AVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAV  282
            MA +FA AVEDGL+L+KRI  GKDR AV PP+    ME++ + YLPSAPM+YAVI +P +
Sbjct  1    MAEDFAQAVEDGLKLAKRIYLGKDRGAVGPPKPPPPMERSPYRYLPSAPMVYAVISDPRI  60

Query  283  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            VDNPD+PSYQPHVHGRCDPPALIPLQMN + +  +CY DTAF+ V+GSWRVHCVMGSRSC
Sbjct  61   VDNPDIPSYQPHVHGRCDPPALIPLQMNGVDLDVDCYADTAFIQVSGSWRVHCVMGSRSC  120

Query  463  DCRIAIPMGEQGSILGLEVEVP  528
            DCRIA+P G QGSILG+EV++P
Sbjct  121  DCRIAVPTGPQGSILGVEVDLP  142



>gb|KJB65318.1| hypothetical protein B456_010G089800 [Gossypium raimondii]
Length=754

 Score =   223 bits (569),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA +FA AVEDGL+L KRI  GKDRAV PP+ +  ME++ H YLPSAPM+YAVI +P +V
Sbjct  1    MAEDFARAVEDGLKLGKRIYMGKDRAVQPPKPLPLMERSMHFYLPSAPMVYAVISDPRIV  60

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+PSYQPHVHGR DPPALIPLQMN +++  +CY D+AFV V+G WRVHCVM SRSCD
Sbjct  61   DNPDIPSYQPHVHGRLDPPALIPLQMNGVNLDVDCYGDSAFVQVSGMWRVHCVMRSRSCD  120

Query  466  CRIAIPMGEQGSILGLEVEVP  528
            CRIA+PMG++GSILG+E+++P
Sbjct  121  CRIAVPMGDEGSILGVEIDLP  141



>ref|XP_010537665.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Tarenaya hassleriana]
Length=760

 Score =   223 bits (568),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 121/144 (84%), Gaps = 2/144 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAP-PRAMTAMEKTAHS-YLPSAPMLYAVIENPA  279
            MA +F  AVEDGL+L+KR+  G DR VA  P     ME+++ + YLP+APM+YAVI +PA
Sbjct  1    MAEDFTKAVEDGLKLAKRVYLGNDRLVAAAPLPSPVMERSSSTAYLPTAPMVYAVISDPA  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
            +VDNPD+PSYQPHVHGRCDPPALIPLQMN++ +  +CYLDTA + VTGSWRVHCVMGSRS
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNAVELEVDCYLDTALIRVTGSWRVHCVMGSRS  120

Query  460  CDCRIAIPMGEQGSILGLEVEVPR  531
            CDCRIAIPMGEQG +LG+EVE+PR
Sbjct  121  CDCRIAIPMGEQGFVLGVEVEIPR  144



>ref|XP_010537668.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X4 [Tarenaya hassleriana]
Length=752

 Score =   223 bits (568),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 121/144 (84%), Gaps = 2/144 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAP-PRAMTAMEKTAHS-YLPSAPMLYAVIENPA  279
            MA +F  AVEDGL+L+KR+  G DR VA  P     ME+++ + YLP+APM+YAVI +PA
Sbjct  1    MAEDFTKAVEDGLKLAKRVYLGNDRLVAAAPLPSPVMERSSSTAYLPTAPMVYAVISDPA  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
            +VDNPD+PSYQPHVHGRCDPPALIPLQMN++ +  +CYLDTA + VTGSWRVHCVMGSRS
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNAVELEVDCYLDTALIRVTGSWRVHCVMGSRS  120

Query  460  CDCRIAIPMGEQGSILGLEVEVPR  531
            CDCRIAIPMGEQG +LG+EVE+PR
Sbjct  121  CDCRIAIPMGEQGFVLGVEVEIPR  144



>ref|XP_010537666.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X2 [Tarenaya hassleriana]
Length=756

 Score =   223 bits (568),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 121/144 (84%), Gaps = 2/144 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAP-PRAMTAMEKTAHS-YLPSAPMLYAVIENPA  279
            MA +F  AVEDGL+L+KR+  G DR VA  P     ME+++ + YLP+APM+YAVI +PA
Sbjct  1    MAEDFTKAVEDGLKLAKRVYLGNDRLVAAAPLPSPVMERSSSTAYLPTAPMVYAVISDPA  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
            +VDNPD+PSYQPHVHGRCDPPALIPLQMN++ +  +CYLDTA + VTGSWRVHCVMGSRS
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNAVELEVDCYLDTALIRVTGSWRVHCVMGSRS  120

Query  460  CDCRIAIPMGEQGSILGLEVEVPR  531
            CDCRIAIPMGEQG +LG+EVE+PR
Sbjct  121  CDCRIAIPMGEQGFVLGVEVEIPR  144



>ref|XP_010537667.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X3 [Tarenaya hassleriana]
Length=756

 Score =   223 bits (568),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 121/144 (84%), Gaps = 2/144 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAP-PRAMTAMEKTAHS-YLPSAPMLYAVIENPA  279
            MA +F  AVEDGL+L+KR+  G DR VA  P     ME+++ + YLP+APM+YAVI +PA
Sbjct  1    MAEDFTKAVEDGLKLAKRVYLGNDRLVAAAPLPSPVMERSSSTAYLPTAPMVYAVISDPA  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
            +VDNPD+PSYQPHVHGRCDPPALIPLQMN++ +  +CYLDTA + VTGSWRVHCVMGSRS
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNAVELEVDCYLDTALIRVTGSWRVHCVMGSRS  120

Query  460  CDCRIAIPMGEQGSILGLEVEVPR  531
            CDCRIAIPMGEQG +LG+EVE+PR
Sbjct  121  CDCRIAIPMGEQGFVLGVEVEIPR  144



>ref|XP_003551107.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0292028-like [Glycine max]
Length=754

 Score =   222 bits (566),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA +F+ AV+DGL+LSKRI FGKDRAVAPP+    M ++A ++LPSAPM+YAVI +P +V
Sbjct  1    MAQDFSKAVDDGLKLSKRIYFGKDRAVAPPKPPPPMTRSATAFLPSAPMVYAVISDPGIV  60

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+PSYQPHV+GRCDPPALIPLQMN+I + A+CY +TAF+TV+G+WR+HCVMGSRSCD
Sbjct  61   DNPDIPSYQPHVYGRCDPPALIPLQMNAIQMEADCYHETAFITVSGTWRLHCVMGSRSCD  120

Query  466  CRIAIPMGEQGSILGLEVEVPR  531
            CRIA+P+  QGSILG+EV V R
Sbjct  121  CRIAVPVSHQGSILGVEVSVSR  142



>ref|XP_004508009.1| PREDICTED: uncharacterized protein LOC101514299 [Cicer arietinum]
Length=751

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA EF+ AVEDGL+LSKRI FGKDRAVAPP+   +M +++++ LP APM+YAVI +P +V
Sbjct  1    MAEEFSRAVEDGLKLSKRIYFGKDRAVAPPKPPPSMARSSNALLPKAPMVYAVIYDPGMV  60

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+PSYQPHV+GRCDPPALIPLQM+ I +  +CYLDTAF+TV+ +WR+HCV  SRSCD
Sbjct  61   DNPDIPSYQPHVYGRCDPPALIPLQMSGIEMDIDCYLDTAFITVSATWRLHCVTASRSCD  120

Query  466  CRIAIPMGEQGSILGLEVEVPR  531
            CR+AIP+G QGSILG+EV +PR
Sbjct  121  CRLAIPIGHQGSILGVEVNLPR  142



>gb|KDO73865.1| hypothetical protein CISIN_1g004349mg [Citrus sinensis]
Length=613

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA--HSYLPSAPMLYAVIENPA  279
            MA +F  AVEDGL+LSKR+ FGKDR V PP+  ++M+K+      LP +PM+YAVI +P 
Sbjct  1    MADDFVKAVEDGLKLSKRLYFGKDRPVTPPKVPSSMDKSGAVDMLLPKSPMVYAVITDPK  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
            +VDNPD+PSYQP+VHGRCDPP+LIPLQMN++ +  +CYLDTAFV V+G+WRVHCVMGS+S
Sbjct  61   IVDNPDIPSYQPYVHGRCDPPSLIPLQMNAVELDVDCYLDTAFVRVSGTWRVHCVMGSKS  120

Query  460  CDCRIAIPMGEQGSILGLEVEV  525
            CDCRIA+PMG+QGSILG+E E+
Sbjct  121  CDCRIAVPMGDQGSILGVEAEI  142



>ref|XP_006452826.1| hypothetical protein CICLE_v10007546mg [Citrus clementina]
 gb|ESR66066.1| hypothetical protein CICLE_v10007546mg [Citrus clementina]
Length=613

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA--HSYLPSAPMLYAVIENPA  279
            MA +F  AVEDGL+LSKR+ FGKDR V PP+  ++M+K+      LP +PM+YAVI +P 
Sbjct  1    MADDFVKAVEDGLKLSKRLYFGKDRPVTPPKVPSSMDKSGAVDMLLPKSPMVYAVITDPK  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
            +VDNPD+PSYQP+VHGRCDPP+LIPLQMN++ +  +CYLDTAFV V+G+WRVHCVMGS+S
Sbjct  61   IVDNPDIPSYQPYVHGRCDPPSLIPLQMNAVELDVDCYLDTAFVRVSGTWRVHCVMGSKS  120

Query  460  CDCRIAIPMGEQGSILGLEVEV  525
            CDCRIA+PMG+QGSILG+E E+
Sbjct  121  CDCRIAVPMGDQGSILGVEAEI  142



>ref|XP_002890318.1| hypothetical protein ARALYDRAFT_472131 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66577.1| hypothetical protein ARALYDRAFT_472131 [Arabidopsis lyrata subsp. 
lyrata]
Length=755

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 124/145 (86%), Gaps = 3/145 (2%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEK--TAHSYLPSAPMLYAVIENPA  279
            MA +FA AV+DGL+L+KRI FGKDRAVA PR    ME+  T  SYLP+APM+YAVI +P 
Sbjct  1    MAEDFARAVDDGLKLAKRIYFGKDRAVAAPRPPAPMERSSTTQSYLPTAPMVYAVIPDPG  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
            +VDNPD+PSYQPHVHGRCDPPALIPLQMNSI +  +CYLDTA VTVTGSWRVHCVMGS+ 
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNSIELDVDCYLDTALVTVTGSWRVHCVMGSKR  120

Query  460  CDCRIAIPMGEQ-GSILGLEVEVPR  531
            CDCRIAIPMGEQ  SILG+EVE+PR
Sbjct  121  CDCRIAIPMGEQVCSILGVEVEIPR  145



>ref|XP_010937323.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4 [Elaeis 
guineensis]
Length=747

 Score =   221 bits (563),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  EFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVVDNP  294
            EFA AVEDGL+L+KRI  GKDR  APPR +  ME++  S LP+APM+YAV+++P +VDNP
Sbjct  5    EFAKAVEDGLKLAKRIYAGKDRHFAPPRPVGGMERSPVSLLPAAPMVYAVVDDPGIVDNP  64

Query  295  DVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCDCRI  474
            D+PSYQPHV+GRCDPPALIPLQMN I++ A+C+LDTAFV + G WRVHC+M +RSCDCR+
Sbjct  65   DIPSYQPHVYGRCDPPALIPLQMNEIALEADCFLDTAFVAIRGRWRVHCIMRNRSCDCRL  124

Query  475  AIPMGEQGSILGLEVEVPR  531
             +PMGEQGSILG+EVEV R
Sbjct  125  VVPMGEQGSILGVEVEVGR  143



>ref|XP_004287649.1| PREDICTED: uncharacterized protein LOC101300180 [Fragaria vesca 
subsp. vesca]
Length=752

 Score =   221 bits (563),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKT--AHSYLPSAPMLYAVIENPA  279
            MA EF+ AV+DGLRLSKR+ FGKDR+V+PP+   AM K+    +YLP++PM+YAVI +P 
Sbjct  1    MAEEFSKAVDDGLRLSKRLYFGKDRSVSPPKPPPAMHKSVAGRTYLPTSPMVYAVISDPT  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
            +VDNPD+PSYQPHVHGRCDPPALIPL MN + +  +C++DTAF+ VTGSWRVHCV  SRS
Sbjct  61   IVDNPDIPSYQPHVHGRCDPPALIPLPMNRVDLEVDCFMDTAFIRVTGSWRVHCVKSSRS  120

Query  460  CDCRIAIPMGEQGSILGLEVEV  525
            C CRIAIPMGEQGSILG+EVE+
Sbjct  121  CGCRIAIPMGEQGSILGVEVEI  142



>ref|XP_007012611.1| Inter-alpha-trypsin inhibitor heavy chain-related isoform 2 [Theobroma 
cacao]
 gb|EOY30230.1| Inter-alpha-trypsin inhibitor heavy chain-related isoform 2 [Theobroma 
cacao]
Length=759

 Score =   220 bits (560),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 120/142 (85%), Gaps = 1/142 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDR-AVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAV  282
            MA +FA AVEDGL+L+KRI  GKDR AV PP+    ME++ + YLPSAPM+YAVI +P +
Sbjct  1    MAEDFAQAVEDGLKLAKRIYLGKDRGAVGPPKPPPPMERSPYRYLPSAPMVYAVISDPRI  60

Query  283  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            VDNPD+PSYQPHVHGRCDPPALIPLQMN + +  +CY DTAF+ V+GSWRVHCVMGSRSC
Sbjct  61   VDNPDIPSYQPHVHGRCDPPALIPLQMNGVDLDVDCYADTAFIQVSGSWRVHCVMGSRSC  120

Query  463  DCRIAIPMGEQGSILGLEVEVP  528
            DCRIA+P G QGSILG+EV++P
Sbjct  121  DCRIAVPTGPQGSILGVEVDLP  142



>ref|XP_008388928.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 [Malus 
domestica]
Length=755

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 122/141 (87%), Gaps = 1/141 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEK-TAHSYLPSAPMLYAVIENPAV  282
            MA +F+ AV+DGL+ SKR+ FGKDRAV+PP+   +M+K T+ ++LP+APM+YAVI +P +
Sbjct  1    MAEDFSKAVDDGLKFSKRLYFGKDRAVSPPKQPPSMDKATSCAFLPTAPMVYAVISDPGI  60

Query  283  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            VDNPD+PSYQPHVHGRCDPPALIPL MN + +  +CY+DTAF+ V+GSWRVHC+ GS+SC
Sbjct  61   VDNPDIPSYQPHVHGRCDPPALIPLTMNRVELQVDCYMDTAFIRVSGSWRVHCIKGSKSC  120

Query  463  DCRIAIPMGEQGSILGLEVEV  525
             CR+AIPMGEQGSILG+EV+V
Sbjct  121  GCRVAIPMGEQGSILGVEVDV  141



>ref|XP_006452827.1| hypothetical protein CICLE_v10007546mg [Citrus clementina]
 gb|ESR66067.1| hypothetical protein CICLE_v10007546mg [Citrus clementina]
Length=758

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA--HSYLPSAPMLYAVIENPA  279
            MA +F  AVEDGL+LSKR+ FGKDR V PP+  ++M+K+      LP +PM+YAVI +P 
Sbjct  1    MADDFVKAVEDGLKLSKRLYFGKDRPVTPPKVPSSMDKSGAVDMLLPKSPMVYAVITDPK  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
            +VDNPD+PSYQP+VHGRCDPP+LIPLQMN++ +  +CYLDTAFV V+G+WRVHCVMGS+S
Sbjct  61   IVDNPDIPSYQPYVHGRCDPPSLIPLQMNAVELDVDCYLDTAFVRVSGTWRVHCVMGSKS  120

Query  460  CDCRIAIPMGEQGSILGLEVEV  525
            CDCRIA+PMG+QGSILG+E E+
Sbjct  121  CDCRIAVPMGDQGSILGVEAEI  142



>gb|KDO73864.1| hypothetical protein CISIN_1g004349mg [Citrus sinensis]
Length=759

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA--HSYLPSAPMLYAVIENPA  279
            MA +F  AVEDGL+LSKR+ FGKDR V PP+  ++M+K+      LP +PM+YAVI +P 
Sbjct  1    MADDFVKAVEDGLKLSKRLYFGKDRPVTPPKVPSSMDKSGAVDMLLPKSPMVYAVITDPK  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
            +VDNPD+PSYQP+VHGRCDPP+LIPLQMN++ +  +CYLDTAFV V+G+WRVHCVMGS+S
Sbjct  61   IVDNPDIPSYQPYVHGRCDPPSLIPLQMNAVELDVDCYLDTAFVRVSGTWRVHCVMGSKS  120

Query  460  CDCRIAIPMGEQGSILGLEVEV  525
            CDCRIA+PMG+QGSILG+E E+
Sbjct  121  CDCRIAVPMGDQGSILGVEAEI  142



>ref|XP_007204639.1| hypothetical protein PRUPE_ppa001864mg [Prunus persica]
 gb|EMJ05838.1| hypothetical protein PRUPE_ppa001864mg [Prunus persica]
Length=753

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKT-AHSYLPSAPMLYAVIENPAV  282
            MA EF+ AV+DGL+LSKR+ FGKDRAV+PP+   +M+KT + ++LP+APM+YAVI +PA+
Sbjct  1    MAEEFSKAVDDGLKLSKRLYFGKDRAVSPPKPPPSMDKTTSGAFLPTAPMVYAVIFDPAI  60

Query  283  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            VDNPD+PSYQPHVHGRCDP ALIPL MN + +  +CY+DTAFV VTGSWRVHCV G++SC
Sbjct  61   VDNPDIPSYQPHVHGRCDPAALIPLPMNRVELEVDCYMDTAFVRVTGSWRVHCVKGNKSC  120

Query  463  DCRIAIPMGEQGSILGLEVEV  525
             CR+AIPMGEQGSILG+EV+V
Sbjct  121  GCRVAIPMGEQGSILGVEVDV  141



>ref|XP_008242259.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 isoform 
X1 [Prunus mume]
Length=753

 Score =   219 bits (557),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKT-AHSYLPSAPMLYAVIENPAV  282
            MA EF+ AV+DGL+LSKR+ FGKDRAV+PP+   +M+KT + ++LP+APM+YAVI +PA+
Sbjct  1    MAEEFSKAVDDGLKLSKRLYFGKDRAVSPPKPPPSMDKTTSGAFLPTAPMVYAVIFDPAI  60

Query  283  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            VDNPD+PSYQPHVHGRCDP ALIPL MN + +  +CY+DTAFV VTGSWRVHCV G++SC
Sbjct  61   VDNPDIPSYQPHVHGRCDPAALIPLPMNRVELEVDCYMDTAFVRVTGSWRVHCVKGNKSC  120

Query  463  DCRIAIPMGEQGSILGLEVEV  525
             CR+AIPMGEQGSILG+EV+V
Sbjct  121  GCRVAIPMGEQGSILGVEVDV  141



>ref|XP_008337841.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Malus domestica]
Length=751

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 122/141 (87%), Gaps = 1/141 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEK-TAHSYLPSAPMLYAVIENPAV  282
            MA +F+ AV+DGL+LSKR+ FGKDRAV+PP+   +M+K T+ ++LP APM+YAVI +PA+
Sbjct  1    MAEDFSKAVDDGLKLSKRLYFGKDRAVSPPKPPPSMDKATSCAFLPKAPMVYAVISDPAI  60

Query  283  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            VDNPD+PSYQPHVHGRCDPPALIPL MN + +  +CY+DTAF+ V+GSWRVHCV  S+SC
Sbjct  61   VDNPDIPSYQPHVHGRCDPPALIPLTMNRVELEVDCYMDTAFIRVSGSWRVHCVKASKSC  120

Query  463  DCRIAIPMGEQGSILGLEVEV  525
             CR+AIPMGEQGSILG+EV+V
Sbjct  121  GCRVAIPMGEQGSILGVEVDV  141



>gb|KHN17734.1| von Willebrand factor A domain-containing protein [Glycine soja]
Length=754

 Score =   218 bits (556),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA +F+ AV+DGL+LSKRI FGKDRAV+  +  + M +   ++LPSAPM+YAVI +P +V
Sbjct  1    MAQDFSKAVDDGLKLSKRIYFGKDRAVSLSKHPSPMARLTTTFLPSAPMVYAVISDPGIV  60

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+PSYQPHV+GRCDPPALIPLQMN+I + A+CY +TAF+TV+G+WR+HCVMGSRSCD
Sbjct  61   DNPDIPSYQPHVYGRCDPPALIPLQMNAIQMEADCYHETAFITVSGTWRLHCVMGSRSCD  120

Query  466  CRIAIPMGEQGSILGLEVEVPR  531
            CRIA+P+  QGSILG+EV V R
Sbjct  121  CRIAVPVSHQGSILGVEVSVSR  142



>gb|KEH32427.1| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=585

 Score =   215 bits (548),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 119/142 (84%), Gaps = 1/142 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA EF  AV+DG++LSKRI FGKDRAVAPP+  T M K++ S LP APM+YAVI +P +V
Sbjct  1    MAEEFCRAVDDGMKLSKRIYFGKDRAVAPPKVPT-MSKSSTSLLPKAPMVYAVIHDPGIV  59

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+ SYQPHV+GRCDPPALIPLQMN+I +  +CYLDTAFVTV+G+WRVHCV GS + D
Sbjct  60   DNPDIASYQPHVYGRCDPPALIPLQMNAIEMEIDCYLDTAFVTVSGTWRVHCVTGSSTTD  119

Query  466  CRIAIPMGEQGSILGLEVEVPR  531
            CR+AIP+G++GSILG+EV   R
Sbjct  120  CRLAIPIGDEGSILGVEVNALR  141



>ref|XP_008782726.1| PREDICTED: LOW QUALITY PROTEIN: inter alpha-trypsin inhibitor, 
heavy chain 4-like [Phoenix dactylifera]
Length=746

 Score =   218 bits (554),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  EFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVVDNP  294
            EFA AVEDGL+L+KRI  GKDR   PPR +  ME++  S LP+APM+YAV+++P +VDNP
Sbjct  5    EFAKAVEDGLKLAKRIYAGKDRHFGPPRPVGGMERSLASLLPAAPMVYAVVDDPGIVDNP  64

Query  295  DVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCDCRI  474
            D+PSYQPHV+G CDPPALIPLQMN I+V A+C+LDTAFV + G WRVHC+M +RSCDCR+
Sbjct  65   DIPSYQPHVYGHCDPPALIPLQMNEIAVEADCFLDTAFVAIRGRWRVHCIMRNRSCDCRL  124

Query  475  AIPMGEQGSILGLEVEVPR  531
             +PMGEQGSILG+EVEV +
Sbjct  125  LVPMGEQGSILGVEVEVGK  143



>ref|XP_010666845.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4 [Beta 
vulgaris subsp. vulgaris]
Length=758

 Score =   218 bits (554),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  EFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVVDNP  294
            +F  AVE+GL+LSKR+ FGKDR+VAPP+    M K    YLP+APM+YAV+ +P +VDNP
Sbjct  7    DFMEAVEEGLKLSKRLYFGKDRSVAPPKPPPPMSKFPRFYLPTAPMVYAVVSDPGIVDNP  66

Query  295  DVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCDCRI  474
            D+PSYQP+V+GRCDPPALIPLQMN++S+  +CYLDT FV+V+G WRVHCVMGS+SCDCR+
Sbjct  67   DIPSYQPYVYGRCDPPALIPLQMNNVSMEVDCYLDTVFVSVSGEWRVHCVMGSKSCDCRL  126

Query  475  AIPMGEQGSILGLEVEVPR  531
            A+PMGEQGS+LG+E++V R
Sbjct  127  AVPMGEQGSVLGVEIDVSR  145



>ref|XP_006474710.1| PREDICTED: uncharacterized protein LOC102609180 [Citrus sinensis]
Length=759

 Score =   217 bits (553),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 119/142 (84%), Gaps = 2/142 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA--HSYLPSAPMLYAVIENPA  279
            MA +F  AVEDGL+LSKR+ FGKDR   PP+  ++M+K+      LP +PM+YAVI +P 
Sbjct  1    MADDFVKAVEDGLKLSKRLYFGKDRPATPPKVPSSMDKSGAVDMLLPKSPMVYAVITDPK  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
            +VDNPD+PSYQP+VHGRCDPP+LIPLQMN++ +  +CYLDTAFV V+G+WRVHCVMGS+S
Sbjct  61   IVDNPDIPSYQPYVHGRCDPPSLIPLQMNAVELDVDCYLDTAFVRVSGTWRVHCVMGSKS  120

Query  460  CDCRIAIPMGEQGSILGLEVEV  525
            CDCRIA+PMG+QGSILG+E E+
Sbjct  121  CDCRIAVPMGDQGSILGVEAEI  142



>ref|XP_009359719.1| PREDICTED: uncharacterized protein LOC103950254 [Pyrus x bretschneideri]
Length=755

 Score =   216 bits (550),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 120/141 (85%), Gaps = 1/141 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEK-TAHSYLPSAPMLYAVIENPAV  282
            MA +F+ AV+DGL+LSKR+ FGKDRAV+PP+   +M+K T+ ++LP APM+YAVI +PA+
Sbjct  1    MAEDFSKAVDDGLKLSKRLYFGKDRAVSPPKPPPSMDKATSCTFLPKAPMVYAVISDPAI  60

Query  283  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            VDNPD+PSYQPHVHGRCDPPALIPL MN + +  +CY+DTAF+ V+GSWRVHCV  S+ C
Sbjct  61   VDNPDIPSYQPHVHGRCDPPALIPLTMNRVELEVDCYMDTAFIRVSGSWRVHCVKPSKGC  120

Query  463  DCRIAIPMGEQGSILGLEVEV  525
             CR+AIPMGEQGSILG+EV V
Sbjct  121  GCRVAIPMGEQGSILGVEVNV  141



>ref|XP_007154569.1| hypothetical protein PHAVU_003G129800g [Phaseolus vulgaris]
 gb|ESW26563.1| hypothetical protein PHAVU_003G129800g [Phaseolus vulgaris]
Length=753

 Score =   215 bits (548),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA +F+ AV+DGL+LSKRI FGKDRAVAPP+    M ++A ++LPSA M+YAVI +P +V
Sbjct  1    MAEDFSKAVDDGLKLSKRIYFGKDRAVAPPKPPPPMARSAKAFLPSASMIYAVICDPGIV  60

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+PSYQPHVHGRCDPPALIPLQM +I +  +C+ +TAFVTV+G+WR+HC+  SRSCD
Sbjct  61   DNPDIPSYQPHVHGRCDPPALIPLQMTAIQMEVDCHHETAFVTVSGTWRLHCIKASRSCD  120

Query  466  CRIAIPMGEQGSILGLEVEVPR  531
            CR+AIPMG QGSILG+EV VPR
Sbjct  121  CRVAIPMGRQGSILGVEVGVPR  142



>gb|AES92187.2| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=752

 Score =   215 bits (548),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 119/142 (84%), Gaps = 1/142 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA EF  AV+DG++LSKRI FGKDRAVAPP+  T M K++ S LP APM+YAVI +P +V
Sbjct  1    MAEEFCRAVDDGMKLSKRIYFGKDRAVAPPKVPT-MSKSSTSLLPKAPMVYAVIHDPGIV  59

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+ SYQPHV+GRCDPPALIPLQMN+I +  +CYLDTAFVTV+G+WRVHCV GS + D
Sbjct  60   DNPDIASYQPHVYGRCDPPALIPLQMNAIEMEIDCYLDTAFVTVSGTWRVHCVTGSSTTD  119

Query  466  CRIAIPMGEQGSILGLEVEVPR  531
            CR+AIP+G++GSILG+EV   R
Sbjct  120  CRLAIPIGDEGSILGVEVNALR  141



>ref|XP_010242255.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Nelumbo nucifera]
Length=750

 Score =   214 bits (546),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 119/140 (85%), Gaps = 1/140 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA +F+ +VE+G RLSKR+ +GK   V PP    AM+K+  ++LP+APM+YAVI +PAVV
Sbjct  1    MADDFSKSVEEGFRLSKRLYYGKHHPVLPPLP-AAMKKSRRTHLPTAPMVYAVISDPAVV  59

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+PSYQP+VHG CDPPALIPLQMN I+V  +CYLDTA V+V+GSWRVHCVMGSRSC 
Sbjct  60   DNPDIPSYQPYVHGLCDPPALIPLQMNDIAVQVDCYLDTALVSVSGSWRVHCVMGSRSCS  119

Query  466  CRIAIPMGEQGSILGLEVEV  525
            CRIA+PMGEQGSILG+EV+V
Sbjct  120  CRIAVPMGEQGSILGVEVDV  139



>ref|XP_003609990.1| von Willebrand factor A domain-containing protein [Medicago truncatula]
Length=844

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 119/142 (84%), Gaps = 1/142 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA EF  AV+DG++LSKRI FGKDRAVAPP+  T M K++ S LP APM+YAVI +P +V
Sbjct  1    MAEEFCRAVDDGMKLSKRIYFGKDRAVAPPKVPT-MSKSSTSLLPKAPMVYAVIHDPGIV  59

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+ SYQPHV+GRCDPPALIPLQMN+I +  +CYLDTAFVTV+G+WRVHCV GS + D
Sbjct  60   DNPDIASYQPHVYGRCDPPALIPLQMNAIEMEIDCYLDTAFVTVSGTWRVHCVTGSSTTD  119

Query  466  CRIAIPMGEQGSILGLEVEVPR  531
            CR+AIP+G++GSILG+EV   R
Sbjct  120  CRLAIPIGDEGSILGVEVNALR  141



>gb|KCW79380.1| hypothetical protein EUGRSUZ_C00792 [Eucalyptus grandis]
Length=600

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 117/148 (79%), Gaps = 6/148 (4%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPS------APMLYAVI  267
            MA +FA AV+DGLRLSKR+ FGKDRAV  PR+   ME+   +   +      +PM+YAVI
Sbjct  1    MADDFAKAVDDGLRLSKRLYFGKDRAVTAPRSPAPMERAPAAGEAALLLLPASPMVYAVI  60

Query  268  ENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVM  447
             +P VVDNPD+PSYQPHVHGRCDPPALIPLQMN I V A+C LD A V V+GSWRVHCVM
Sbjct  61   PDPTVVDNPDIPSYQPHVHGRCDPPALIPLQMNGIEVEADCQLDAAVVRVSGSWRVHCVM  120

Query  448  GSRSCDCRIAIPMGEQGSILGLEVEVPR  531
            GS+ CDCR+AIPMGEQGS+LGLEV+V +
Sbjct  121  GSKCCDCRVAIPMGEQGSVLGLEVKVSK  148



>ref|XP_003542365.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
[Glycine max]
Length=754

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA +F+ AV+DGL+LSKRI F KDRAV+PP+    M + A ++LPSAPM+YAVI +P +V
Sbjct  1    MAVDFSKAVDDGLKLSKRIYFVKDRAVSPPKPPPPMARWATAFLPSAPMVYAVISDPGIV  60

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+ SYQPHV+GRCDPPALIPLQMN+I + A+CY +TAFVTV+G+WR+HCVMGSRSCD
Sbjct  61   DNPDISSYQPHVYGRCDPPALIPLQMNAIEMEADCYHETAFVTVSGTWRLHCVMGSRSCD  120

Query  466  CRIAIPMGEQGSILGLEVEVPR  531
            CRIA+P+  QGSILG+EV V R
Sbjct  121  CRIAVPVSHQGSILGVEVSVSR  142



>ref|XP_010100827.1| hypothetical protein L484_000119 [Morus notabilis]
 gb|EXC45032.1| hypothetical protein L484_000119 [Morus notabilis]
Length=160

 Score =   197 bits (502),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 112/132 (85%), Gaps = 2/132 (2%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTA-MEKT-AHSYLPSAPMLYAVIENPA  279
            MA +FA AV+DGLRLSKR+ FGKDR  AP R   A ME++ + S LP+APM+YAVI +PA
Sbjct  1    MADDFAQAVDDGLRLSKRLYFGKDREAAPRRPSPAVMERSPSRSLLPTAPMVYAVIYDPA  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
            +VDNPD+PSYQPHVHGRCD PALIPLQM+ + + A+CYLDTAFV V+GSWRVHCVMGS+S
Sbjct  61   IVDNPDIPSYQPHVHGRCDTPALIPLQMHGVELEADCYLDTAFVRVSGSWRVHCVMGSKS  120

Query  460  CDCRIAIPMGEQ  495
            C CRIA+P+GEQ
Sbjct  121  CGCRIAVPIGEQ  132



>ref|XP_002271630.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 isoform 
X1 [Vitis vinifera]
 emb|CBI35850.3| unnamed protein product [Vitis vinifera]
Length=747

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 120/142 (85%), Gaps = 3/142 (2%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKT--AHSYLPSAPMLYAVIENPA  279
            MA +F+ AVE GLRLSKRI +GKDR+ + P+    MEK+    S+LP+APM+YAVI  P+
Sbjct  1    MAEDFSTAVEYGLRLSKRIYYGKDRSASAPKPQ-EMEKSESQESFLPTAPMVYAVIPEPS  59

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
            +VDNPDVPSYQP+VHGRCDPPALIPL M  I++  +CYLDTAF++V+G+WRVHCVMGSR 
Sbjct  60   IVDNPDVPSYQPYVHGRCDPPALIPLHMLGIAMEVDCYLDTAFISVSGTWRVHCVMGSRR  119

Query  460  CDCRIAIPMGEQGSILGLEVEV  525
            CDCR+AIPMGEQGS+LG+EV+V
Sbjct  120  CDCRVAIPMGEQGSVLGVEVDV  141



>ref|XP_010654417.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 isoform 
X2 [Vitis vinifera]
Length=746

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 120/142 (85%), Gaps = 3/142 (2%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKT--AHSYLPSAPMLYAVIENPA  279
            MA +F+ AVE GLRLSKRI +GKDR+ + P+    MEK+    S+LP+APM+YAVI  P+
Sbjct  1    MAEDFSTAVEYGLRLSKRIYYGKDRSASAPKPQ-EMEKSESQESFLPTAPMVYAVIPEPS  59

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
            +VDNPDVPSYQP+VHGRCDPPALIPL M  I++  +CYLDTAF++V+G+WRVHCVMGSR 
Sbjct  60   IVDNPDVPSYQPYVHGRCDPPALIPLHMLGIAMEVDCYLDTAFISVSGTWRVHCVMGSRR  119

Query  460  CDCRIAIPMGEQGSILGLEVEV  525
            CDCR+AIPMGEQGS+LG+EV+V
Sbjct  120  CDCRVAIPMGEQGSVLGVEVDV  141



>ref|XP_010047465.1| PREDICTED: uncharacterized protein LOC104436401 [Eucalyptus grandis]
 gb|KCW79379.1| hypothetical protein EUGRSUZ_C00792 [Eucalyptus grandis]
Length=755

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 117/148 (79%), Gaps = 6/148 (4%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPS------APMLYAVI  267
            MA +FA AV+DGLRLSKR+ FGKDRAV  PR+   ME+   +   +      +PM+YAVI
Sbjct  1    MADDFAKAVDDGLRLSKRLYFGKDRAVTAPRSPAPMERAPAAGEAALLLLPASPMVYAVI  60

Query  268  ENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVM  447
             +P VVDNPD+PSYQPHVHGRCDPPALIPLQMN I V A+C LD A V V+GSWRVHCVM
Sbjct  61   PDPTVVDNPDIPSYQPHVHGRCDPPALIPLQMNGIEVEADCQLDAAVVRVSGSWRVHCVM  120

Query  448  GSRSCDCRIAIPMGEQGSILGLEVEVPR  531
            GS+ CDCR+AIPMGEQGS+LGLEV+V +
Sbjct  121  GSKCCDCRVAIPMGEQGSVLGLEVKVSK  148



>gb|KJB07323.1| hypothetical protein B456_001G016000 [Gossypium raimondii]
Length=781

 Score =   211 bits (538),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 95/144 (66%), Positives = 114/144 (79%), Gaps = 2/144 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAV--APPRAMTAMEKTAHSYLPSAPMLYAVIENPA  279
            MA +FA AVEDGL+L+KRI  GKD+AV  AP      ++  A  YLPSAPM+YAVI +P 
Sbjct  1    MAEDFAKAVEDGLKLAKRIYLGKDKAVMTAPKPPSPPVQGLADYYLPSAPMVYAVISDPG  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
             VDNPD PSYQPHV+GRCDPPALIPLQM+ + +   CY DTAFV ++G WRVHCVMGS S
Sbjct  61   FVDNPDFPSYQPHVYGRCDPPALIPLQMSGVDLEVNCYGDTAFVQISGKWRVHCVMGSHS  120

Query  460  CDCRIAIPMGEQGSILGLEVEVPR  531
            CDCRIA+PMG QGSILG+EV++P+
Sbjct  121  CDCRIAVPMGNQGSILGVEVDLPK  144



>gb|KJB07327.1| hypothetical protein B456_001G016000 [Gossypium raimondii]
Length=756

 Score =   211 bits (536),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 95/144 (66%), Positives = 114/144 (79%), Gaps = 2/144 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAV--APPRAMTAMEKTAHSYLPSAPMLYAVIENPA  279
            MA +FA AVEDGL+L+KRI  GKD+AV  AP      ++  A  YLPSAPM+YAVI +P 
Sbjct  1    MAEDFAKAVEDGLKLAKRIYLGKDKAVMTAPKPPSPPVQGLADYYLPSAPMVYAVISDPG  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
             VDNPD PSYQPHV+GRCDPPALIPLQM+ + +   CY DTAFV ++G WRVHCVMGS S
Sbjct  61   FVDNPDFPSYQPHVYGRCDPPALIPLQMSGVDLEVNCYGDTAFVQISGKWRVHCVMGSHS  120

Query  460  CDCRIAIPMGEQGSILGLEVEVPR  531
            CDCRIA+PMG QGSILG+EV++P+
Sbjct  121  CDCRIAVPMGNQGSILGVEVDLPK  144



>gb|KJB07324.1| hypothetical protein B456_001G016000 [Gossypium raimondii]
 gb|KJB07326.1| hypothetical protein B456_001G016000 [Gossypium raimondii]
Length=614

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 114/144 (79%), Gaps = 2/144 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAV--APPRAMTAMEKTAHSYLPSAPMLYAVIENPA  279
            MA +FA AVEDGL+L+KRI  GKD+AV  AP      ++  A  YLPSAPM+YAVI +P 
Sbjct  1    MAEDFAKAVEDGLKLAKRIYLGKDKAVMTAPKPPSPPVQGLADYYLPSAPMVYAVISDPG  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
             VDNPD PSYQPHV+GRCDPPALIPLQM+ + +   CY DTAFV ++G WRVHCVMGS S
Sbjct  61   FVDNPDFPSYQPHVYGRCDPPALIPLQMSGVDLEVNCYGDTAFVQISGKWRVHCVMGSHS  120

Query  460  CDCRIAIPMGEQGSILGLEVEVPR  531
            CDCRIA+PMG QGSILG+EV++P+
Sbjct  121  CDCRIAVPMGNQGSILGVEVDLPK  144



>gb|KJB07322.1| hypothetical protein B456_001G016000 [Gossypium raimondii]
Length=654

 Score =   208 bits (529),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 114/144 (79%), Gaps = 2/144 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAV--APPRAMTAMEKTAHSYLPSAPMLYAVIENPA  279
            MA +FA AVEDGL+L+KRI  GKD+AV  AP      ++  A  YLPSAPM+YAVI +P 
Sbjct  1    MAEDFAKAVEDGLKLAKRIYLGKDKAVMTAPKPPSPPVQGLADYYLPSAPMVYAVISDPG  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
             VDNPD PSYQPHV+GRCDPPALIPLQM+ + +   CY DTAFV ++G WRVHCVMGS S
Sbjct  61   FVDNPDFPSYQPHVYGRCDPPALIPLQMSGVDLEVNCYGDTAFVQISGKWRVHCVMGSHS  120

Query  460  CDCRIAIPMGEQGSILGLEVEVPR  531
            CDCRIA+PMG QGSILG+EV++P+
Sbjct  121  CDCRIAVPMGNQGSILGVEVDLPK  144



>gb|KHG29331.1| von Willebrand factor A domain-containing [Gossypium arboreum]
Length=756

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 114/144 (79%), Gaps = 2/144 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAV--APPRAMTAMEKTAHSYLPSAPMLYAVIENPA  279
            MA +FA AVEDGL+L+KRI  GKD+AV  AP      ++  A  YLPSAPM+YAVI +P 
Sbjct  1    MAEDFAKAVEDGLKLAKRIYLGKDKAVMTAPKPPSPPVQGLADYYLPSAPMVYAVISDPR  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
             VDNPD PSYQPHV+GRCDPPALIPLQM+ + +   CY DTAFV ++G WRVHCVMGS S
Sbjct  61   FVDNPDFPSYQPHVYGRCDPPALIPLQMSGVDLEVNCYGDTAFVQISGKWRVHCVMGSHS  120

Query  460  CDCRIAIPMGEQGSILGLEVEVPR  531
            CDCRIA+PMG QGSILG+EV++P+
Sbjct  121  CDCRIAVPMGNQGSILGVEVDLPK  144



>ref|XP_004488095.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Cicer arietinum]
Length=752

 Score =   207 bits (527),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 119/143 (83%), Gaps = 1/143 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA EF+ AVE+G+RLSKRI FG DRAV+PP+  T+M K+  ++LP++PM+YAVI +PA+V
Sbjct  1    MAEEFSKAVEEGIRLSKRIYFGNDRAVSPPKPPTSMLKSNTAFLPTSPMVYAVIHDPAIV  60

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQM-NSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            DNPDVPSYQP+VHGRC+PPALIPL M N + +  +CYL++AF+ V G WR+HCV GSR+C
Sbjct  61   DNPDVPSYQPYVHGRCEPPALIPLHMINVVELKGDCYLNSAFLEVVGCWRLHCVSGSRAC  120

Query  463  DCRIAIPMGEQGSILGLEVEVPR  531
            DC +A+PMG QGSILG+EV V R
Sbjct  121  DCILAVPMGPQGSILGVEVSVHR  143



>ref|XP_009404352.1| PREDICTED: uncharacterized protein LOC103987694 [Musa acuminata 
subsp. malaccensis]
Length=750

 Score =   206 bits (525),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 113/137 (82%), Gaps = 1/137 (1%)
 Frame = +1

Query  118  FAAAVEDGLRLSKRINFGKDRAVA-PPRAMTAMEKTAHSYLPSAPMLYAVIENPAVVDNP  294
            FA AVEDGL+L+KR+  GK+R  A PPR  T ME+++  +LP+APM+YAVI +PA+VDNP
Sbjct  7    FATAVEDGLKLAKRVYAGKERQFAAPPRPATGMERSSEPFLPTAPMVYAVISDPAIVDNP  66

Query  295  DVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCDCRI  474
            D+PSYQPHV+G CDPPALIPLQM  + +  EC LD AFV V+G WRVHCVM ++SCDCR+
Sbjct  67   DIPSYQPHVYGACDPPALIPLQMGDVGLEVECLLDAAFVAVSGRWRVHCVMRNKSCDCRL  126

Query  475  AIPMGEQGSILGLEVEV  525
             +PMGEQGSILG+EVEV
Sbjct  127  VVPMGEQGSILGVEVEV  143



>ref|XP_010318476.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0292028 isoform X4 [Solanum lycopersicum]
Length=641

 Score =   203 bits (517),  Expect = 3e-58, Method: Composition-based stats.
 Identities = 86/142 (61%), Positives = 117/142 (82%), Gaps = 5/142 (4%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAH-SYLPSAPMLYAVIENPAV  282
            MA EFA++V+ GL+L+KRI +GK+    PP+ +   +K++  + LP+APM+YAV+ +P++
Sbjct  1    MADEFASSVDMGLQLTKRIYYGKN----PPKPLVMEKKSSEINNLPTAPMVYAVVRDPSM  56

Query  283  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            VDNPD+PSYQP+VHGRCDPPALIPL M  I++  +CY+DTAFVTV G+WRVHC+  SR C
Sbjct  57   VDNPDIPSYQPYVHGRCDPPALIPLDMQGIAMEVDCYMDTAFVTVNGTWRVHCIASSRYC  116

Query  463  DCRIAIPMGEQGSILGLEVEVP  528
            DCRIA+PMGEQGS+LG+E+E P
Sbjct  117  DCRIAVPMGEQGSVLGVEIETP  138



>ref|XP_003595328.1| Inter-alpha-trypsin inhibitor heavy chain H3 [Medicago truncatula]
 gb|AES65579.1| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=751

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 113/143 (79%), Gaps = 1/143 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA EF+ +VE+G++LSKRI FG DRAV  P+    M KT  ++LP++PM+YAVI +P +V
Sbjct  1    MAEEFSKSVEEGIKLSKRIYFGNDRAVTAPKPPPTMSKTNTAFLPTSPMVYAVIHDPKIV  60

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQM-NSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            DNPDVPSYQPHVHGRCDPPALIPLQM N + +  + +LDTAFV V+G WR+HCV GSRSC
Sbjct  61   DNPDVPSYQPHVHGRCDPPALIPLQMINGVDLRVDAWLDTAFVEVSGCWRLHCVSGSRSC  120

Query  463  DCRIAIPMGEQGSILGLEVEVPR  531
            DC + +PM  QGSILG+EV V R
Sbjct  121  DCIVVVPMSSQGSILGVEVSVHR  143



>ref|XP_009625881.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0285981-like isoform X1 [Nicotiana tomentosiformis]
Length=745

 Score =   201 bits (511),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 116/144 (81%), Gaps = 7/144 (5%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHS---YLPSAPMLYAVIENP  276
            MA +FA +V+ GL+L+KRI +GK+    PP+ +   +K++ +   YLP+ PM+YAVI +P
Sbjct  1    MADDFATSVDMGLQLAKRIYYGKN----PPKPLVMEKKSSFTEINYLPTGPMMYAVIRDP  56

Query  277  AVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSR  456
            ++VDNPD+PSYQP+VHGRCDPPALIPL M++I +  +CY+DTAFVTV GSWRVHCV  SR
Sbjct  57   SIVDNPDIPSYQPYVHGRCDPPALIPLDMHAIGMEVDCYMDTAFVTVNGSWRVHCVASSR  116

Query  457  SCDCRIAIPMGEQGSILGLEVEVP  528
             CDCR A+PMGEQGS+LG+EVE P
Sbjct  117  CCDCRFAVPMGEQGSVLGVEVETP  140



>ref|XP_009625882.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0285981-like isoform X2 [Nicotiana tomentosiformis]
Length=744

 Score =   201 bits (511),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 116/144 (81%), Gaps = 7/144 (5%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHS---YLPSAPMLYAVIENP  276
            MA +FA +V+ GL+L+KRI +GK+    PP+ +   +K++ +   YLP+ PM+YAVI +P
Sbjct  1    MADDFATSVDMGLQLAKRIYYGKN----PPKPLVMEKKSSFTEINYLPTGPMMYAVIRDP  56

Query  277  AVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSR  456
            ++VDNPD+PSYQP+VHGRCDPPALIPL M++I +  +CY+DTAFVTV GSWRVHCV  SR
Sbjct  57   SIVDNPDIPSYQPYVHGRCDPPALIPLDMHAIGMEVDCYMDTAFVTVNGSWRVHCVASSR  116

Query  457  SCDCRIAIPMGEQGSILGLEVEVP  528
             CDCR A+PMGEQGS+LG+EVE P
Sbjct  117  CCDCRFAVPMGEQGSVLGVEVETP  140



>ref|XP_009389548.1| PREDICTED: uncharacterized protein LOC103976087 [Musa acuminata 
subsp. malaccensis]
Length=747

 Score =   201 bits (510),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 110/138 (80%), Gaps = 1/138 (1%)
 Frame = +1

Query  115  EFAAAVEDGLRLSKRINFGKDRAVA-PPRAMTAMEKTAHSYLPSAPMLYAVIENPAVVDN  291
            EFA AVE+GL+L+KR+  GKDR +A PP     ME+T  S LP APM+YAVI +PA+VDN
Sbjct  6    EFAKAVEEGLKLAKRVYAGKDRQLAAPPLPAAKMERTPESLLPGAPMVYAVISDPAIVDN  65

Query  292  PDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCDCR  471
            PD+PSYQPHVHGRC+PPALIPLQM  I +  +C L TAFV V G W+VHCVM  +SCDCR
Sbjct  66   PDIPSYQPHVHGRCNPPALIPLQMGEIGLEVDCLLGTAFVAVRGRWKVHCVMRHKSCDCR  125

Query  472  IAIPMGEQGSILGLEVEV  525
            + +P+GEQGSILG+EVEV
Sbjct  126  LVVPVGEQGSILGVEVEV  143



>ref|XP_007138646.1| hypothetical protein PHAVU_009G226200g [Phaseolus vulgaris]
 gb|ESW10640.1| hypothetical protein PHAVU_009G226200g [Phaseolus vulgaris]
Length=761

 Score =   201 bits (510),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA EF+ +VE+GL LSKRI FGKDRAV+PP+    M K+  +YLP+APMLYAVI +PA+V
Sbjct  1    MAEEFSKSVEEGLHLSKRIYFGKDRAVSPPKPPLTMSKSHTAYLPTAPMLYAVIHDPAIV  60

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLD-TAFVTVTGSWRVHCVMGSRSC  462
            DNPDVPSYQP+VHG+CDPPA IPL M ++ + A C+LD  AFVT+  +WR+HC+ GSRSC
Sbjct  61   DNPDVPSYQPYVHGKCDPPAHIPLHMTAVHLQAHCHLDAAAFVTLFATWRLHCISGSRSC  120

Query  463  DCRIAIPMGEQGSILGLEVEVPR  531
            DC +A+P+  QGSILG+EV V R
Sbjct  121  DCIVAVPVPHQGSILGVEVSVHR  143



>gb|KJB82978.1| hypothetical protein B456_013G222900 [Gossypium raimondii]
Length=749

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 115/142 (81%), Gaps = 1/142 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKD-RAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAV  282
            MA +FA AVEDGL+L+KR+  GKD R VA   A   ME++ + YLPSAPM+YAVI +P +
Sbjct  1    MAEDFAKAVEDGLKLAKRVYLGKDSRTVARRMAPPLMERSTNWYLPSAPMVYAVISDPRM  60

Query  283  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            VDNPD+PSYQP+VHG  DPPALIPLQM  +++  +CY+DTA + V G+WR+HCVMGSRSC
Sbjct  61   VDNPDMPSYQPYVHGMYDPPALIPLQMMGVNLNVDCYVDTAIIVVAGTWRIHCVMGSRSC  120

Query  463  DCRIAIPMGEQGSILGLEVEVP  528
            DC IA+PMG QGSILG+EV++P
Sbjct  121  DCLIAVPMGNQGSILGVEVDLP  142



>gb|KCW71314.1| hypothetical protein EUGRSUZ_F04397 [Eucalyptus grandis]
Length=527

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 113/140 (81%), Gaps = 2/140 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA +FA +V+ GL LSKRI +GK  A AP     AM ++   YLP+APM+YAV+ +P  V
Sbjct  1    MARKFAGSVDYGLALSKRIYYGKGAATAPDPP--AMSRSPDDYLPTAPMVYAVVPDPTAV  58

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPDVPSYQP+VHGRCDPPAL+PLQM+ +++  +CYLDTAFV++TG WRVHC+M SR CD
Sbjct  59   DNPDVPSYQPYVHGRCDPPALVPLQMHEVAMEVDCYLDTAFVSMTGRWRVHCIMTSRRCD  118

Query  466  CRIAIPMGEQGSILGLEVEV  525
            C++AIPMGEQG +LG+EV+V
Sbjct  119  CQVAIPMGEQGLLLGIEVDV  138



>emb|CDO97834.1| unnamed protein product [Coffea canephora]
Length=736

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 113/141 (80%), Gaps = 0/141 (0%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA +F+ +VE GL+LSKRI +GK+ +   P  M    +T    LP+ PM+YAVI  P++V
Sbjct  1    MADQFSKSVEFGLKLSKRIFYGKESSAPAPAVMERKSETNWPLLPTGPMVYAVISEPSMV  60

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+PSYQP+VHGRC+PPALIPL M+ +++  +CYLDTAF+TVTG+WR+HCV  S+SCD
Sbjct  61   DNPDIPSYQPYVHGRCEPPALIPLHMHGVAMEVDCYLDTAFITVTGTWRLHCVTASKSCD  120

Query  466  CRIAIPMGEQGSILGLEVEVP  528
            CRIA+PMGE+GSILG++VE P
Sbjct  121  CRIAVPMGEKGSILGVQVECP  141



>ref|XP_004235553.1| PREDICTED: uncharacterized protein LOC101253877 isoform X1 [Solanum 
lycopersicum]
Length=744

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 117/142 (82%), Gaps = 5/142 (4%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAH-SYLPSAPMLYAVIENPAV  282
            MA EFA++V+ GL+L+KRI +GK+    PP+ +   +K++  + LP+APM+YAV+ +P++
Sbjct  1    MADEFASSVDMGLQLTKRIYYGKN----PPKPLVMEKKSSEINNLPTAPMVYAVVRDPSM  56

Query  283  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            VDNPD+PSYQP+VHGRCDPPALIPL M  I++  +CY+DTAFVTV G+WRVHC+  SR C
Sbjct  57   VDNPDIPSYQPYVHGRCDPPALIPLDMQGIAMEVDCYMDTAFVTVNGTWRVHCIASSRYC  116

Query  463  DCRIAIPMGEQGSILGLEVEVP  528
            DCRIA+PMGEQGS+LG+E+E P
Sbjct  117  DCRIAVPMGEQGSVLGVEIETP  138



>ref|XP_010318475.1| PREDICTED: uncharacterized protein LOC101253877 isoform X3 [Solanum 
lycopersicum]
Length=739

 Score =   198 bits (504),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 117/142 (82%), Gaps = 5/142 (4%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAH-SYLPSAPMLYAVIENPAV  282
            MA EFA++V+ GL+L+KRI +GK+    PP+ +   +K++  + LP+APM+YAV+ +P++
Sbjct  1    MADEFASSVDMGLQLTKRIYYGKN----PPKPLVMEKKSSEINNLPTAPMVYAVVRDPSM  56

Query  283  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            VDNPD+PSYQP+VHGRCDPPALIPL M  I++  +CY+DTAFVTV G+WRVHC+  SR C
Sbjct  57   VDNPDIPSYQPYVHGRCDPPALIPLDMQGIAMEVDCYMDTAFVTVNGTWRVHCIASSRYC  116

Query  463  DCRIAIPMGEQGSILGLEVEVP  528
            DCRIA+PMGEQGS+LG+E+E P
Sbjct  117  DCRIAVPMGEQGSVLGVEIETP  138



>ref|XP_010318474.1| PREDICTED: uncharacterized protein LOC101253877 isoform X2 [Solanum 
lycopersicum]
Length=743

 Score =   198 bits (504),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 117/142 (82%), Gaps = 5/142 (4%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAH-SYLPSAPMLYAVIENPAV  282
            MA EFA++V+ GL+L+KRI +GK+    PP+ +   +K++  + LP+APM+YAV+ +P++
Sbjct  1    MADEFASSVDMGLQLTKRIYYGKN----PPKPLVMEKKSSEINNLPTAPMVYAVVRDPSM  56

Query  283  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            VDNPD+PSYQP+VHGRCDPPALIPL M  I++  +CY+DTAFVTV G+WRVHC+  SR C
Sbjct  57   VDNPDIPSYQPYVHGRCDPPALIPLDMQGIAMEVDCYMDTAFVTVNGTWRVHCIASSRYC  116

Query  463  DCRIAIPMGEQGSILGLEVEVP  528
            DCRIA+PMGEQGS+LG+E+E P
Sbjct  117  DCRIAVPMGEQGSVLGVEIETP  138



>ref|XP_009764208.1| PREDICTED: uncharacterized protein LOC104215964 isoform X1 [Nicotiana 
sylvestris]
Length=745

 Score =   198 bits (504),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 114/144 (79%), Gaps = 7/144 (5%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHS---YLPSAPMLYAVIENP  276
            MA +FA +V+ GL+L+KRI +GK+    PP+ +   +K++ +   YLP  PM+YAVI +P
Sbjct  1    MADDFATSVDMGLQLAKRIYYGKN----PPKPLVMEKKSSFTETNYLPMGPMMYAVIRDP  56

Query  277  AVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSR  456
            ++VDNPD+PSYQP+VHGRCDPPALIPL M +I +  +CY+DTAFVTV GSWRVHCV  SR
Sbjct  57   SMVDNPDIPSYQPYVHGRCDPPALIPLDMQAIGMEVDCYMDTAFVTVNGSWRVHCVASSR  116

Query  457  SCDCRIAIPMGEQGSILGLEVEVP  528
             CDCR A+PMGEQGS+LG+EVE P
Sbjct  117  CCDCRFAVPMGEQGSVLGVEVETP  140



>ref|XP_009764209.1| PREDICTED: uncharacterized protein LOC104215964 isoform X2 [Nicotiana 
sylvestris]
Length=744

 Score =   198 bits (504),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 114/144 (79%), Gaps = 7/144 (5%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHS---YLPSAPMLYAVIENP  276
            MA +FA +V+ GL+L+KRI +GK+    PP+ +   +K++ +   YLP  PM+YAVI +P
Sbjct  1    MADDFATSVDMGLQLAKRIYYGKN----PPKPLVMEKKSSFTETNYLPMGPMMYAVIRDP  56

Query  277  AVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSR  456
            ++VDNPD+PSYQP+VHGRCDPPALIPL M +I +  +CY+DTAFVTV GSWRVHCV  SR
Sbjct  57   SMVDNPDIPSYQPYVHGRCDPPALIPLDMQAIGMEVDCYMDTAFVTVNGSWRVHCVASSR  116

Query  457  SCDCRIAIPMGEQGSILGLEVEVP  528
             CDCR A+PMGEQGS+LG+EVE P
Sbjct  117  CCDCRFAVPMGEQGSVLGVEVETP  140



>gb|KCW71313.1| hypothetical protein EUGRSUZ_F04397 [Eucalyptus grandis]
Length=590

 Score =   196 bits (499),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 113/140 (81%), Gaps = 2/140 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA +FA +V+ GL LSKRI +GK  A AP     AM ++   YLP+APM+YAV+ +P  V
Sbjct  1    MARKFAGSVDYGLALSKRIYYGKGAATAPDPP--AMSRSPDDYLPTAPMVYAVVPDPTAV  58

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPDVPSYQP+VHGRCDPPAL+PLQM+ +++  +CYLDTAFV++TG WRVHC+M SR CD
Sbjct  59   DNPDVPSYQPYVHGRCDPPALVPLQMHEVAMEVDCYLDTAFVSMTGRWRVHCIMTSRRCD  118

Query  466  CRIAIPMGEQGSILGLEVEV  525
            C++AIPMGEQG +LG+EV+V
Sbjct  119  CQVAIPMGEQGLLLGIEVDV  138



>gb|KCW71310.1| hypothetical protein EUGRSUZ_F04397 [Eucalyptus grandis]
Length=694

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 113/140 (81%), Gaps = 2/140 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA +FA +V+ GL LSKRI +GK  A AP     AM ++   YLP+APM+YAV+ +P  V
Sbjct  1    MARKFAGSVDYGLALSKRIYYGKGAATAPDPP--AMSRSPDDYLPTAPMVYAVVPDPTAV  58

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPDVPSYQP+VHGRCDPPAL+PLQM+ +++  +CYLDTAFV++TG WRVHC+M SR CD
Sbjct  59   DNPDVPSYQPYVHGRCDPPALVPLQMHEVAMEVDCYLDTAFVSMTGRWRVHCIMTSRRCD  118

Query  466  CRIAIPMGEQGSILGLEVEV  525
            C++AIPMGEQG +LG+EV+V
Sbjct  119  CQVAIPMGEQGLLLGIEVDV  138



>ref|XP_010064019.1| PREDICTED: uncharacterized protein LOC104450974 [Eucalyptus grandis]
 gb|KCW71311.1| hypothetical protein EUGRSUZ_F04397 [Eucalyptus grandis]
Length=751

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 113/140 (81%), Gaps = 2/140 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA +FA +V+ GL LSKRI +GK  A AP     AM ++   YLP+APM+YAV+ +P  V
Sbjct  1    MARKFAGSVDYGLALSKRIYYGKGAATAPDPP--AMSRSPDDYLPTAPMVYAVVPDPTAV  58

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPDVPSYQP+VHGRCDPPAL+PLQM+ +++  +CYLDTAFV++TG WRVHC+M SR CD
Sbjct  59   DNPDVPSYQPYVHGRCDPPALVPLQMHEVAMEVDCYLDTAFVSMTGRWRVHCIMTSRRCD  118

Query  466  CRIAIPMGEQGSILGLEVEV  525
            C++AIPMGEQG +LG+EV+V
Sbjct  119  CQVAIPMGEQGLLLGIEVDV  138



>gb|EYU21307.1| hypothetical protein MIMGU_mgv1a001939mg [Erythranthe guttata]
Length=736

 Score =   195 bits (495),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 112/145 (77%), Gaps = 5/145 (3%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAV----APPRAMTAMEKTAHSYLPSAPMLYAVIEN  273
            MA EF+AAV+ GLRL KRI +GKD A      PPR    M   A SYLP+A M+YA + +
Sbjct  1    MAAEFSAAVDVGLRLCKRIYYGKDAAAPVVSVPPRT-AEMSPEAESYLPAALMVYAEVND  59

Query  274  PAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGS  453
            PAVV+NPDVPSYQP+VHGRC+ PALIPL M+ +SV  +C LDTAFVTV G+WRVHCV  S
Sbjct  60   PAVVENPDVPSYQPYVHGRCETPALIPLHMHGVSVEVDCCLDTAFVTVGGAWRVHCVSAS  119

Query  454  RSCDCRIAIPMGEQGSILGLEVEVP  528
            RSC CRIA+P+GEQGS+LG+E+E P
Sbjct  120  RSCYCRIAVPIGEQGSVLGVEIETP  144



>gb|KJB35007.1| hypothetical protein B456_006G094900 [Gossypium raimondii]
Length=745

 Score =   194 bits (494),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 83/143 (58%), Positives = 110/143 (77%), Gaps = 0/143 (0%)
 Frame = +1

Query  97   RGVMAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENP  276
            + V+A EF+++V  GL LSKRI +GK  +  P     ++  T   YLP+A M YAV+  P
Sbjct  4    KSVIADEFSSSVSCGLMLSKRIYYGKGASPTPALMSRSLSSTESCYLPTAVMAYAVVSEP  63

Query  277  AVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSR  456
            +VVDNPDVPSYQP+VHGRC+PPALIPL M+ +S+  +C++DTAFVT +G+WRVHC+M  R
Sbjct  64   SVVDNPDVPSYQPYVHGRCEPPALIPLHMHEVSMEVDCWMDTAFVTASGAWRVHCIMAGR  123

Query  457  SCDCRIAIPMGEQGSILGLEVEV  525
             CDCR+A+PMGEQGSILG+EV +
Sbjct  124  RCDCRVAVPMGEQGSILGVEVNI  146



>gb|KJB35006.1| hypothetical protein B456_006G094900 [Gossypium raimondii]
Length=763

 Score =   194 bits (494),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 83/143 (58%), Positives = 110/143 (77%), Gaps = 0/143 (0%)
 Frame = +1

Query  97   RGVMAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENP  276
            + V+A EF+++V  GL LSKRI +GK  +  P     ++  T   YLP+A M YAV+  P
Sbjct  4    KSVIADEFSSSVSCGLMLSKRIYYGKGASPTPALMSRSLSSTESCYLPTAVMAYAVVSEP  63

Query  277  AVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSR  456
            +VVDNPDVPSYQP+VHGRC+PPALIPL M+ +S+  +C++DTAFVT +G+WRVHC+M  R
Sbjct  64   SVVDNPDVPSYQPYVHGRCEPPALIPLHMHEVSMEVDCWMDTAFVTASGAWRVHCIMAGR  123

Query  457  SCDCRIAIPMGEQGSILGLEVEV  525
             CDCR+A+PMGEQGSILG+EV +
Sbjct  124  RCDCRVAVPMGEQGSILGVEVNI  146



>ref|XP_006342928.1| PREDICTED: uncharacterized protein LOC102599336 [Solanum tuberosum]
Length=744

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 116/142 (82%), Gaps = 5/142 (4%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAH-SYLPSAPMLYAVIENPAV  282
            MA EFA +V+ GL+L+KRI +GK+    PP+ +   +K++  + LP+APM+YAV+++P++
Sbjct  1    MADEFATSVDMGLQLTKRIYYGKN----PPKPLVMEKKSSEINNLPTAPMVYAVVKDPSM  56

Query  283  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            VDNPD+PSYQP+V+GR DPPALIPL M  I++  +CY+DTAFVTV G+WR+HC+  SR C
Sbjct  57   VDNPDIPSYQPYVYGRSDPPALIPLDMQGIAMEVDCYMDTAFVTVNGTWRMHCIASSRYC  116

Query  463  DCRIAIPMGEQGSILGLEVEVP  528
            DCRIA+PMGEQGS+LG+E+E P
Sbjct  117  DCRIAVPMGEQGSVLGVEIETP  138



>ref|XP_007216978.1| hypothetical protein PRUPE_ppa002885mg [Prunus persica]
 gb|EMJ18177.1| hypothetical protein PRUPE_ppa002885mg [Prunus persica]
Length=624

 Score =   190 bits (482),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 113/140 (81%), Gaps = 4/140 (3%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA EF++ VE GL LSKR+ +GK+ +V  P AMT   +++ SYLP APM+YAV+ +P+VV
Sbjct  1    MAAEFSSCVEYGLGLSKRVFYGKE-SVPDPSAMT---RSSESYLPEAPMVYAVVPDPSVV  56

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+PSYQP+VHG C+PPALIPL M+ I++  E YLDTAFVTV G+WRVHCV   + CD
Sbjct  57   DNPDIPSYQPYVHGMCEPPALIPLHMHGIAMEIESYLDTAFVTVNGTWRVHCVSAGKRCD  116

Query  466  CRIAIPMGEQGSILGLEVEV  525
            CR+A+PMG++GS+LG+E E+
Sbjct  117  CRVAVPMGDKGSLLGVEAEI  136



>ref|XP_011072601.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105157816 
[Sesamum indicum]
Length=745

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 110/144 (76%), Gaps = 6/144 (4%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDR---AVAPPRAMTAMEKTAHSYLPSAPMLYAVIENP  276
            MA EF+ AVE GL+LSKRI +GK+    ++APPR    M     SYLP+A M+YA I  P
Sbjct  1    MAAEFSKAVELGLKLSKRIYYGKNAPTVSLAPPRG-AEMTAETESYLPTAVMVYAEINEP  59

Query  277  AVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSR  456
             VVDNPDVPSYQP+VHGR   P LIPL M+ + +  +CYLDTAFVTV+G+WRVHCV  SR
Sbjct  60   GVVDNPDVPSYQPYVHGR--XPVLIPLHMHGVELEVDCYLDTAFVTVSGAWRVHCVAASR  117

Query  457  SCDCRIAIPMGEQGSILGLEVEVP  528
            SCDCRIA+PMGEQGS+LG+EVE P
Sbjct  118  SCDCRIAVPMGEQGSVLGVEVESP  141



>ref|XP_007024661.1| Inter-alpha-trypsin inhibitor heavy chain-related, putative [Theobroma 
cacao]
 gb|EOY27283.1| Inter-alpha-trypsin inhibitor heavy chain-related, putative [Theobroma 
cacao]
Length=752

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MAGEF+ +V  G+ LSKR+ +G+  + APP  M+    +  SY P+  M YAV+  PA V
Sbjct  1    MAGEFSTSVTCGIMLSKRLYYGRGASPAPP-VMSRSLSSTESYRPTGVMAYAVVPEPAAV  59

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPDVPSYQP+VHGRCDPPALIPL M+ +S+  +C +DTAFVTV G+WRVHC+M SR CD
Sbjct  60   DNPDVPSYQPYVHGRCDPPALIPLHMHEVSMEVDCCMDTAFVTVRGAWRVHCIMSSRRCD  119

Query  466  CRIAIPMGEQGSILGLEVEV  525
            CRIAIPMGEQGSILG+EV+V
Sbjct  120  CRIAIPMGEQGSILGVEVDV  139



>ref|XP_008373868.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
[Malus domestica]
Length=745

 Score =   189 bits (481),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 112/139 (81%), Gaps = 4/139 (3%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA EF++ VE GL LSKRI +GK+ +V  P AMT   +++ S+LP APM+YAV+ NP +V
Sbjct  1    MAAEFSSCVEYGLGLSKRIFYGKE-SVPDPLAMT---RSSKSFLPEAPMVYAVVTNPEIV  56

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            +NPD+PSYQP+VHG C PPALIPL M+ I++  E YLDTAFVTV+G+WRVHCV  ++ CD
Sbjct  57   ENPDIPSYQPYVHGLCQPPALIPLHMHGIAMEIEVYLDTAFVTVSGTWRVHCVSSAKRCD  116

Query  466  CRIAIPMGEQGSILGLEVE  522
            CR+A+PMGEQGS+LG+E E
Sbjct  117  CRVAVPMGEQGSLLGVEAE  135



>gb|KDO64974.1| hypothetical protein CISIN_1g004469mg [Citrus sinensis]
 gb|KDO64975.1| hypothetical protein CISIN_1g004469mg [Citrus sinensis]
Length=591

 Score =   187 bits (476),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 84/144 (58%), Positives = 104/144 (72%), Gaps = 8/144 (6%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKD----RAVAPPRAMTAMEKTAHSYLPSAPMLYAVIEN  273
            MA EF + V  GL LSKRI +GK+    RAV PP     M +   SYLP A M+YAV+  
Sbjct  1    MASEFESCVNYGLNLSKRIYYGKEPGSGRAVMPP----GMTRQPESYLPEAVMVYAVVGE  56

Query  274  PAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGS  453
            P +VDNPDVPSYQP+VHG+C PPALIPL M+ + +  +C LDTAFV   GSWRVHC+M  
Sbjct  57   PQIVDNPDVPSYQPYVHGKCQPPALIPLHMHGVEMEVDCCLDTAFVAFNGSWRVHCIMAG  116

Query  454  RSCDCRIAIPMGEQGSILGLEVEV  525
            R CDC IA+P+GE+GS+LG+EVE+
Sbjct  117  RQCDCTIAVPLGERGSLLGVEVEI  140



>ref|XP_006465891.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
[Citrus sinensis]
Length=751

 Score =   189 bits (480),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 85/144 (59%), Positives = 105/144 (73%), Gaps = 8/144 (6%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKD----RAVAPPRAMTAMEKTAHSYLPSAPMLYAVIEN  273
            MA EF + V  GL LSKRI +GK+    RAV PP     M +   SYLP A M+YAV+  
Sbjct  1    MASEFESCVNYGLNLSKRIYYGKEPGSGRAVMPP----GMTRQPESYLPEAVMVYAVVGE  56

Query  274  PAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGS  453
            P +VDNPDVPSYQP+VHG+C PPALIPL M+ + +  +C LDTAFV   GSWRVHC+M  
Sbjct  57   PQIVDNPDVPSYQPYVHGKCQPPALIPLHMHGVEMEVDCCLDTAFVAFNGSWRVHCIMAG  116

Query  454  RSCDCRIAIPMGEQGSILGLEVEV  525
            R CDCRIA+P+GE+GS+LG+EVE+
Sbjct  117  RQCDCRIAVPLGERGSLLGVEVEI  140



>gb|KDO64973.1| hypothetical protein CISIN_1g004469mg [Citrus sinensis]
Length=591

 Score =   187 bits (476),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 84/144 (58%), Positives = 104/144 (72%), Gaps = 8/144 (6%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKD----RAVAPPRAMTAMEKTAHSYLPSAPMLYAVIEN  273
            MA EF + V  GL LSKRI +GK+    RAV PP     M +   SYLP A M+YAV+  
Sbjct  1    MASEFESCVNYGLNLSKRIYYGKEPGSGRAVMPP----GMTRQPESYLPEAVMVYAVVGE  56

Query  274  PAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGS  453
            P +VDNPDVPSYQP+VHG+C PPALIPL M+ + +  +C LDTAFV   GSWRVHC+M  
Sbjct  57   PQIVDNPDVPSYQPYVHGKCQPPALIPLHMHGVEMEVDCCLDTAFVAFNGSWRVHCIMAG  116

Query  454  RSCDCRIAIPMGEQGSILGLEVEV  525
            R CDC IA+P+GE+GS+LG+EVE+
Sbjct  117  RQCDCTIAVPLGERGSLLGVEVEI  140



>ref|XP_007135424.1| hypothetical protein PHAVU_010G128200g [Phaseolus vulgaris]
 gb|ESW07418.1| hypothetical protein PHAVU_010G128200g [Phaseolus vulgaris]
Length=650

 Score =   188 bits (477),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 82/139 (59%), Positives = 108/139 (78%), Gaps = 3/139 (2%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA  F+ +VE GL LSKR+ +G+  A   P ++ +M ++   +LP+APM YAVI +P  V
Sbjct  1    MADYFSGSVEFGLNLSKRVYYGRGSA---PLSVPSMSRSPEGFLPTAPMCYAVISDPEKV  57

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+ SYQP+V G CDPPALIPL+++ +++  EC LDTAFVTVTG WRVHCV GS +CD
Sbjct  58   DNPDIRSYQPYVLGECDPPALIPLELHGVAMEVECSLDTAFVTVTGKWRVHCVTGSSTCD  117

Query  466  CRIAIPMGEQGSILGLEVE  522
            C++AIPMGEQGS+LGLEV+
Sbjct  118  CQVAIPMGEQGSLLGLEVD  136



>gb|KEH18486.1| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=597

 Score =   187 bits (474),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 85/139 (61%), Positives = 109/139 (78%), Gaps = 3/139 (2%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MAG+F+++VE GL LSKRI+  K  A AP   +  M ++   +LPSAPM YAVI +P +V
Sbjct  1    MAGQFSSSVEFGLNLSKRIHHTKLSAPAP---LPEMTRSIDEHLPSAPMCYAVIPDPDIV  57

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+ SYQP+V+GRCDPPALIPLQ+  I +  +C LDTAFVTVTG WRVHCV GS  CD
Sbjct  58   DNPDIRSYQPYVYGRCDPPALIPLQLQGIEMDVDCCLDTAFVTVTGRWRVHCVRGSSLCD  117

Query  466  CRIAIPMGEQGSILGLEVE  522
            C++AIP+G+QGS+LG+EV+
Sbjct  118  CQVAIPIGDQGSLLGVEVD  136



>ref|XP_009414823.1| PREDICTED: uncharacterized protein LOC103995835 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=599

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 109/141 (77%), Gaps = 5/141 (4%)
 Frame = +1

Query  118  FAAAVEDGLRLSKRINFGKDR----AVAPPRAMTAMEKTAHS-YLPSAPMLYAVIENPAV  282
            FA AVEDGL+L+KR+  GKD+     V  PR    ME++  S +LP+APM+YAVI +PA+
Sbjct  7    FAKAVEDGLKLAKRVYAGKDQRFAPPVPAPRPAAGMERSPESPFLPAAPMVYAVITDPAI  66

Query  283  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            VDNPD+PSYQPHVHGRCDPPALIPL M  I V  +C LD+AFV + G WRVHCVM +RS 
Sbjct  67   VDNPDIPSYQPHVHGRCDPPALIPLHMTDIGVEVDCILDSAFVAIRGRWRVHCVMRTRSS  126

Query  463  DCRIAIPMGEQGSILGLEVEV  525
            DCR+ +PMGEQ S+LG+EVEV
Sbjct  127  DCRLVVPMGEQDSVLGVEVEV  147



>gb|KEH18485.1| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=648

 Score =   187 bits (474),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 85/139 (61%), Positives = 109/139 (78%), Gaps = 3/139 (2%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MAG+F+++VE GL LSKRI+  K  A AP   +  M ++   +LPSAPM YAVI +P +V
Sbjct  1    MAGQFSSSVEFGLNLSKRIHHTKLSAPAP---LPEMTRSIDEHLPSAPMCYAVIPDPDIV  57

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+ SYQP+V+GRCDPPALIPLQ+  I +  +C LDTAFVTVTG WRVHCV GS  CD
Sbjct  58   DNPDIRSYQPYVYGRCDPPALIPLQLQGIEMDVDCCLDTAFVTVTGRWRVHCVRGSSLCD  117

Query  466  CRIAIPMGEQGSILGLEVE  522
            C++AIP+G+QGS+LG+EV+
Sbjct  118  CQVAIPIGDQGSLLGVEVD  136



>ref|XP_004303707.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0286969 [Fragaria vesca subsp. vesca]
Length=756

 Score =   187 bits (475),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 112/147 (76%), Gaps = 7/147 (5%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPP-------RAMTAMEKTAHSYLPSAPMLYAV  264
            MAG+F++ VE GL +SKRI +GK+   APP        +  +       YLP +PM+YA 
Sbjct  1    MAGQFSSCVEYGLAISKRILYGKESVPAPPAMSRSSSHSSQSRPSPEQGYLPESPMVYAA  60

Query  265  IENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCV  444
            + +PA+VDNPD+PSYQP+V+GRC+PPALIPL M+ +++  E YL+TAFVTVTG+WRVHC+
Sbjct  61   VSDPAIVDNPDIPSYQPYVYGRCEPPALIPLHMHGVALEVESYLETAFVTVTGNWRVHCI  120

Query  445  MGSRSCDCRIAIPMGEQGSILGLEVEV  525
               +SCDCR+A+PMGEQGS+LG+EV+V
Sbjct  121  STGKSCDCRVAVPMGEQGSLLGVEVDV  147



>ref|XP_008228173.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 [Prunus 
mume]
Length=749

 Score =   187 bits (474),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 114/140 (81%), Gaps = 4/140 (3%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA EF++ VE GL LSKR+ +GK+ +V  P AMT   +++ SYLP APM+YAV+ +P++V
Sbjct  1    MAAEFSSCVEYGLGLSKRVFYGKE-SVPDPSAMT---RSSESYLPEAPMVYAVVPDPSIV  56

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+PSYQP+VHG C+PPAL+PL M+ I++  E YLDTAFVTV+G+WR+HCV   + CD
Sbjct  57   DNPDIPSYQPYVHGMCEPPALMPLHMHGIAMEIESYLDTAFVTVSGTWRLHCVAAGKRCD  116

Query  466  CRIAIPMGEQGSILGLEVEV  525
            CR+A+PMG++GS+LG+E E+
Sbjct  117  CRVAVPMGDKGSLLGVEAEI  136



>ref|XP_008462285.1| PREDICTED: uncharacterized protein LOC103500681 isoform X1 [Cucumis 
melo]
Length=758

 Score =   187 bits (474),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 104/140 (74%), Gaps = 2/140 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA EF+ +VE GL LSKRI +GK    AP      M + +  YLP APM+YAVI  P +V
Sbjct  1    MATEFSNSVEYGLHLSKRIYYGK--GSAPAALARQMSRVSEDYLPRAPMVYAVIPEPTIV  58

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPDVPSYQP+VHGRC PPALIPL MN +S+   C  DTAF+ V G+WRVHCVM  +SC+
Sbjct  59   DNPDVPSYQPYVHGRCVPPALIPLHMNGVSMEINCCFDTAFIGVNGTWRVHCVMAGKSCE  118

Query  466  CRIAIPMGEQGSILGLEVEV  525
            C IA+PMGEQGS+LG+EV+V
Sbjct  119  CLIAVPMGEQGSLLGVEVDV  138



>ref|XP_007135423.1| hypothetical protein PHAVU_010G128200g [Phaseolus vulgaris]
 gb|ESW07417.1| hypothetical protein PHAVU_010G128200g [Phaseolus vulgaris]
Length=752

 Score =   187 bits (474),  Expect = 7e-52, Method: Composition-based stats.
 Identities = 82/139 (59%), Positives = 108/139 (78%), Gaps = 3/139 (2%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA  F+ +VE GL LSKR+ +G+  A   P ++ +M ++   +LP+APM YAVI +P  V
Sbjct  1    MADYFSGSVEFGLNLSKRVYYGRGSA---PLSVPSMSRSPEGFLPTAPMCYAVISDPEKV  57

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+ SYQP+V G CDPPALIPL+++ +++  EC LDTAFVTVTG WRVHCV GS +CD
Sbjct  58   DNPDIRSYQPYVLGECDPPALIPLELHGVAMEVECSLDTAFVTVTGKWRVHCVTGSSTCD  117

Query  466  CRIAIPMGEQGSILGLEVE  522
            C++AIPMGEQGS+LGLEV+
Sbjct  118  CQVAIPMGEQGSLLGLEVD  136



>ref|XP_008462286.1| PREDICTED: uncharacterized protein LOC103500681 isoform X2 [Cucumis 
melo]
Length=755

 Score =   187 bits (474),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 104/140 (74%), Gaps = 2/140 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA EF+ +VE GL LSKRI +GK    AP      M + +  YLP APM+YAVI  P +V
Sbjct  1    MATEFSNSVEYGLHLSKRIYYGK--GSAPAALARQMSRVSEDYLPRAPMVYAVIPEPTIV  58

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPDVPSYQP+VHGRC PPALIPL MN +S+   C  DTAF+ V G+WRVHCVM  +SC+
Sbjct  59   DNPDVPSYQPYVHGRCVPPALIPLHMNGVSMEINCCFDTAFIGVNGTWRVHCVMAGKSCE  118

Query  466  CRIAIPMGEQGSILGLEVEV  525
            C IA+PMGEQGS+LG+EV+V
Sbjct  119  CLIAVPMGEQGSLLGVEVDV  138



>ref|XP_004141711.1| PREDICTED: uncharacterized protein LOC101206287 [Cucumis sativus]
 ref|XP_004155911.1| PREDICTED: uncharacterized LOC101206287 [Cucumis sativus]
 gb|KGN45475.1| hypothetical protein Csa_7G448860 [Cucumis sativus]
Length=754

 Score =   187 bits (474),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 103/140 (74%), Gaps = 2/140 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA EF+ +VE GL LSKRI +GK     P      M + +  YLP APM+YAVI  P +V
Sbjct  1    MATEFSNSVEYGLHLSKRIYYGK--GSTPAALARQMSRVSEDYLPRAPMVYAVIPEPTIV  58

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+PSYQP+VHGRC PPALIPL MN +S+   C  DTAF+ V G+WRVHCVM  RSC+
Sbjct  59   DNPDIPSYQPYVHGRCVPPALIPLHMNGVSMEINCCFDTAFICVNGTWRVHCVMAGRSCE  118

Query  466  CRIAIPMGEQGSILGLEVEV  525
            C IA+PMGEQGS+LG+EV+V
Sbjct  119  CLIAVPMGEQGSLLGVEVDV  138



>gb|KDO64972.1| hypothetical protein CISIN_1g004469mg [Citrus sinensis]
Length=751

 Score =   186 bits (473),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 84/144 (58%), Positives = 104/144 (72%), Gaps = 8/144 (6%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKD----RAVAPPRAMTAMEKTAHSYLPSAPMLYAVIEN  273
            MA EF + V  GL LSKRI +GK+    RAV PP     M +   SYLP A M+YAV+  
Sbjct  1    MASEFESCVNYGLNLSKRIYYGKEPGSGRAVMPP----GMTRQPESYLPEAVMVYAVVGE  56

Query  274  PAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGS  453
            P +VDNPDVPSYQP+VHG+C PPALIPL M+ + +  +C LDTAFV   GSWRVHC+M  
Sbjct  57   PQIVDNPDVPSYQPYVHGKCQPPALIPLHMHGVEMEVDCCLDTAFVAFNGSWRVHCIMAG  116

Query  454  RSCDCRIAIPMGEQGSILGLEVEV  525
            R CDC IA+P+GE+GS+LG+EVE+
Sbjct  117  RQCDCTIAVPLGERGSLLGVEVEI  140



>ref|XP_009414822.1| PREDICTED: uncharacterized protein LOC103995835 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=754

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 109/141 (77%), Gaps = 5/141 (4%)
 Frame = +1

Query  118  FAAAVEDGLRLSKRINFGKDR----AVAPPRAMTAMEKTAHS-YLPSAPMLYAVIENPAV  282
            FA AVEDGL+L+KR+  GKD+     V  PR    ME++  S +LP+APM+YAVI +PA+
Sbjct  7    FAKAVEDGLKLAKRVYAGKDQRFAPPVPAPRPAAGMERSPESPFLPAAPMVYAVITDPAI  66

Query  283  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            VDNPD+PSYQPHVHGRCDPPALIPL M  I V  +C LD+AFV + G WRVHCVM +RS 
Sbjct  67   VDNPDIPSYQPHVHGRCDPPALIPLHMTDIGVEVDCILDSAFVAIRGRWRVHCVMRTRSS  126

Query  463  DCRIAIPMGEQGSILGLEVEV  525
            DCR+ +PMGEQ S+LG+EVEV
Sbjct  127  DCRLVVPMGEQDSVLGVEVEV  147



>ref|XP_006426697.1| hypothetical protein CICLE_v10024980mg [Citrus clementina]
 gb|ESR39937.1| hypothetical protein CICLE_v10024980mg [Citrus clementina]
Length=742

 Score =   186 bits (472),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 84/144 (58%), Positives = 104/144 (72%), Gaps = 8/144 (6%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKD----RAVAPPRAMTAMEKTAHSYLPSAPMLYAVIEN  273
            MA EF + V  GL LSKRI +GK+    RAV PP     M +   SYLP A M+YAV+  
Sbjct  1    MASEFESCVNYGLNLSKRIYYGKEPGSGRAVMPP----GMTRQPESYLPEAVMVYAVVGE  56

Query  274  PAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGS  453
            P +VDNPDVPSYQP+VHG+C PPALIPL M+ + +  +C LDTAFV   GSWRVHC+M  
Sbjct  57   PQIVDNPDVPSYQPYVHGKCQPPALIPLHMHGVEMEVDCCLDTAFVAFNGSWRVHCIMAG  116

Query  454  RSCDCRIAIPMGEQGSILGLEVEV  525
            R CDC IA+P+GE+GS+LG+EVE+
Sbjct  117  RQCDCTIAVPLGERGSLLGVEVEI  140



>ref|XP_004510514.1| PREDICTED: uncharacterized protein LOC101499440 [Cicer arietinum]
Length=757

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 111/139 (80%), Gaps = 3/139 (2%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA +F+++VE GL LSKRI+  K+ A AP  AM+   ++   +LPSAPM YAVI +P +V
Sbjct  1    MAEQFSSSVEFGLNLSKRIHHVKESAPAPAPAMS---RSPKLHLPSAPMCYAVIPDPQIV  57

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+ SYQP+V+GRCDPPALIPLQ++ I +  EC LDTAFVTVTG WRVHC+M S  CD
Sbjct  58   DNPDIRSYQPYVYGRCDPPALIPLQLHGIGMEVECCLDTAFVTVTGKWRVHCIMASSICD  117

Query  466  CRIAIPMGEQGSILGLEVE  522
            C++AIPMGEQGS+LG+EV+
Sbjct  118  CQVAIPMGEQGSLLGVEVD  136



>ref|XP_009344471.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Pyrus x bretschneideri]
 ref|XP_009344474.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Pyrus x bretschneideri]
Length=745

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 107/139 (77%), Gaps = 4/139 (3%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA EF + VE GL LSKR+ +GK+    P    + M++++ SY P APM+YAV+ +P +V
Sbjct  1    MAAEFTSCVEYGLGLSKRVFYGKESVPNP----SEMKRSSKSYFPEAPMVYAVVSDPEIV  56

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+PSYQP+VHG C PPALIPL M+ I +  E YLDTAFVTV+G+WRVHCV  ++ C+
Sbjct  57   DNPDIPSYQPYVHGLCQPPALIPLHMHGIGMEIEVYLDTAFVTVSGTWRVHCVSAAKRCE  116

Query  466  CRIAIPMGEQGSILGLEVE  522
            CR+A+PMGEQGS+LG+E E
Sbjct  117  CRLAVPMGEQGSLLGVEAE  135



>ref|XP_003528576.1| PREDICTED: uncharacterized protein LOC100807956 isoform X1 [Glycine 
max]
Length=756

 Score =   185 bits (469),  Expect = 3e-51, Method: Composition-based stats.
 Identities = 82/140 (59%), Positives = 110/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMT-AMEKTAHSYLPSAPMLYAVIENPAV  282
            MA  F+ +VE GL LSKRI +GK  A +P  AM+ ++ K+   YLP+APM YAVI +P  
Sbjct  1    MADYFSGSVEFGLNLSKRIYYGKGSAPSPAPAMSRSLSKSPEGYLPTAPMCYAVISDPEK  60

Query  283  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            V+NPD+ SYQP+V G+C+PPALIPL+++ +++  EC LDTAFVTVTG WRVHCV  S +C
Sbjct  61   VENPDIRSYQPYVLGQCEPPALIPLELHGVAMEVECSLDTAFVTVTGKWRVHCVTASSTC  120

Query  463  DCRIAIPMGEQGSILGLEVE  522
            DC++AIP+GE+GS+LGLEV+
Sbjct  121  DCQVAIPIGEEGSLLGLEVD  140



>ref|XP_006587053.1| PREDICTED: uncharacterized protein LOC100820133 [Glycine max]
Length=759

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 118/144 (82%), Gaps = 2/144 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA EF+ +VE+GLRLSKRI FG DRAV+PP+   +M K+  + LP+APMLYAVI +PA+V
Sbjct  1    MAEEFSKSVEEGLRLSKRIYFGNDRAVSPPKPPPSMSKSHTACLPTAPMLYAVIHDPAIV  60

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQM-NSISVAAECYLD-TAFVTVTGSWRVHCVMGSRS  459
            DNPDVPSYQP+VHG+CDPPALIPL M  ++ + A CY++  AFVTV+GSWR+HCV GSR+
Sbjct  61   DNPDVPSYQPYVHGQCDPPALIPLHMIGNVHLQAHCYVNAVAFVTVSGSWRLHCVSGSRT  120

Query  460  CDCRIAIPMGEQGSILGLEVEVPR  531
            CDC +A+P+  QGSILG+EV V R
Sbjct  121  CDCIVALPVPPQGSILGVEVSVHR  144



>ref|XP_006583165.1| PREDICTED: uncharacterized protein LOC100807956 isoform X2 [Glycine 
max]
Length=699

 Score =   184 bits (468),  Expect = 4e-51, Method: Composition-based stats.
 Identities = 82/140 (59%), Positives = 110/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMT-AMEKTAHSYLPSAPMLYAVIENPAV  282
            MA  F+ +VE GL LSKRI +GK  A +P  AM+ ++ K+   YLP+APM YAVI +P  
Sbjct  1    MADYFSGSVEFGLNLSKRIYYGKGSAPSPAPAMSRSLSKSPEGYLPTAPMCYAVISDPEK  60

Query  283  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            V+NPD+ SYQP+V G+C+PPALIPL+++ +++  EC LDTAFVTVTG WRVHCV  S +C
Sbjct  61   VENPDIRSYQPYVLGQCEPPALIPLELHGVAMEVECSLDTAFVTVTGKWRVHCVTASSTC  120

Query  463  DCRIAIPMGEQGSILGLEVE  522
            DC++AIP+GE+GS+LGLEV+
Sbjct  121  DCQVAIPIGEEGSLLGLEVD  140



>gb|KDP40680.1| hypothetical protein JCGZ_24679 [Jatropha curcas]
Length=750

 Score =   184 bits (467),  Expect = 5e-51, Method: Composition-based stats.
 Identities = 84/140 (60%), Positives = 105/140 (75%), Gaps = 3/140 (2%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA EF  +V+ GL+LSKRI +GK     PP  +  M K++ S+LP+A M+YAVI  P VV
Sbjct  1    MADEFETSVDFGLKLSKRIYYGKG---LPPAPVLGMSKSSESFLPTAVMVYAVIPEPEVV  57

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPDV SYQPHVHGRC+PPALIPL M  +++  E  LD A V+ +G+WRVHC+  S  CD
Sbjct  58   DNPDVQSYQPHVHGRCEPPALIPLHMYGVAMEVESCLDHANVSFSGNWRVHCIKASSKCD  117

Query  466  CRIAIPMGEQGSILGLEVEV  525
            CRIAIPMG+QGSILGLEV++
Sbjct  118  CRIAIPMGDQGSILGLEVDI  137



>ref|XP_008342579.1| PREDICTED: uncharacterized protein LOC103405374 [Malus domestica]
Length=745

 Score =   184 bits (467),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 107/139 (77%), Gaps = 4/139 (3%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA EF + VE GL LSKR+ +GK+    P    + M++++ SY P APM+YAV+ +P +V
Sbjct  1    MATEFTSCVEYGLGLSKRVFYGKESVPNP----SEMKRSSKSYFPEAPMVYAVVSDPEIV  56

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+PSYQP+VHG C PPALIPL M+ I +  E YLDTAFVTV+G+WRVHCV  ++ C+
Sbjct  57   DNPDIPSYQPYVHGLCQPPALIPLHMHGIGMEIEVYLDTAFVTVSGTWRVHCVSAAKRCE  116

Query  466  CRIAIPMGEQGSILGLEVE  522
            CR+A+PMGEQGS+LG+E E
Sbjct  117  CRVAVPMGEQGSLLGVESE  135



>ref|XP_010111991.1| von Willebrand factor A domain-containing protein [Morus notabilis]
 gb|EXC32302.1| von Willebrand factor A domain-containing protein [Morus notabilis]
Length=745

 Score =   184 bits (467),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 112/146 (77%), Gaps = 9/146 (6%)
 Frame = +1

Query  109  AGEFAAAVEDGLRLSKRINFGKDR-------AVAPPRAMTAMEKTAHSYLPSAPMLYAVI  267
            A EF++ V+ G++LSKRI +GKD            P+AMT     +  YLP+APM YAV+
Sbjct  3    AAEFSSCVDYGVQLSKRIYYGKDLRPSLSAAEAVEPQAMT--RSPSEEYLPTAPMAYAVV  60

Query  268  ENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVM  447
              PA+VDNPDVPSYQP+VHGRC+PPAL+PLQM+ +++  + YLDTAFV V+ +WRVHC+M
Sbjct  61   PEPAIVDNPDVPSYQPYVHGRCEPPALVPLQMHEVAMEVDAYLDTAFVGVSATWRVHCIM  120

Query  448  GSRSCDCRIAIPMGEQGSILGLEVEV  525
             ++ CDCR+A+P+GE+GS+LG+EVEV
Sbjct  121  AAKRCDCRVALPIGEKGSLLGVEVEV  146



>ref|XP_002532724.1| inter-alpha-trypsin inhibitor heavy chain, putative [Ricinus 
communis]
 gb|EEF29655.1| inter-alpha-trypsin inhibitor heavy chain, putative [Ricinus 
communis]
Length=752

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 104/142 (73%), Gaps = 5/142 (4%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA--HSYLPSAPMLYAVIENPA  279
            MA EF   V+ GLRLSKRI +GK+    PP     M KT    SYLP+A M+YAV+  P 
Sbjct  1    MAEEFGTCVDYGLRLSKRIYYGKE---LPPAPEPEMSKTVSWESYLPTAVMVYAVVPEPE  57

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
             VDNPDVPSYQP+VHGRC PPALIPLQM+ +++  +C LD A V+  G WRVHCV  SR 
Sbjct  58   AVDNPDVPSYQPYVHGRCQPPALIPLQMHGVAMDVDCCLDYANVSFNGKWRVHCVKTSRK  117

Query  460  CDCRIAIPMGEQGSILGLEVEV  525
            CDCRIA+PMGEQGSILGLEV++
Sbjct  118  CDCRIAVPMGEQGSILGLEVDI  139



>gb|AET01809.2| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=753

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 109/139 (78%), Gaps = 3/139 (2%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MAG+F+++VE GL LSKRI+  K  A AP   MT   ++   +LPSAPM YAVI +P +V
Sbjct  1    MAGQFSSSVEFGLNLSKRIHHTKLSAPAPLPEMT---RSIDEHLPSAPMCYAVIPDPDIV  57

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPD+ SYQP+V+GRCDPPALIPLQ+  I +  +C LDTAFVTVTG WRVHCV GS  CD
Sbjct  58   DNPDIRSYQPYVYGRCDPPALIPLQLQGIEMDVDCCLDTAFVTVTGRWRVHCVRGSSLCD  117

Query  466  CRIAIPMGEQGSILGLEVE  522
            C++AIP+G+QGS+LG+EV+
Sbjct  118  CQVAIPIGDQGSLLGVEVD  136



>ref|XP_010685291.1| PREDICTED: uncharacterized protein LOC104899734 [Beta vulgaris 
subsp. vulgaris]
Length=756

 Score =   180 bits (456),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 81/142 (57%), Positives = 111/142 (78%), Gaps = 3/142 (2%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHS---YLPSAPMLYAVIENP  276
            MA +F  +V+ GL+LSKRI +GKD ++ PP+   +MEK++     +LP++PM+YAV+ +P
Sbjct  1    MADDFQRSVQLGLKLSKRIYYGKDPSMKPPQPPPSMEKSSEQEPQFLPTSPMVYAVVSDP  60

Query  277  AVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSR  456
             VVDNPD+ SYQP+VHGRC+PPALIPL +  I V  +CYLD AFV  TG+WR+HCV G+R
Sbjct  61   IVVDNPDIRSYQPYVHGRCNPPALIPLHLYGIEVEVDCYLDMAFVNFTGTWRLHCVDGNR  120

Query  457  SCDCRIAIPMGEQGSILGLEVE  522
             CDC +AIPMG+QGS+LG ++E
Sbjct  121  RCDCCLAIPMGDQGSVLGFDIE  142



>ref|XP_009337232.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 [Pyrus 
x bretschneideri]
Length=757

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +1

Query  190  PPRAMTAMEK-TAHSYLPSAPMLYAVIENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMN  366
            PP+   +M+K T+ ++LP+APM+YAVI +P +VDNPD+PSYQPHVHGRCDPPALIPL MN
Sbjct  31   PPKHPPSMDKATSCAFLPTAPMVYAVISDPGIVDNPDIPSYQPHVHGRCDPPALIPLTMN  90

Query  367  SISVAAECYLDTAFVTVTGSWRVHCVMGSRSCDCRIAIPMGEQGSILGLEVEV  525
             + +  +CY+DTAF+ V+GSWRVHC+ GS+SC CR+AIPMGEQGSILG+EV+V
Sbjct  91   RVELQVDCYMDTAFIRVSGSWRVHCIKGSKSCGCRVAIPMGEQGSILGVEVDV  143



>gb|KHN01425.1| Inter-alpha-trypsin inhibitor heavy chain H3 [Glycine soja]
Length=753

 Score =   178 bits (451),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 80/139 (58%), Positives = 107/139 (77%), Gaps = 3/139 (2%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            MA  F+ +VE GL LSKRI +G   A A  R+++   K+   YLP+APM YAVI +P  V
Sbjct  1    MADYFSGSVEFGLNLSKRIYYGPSPAPAMSRSLS---KSPEGYLPTAPMCYAVISDPEKV  57

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            +NPD+ SYQP+V G+C+PPALIPL+++ +++  EC LDTAFVTVTG WRVHCV  S +CD
Sbjct  58   ENPDIRSYQPYVLGQCEPPALIPLELHGVAMEVECSLDTAFVTVTGKWRVHCVTASSTCD  117

Query  466  CRIAIPMGEQGSILGLEVE  522
            C++AIP+GE+GS+LGLEV+
Sbjct  118  CQVAIPIGEEGSLLGLEVD  136



>gb|KHG04434.1| von Willebrand factor A domain-containing [Gossypium arboreum]
Length=735

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 103/142 (73%), Gaps = 19/142 (13%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKD-RAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAV  282
            MA +FA AVEDGL+L+KR+  GKD R VA   A   ME++ + YLPSAPM+YAVI +P +
Sbjct  1    MAEDFAKAVEDGLKLAKRVYLGKDSRTVARRMAPPLMERSTNWYLPSAPMVYAVISDPRM  60

Query  283  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            VDNPD+PSYQP+VHG  DPPALIPLQM                   G+WR+HCVMGSRSC
Sbjct  61   VDNPDMPSYQPYVHGMYDPPALIPLQM------------------MGTWRIHCVMGSRSC  102

Query  463  DCRIAIPMGEQGSILGLEVEVP  528
            DC IA+PMG QGSILG+EV++P
Sbjct  103  DCLIAVPMGNQGSILGVEVDLP  124



>ref|XP_011035744.1| PREDICTED: uncharacterized protein LOC105133437 isoform X2 [Populus 
euphratica]
Length=717

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 106/146 (73%), Gaps = 6/146 (4%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMT-----AMEKTAHSYLPSAPMLYAVIE  270
            MA EFA  VE GL LSKRI +GK+   A   AMT        + A SYLP+A M YAV+ 
Sbjct  1    MAREFATCVEYGLSLSKRIYYGKEMTPAASAAMTRSMSSKSSELAESYLPTALMAYAVVS  60

Query  271  NPAVVDNPDVPSYQPHVHGRCDPPALIPLQMN-SISVAAECYLDTAFVTVTGSWRVHCVM  447
             P +VDNPDVPSYQP+VHGRC+PPALIPLQM+ ++++  +C  D A V  +G+WRVHC+ 
Sbjct  61   EPELVDNPDVPSYQPYVHGRCEPPALIPLQMHGAVAMEIDCCFDHANVCFSGAWRVHCIK  120

Query  448  GSRSCDCRIAIPMGEQGSILGLEVEV  525
             SR CD RIA+PMGEQGS+LG+EV+V
Sbjct  121  ASRKCDVRIAVPMGEQGSLLGVEVDV  146



>ref|XP_011035745.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X3 [Populus euphratica]
Length=643

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 106/146 (73%), Gaps = 6/146 (4%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMT-----AMEKTAHSYLPSAPMLYAVIE  270
            MA EFA  VE GL LSKRI +GK+   A   AMT        + A SYLP+A M YAV+ 
Sbjct  1    MAREFATCVEYGLSLSKRIYYGKEMTPAASAAMTRSMSSKSSELAESYLPTALMAYAVVS  60

Query  271  NPAVVDNPDVPSYQPHVHGRCDPPALIPLQMN-SISVAAECYLDTAFVTVTGSWRVHCVM  447
             P +VDNPDVPSYQP+VHGRC+PPALIPLQM+ ++++  +C  D A V  +G+WRVHC+ 
Sbjct  61   EPELVDNPDVPSYQPYVHGRCEPPALIPLQMHGAVAMEIDCCFDHANVCFSGAWRVHCIK  120

Query  448  GSRSCDCRIAIPMGEQGSILGLEVEV  525
             SR CD RIA+PMGEQGS+LG+EV+V
Sbjct  121  ASRKCDVRIAVPMGEQGSLLGVEVDV  146



>ref|XP_011035746.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X4 [Populus euphratica]
Length=641

 Score =   173 bits (438),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 106/146 (73%), Gaps = 6/146 (4%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMT-----AMEKTAHSYLPSAPMLYAVIE  270
            MA EFA  VE GL LSKRI +GK+   A   AMT        + A SYLP+A M YAV+ 
Sbjct  1    MAREFATCVEYGLSLSKRIYYGKEMTPAASAAMTRSMSSKSSELAESYLPTALMAYAVVS  60

Query  271  NPAVVDNPDVPSYQPHVHGRCDPPALIPLQMN-SISVAAECYLDTAFVTVTGSWRVHCVM  447
             P +VDNPDVPSYQP+VHGRC+PPALIPLQM+ ++++  +C  D A V  +G+WRVHC+ 
Sbjct  61   EPELVDNPDVPSYQPYVHGRCEPPALIPLQMHGAVAMEIDCCFDHANVCFSGAWRVHCIK  120

Query  448  GSRSCDCRIAIPMGEQGSILGLEVEV  525
             SR CD RIA+PMGEQGS+LG+EV+V
Sbjct  121  ASRKCDVRIAVPMGEQGSLLGVEVDV  146



>ref|XP_011035743.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Populus euphratica]
Length=756

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 106/146 (73%), Gaps = 6/146 (4%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMT-----AMEKTAHSYLPSAPMLYAVIE  270
            MA EFA  VE GL LSKRI +GK+   A   AMT        + A SYLP+A M YAV+ 
Sbjct  1    MAREFATCVEYGLSLSKRIYYGKEMTPAASAAMTRSMSSKSSELAESYLPTALMAYAVVS  60

Query  271  NPAVVDNPDVPSYQPHVHGRCDPPALIPLQMN-SISVAAECYLDTAFVTVTGSWRVHCVM  447
             P +VDNPDVPSYQP+VHGRC+PPALIPLQM+ ++++  +C  D A V  +G+WRVHC+ 
Sbjct  61   EPELVDNPDVPSYQPYVHGRCEPPALIPLQMHGAVAMEIDCCFDHANVCFSGAWRVHCIK  120

Query  448  GSRSCDCRIAIPMGEQGSILGLEVEV  525
             SR CD RIA+PMGEQGS+LG+EV+V
Sbjct  121  ASRKCDVRIAVPMGEQGSLLGVEVDV  146



>ref|XP_006385519.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
 gb|ERP63316.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
Length=535

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 106/147 (72%), Gaps = 6/147 (4%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMT--AMEKT---AHSYLPSAPMLYAVIE  270
            MA EFA  VE GL LSKRI +GK+   A   AMT    EK+   A SY P+A M YAV+ 
Sbjct  1    MAREFATCVEYGLSLSKRIYYGKEMTPAATAAMTRSVSEKSSDVAESYFPTAVMAYAVVS  60

Query  271  NPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNS-ISVAAECYLDTAFVTVTGSWRVHCVM  447
             P +V+NPDVPSYQP+VHGRC+PPALIPL M+  +++  +C  D A V  +G+WRVHC+ 
Sbjct  61   EPELVENPDVPSYQPYVHGRCEPPALIPLHMHGVVTMEIDCCFDHANVCFSGAWRVHCIK  120

Query  448  GSRSCDCRIAIPMGEQGSILGLEVEVP  528
            G+  CD RIA+PMGEQGS+LG+EV+VP
Sbjct  121  GNSKCDVRIAVPMGEQGSLLGVEVDVP  147



>gb|KFK41669.1| hypothetical protein AALP_AA2G157400 [Arabis alpina]
Length=761

 Score =   171 bits (432),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 103/140 (74%), Gaps = 2/140 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            M+ EFA  VE GL+LS+RI +GK   VAPP        +  ++LP+A   YA I +P  V
Sbjct  1    MSEEFAIRVEQGLKLSRRIYYGK--GVAPPIVQDPPSSSPENFLPTAITAYASITDPVAV  58

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPDVPSYQP+VH RCDP AL+PLQM  I ++ +C+LDTAFV+VTG WRVHCVM S+  D
Sbjct  59   DNPDVPSYQPYVHARCDPSALVPLQMLGIEMSIDCWLDTAFVSVTGRWRVHCVMPSKRFD  118

Query  466  CRIAIPMGEQGSILGLEVEV  525
            C +A+PMGE+G++LG E++V
Sbjct  119  CCVAVPMGEKGTVLGAEIDV  138



>ref|XP_006385520.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
 gb|ERP63317.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
Length=606

 Score =   169 bits (429),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 106/147 (72%), Gaps = 6/147 (4%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMT--AMEKT---AHSYLPSAPMLYAVIE  270
            MA EFA  VE GL LSKRI +GK+   A   AMT    EK+   A SY P+A M YAV+ 
Sbjct  1    MAREFATCVEYGLSLSKRIYYGKEMTPAATAAMTRSVSEKSSDVAESYFPTAVMAYAVVS  60

Query  271  NPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNS-ISVAAECYLDTAFVTVTGSWRVHCVM  447
             P +V+NPDVPSYQP+VHGRC+PPALIPL M+  +++  +C  D A V  +G+WRVHC+ 
Sbjct  61   EPELVENPDVPSYQPYVHGRCEPPALIPLHMHGVVTMEIDCCFDHANVCFSGAWRVHCIK  120

Query  448  GSRSCDCRIAIPMGEQGSILGLEVEVP  528
            G+  CD RIA+PMGEQGS+LG+EV+VP
Sbjct  121  GNSKCDVRIAVPMGEQGSLLGVEVDVP  147



>ref|XP_006385522.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
 gb|ERP63319.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
Length=690

 Score =   170 bits (430),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 106/147 (72%), Gaps = 6/147 (4%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMT--AMEKT---AHSYLPSAPMLYAVIE  270
            MA EFA  VE GL LSKRI +GK+   A   AMT    EK+   A SY P+A M YAV+ 
Sbjct  1    MAREFATCVEYGLSLSKRIYYGKEMTPAATAAMTRSVSEKSSDVAESYFPTAVMAYAVVS  60

Query  271  NPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNS-ISVAAECYLDTAFVTVTGSWRVHCVM  447
             P +V+NPDVPSYQP+VHGRC+PPALIPL M+  +++  +C  D A V  +G+WRVHC+ 
Sbjct  61   EPELVENPDVPSYQPYVHGRCEPPALIPLHMHGVVTMEIDCCFDHANVCFSGAWRVHCIK  120

Query  448  GSRSCDCRIAIPMGEQGSILGLEVEVP  528
            G+  CD RIA+PMGEQGS+LG+EV+VP
Sbjct  121  GNSKCDVRIAVPMGEQGSLLGVEVDVP  147



>ref|XP_006385521.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
 gb|ERP63318.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
Length=758

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 106/147 (72%), Gaps = 6/147 (4%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMT--AMEKT---AHSYLPSAPMLYAVIE  270
            MA EFA  VE GL LSKRI +GK+   A   AMT    EK+   A SY P+A M YAV+ 
Sbjct  1    MAREFATCVEYGLSLSKRIYYGKEMTPAATAAMTRSVSEKSSDVAESYFPTAVMAYAVVS  60

Query  271  NPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNS-ISVAAECYLDTAFVTVTGSWRVHCVM  447
             P +V+NPDVPSYQP+VHGRC+PPALIPL M+  +++  +C  D A V  +G+WRVHC+ 
Sbjct  61   EPELVENPDVPSYQPYVHGRCEPPALIPLHMHGVVTMEIDCCFDHANVCFSGAWRVHCIK  120

Query  448  GSRSCDCRIAIPMGEQGSILGLEVEVP  528
            G+  CD RIA+PMGEQGS+LG+EV+VP
Sbjct  121  GNSKCDVRIAVPMGEQGSLLGVEVDVP  147



>ref|XP_002304123.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
 gb|EEE79102.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
Length=757

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 106/147 (72%), Gaps = 6/147 (4%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMT--AMEKT---AHSYLPSAPMLYAVIE  270
            MA EFA  VE GL LSKRI +GK+   A   AMT    EK+   A SY P+A M YAV+ 
Sbjct  1    MAREFATCVEYGLSLSKRIYYGKEMTPAATAAMTRSVSEKSSDVAESYFPTAVMAYAVVS  60

Query  271  NPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNS-ISVAAECYLDTAFVTVTGSWRVHCVM  447
             P +V+NPDVPSYQP+VHGRC+PPALIPL M+  +++  +C  D A V  +G+WRVHC+ 
Sbjct  61   EPELVENPDVPSYQPYVHGRCEPPALIPLHMHGVVTMEIDCCFDHANVCFSGAWRVHCIK  120

Query  448  GSRSCDCRIAIPMGEQGSILGLEVEVP  528
            G+  CD RIA+PMGEQGS+LG+EV+VP
Sbjct  121  GNSKCDVRIAVPMGEQGSLLGVEVDVP  147



>ref|XP_011036461.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X4 [Populus euphratica]
Length=647

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 103/148 (70%), Gaps = 6/148 (4%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMT-----AMEKTAHSYLPSAPMLYAVIE  270
            MA EFA  VE GL LSKRI +GK+   A   AMT          A SY P+A M YAV+ 
Sbjct  1    MAREFATCVEYGLNLSKRIYYGKEMTPAATAAMTRSMSAKSSDVAESYFPTAVMAYAVVS  60

Query  271  NPAVVDNPDVPSYQPHVHGRCDPPALIPLQM-NSISVAAECYLDTAFVTVTGSWRVHCVM  447
             P +V+NPDVPSYQP+VHGRC+PPALIPL M   +++  +C  D A V  +G+WRVHC+ 
Sbjct  61   EPELVENPDVPSYQPYVHGRCEPPALIPLHMLGVVTMEIDCCFDHANVCFSGAWRVHCIK  120

Query  448  GSRSCDCRIAIPMGEQGSILGLEVEVPR  531
            G+  CD RIA+P+GEQGS+LG+EV+VPR
Sbjct  121  GNSKCDVRIAVPIGEQGSLLGVEVDVPR  148



>ref|XP_011036458.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Populus euphratica]
Length=758

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 103/148 (70%), Gaps = 6/148 (4%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMT-----AMEKTAHSYLPSAPMLYAVIE  270
            MA EFA  VE GL LSKRI +GK+   A   AMT          A SY P+A M YAV+ 
Sbjct  1    MAREFATCVEYGLNLSKRIYYGKEMTPAATAAMTRSMSAKSSDVAESYFPTAVMAYAVVS  60

Query  271  NPAVVDNPDVPSYQPHVHGRCDPPALIPLQM-NSISVAAECYLDTAFVTVTGSWRVHCVM  447
             P +V+NPDVPSYQP+VHGRC+PPALIPL M   +++  +C  D A V  +G+WRVHC+ 
Sbjct  61   EPELVENPDVPSYQPYVHGRCEPPALIPLHMLGVVTMEIDCCFDHANVCFSGAWRVHCIK  120

Query  448  GSRSCDCRIAIPMGEQGSILGLEVEVPR  531
            G+  CD RIA+P+GEQGS+LG+EV+VPR
Sbjct  121  GNSKCDVRIAVPIGEQGSLLGVEVDVPR  148



>ref|XP_011036459.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X2 [Populus euphratica]
Length=757

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 103/148 (70%), Gaps = 6/148 (4%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMT-----AMEKTAHSYLPSAPMLYAVIE  270
            MA EFA  VE GL LSKRI +GK+   A   AMT          A SY P+A M YAV+ 
Sbjct  1    MAREFATCVEYGLNLSKRIYYGKEMTPAATAAMTRSMSAKSSDVAESYFPTAVMAYAVVS  60

Query  271  NPAVVDNPDVPSYQPHVHGRCDPPALIPLQM-NSISVAAECYLDTAFVTVTGSWRVHCVM  447
             P +V+NPDVPSYQP+VHGRC+PPALIPL M   +++  +C  D A V  +G+WRVHC+ 
Sbjct  61   EPELVENPDVPSYQPYVHGRCEPPALIPLHMLGVVTMEIDCCFDHANVCFSGAWRVHCIK  120

Query  448  GSRSCDCRIAIPMGEQGSILGLEVEVPR  531
            G+  CD RIA+P+GEQGS+LG+EV+VPR
Sbjct  121  GNSKCDVRIAVPIGEQGSLLGVEVDVPR  148



>ref|XP_009105911.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4 [Brassica 
rapa]
 emb|CDX96412.1| BnaA07g30230D [Brassica napus]
Length=756

 Score =   164 bits (416),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 102/140 (73%), Gaps = 3/140 (2%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            M+ EFA  VE GL+LS+RI +GK   +APP  +   + +  ++LP+A   YA I +P  V
Sbjct  1    MSEEFAVRVEQGLKLSRRIYYGK--GIAPP-VVPDPQSSPENFLPTAITAYASITDPVAV  57

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPDVPSYQP+VH RCDP AL+PLQM  I +  +C+LDTAFVTVTG WRVHCVM S+  D
Sbjct  58   DNPDVPSYQPYVHARCDPSALVPLQMLGIEMRVDCWLDTAFVTVTGRWRVHCVMPSKRFD  117

Query  466  CRIAIPMGEQGSILGLEVEV  525
            C IA+P GE+G++L  E++V
Sbjct  118  CCIAVPTGEKGTLLSAEIDV  137



>emb|CDX72920.1| BnaC06g33680D [Brassica napus]
Length=756

 Score =   164 bits (416),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 102/140 (73%), Gaps = 3/140 (2%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            M+ EFA  VE GL+LS+RI +GK   +APP  +   + +  ++LP+A   YA I +P  V
Sbjct  1    MSEEFAVRVEQGLKLSRRIYYGK--GIAPP-VVPDPQSSPENFLPTAITAYASITDPVAV  57

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPDVPSYQP+VH RCDP AL+PLQM  I +  +C+LDTAFVTVTG WRVHCVM S+  D
Sbjct  58   DNPDVPSYQPYVHARCDPSALVPLQMLGIEMRVDCWLDTAFVTVTGRWRVHCVMPSKRFD  117

Query  466  CRIAIPMGEQGSILGLEVEV  525
            C IA+P GE+G++L  E++V
Sbjct  118  CCIAVPTGEKGTLLSAEIDV  137



>ref|XP_010428136.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X1 [Camelina sativa]
 ref|XP_010428137.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X2 [Camelina sativa]
Length=758

 Score =   164 bits (416),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 102/140 (73%), Gaps = 2/140 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            M+ EFA  VE GL+L++RI +GK   + PP A +    +  ++LP+A   YA I +P  V
Sbjct  1    MSEEFAIRVEQGLKLARRIYYGK--GITPPLAPSDPPSSPENFLPTAITAYASITDPVAV  58

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPDVPSYQP+VH RCDP AL+PLQM  + +  +C+LDTAFV+++G WRVHCVM S+  D
Sbjct  59   DNPDVPSYQPYVHARCDPSALVPLQMLGVEMRVDCWLDTAFVSISGRWRVHCVMPSKRFD  118

Query  466  CRIAIPMGEQGSILGLEVEV  525
            C + +PMGE+GS+LG E++V
Sbjct  119  CCVGVPMGEKGSLLGAEIDV  138



>ref|XP_006390650.1| hypothetical protein EUTSA_v10018177mg [Eutrema salsugineum]
 gb|ESQ27936.1| hypothetical protein EUTSA_v10018177mg [Eutrema salsugineum]
Length=756

 Score =   164 bits (414),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 75/140 (54%), Positives = 98/140 (70%), Gaps = 3/140 (2%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            M+ EFA  VE GL+LS+RI +GK         +     +  ++LP+A   YA I +P  V
Sbjct  1    MSEEFAIRVEQGLKLSRRIYYGKGITPP---LLPDPPSSPENFLPTAITAYASITDPVAV  57

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPDVPSYQP+VH RCDP AL+PLQM  I +  +C+LDTAF TV+G WRVHCVM S+  D
Sbjct  58   DNPDVPSYQPYVHARCDPSALVPLQMLGIEMRVDCWLDTAFFTVSGRWRVHCVMNSKRFD  117

Query  466  CRIAIPMGEQGSILGLEVEV  525
            C +A+PMGE+GS+LG E++V
Sbjct  118  CCLAVPMGEKGSLLGAEIDV  137



>ref|XP_003627333.1| hypothetical protein MTR_8g021230, partial [Medicago truncatula]
Length=311

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +1

Query  211  MEKTAHSYLPSAPMLYAVIENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAEC  390
            M ++   +LPSAPM YAVI +P +VDNPD+ SYQP+V+GRCDPPALIPLQ+  I +  +C
Sbjct  1    MTRSIDEHLPSAPMCYAVIPDPDIVDNPDIRSYQPYVYGRCDPPALIPLQLQGIEMDVDC  60

Query  391  YLDTAFVTVTGSWRVHCVMGSRSCDCRIAIPMGEQGSILGLEVE  522
             LDTAFVTVTG WRVHCV GS  CDC++AIP+G+QGS+LG+EV+
Sbjct  61   CLDTAFVTVTGRWRVHCVRGSSLCDCQVAIPIGDQGSLLGVEVD  104



>ref|XP_002888881.1| hypothetical protein ARALYDRAFT_476383 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65140.1| hypothetical protein ARALYDRAFT_476383 [Arabidopsis lyrata subsp. 
lyrata]
Length=757

 Score =   162 bits (410),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 100/140 (71%), Gaps = 3/140 (2%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            M+ EFA  VE GL+LS+RI +GK   + PP  +     +  ++LP+A   YA I +P  V
Sbjct  1    MSEEFALRVEQGLKLSRRIYYGK--GITPP-VVPDSPSSPENFLPTAITAYASITDPVAV  57

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPDVPSYQP+VH RCDP AL+PLQM  I +  +C+LD AFVTVTG WRVHCVM S+  D
Sbjct  58   DNPDVPSYQPYVHARCDPSALVPLQMLGIEMRVDCWLDMAFVTVTGRWRVHCVMPSKRFD  117

Query  466  CRIAIPMGEQGSILGLEVEV  525
            C + +PMGE+G++LG E++V
Sbjct  118  CCVGVPMGEKGTLLGAEIDV  137



>ref|XP_006301970.1| hypothetical protein CARUB_v10022450mg [Capsella rubella]
 gb|EOA34868.1| hypothetical protein CARUB_v10022450mg [Capsella rubella]
Length=757

 Score =   161 bits (408),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 99/140 (71%), Gaps = 3/140 (2%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            M+ EFA  VE GL+LS+RI +GK      P  +     +  ++LP+A   YA I +P  V
Sbjct  1    MSEEFAIRVEQGLKLSRRIYYGKG---ITPPVVPDPPSSPENFLPTAITAYASITDPVAV  57

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPDVPSYQP+VH RCDP AL+PLQM  + +  +C+LDTAFVTVTG WRVHCVM S+  D
Sbjct  58   DNPDVPSYQPYVHARCDPSALVPLQMLGVEMRVDCWLDTAFVTVTGRWRVHCVMPSKRFD  117

Query  466  CRIAIPMGEQGSILGLEVEV  525
            C + +PMGE+GS+LG E++V
Sbjct  118  CCVGVPMGEKGSLLGAEIDV  137



>ref|XP_010471276.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Camelina sativa]
Length=758

 Score =   161 bits (408),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 100/140 (71%), Gaps = 2/140 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            M+ EFA  VE GL+LS+RI +GK   + PP        +  ++LP+A   YA I +P  V
Sbjct  1    MSEEFAIRVEQGLKLSRRIYYGK--GITPPLVPADPPSSPDNFLPTAITAYASITDPVAV  58

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNP+VPSYQP+VH RCDP AL+PLQM  + +  +C+LDTAFV+++G WRVHCVM S+  D
Sbjct  59   DNPEVPSYQPYVHARCDPSALVPLQMLGVEMRVDCWLDTAFVSISGRWRVHCVMPSKRFD  118

Query  466  CRIAIPMGEQGSILGLEVEV  525
            C + +PMGE+GS+LG E++V
Sbjct  119  CCVGVPMGEKGSLLGAEIDV  138



>ref|XP_010416000.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Camelina sativa]
Length=759

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 101/141 (72%), Gaps = 3/141 (2%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA-HSYLPSAPMLYAVIENPAV  282
            M+ EFA  VE GL+LS+RI +GK   + PP   +    ++  ++LP+A   YA I +P  
Sbjct  1    MSEEFAIRVEQGLKLSRRIYYGK--GITPPLVPSDHPPSSPENFLPTAITAYASITDPVA  58

Query  283  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  462
            VDNPDVPSYQP+VH RCDP AL+PLQM  + +  +C+LDTAFV+++G WRVHCVM S+  
Sbjct  59   VDNPDVPSYQPYVHARCDPSALVPLQMLGVEMRVDCWLDTAFVSISGRWRVHCVMPSKRF  118

Query  463  DCRIAIPMGEQGSILGLEVEV  525
            DC + +PMGE+GS+LG E+ V
Sbjct  119  DCCVGVPMGEKGSLLGAEIYV  139



>gb|AAG52586.1|AC016529_17 hypothetical protein; 14673-17893 [Arabidopsis thaliana]
Length=758

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 97/140 (69%), Gaps = 3/140 (2%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            M+ EFA  VE GL+L++RI +GK  A      +     +  ++LP+A   YA I +P  V
Sbjct  1    MSEEFALRVEQGLQLARRIYYGKGIAPP---VVPDPPSSPENFLPTAITAYASITDPVAV  57

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPDVPSYQP+VH RCDP AL+PLQM  I +  +C+LDTAFVTVTG WRVHCV  S+  D
Sbjct  58   DNPDVPSYQPYVHARCDPSALVPLQMLGIEMNIDCWLDTAFVTVTGRWRVHCVRPSKRFD  117

Query  466  CRIAIPMGEQGSILGLEVEV  525
            C + +PMGE+GS LG E++V
Sbjct  118  CCVGVPMGEKGSFLGAEIDV  137



>ref|NP_177394.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE35331.1| uncharacterized protein AT1G72500 [Arabidopsis thaliana]
Length=756

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 97/140 (69%), Gaps = 3/140 (2%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  285
            M+ EFA  VE GL+L++RI +GK  A      +     +  ++LP+A   YA I +P  V
Sbjct  1    MSEEFALRVEQGLQLARRIYYGKGIAPP---VVPDPPSSPENFLPTAITAYASITDPVAV  57

Query  286  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  465
            DNPDVPSYQP+VH RCDP AL+PLQM  I +  +C+LDTAFVTVTG WRVHCV  S+  D
Sbjct  58   DNPDVPSYQPYVHARCDPSALVPLQMLGIEMNIDCWLDTAFVTVTGRWRVHCVRPSKRFD  117

Query  466  CRIAIPMGEQGSILGLEVEV  525
            C + +PMGE+GS LG E++V
Sbjct  118  CCVGVPMGEKGSFLGAEIDV  137



>ref|XP_010235662.1| PREDICTED: uncharacterized protein LOC100843408 [Brachypodium 
distachyon]
Length=746

 Score =   156 bits (395),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 99/144 (69%), Gaps = 7/144 (5%)
 Frame = +1

Query  115  EFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEK-----TAHSYLPSAPMLYAVIENPA  279
            +FA AVEDGL+LSKR+       + PPR  T ME+      +   LP+APM YAV+ +P 
Sbjct  3    DFARAVEDGLKLSKRLV--LPGGLPPPRPPTGMERGPDAAVSQLLLPTAPMAYAVVSDPG  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
             VD PDVPSYQP+V+GR DPPALIPLQM  I +AA+C LD A VT+   W +HC+  SR 
Sbjct  61   AVDTPDVPSYQPYVYGRLDPPALIPLQMKEIDLAADCTLDAAAVTLRARWWLHCITRSRE  120

Query  460  CDCRIAIPMGEQGSILGLEVEVPR  531
            CD R+ +PMGEQGSILG EV V R
Sbjct  121  CDVRLVVPMGEQGSILGAEVTVGR  144



>ref|XP_010537629.1| PREDICTED: uncharacterized protein LOC104812256 [Tarenaya hassleriana]
Length=763

 Score =   156 bits (394),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 99/142 (70%), Gaps = 2/142 (1%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA--HSYLPSAPMLYAVIENPA  279
            M+ +FA  VE GL+LS+RI +GK  A+ PP         +   ++LP+A   Y+ I +P 
Sbjct  1    MSCDFAGRVEQGLQLSRRIYYGKGVALPPPVIPEPPPARSPPENFLPTAVTAYSAIYDPV  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  459
             VDNPDVPSYQP+VH RCDPPAL+PLQM +  V  +C+LDTA VT  G WRVHC+M  R 
Sbjct  61   AVDNPDVPSYQPYVHARCDPPALVPLQMLAAEVRVDCWLDTAVVTFIGRWRVHCLMACRR  120

Query  460  CDCRIAIPMGEQGSILGLEVEV  525
             DC IA+PMGE+GS+LG ++++
Sbjct  121  ADCCIAVPMGEKGSLLGADIDI  142



>gb|KHN39616.1| Inter-alpha-trypsin inhibitor heavy chain H5 [Glycine soja]
Length=742

 Score =   155 bits (393),  Expect = 9e-41, Method: Composition-based stats.
 Identities = 63/105 (60%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = +1

Query  208  AMEKTAHSYLPSAPMLYAVIENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAE  387
            ++ K+   YLP+APM YAVI +P  V+NPD+ SYQP+V G+C+PPALIPL+++ + +  E
Sbjct  4    SLSKSPEGYLPTAPMCYAVISDPEKVENPDIRSYQPYVLGQCEPPALIPLELHGVGMEVE  63

Query  388  CYLDTAFVTVTGSWRVHCVMGSRSCDCRIAIPMGEQGSILGLEVE  522
            C LDTAFVTV+G WRVHCV  S +CDC++AIP+GE+GS+LGLEV+
Sbjct  64   CSLDTAFVTVSGKWRVHCVTASSTCDCQVAIPIGEEGSLLGLEVD  108



>ref|XP_006836596.1| hypothetical protein AMTR_s00131p00098870 [Amborella trichopoda]
 gb|ERM99449.1| hypothetical protein AMTR_s00131p00098870 [Amborella trichopoda]
Length=761

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 97/143 (68%), Gaps = 4/143 (3%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAV---APPRAMTAMEKTAHSYLPSAPMLYAVIENP  276
            M   F  +VE GL+LSKR+ +G++      + P     +E + H + P +PM+Y++I +P
Sbjct  1    MEEAFGRSVESGLKLSKRLYYGRNELSGRRSAPFPAKMVEDSKHLF-PRSPMVYSMISDP  59

Query  277  AVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSR  456
            ++VDNPD+PSYQPHV+G  DPPALIPL MN I V   C +++A   + GSWRVHCV   R
Sbjct  60   SIVDNPDIPSYQPHVYGTLDPPALIPLHMNRIEVDVNCVVNSAIFELKGSWRVHCVSCDR  119

Query  457  SCDCRIAIPMGEQGSILGLEVEV  525
             CDC +A+P+ E GSILG+E EV
Sbjct  120  KCDCLLALPLHEVGSILGVEAEV  142



>gb|EEE67586.1| hypothetical protein OsJ_25118 [Oryza sativa Japonica Group]
Length=755

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 92/149 (62%), Gaps = 11/149 (7%)
 Frame = +1

Query  118  FAAAVEDGLRLSKRI-----------NFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAV  264
            FA AVEDGL+LSKR+             G DR V            A   LPSAPM YAV
Sbjct  4    FARAVEDGLKLSKRLVLPGGLPPPRPLAGMDRGVGVGGGGGGDASVAALLLPSAPMAYAV  63

Query  265  IENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCV  444
            + +P  VD PDVPSYQP+V+GR DPPALIPLQM  + ++ +C L  A VTV   W +HC+
Sbjct  64   VTDPGAVDTPDVPSYQPYVYGRLDPPALIPLQMKEVDLSVDCALGEAAVTVRARWWLHCI  123

Query  445  MGSRSCDCRIAIPMGEQGSILGLEVEVPR  531
              SR CD RI +PMG+QGSILG EV V R
Sbjct  124  TRSRDCDVRIVVPMGDQGSILGAEVTVGR  152



>dbj|BAJ95100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=752

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 97/149 (65%), Gaps = 9/149 (6%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEK-----TAHSYLPSAPMLYAVIE  270
            M  +F  AVEDGLRLSKR+         PPR   AM++      A S LP APM YAV+ 
Sbjct  1    MEEDFERAVEDGLRLSKRLVLPG--GAGPPRPHAAMDRYGAPEAATSLLPVAPMAYAVVT  58

Query  271  NPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLD--TAFVTVTGSWRVHCV  444
            +PA VD+PDVPSY+PHV+GR  PPALIPLQM  + +  +C     TA VT+   W +HC+
Sbjct  59   DPAAVDSPDVPSYKPHVYGRLSPPALIPLQMREVELRVDCAAGCATAEVTLVARWWLHCL  118

Query  445  MGSRSCDCRIAIPMGEQGSILGLEVEVPR  531
              SR CDCR+ +PMGE+GSILG EV V +
Sbjct  119  TRSRDCDCRLVVPMGEEGSILGAEVTVGK  147



>gb|EEC82439.1| hypothetical protein OsI_26857 [Oryza sativa Indica Group]
Length=863

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 96/154 (62%), Gaps = 16/154 (10%)
 Frame = +1

Query  103  VMAGEFAAAVEDGLRLSKRI-----------NFGKDRAVAPPRAMTAMEKTAHSYLPSAP  249
            VM G FA AVEDGL+LSKR+             G DR V      +     A   LPSAP
Sbjct  112  VMEG-FARAVEDGLKLSKRLVLPGGLPPPRPLAGMDRGVGGGGDAS----VAALLLPSAP  166

Query  250  MLYAVIENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSW  429
            M YAV+ +P  VD PDVPSYQP+V+GR DPPALIPLQM  + ++ +C L  A VTV   W
Sbjct  167  MAYAVVTDPGAVDTPDVPSYQPYVYGRLDPPALIPLQMKEVDLSVDCALGEAAVTVRARW  226

Query  430  RVHCVMGSRSCDCRIAIPMGEQGSILGLEVEVPR  531
             +HC+  SR CD RI +PMG+QGSILG EV V R
Sbjct  227  WLHCITRSRDCDVRIVVPMGDQGSILGAEVTVGR  260



>ref|XP_004958289.1| PREDICTED: uncharacterized protein LOC101756562 [Setaria italica]
Length=751

 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 97/148 (66%), Gaps = 11/148 (7%)
 Frame = +1

Query  115  EFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHS---------YLPSAPMLYAVI  267
            +FA AVEDGL+LSKR+       V PPR    M++T  +          LP+AP  YAV+
Sbjct  3    DFARAVEDGLKLSKRLVLPG--GVPPPRPPAGMDRTVSAASAAGPDPRLLPTAPTAYAVV  60

Query  268  ENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVM  447
             +P  VD PDVPSYQP+V+GR +PPALIPLQM  + +A +C LD A VT+   W +HC+ 
Sbjct  61   TDPGAVDTPDVPSYQPYVYGRLEPPALIPLQMKEVDLAVDCALDAAHVTLRARWWLHCIT  120

Query  448  GSRSCDCRIAIPMGEQGSILGLEVEVPR  531
             SR CD RI +PMGEQGSILG EV + R
Sbjct  121  RSRECDVRIVVPMGEQGSILGAEVTIGR  148



>tpg|DAA41434.1| TPA: hypothetical protein ZEAMMB73_769800 [Zea mays]
Length=758

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 98/150 (65%), Gaps = 13/150 (9%)
 Frame = +1

Query  115  EFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHS---------YLPSAPMLYAVI  267
            +FA AVEDGL+LSKR+       V PPR    ME+T  S          LP+APM YAV+
Sbjct  3    DFARAVEDGLKLSKRLVLPG--GVPPPRPPAGMERTMSSASASGPDPRLLPTAPMAYAVV  60

Query  268  ENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVM  447
             +PA +D PDVPSYQP+V+G  DPPALIPLQM  + +A +C LD A VT+   W +HC+ 
Sbjct  61   TDPAAIDTPDVPSYQPYVYGHLDPPALIPLQMKEVDLAVDCALDAAHVTLRARWWLHCIT  120

Query  448  GSRSCDCRIAIPMG--EQGSILGLEVEVPR  531
             SR CD R+ +P+G  EQGSILG EV V R
Sbjct  121  RSRDCDVRLVVPLGEQEQGSILGAEVTVGR  150



>ref|XP_002461009.1| hypothetical protein SORBIDRAFT_02g039160 [Sorghum bicolor]
 gb|EER97530.1| hypothetical protein SORBIDRAFT_02g039160 [Sorghum bicolor]
Length=751

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 95/148 (64%), Gaps = 11/148 (7%)
 Frame = +1

Query  115  EFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHS---------YLPSAPMLYAVI  267
            +FA AVEDGL+LSKR+          P A   ME+T  +          LP+APM YAV+
Sbjct  3    DFARAVEDGLKLSKRLVLPGGLPPPRPPA--GMERTVSAAAASGPDPRLLPTAPMAYAVV  60

Query  268  ENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVM  447
             +PA VD PDVPSYQP+V+G  DPPALIPLQM  + +  +C +DTA VT+   W +HC+ 
Sbjct  61   TDPAAVDTPDVPSYQPYVYGNLDPPALIPLQMKEVDLTVDCAVDTAHVTLRARWWLHCIT  120

Query  448  GSRSCDCRIAIPMGEQGSILGLEVEVPR  531
             SR CD R+ +P+ EQGSILG EV + R
Sbjct  121  RSRECDVRLVVPLVEQGSILGAEVAIGR  148



>ref|XP_003557739.1| PREDICTED: uncharacterized protein LOC100836064 [Brachypodium 
distachyon]
Length=754

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 94/146 (64%), Gaps = 4/146 (3%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMT--AMEKTAHSYLPSAPMLYAVIENPA  279
            M  +FA AVEDGL+LSKR+          P A    A    A   LP+APM YAV+ +P 
Sbjct  1    MDEDFARAVEDGLKLSKRLVLPGGAPPPRPPAGMDRAAAWDAAPLLPTAPMAYAVVTDPG  60

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLD--TAFVTVTGSWRVHCVMGS  453
             VD+PDVPSYQPHV+GR +PPALIPLQM  I +  +C     TA VTV   W +HC+  S
Sbjct  61   TVDSPDVPSYQPHVYGRLNPPALIPLQMREIDLRVDCVAGCATAEVTVRARWWLHCITRS  120

Query  454  RSCDCRIAIPMGEQGSILGLEVEVPR  531
            R CDCR+ +PMGEQGS+LG EV V +
Sbjct  121  RDCDCRVVVPMGEQGSLLGAEVTVGK  146



>ref|XP_002465153.1| hypothetical protein SORBIDRAFT_01g032840 [Sorghum bicolor]
 gb|EER92151.1| hypothetical protein SORBIDRAFT_01g032840 [Sorghum bicolor]
Length=756

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 95/151 (63%), Gaps = 9/151 (6%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAH------SYLPSAPMLYAVI  267
            M   FA AVEDGL+L+KR+       + PPR   AM++           +P++PM YAV+
Sbjct  1    MDEAFARAVEDGLKLTKRLVLPNGGGLPPPRPHLAMDRDNDPAAALLQLMPASPMAYAVV  60

Query  268  ENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECY---LDTAFVTVTGSWRVH  438
             +P  VD+PDVPSYQPHV+GR DPPALIPLQM  + +  +C      TA V +   W VH
Sbjct  61   VDPGAVDSPDVPSYQPHVYGRLDPPALIPLQMREVDLRVDCAAAGCATAEVALRARWWVH  120

Query  439  CVMGSRSCDCRIAIPMGEQGSILGLEVEVPR  531
            C+  SR+C CRI +PMG QGSILG EV V +
Sbjct  121  CITRSRACHCRIVVPMGHQGSILGAEVTVGK  151



>tpg|DAA63586.1| TPA: hypothetical protein ZEAMMB73_270893 [Zea mays]
Length=750

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 97/148 (66%), Gaps = 11/148 (7%)
 Frame = +1

Query  115  EFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHS---------YLPSAPMLYAVI  267
            +FA AVEDGL+LSKR+       V PPR    ME+T  +          LP+APM YA++
Sbjct  3    DFARAVEDGLKLSKRLVLPG--GVPPPRPPAGMERTVSAASASGPDPRLLPTAPMAYALV  60

Query  268  ENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVM  447
             +PA VD PDVPSYQP+V+G  DPPALIPLQM  + +A +C LD A VT+   W +HC+ 
Sbjct  61   TDPAAVDTPDVPSYQPYVYGDLDPPALIPLQMKEVDLAVDCALDAAHVTLRARWWLHCIT  120

Query  448  GSRSCDCRIAIPMGEQGSILGLEVEVPR  531
             SR  D R+ +P+GEQGSILG EV V R
Sbjct  121  RSRDSDVRLVVPLGEQGSILGAEVTVGR  148



>gb|ABF96530.1| von Willebrand factor type A domain containing protein, expressed 
[Oryza sativa Japonica Group]
Length=614

 Score =   144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 96/156 (62%), Gaps = 20/156 (13%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINF-----------GKDRAVAPPRAMTAMEKTAHSYLPSAPM  252
            M  +FA AVEDGL+LSKR+             G DR + P  A       A S LPSAPM
Sbjct  1    MEEDFARAVEDGLKLSKRLVLPGGAPSPRPVPGMDRGLLPDAA------AASSLLPSAPM  54

Query  253  LYAVIENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAF---VTVTG  423
             YAV+ +PA VD+PDVPSYQPHV+GR DPPALIPL M  +++A +C         VT+  
Sbjct  55   AYAVVVDPAAVDSPDVPSYQPHVYGRLDPPALIPLHMREVALAVDCAAAGCAAAEVTLRA  114

Query  424  SWRVHCVMGSRSCDCRIAIPMGEQGSILGLEVEVPR  531
             W VHC+  S  C CRI +PMGEQG+ILG EV V +
Sbjct  115  RWWVHCLTRSCDCHCRIVVPMGEQGTILGAEVTVGK  150



>gb|ABF96529.1| von Willebrand factor type A domain containing protein, expressed 
[Oryza sativa Japonica Group]
Length=680

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 96/156 (62%), Gaps = 20/156 (13%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINF-----------GKDRAVAPPRAMTAMEKTAHSYLPSAPM  252
            M  +FA AVEDGL+LSKR+             G DR + P  A       A S LPSAPM
Sbjct  1    MEEDFARAVEDGLKLSKRLVLPGGAPSPRPVPGMDRGLLPDAA------AASSLLPSAPM  54

Query  253  LYAVIENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAF---VTVTG  423
             YAV+ +PA VD+PDVPSYQPHV+GR DPPALIPL M  +++A +C         VT+  
Sbjct  55   AYAVVVDPAAVDSPDVPSYQPHVYGRLDPPALIPLHMREVALAVDCAAAGCAAAEVTLRA  114

Query  424  SWRVHCVMGSRSCDCRIAIPMGEQGSILGLEVEVPR  531
             W VHC+  S  C CRI +PMGEQG+ILG EV V +
Sbjct  115  RWWVHCLTRSCDCHCRIVVPMGEQGTILGAEVTVGK  150



>tpg|DAA41433.1| TPA: hypothetical protein ZEAMMB73_769800 [Zea mays]
Length=1295

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 98/150 (65%), Gaps = 13/150 (9%)
 Frame = +1

Query  115  EFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHS---------YLPSAPMLYAVI  267
            +FA AVEDGL+LSKR+       V PPR    ME+T  S          LP+APM YAV+
Sbjct  3    DFARAVEDGLKLSKRLVLPG--GVPPPRPPAGMERTMSSASASGPDPRLLPTAPMAYAVV  60

Query  268  ENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVM  447
             +PA +D PDVPSYQP+V+G  DPPALIPLQM  + +A +C LD A VT+   W +HC+ 
Sbjct  61   TDPAAIDTPDVPSYQPYVYGHLDPPALIPLQMKEVDLAVDCALDAAHVTLRARWWLHCIT  120

Query  448  GSRSCDCRIAIPMG--EQGSILGLEVEVPR  531
             SR CD R+ +P+G  EQGSILG EV V R
Sbjct  121  RSRDCDVRLVVPLGEQEQGSILGAEVTVGR  150



>ref|XP_006650182.1| PREDICTED: uncharacterized protein LOC102717967 [Oryza brachyantha]
Length=750

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 99/147 (67%), Gaps = 6/147 (4%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAH--SYLPSAPMLYAVIENPA  279
            M  +FA AVEDGL+LSKR+      A +P R +  M+++    S LPSAPM YAV+ +PA
Sbjct  1    MEEDFARAVEDGLKLSKRLVLPGGGAPSP-RPLAPMDRSLDVTSLLPSAPMAYAVVVDPA  59

Query  280  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAEC-YLDT--AFVTVTGSWRVHCVMG  450
              D+PDVPSYQPHV+GR DPPALIPL +  + +A +C Y  +  A VTV   W V C+  
Sbjct  60   AGDSPDVPSYQPHVYGRLDPPALIPLHVREVDLAVDCAYAGSPAAEVTVRARWWVQCIAR  119

Query  451  SRSCDCRIAIPMGEQGSILGLEVEVPR  531
            SR C CR+ +PMG+QGSILG EV V +
Sbjct  120  SRDCHCRLVVPMGDQGSILGAEVTVGK  146



>gb|ABF96527.1| von Willebrand factor type A domain containing protein, expressed 
[Oryza sativa Japonica Group]
 gb|EEC75447.1| hypothetical protein OsI_11983 [Oryza sativa Indica Group]
Length=751

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 96/156 (62%), Gaps = 20/156 (13%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINF-----------GKDRAVAPPRAMTAMEKTAHSYLPSAPM  252
            M  +FA AVEDGL+LSKR+             G DR + P  A       A S LPSAPM
Sbjct  1    MEEDFARAVEDGLKLSKRLVLPGGAPSPRPVPGMDRGLLPDAA------AASSLLPSAPM  54

Query  253  LYAVIENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAF---VTVTG  423
             YAV+ +PA VD+PDVPSYQPHV+GR DPPALIPL M  +++A +C         VT+  
Sbjct  55   AYAVVVDPAAVDSPDVPSYQPHVYGRLDPPALIPLHMREVALAVDCAAAGCAAAEVTLRA  114

Query  424  SWRVHCVMGSRSCDCRIAIPMGEQGSILGLEVEVPR  531
             W VHC+  S  C CRI +PMGEQG+ILG EV V +
Sbjct  115  RWWVHCLTRSCDCHCRIVVPMGEQGTILGAEVTVGK  150



>gb|AAU89244.1| von Willebrand factor type A domain containing protein [Oryza 
sativa Japonica Group]
Length=801

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 96/156 (62%), Gaps = 20/156 (13%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINF-----------GKDRAVAPPRAMTAMEKTAHSYLPSAPM  252
            M  +FA AVEDGL+LSKR+             G DR + P  A       A S LPSAPM
Sbjct  1    MEEDFARAVEDGLKLSKRLVLPGGAPSPRPVPGMDRGLLPDAA------AASSLLPSAPM  54

Query  253  LYAVIENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAF---VTVTG  423
             YAV+ +PA VD+PDVPSYQPHV+GR DPPALIPL M  +++A +C         VT+  
Sbjct  55   AYAVVVDPAAVDSPDVPSYQPHVYGRLDPPALIPLHMREVALAVDCAAAGCAAAEVTLRA  114

Query  424  SWRVHCVMGSRSCDCRIAIPMGEQGSILGLEVEVPR  531
             W VHC+  S  C CRI +PMGEQG+ILG EV V +
Sbjct  115  RWWVHCLTRSCDCHCRIVVPMGEQGTILGAEVTVGK  150



>ref|XP_006658810.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like, 
partial [Oryza brachyantha]
Length=703

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 73/99 (74%), Gaps = 0/99 (0%)
 Frame = +1

Query  235  LPSAPMLYAVIENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVT  414
            LPSAPM YAV+ +P  VD PDVPSYQP+V+GR DPPALIPLQM  + +A +C LD A VT
Sbjct  3    LPSAPMAYAVVSDPGAVDTPDVPSYQPYVYGRLDPPALIPLQMKEVDLAVDCALDEAAVT  62

Query  415  VTGSWRVHCVMGSRSCDCRIAIPMGEQGSILGLEVEVPR  531
            V   W +HC+  SR CD RI +PMGE+GSILG EV   R
Sbjct  63   VRARWWLHCITRSRECDVRIVVPMGERGSILGAEVTAGR  101



>ref|XP_004984064.1| PREDICTED: uncharacterized protein LOC101774989 isoform X1 [Setaria 
italica]
Length=760

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 93/158 (59%), Gaps = 19/158 (12%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGK-------------DRAVAPPRAMTAMEKTAHSYLPSA  246
            M   FA AV+DGL+L+KR+                 DR   P  A  A  +     LP++
Sbjct  1    MEEAFARAVDDGLKLTKRLIMPGGGGLPPPRPPHGMDRDDDPGAAQAAWLR---RLLPAS  57

Query  247  PMLYAVIENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECY---LDTAFVTV  417
            PM YAV+ +P  VD+PDVPSYQPHV+GR DPPALIPLQM  + +  +C      TA V +
Sbjct  58   PMAYAVVVDPGAVDSPDVPSYQPHVYGRLDPPALIPLQMREVELRVDCAAAGCATAEVAL  117

Query  418  TGSWRVHCVMGSRSCDCRIAIPMGEQGSILGLEVEVPR  531
               W VHCV  SR+C CRI +PMG QGSILG EV V +
Sbjct  118  RARWWVHCVTRSRACHCRIVVPMGHQGSILGAEVTVGK  155



>ref|XP_008667805.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=756

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 94/150 (63%), Gaps = 8/150 (5%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAM-TAMEK-----TAHSYLPSAPMLYAVI  267
            M   FA AVEDGL+L+KR+       + PP     AM++          +P+APM YAV+
Sbjct  1    MDEAFARAVEDGLKLTKRLVLPSGGGMPPPPRPHLAMDRDDPAAALQQLMPAAPMAYAVV  60

Query  268  ENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLD--TAFVTVTGSWRVHC  441
             +PA VD+PDVPSYQPHV+GR DPPALIPLQM  + +  +C     TA V +   W +HC
Sbjct  61   VDPAAVDSPDVPSYQPHVYGRLDPPALIPLQMREVELRVDCAAGCATAEVALRARWWLHC  120

Query  442  VMGSRSCDCRIAIPMGEQGSILGLEVEVPR  531
            +  SR+C CRI +PM  QGSILG EV V +
Sbjct  121  ITRSRACHCRIVVPMAHQGSILGAEVTVGK  150



>ref|XP_010242206.1| PREDICTED: uncharacterized protein LOC104586618 [Nelumbo nucifera]
Length=121

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  SKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVVDNPDVPSYQPHVHGR  330
            +++ N    R+        AMEK++H+ LP++PMLYAVI +P +VD PD+ SYQPHVHGR
Sbjct  11   ARKANIIWKRSFRFASKAVAMEKSSHTLLPTSPMLYAVISDPTIVDKPDITSYQPHVHGR  70

Query  331  CDPPALIPLQMNSISVAAECYLDTAFVTVT  420
            CD PALIPLQMN+ISV  +CYLDT  + +T
Sbjct  71   CDLPALIPLQMNAISVEVDCYLDTGSLRLT  100



>gb|EEE59232.1| hypothetical protein OsJ_11214 [Oryza sativa Japonica Group]
Length=718

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 67/105 (64%), Gaps = 17/105 (16%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINF-----------GKDRAVAPPRAMTAMEKTAHSYLPSAPM  252
            M  +FA AVEDGL+LSKR+             G DR + P  A       A S LPSAPM
Sbjct  1    MEEDFARAVEDGLKLSKRLVLPGGAPSPRPVPGMDRGLLPDAA------AASSLLPSAPM  54

Query  253  LYAVIENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAE  387
             YAV+ +PA VD+PDVPSYQPHV+GR DPPALIPL M  +++A +
Sbjct  55   AYAVVVDPAAVDSPDVPSYQPHVYGRLDPPALIPLHMREVALAVD  99



>ref|XP_006593107.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Glycine max]
Length=262

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +1

Query  211  MEKTAHSYLPSAPMLYAVIENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISV  378
            M ++A ++LPSAPM+YAVI +P +VDNPD+PSYQPHV+GRCDPPALIPLQMN+ +V
Sbjct  1    MARSATAFLPSAPMVYAVISDPGIVDNPDIPSYQPHVYGRCDPPALIPLQMNARNV  56



>gb|KHN07890.1| von Willebrand factor A domain-containing protein [Glycine soja]
Length=669

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +1

Query  361  MNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCDCRIAIPMGEQGSILGLEVEVPR  531
            MN+I + A+CY +TAF+TV+G+WR+HCVMGSRSCDCRIA+P+  QGSILG+EV V R
Sbjct  1    MNAIQMEADCYHETAFITVSGTWRLHCVMGSRSCDCRIAVPVSHQGSILGVEVSVSR  57



>gb|KJB83726.1| hypothetical protein B456_013G261400 [Gossypium raimondii]
Length=644

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  370  ISVAAECYLDTAFVTVTGSWRVHCVMGSRSCDCRIAIPMGEQGSILGLEVEVP  528
            +++  +CY+DTA + V+G+WR+ CVMGSRSCDC IA+PMG QGSILG+EV++P
Sbjct  3    VNLNVDCYVDTAIIVVSGTWRIRCVMGSRSCDCLIAVPMGNQGSILGVEVDLP  55



>ref|XP_006598837.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H1-like 
[Glycine max]
Length=665

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +1

Query  385  ECYLDTAFVTVTGSWRVHCVMGSRSCDCRIAIPMGEQGSILGLEVE  522
            EC LDTAFVTV+G WRVHCV  S +CDC++AIP+GE+GS+LGLEV+
Sbjct  4    ECSLDTAFVTVSGKWRVHCVTASSTCDCQVAIPIGEEGSLLGLEVD  49



>ref|XP_001768544.1| predicted protein [Physcomitrella patens]
 gb|EDQ66695.1| predicted protein [Physcomitrella patens]
Length=778

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 76/148 (51%), Gaps = 12/148 (8%)
 Frame = +1

Query  118  FAAAVEDGLRLSKRINFGKDRA---VAPPRAMT---AMEKTAHSYLPSAPMLYAVIENPA  279
            F  ++  G  LS+++  G   +   + PP+  T     EK     LP+ PM+YA+I +  
Sbjct  7    FVTSIAAGQILSQQLRHGGGVSAPSLGPPKHSTIPTMPEKKKMKGLPTCPMIYAIITDLN  66

Query  280  VVDNPDVPSYQPHVH---GRCDPP---ALIPLQMNSISVAAECYLDTAFVTVTGSWRVHC  441
               NP V +    +H    R D P   AL+PL +  I +   C++ T FVT    W ++C
Sbjct  67   TFGNPKVDNAHGSLHPPTFRADAPPLPALVPLSLEMIELDVACHISTGFVTAKSRWNLNC  126

Query  442  VMGSRSCDCRIAIPMGEQGSILGLEVEV  525
            V    SCDC +A+PM  QG++  +E+++
Sbjct  127  VRSQASCDCLLALPMDHQGTVSSVEIDM  154



>ref|XP_001770617.1| predicted protein [Physcomitrella patens]
 gb|EDQ64600.1| predicted protein [Physcomitrella patens]
Length=634

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 79/148 (53%), Gaps = 14/148 (9%)
 Frame = +1

Query  109  AGEFAAAVEDGLRLSKRINFGK--DRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAV  282
            A  FA +V  G  L++++ +G   D     P   TA   T  ++L + PM+YAVI +  V
Sbjct  3    ANSFATSVGAGRVLAQQLRYGGPLDYPTMSPMDGTA---TQEAFL-TCPMVYAVITDMNV  58

Query  283  VDNPDVPSYQPH-VHGRCDP------PALIPLQMNSISVAAECYLDTAFVTVTGSWRVHC  441
                D   Y P+  H +  P      PA +PL +  + V  EC++ T FVT+  +W V+C
Sbjct  59   FGKADA-EYDPYNQHPQTYPMNAPTLPAFVPLTLGKMKVKVECHISTGFVTMKSTWHVNC  117

Query  442  VMGSRSCDCRIAIPMGEQGSILGLEVEV  525
            +    SCDC +A+PM  QG++  +E+++
Sbjct  118  IRSQASCDCLLALPMDNQGTVSSVEIDM  145



>ref|XP_002446722.1| hypothetical protein SORBIDRAFT_06g021180 [Sorghum bicolor]
 gb|EES11050.1| hypothetical protein SORBIDRAFT_06g021180 [Sorghum bicolor]
Length=103

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = +1

Query  250  MLYAVIENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSW  429
            M YAV+ +   VD+PDVPSYQPH++GR DPPALIPL+M  + +  +C    +  T   + 
Sbjct  1    MAYAVVVDSGAVDSPDVPSYQPHMYGRLDPPALIPLKMQEVELRVDCAA-ASCATTEVAL  59

Query  430  RVHC  441
            R HC
Sbjct  60   RAHC  63



>ref|XP_010253846.1| PREDICTED: protein TIME FOR COFFEE-like [Nelumbo nucifera]
Length=381

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 42/52 (81%), Gaps = 1/52 (2%)
 Frame = +1

Query  106  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYA  261
            MA +F  +V+DGL+L+KRI FG DR+V+ PR + AMEK++H+ LP++PM YA
Sbjct  1    MAQQFVKSVKDGLKLAKRIYFGNDRSVSSPRPV-AMEKSSHTLLPTSPMFYA  51



>gb|EEE51525.1| hypothetical protein OsJ_32720 [Oryza sativa Japonica Group]
Length=53

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  235  LPSAPMLYAVIENPAVVDNPDVPSYQPHVHGRCDP  339
            LPSAPM YAV+ +P  VD PD+PSYQP+V+GR DP
Sbjct  17   LPSAPMAYAVVTDPGTVDTPDMPSYQPYVYGRLDP  51



>gb|EEC67542.1| hypothetical protein OsI_34867 [Oryza sativa Indica Group]
Length=59

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  238  PSAPMLYAVIENPAVVDNPDVPSYQPHVHGRCDP  339
            PSAPM YAV+ +P  VD PD+PSYQP+V+GR DP
Sbjct  24   PSAPMAYAVVTDPGTVDTPDMPSYQPYVYGRLDP  57



>ref|XP_001762340.1| predicted protein [Physcomitrella patens]
 gb|EDQ72807.1| predicted protein [Physcomitrella patens]
Length=621

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 56/109 (51%), Gaps = 18/109 (17%)
 Frame = +1

Query  235  LPSAPMLYAVIENPAVVDNPDVPSYQPHVHGRCDPPALI------------PLQMNSISV  378
            LP+ PM+YA+I +  V  NP V     + H    PP                L+ + ++V
Sbjct  37   LPTCPMVYAIITDMKVFGNPKVD----NDHYEQYPPTYPLDAPPPPALVPLTLEKSKLNV  92

Query  379  AAECYLDTAFVTVTGSWRVHCVMGSRSCDCRIAIPMGEQGSILGLEVEV  525
              EC + T FVT   +W ++CV    SCDC +A+P+  QG++  +E+++
Sbjct  93   --ECCISTGFVTSKCTWNLNCVRSQASCDCLLAVPIDNQGTVSSVEIDM  139



>ref|XP_011458408.1| PREDICTED: calcium-dependent protein kinase 11-like isoform X3 
[Fragaria vesca subsp. vesca]
 ref|XP_011458409.1| PREDICTED: calcium-dependent protein kinase 11-like isoform X3 
[Fragaria vesca subsp. vesca]
Length=471

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 44/76 (58%), Gaps = 6/76 (8%)
 Frame = +1

Query  127  AVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAH--SYLPSAPMLYAVIENPAVVDNPDV  300
            AV+DGL LSK + F KD   +P +  +  +K+    +YLP +P +Y VI +P +V+N D+
Sbjct  56   AVDDGLHLSKHLYFRKDPGKSPHKPSSGKDKSVVGCAYLPKSPTVYTVISDPMIVENSDI  115

Query  301  PSYQPHVHGRCDPPAL  348
             S        C PPAL
Sbjct  116  LS----TSRTCTPPAL  127



>gb|KHN12291.1| Inter-alpha-trypsin inhibitor heavy chain H1, partial [Glycine 
soja]
Length=640

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  433  VHCVMGSRSCDCRIAIPMGEQGSILGLEVEVPR  531
            +HCV GSR+CDC +A+P+  QGSILG+EV V R
Sbjct  1    LHCVSGSRTCDCIVALPVPPQGSILGVEVSVHR  33



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556507818200