BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS014B01

Length=594
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009606207.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    255   9e-76   Nicotiana tomentosiformis
ref|XP_009788524.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    253   6e-75   Nicotiana sylvestris
ref|XP_006352881.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    248   3e-73   
ref|XP_004245918.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    244   5e-72   Solanum lycopersicum
ref|XP_011070302.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    237   2e-69   Sesamum indicum [beniseed]
ref|XP_010245191.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    234   3e-68   
ref|XP_002277503.2|  PREDICTED: alpha,alpha-trehalose-phosphate s...    231   4e-67   Vitis vinifera
emb|CAN61971.1|  hypothetical protein VITISV_016593                     231   4e-67   Vitis vinifera
ref|XP_002527658.1|  trehalose-6-phosphate synthase, putative           230   7e-67   
ref|XP_007210367.1|  hypothetical protein PRUPE_ppa001305mg             227   8e-66   Prunus persica
ref|XP_004300232.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    226   2e-65   Fragaria vesca subsp. vesca
gb|AJO70167.1|  alpha,alpha-trehalose-phosphate synthase 5              225   6e-65   Camellia sinensis [black tea]
ref|XP_006432795.1|  hypothetical protein CICLE_v10000247mg             223   2e-64   
ref|XP_009371197.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    223   2e-64   Pyrus x bretschneideri [bai li]
ref|XP_008238210.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    223   2e-64   Prunus mume [ume]
ref|XP_006432796.1|  hypothetical protein CICLE_v10000247mg             223   4e-64   
gb|EYU33434.1|  hypothetical protein MIMGU_mgv1a001209mg                221   2e-63   Erythranthe guttata [common monkey flower]
ref|XP_009401244.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    218   1e-62   
ref|XP_007040645.1|  Trehalose phosphatase/synthase 5 isoform 3         218   1e-62   
ref|XP_007040643.1|  Trehalose phosphatase/synthase 5 isoform 1         218   2e-62   
ref|XP_002304347.1|  glycosyl transferase family 20 family protein      218   2e-62   
gb|KDP26189.1|  hypothetical protein JCGZ_22685                         215   3e-61   Jatropha curcas
ref|XP_010096957.1|  Alpha,alpha-trehalose-phosphate synthase [UD...    213   9e-61   Morus notabilis
ref|XP_008800104.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    211   5e-60   
gb|KHG14108.1|  Alpha,alpha-trehalose-phosphate synthase [UDP-for...    209   2e-59   Gossypium arboreum [tree cotton]
gb|KHG01348.1|  Alpha,alpha-trehalose-phosphate synthase [UDP-for...    209   2e-59   Gossypium arboreum [tree cotton]
ref|XP_011028149.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    208   2e-59   Populus euphratica
ref|XP_011028148.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    208   2e-59   Populus euphratica
ref|XP_006605933.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    209   3e-59   Glycine max [soybeans]
gb|KHN42432.1|  Alpha,alpha-trehalose-phosphate synthase [UDP-for...    209   3e-59   Glycine soja [wild soybean]
gb|KCW71761.1|  hypothetical protein EUGRSUZ_E00259                     207   6e-59   Eucalyptus grandis [rose gum]
gb|KJB25286.1|  hypothetical protein B456_004G183400                    207   6e-59   Gossypium raimondii
ref|XP_011028143.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    208   6e-59   Populus euphratica
gb|KCW71760.1|  hypothetical protein EUGRSUZ_E00259                     206   8e-59   Eucalyptus grandis [rose gum]
gb|KJB25285.1|  hypothetical protein B456_004G183400                    207   9e-59   Gossypium raimondii
ref|XP_010908489.1|  PREDICTED: LOW QUALITY PROTEIN: alpha,alpha-...    207   1e-58   Elaeis guineensis
gb|KHN06692.1|  Alpha,alpha-trehalose-phosphate synthase [UDP-for...    206   2e-58   Glycine soja [wild soybean]
ref|XP_010055292.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    206   2e-58   Eucalyptus grandis [rose gum]
ref|XP_006589670.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    206   2e-58   Glycine max [soybeans]
gb|KJB39837.1|  hypothetical protein B456_007G033200                    206   4e-58   Gossypium raimondii
ref|XP_006368376.1|  hypothetical protein POPTR_0001s02190g             205   6e-58   Populus trichocarpa [western balsam poplar]
gb|KEH44193.1|  trehalose-6-phosphate synthase domain protein           204   2e-57   Medicago truncatula
ref|XP_011018523.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    203   4e-57   Populus euphratica
ref|XP_004497050.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    202   7e-57   Cicer arietinum [garbanzo]
ref|XP_004497053.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    202   8e-57   
ref|XP_010276860.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    200   4e-56   Nelumbo nucifera [Indian lotus]
ref|XP_004148747.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    198   3e-55   Cucumis sativus [cucumbers]
ref|XP_008448661.1|  PREDICTED: LOW QUALITY PROTEIN: alpha,alpha-...    197   3e-55   Cucumis melo [Oriental melon]
ref|XP_010677331.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    196   2e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006854042.1|  hypothetical protein AMTR_s00048p00069850          195   2e-54   Amborella trichopoda
gb|AAX16014.1|  trehalose-6-phosphate synthase                          195   3e-54   Ginkgo biloba [ginkgo]
ref|XP_006849789.1|  hypothetical protein AMTR_s00176p00032980          194   6e-54   Amborella trichopoda
emb|CDX90449.1|  BnaA03g43320D                                          189   4e-52   
ref|XP_010518663.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    189   4e-52   Tarenaya hassleriana [spider flower]
gb|ABD65165.1|  trehalose-6-phosphate synthase, putative                187   1e-51   Brassica oleracea
ref|XP_009136870.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    187   2e-51   Brassica rapa
emb|CAB10557.1|  trehalose-6-phosphate synthase like protein            186   5e-51   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567538.1|  putative trehalose phosphatase/synthase 5             185   9e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010449562.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    185   1e-50   
emb|CBI33857.3|  unnamed protein product                                174   1e-50   Vitis vinifera
ref|XP_010434619.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    185   1e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010449561.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    185   1e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010449559.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    184   2e-50   
ref|XP_002527520.1|  trehalose-6-phosphate synthase, putative           183   2e-50   
ref|XP_010242150.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    184   2e-50   
ref|XP_002870086.1|  ATTPS5                                             184   3e-50   Arabidopsis lyrata subsp. lyrata
ref|XP_006283097.1|  hypothetical protein CARUB_v10004115mg             184   4e-50   Capsella rubella
ref|XP_010271238.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    182   8e-50   Nelumbo nucifera [Indian lotus]
ref|XP_009351564.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    182   1e-49   
ref|XP_008381762.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    182   1e-49   
ref|XP_010439943.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    182   1e-49   Camelina sativa [gold-of-pleasure]
ref|XP_011021751.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    181   2e-49   Populus euphratica
ref|XP_011021750.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    181   2e-49   Populus euphratica
ref|XP_009595830.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    181   2e-49   Nicotiana tomentosiformis
ref|XP_004293972.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    181   2e-49   Fragaria vesca subsp. vesca
ref|XP_008383601.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    181   3e-49   
ref|XP_002314777.2|  hypothetical protein POPTR_0010s11510g             181   4e-49   Populus trichocarpa [western balsam poplar]
ref|XP_006378432.1|  hypothetical protein POPTR_0010s11510g             180   4e-49   
ref|XP_004228746.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    180   8e-49   Solanum lycopersicum
ref|XP_008220922.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    180   8e-49   Prunus mume [ume]
ref|XP_004233035.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    180   9e-49   Solanum lycopersicum
gb|KDP38139.1|  hypothetical protein JCGZ_04782                         179   1e-48   Jatropha curcas
ref|XP_006364054.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    179   1e-48   Solanum tuberosum [potatoes]
ref|XP_009351624.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    179   2e-48   Pyrus x bretschneideri [bai li]
ref|XP_006414189.1|  hypothetical protein EUTSA_v10024381mg             179   2e-48   Eutrema salsugineum [saltwater cress]
ref|XP_008371505.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    178   3e-48   
ref|XP_007214619.1|  hypothetical protein PRUPE_ppa001324mg             178   4e-48   Prunus persica
gb|KHG01703.1|  putative alpha,alpha-trehalose-phosphate synthase...    178   4e-48   Gossypium arboreum [tree cotton]
gb|KDP21135.1|  hypothetical protein JCGZ_21606                         177   5e-48   Jatropha curcas
ref|XP_006358103.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    177   6e-48   Solanum tuberosum [potatoes]
ref|XP_009778367.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    177   6e-48   Nicotiana sylvestris
ref|XP_010650494.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    177   8e-48   Vitis vinifera
ref|XP_010671073.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    177   9e-48   Beta vulgaris subsp. vulgaris [field beet]
gb|AJO70168.1|  alpha,alpha-trehalose-phosphate synthase 7              177   9e-48   Camellia sinensis [black tea]
ref|XP_007142959.1|  hypothetical protein PHAVU_007G031800g             177   1e-47   Phaseolus vulgaris [French bean]
gb|KJB57382.1|  hypothetical protein B456_009G160400                    177   1e-47   Gossypium raimondii
ref|XP_010106616.1|  putative alpha,alpha-trehalose-phosphate syn...    176   2e-47   Morus notabilis
ref|XP_002522255.1|  trehalose-6-phosphate synthase, putative           176   2e-47   Ricinus communis
ref|XP_004503340.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    175   4e-47   Cicer arietinum [garbanzo]
ref|XP_011463160.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    175   6e-47   Fragaria vesca subsp. vesca
ref|XP_009804181.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    173   1e-46   Nicotiana sylvestris
ref|XP_009804180.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    173   1e-46   Nicotiana sylvestris
ref|XP_011039387.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    174   2e-46   Populus euphratica
ref|XP_002317392.1|  hypothetical protein POPTR_0011s06910g             173   2e-46   Populus trichocarpa [western balsam poplar]
ref|XP_010043976.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    173   3e-46   Eucalyptus grandis [rose gum]
ref|XP_009804177.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    173   3e-46   Nicotiana sylvestris
ref|XP_010052171.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    172   4e-46   Eucalyptus grandis [rose gum]
ref|XP_002268174.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    172   5e-46   Vitis vinifera
ref|XP_004171547.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    169   1e-45   
ref|XP_008439718.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    171   2e-45   Cucumis melo [Oriental melon]
gb|KJB69686.1|  hypothetical protein B456_011G037000                    169   3e-45   Gossypium raimondii
gb|ACD56638.1|  trehalose synthase-like protein                         170   3e-45   Gossypioides kirkii
gb|AHL29280.1|  trehalose-phosphate synthase 6                          170   3e-45   Camellia sinensis [black tea]
gb|KHG11600.1|  putative alpha,alpha-trehalose-phosphate synthase...    169   6e-45   Gossypium arboreum [tree cotton]
ref|XP_002312472.1|  hypothetical protein POPTR_0008s13590g             169   6e-45   
gb|KJB69685.1|  hypothetical protein B456_011G037000                    169   6e-45   Gossypium raimondii
ref|XP_010052868.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    169   7e-45   Eucalyptus grandis [rose gum]
ref|XP_010052859.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    169   7e-45   Eucalyptus grandis [rose gum]
ref|XP_008775883.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    169   8e-45   Phoenix dactylifera
ref|XP_004134569.1|  PREDICTED: LOW QUALITY PROTEIN: probable alp...    168   1e-44   
gb|KGN49325.1|  Trehalose-6-phosphate synthase                          168   2e-44   Cucumis sativus [cucumbers]
ref|XP_002305726.1|  hypothetical protein POPTR_0004s06000g             168   2e-44   Populus trichocarpa [western balsam poplar]
ref|XP_009624608.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    167   2e-44   
ref|XP_011024382.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    167   2e-44   Populus euphratica
ref|XP_009624607.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    167   2e-44   
ref|XP_010999788.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    167   3e-44   Populus euphratica
gb|KJB68366.1|  hypothetical protein B456_010G241200                    166   4e-44   Gossypium raimondii
ref|XP_009624606.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    167   4e-44   Nicotiana tomentosiformis
gb|AAG52003.1|AC012563_13  putative trehalose-6-phosphate synthas...    167   5e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003630977.1|  Alpha,alpha-trehalose-phosphate synthase           166   6e-44   Medicago truncatula
gb|KJB68367.1|  hypothetical protein B456_010G241200                    165   6e-44   Gossypium raimondii
ref|XP_006391193.1|  hypothetical protein EUTSA_v10018111mg             166   8e-44   Eutrema salsugineum [saltwater cress]
ref|XP_010093315.1|  Alpha,alpha-trehalose-phosphate synthase [UD...    166   9e-44   Morus notabilis
ref|XP_004136836.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    166   9e-44   
ref|XP_008455290.1|  PREDICTED: LOW QUALITY PROTEIN: probable alp...    166   1e-43   
ref|XP_002281386.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    164   1e-43   Vitis vinifera
gb|KJB68365.1|  hypothetical protein B456_010G241200                    165   2e-43   Gossypium raimondii
gb|KGN43637.1|  hypothetical protein Csa_7G049190                       166   2e-43   Cucumis sativus [cucumbers]
ref|XP_007025310.1|  Trehalose-phosphatase/synthase 7 isoform 4         164   2e-43   
ref|XP_010511784.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    165   2e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010511780.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    165   2e-43   
ref|XP_007025309.1|  Trehalose-phosphatase/synthase 7 isoform 3         164   2e-43   
ref|NP_564918.1|  alpha,alpha-trehalose-phosphate synthase [UDP-f...    163   3e-43   Arabidopsis thaliana [mouse-ear cress]
gb|KJB30628.1|  hypothetical protein B456_005G152400                    163   3e-43   Gossypium raimondii
ref|XP_007045543.1|  UDP-Glycosyltransferase / trehalose-phosphat...    164   3e-43   
ref|XP_010557135.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    164   5e-43   Tarenaya hassleriana [spider flower]
ref|XP_007025308.1|  Trehalose-phosphatase/synthase 7 isoform 2         164   5e-43   Theobroma cacao [chocolate]
ref|XP_003633255.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    164   6e-43   Vitis vinifera
emb|CAN67058.1|  hypothetical protein VITISV_036715                     164   6e-43   Vitis vinifera
ref|XP_007045541.1|  UDP-Glycosyltransferase / trehalose-phosphat...    164   6e-43   
gb|KJB30627.1|  hypothetical protein B456_005G152400                    163   7e-43   Gossypium raimondii
ref|XP_007025307.1|  Trehalose-phosphatase/synthase 7 isoform 1         164   8e-43   
gb|KDO60795.1|  hypothetical protein CISIN_1g044635mg                   163   1e-42   Citrus sinensis [apfelsine]
ref|XP_003607607.1|  Trehalose synthase-like protein                    163   1e-42   Medicago truncatula
ref|XP_006448141.1|  hypothetical protein CICLE_v10014251mg             163   1e-42   Citrus clementina [clementine]
ref|XP_009411218.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    163   1e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003529226.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    163   1e-42   Glycine max [soybeans]
ref|NP_974105.1|  alpha,alpha-trehalose-phosphate synthase [UDP-f...    163   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004505467.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    163   1e-42   Cicer arietinum [garbanzo]
gb|KJB30625.1|  hypothetical protein B456_005G152400                    163   1e-42   Gossypium raimondii
ref|XP_010415412.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    162   1e-42   Camelina sativa [gold-of-pleasure]
ref|XP_006300724.1|  hypothetical protein CARUB_v10019781mg             162   2e-42   Capsella rubella
gb|KDO77921.1|  hypothetical protein CISIN_1g003025mg                   161   2e-42   Citrus sinensis [apfelsine]
ref|XP_008225229.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    162   2e-42   Prunus mume [ume]
ref|XP_006467609.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    161   4e-42   Citrus sinensis [apfelsine]
ref|XP_006449548.1|  hypothetical protein CICLE_v10014248mg             161   4e-42   
ref|XP_003540002.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    161   4e-42   Glycine max [soybeans]
ref|XP_008381189.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    161   4e-42   
ref|XP_011070555.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    161   5e-42   Sesamum indicum [beniseed]
ref|XP_006843713.1|  hypothetical protein AMTR_s00007p00214170          160   6e-42   Amborella trichopoda
ref|XP_009416430.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    160   7e-42   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK41224.1|  hypothetical protein AALP_AA2G101500                    160   9e-42   Arabis alpina [alpine rockcress]
gb|KHN15462.1|  Alpha,alpha-trehalose-phosphate synthase [UDP-for...    160   1e-41   Glycine soja [wild soybean]
gb|ACJ61506.1|  trehalose-6-phosphate synthase                          160   1e-41   Glycine max [soybeans]
ref|XP_010522084.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    159   2e-41   Tarenaya hassleriana [spider flower]
ref|XP_008228949.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    159   2e-41   Prunus mume [ume]
ref|XP_010276900.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    159   2e-41   Nelumbo nucifera [Indian lotus]
emb|CDY04199.1|  BnaC06g26160D                                          159   2e-41   
ref|XP_011082978.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    159   3e-41   Sesamum indicum [beniseed]
ref|XP_009409100.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    159   3e-41   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY07404.1|  BnaA07g24830D                                          159   3e-41   Brassica napus [oilseed rape]
ref|XP_002888643.1|  predicted protein                                  159   3e-41   Arabidopsis lyrata subsp. lyrata
gb|ACA62945.1|  trehalose-6-phosphate synthase                          159   4e-41   Zostera marina
ref|XP_006417924.1|  hypothetical protein EUTSA_v10006783mg             158   6e-41   Eutrema salsugineum [saltwater cress]
ref|XP_009365280.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    158   6e-41   
gb|KHG14143.1|  Alpha,alpha-trehalose-phosphate synthase [UDP-for...    158   6e-41   Gossypium arboreum [tree cotton]
emb|CAN71202.1|  hypothetical protein VITISV_006369                     157   7e-41   Vitis vinifera
gb|EPS71188.1|  hypothetical protein M569_03569                         158   8e-41   Genlisea aurea
gb|EPS68578.1|  hypothetical protein M569_06190                         157   1e-40   Genlisea aurea
ref|XP_007214959.1|  hypothetical protein PRUPE_ppa001387mg             157   1e-40   Prunus persica
gb|KHG01704.1|  putative alpha,alpha-trehalose-phosphate synthase...    157   2e-40   Gossypium arboreum [tree cotton]
ref|XP_010556235.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    156   3e-40   
gb|KEH40650.1|  trehalose-6-phosphate synthase domain protein           156   4e-40   Medicago truncatula
ref|XP_009628927.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    155   4e-40   Nicotiana tomentosiformis
ref|XP_009782523.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    155   5e-40   Nicotiana sylvestris
ref|XP_008775639.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    155   5e-40   Phoenix dactylifera
gb|AEQ54916.1|  trehalose-6-phosphate synthase                          155   6e-40   Salvia miltiorrhiza [Chinese salvia]
gb|EYU37347.1|  hypothetical protein MIMGU_mgv1a001197mg                155   7e-40   Erythranthe guttata [common monkey flower]
emb|CBI26812.3|  unnamed protein product                                154   7e-40   Vitis vinifera
ref|XP_010916234.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    155   7e-40   Elaeis guineensis
ref|XP_007132825.1|  hypothetical protein PHAVU_011G127700g             154   2e-39   Phaseolus vulgaris [French bean]
ref|XP_010531642.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    153   3e-39   Tarenaya hassleriana [spider flower]
ref|XP_004248198.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    153   3e-39   Solanum lycopersicum
gb|EYU30761.1|  hypothetical protein MIMGU_mgv1a001183mg                153   3e-39   Erythranthe guttata [common monkey flower]
gb|ACA62946.1|  trehalose-6-phosphate synthase                          153   4e-39   Zostera marina
ref|XP_009415178.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    153   4e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006364095.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    153   4e-39   Solanum tuberosum [potatoes]
gb|ACD56625.1|  trehalose synthase/phosphatase-like protein             153   7e-39   Gossypium raimondii
emb|CDY01487.1|  BnaC07g34770D                                          152   1e-38   
ref|XP_010916659.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    151   1e-38   Elaeis guineensis
ref|XP_003527335.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    151   2e-38   Glycine max [soybeans]
ref|XP_009105068.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    150   2e-38   Brassica rapa
ref|XP_009595385.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    150   5e-38   Nicotiana tomentosiformis
ref|XP_009768217.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    149   6e-38   Nicotiana sylvestris
gb|ADN34028.1|  trehalose-6-phosphate synthase                          148   2e-37   Cucumis melo subsp. melo
gb|EYU30144.1|  hypothetical protein MIMGU_mgv1a001255mg                148   2e-37   Erythranthe guttata [common monkey flower]
ref|XP_010926098.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    148   2e-37   
ref|XP_006348895.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    147   4e-37   Solanum tuberosum [potatoes]
ref|XP_004243268.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    147   5e-37   Solanum lycopersicum
gb|AAL91978.1|AF483209_1  putative trehalose synthase                   147   5e-37   Solanum tuberosum [potatoes]
ref|NP_172129.1|  putative alpha,alpha-trehalose-phosphate syntha...    146   1e-36   Arabidopsis thaliana [mouse-ear cress]
gb|KHG20430.1|  putative alpha,alpha-trehalose-phosphate synthase...    145   1e-36   Gossypium arboreum [tree cotton]
ref|XP_008348581.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    145   2e-36   
ref|XP_007153210.1|  hypothetical protein PHAVU_003G016300g             145   2e-36   Phaseolus vulgaris [French bean]
ref|XP_004498234.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    145   2e-36   Cicer arietinum [garbanzo]
ref|XP_002889602.1|  hypothetical protein ARALYDRAFT_470660             145   2e-36   
ref|XP_007153644.1|  hypothetical protein PHAVU_003G053000g             145   3e-36   Phaseolus vulgaris [French bean]
ref|XP_003568093.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    144   5e-36   Brachypodium distachyon [annual false brome]
tpg|DAA57653.1|  TPA: putative trehalose phosphatase/synthase fam...    144   5e-36   
ref|XP_011070304.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    144   6e-36   Sesamum indicum [beniseed]
ref|XP_009365279.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    144   7e-36   
ref|XP_010475368.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    144   7e-36   Camelina sativa [gold-of-pleasure]
ref|XP_006306755.1|  hypothetical protein CARUB_v10008292mg             144   7e-36   Capsella rubella
ref|XP_010486072.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    143   9e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010268366.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    143   9e-36   Nelumbo nucifera [Indian lotus]
ref|XP_004509840.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    143   1e-35   Cicer arietinum [garbanzo]
ref|XP_004969834.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    143   1e-35   Setaria italica
ref|XP_003532016.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    143   1e-35   Glycine max [soybeans]
gb|KDO53157.1|  hypothetical protein CISIN_1g002958mg                   142   1e-35   Citrus sinensis [apfelsine]
ref|XP_006654654.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    143   2e-35   
ref|XP_010932535.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    142   2e-35   Elaeis guineensis
ref|XP_003552011.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    142   2e-35   Glycine max [soybeans]
gb|KHN24134.1|  Putative alpha,alpha-trehalose-phosphate synthase...    142   2e-35   Glycine soja [wild soybean]
gb|KHN10606.1|  Putative alpha,alpha-trehalose-phosphate synthase...    142   3e-35   Glycine soja [wild soybean]
ref|XP_010924709.1|  PREDICTED: LOW QUALITY PROTEIN: probable alp...    141   6e-35   
dbj|BAJ87235.1|  predicted protein                                      141   8e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACI62866.1|  trehalose 6-phosphate synthase                          141   8e-35   Gossypium arboreum [tree cotton]
tpg|DAA57651.1|  TPA: putative trehalose phosphatase/synthase fam...    141   8e-35   
ref|XP_002458490.1|  hypothetical protein SORBIDRAFT_03g034640          140   9e-35   Sorghum bicolor [broomcorn]
gb|KJB31282.1|  hypothetical protein B456_005G183800                    139   1e-34   Gossypium raimondii
ref|XP_008789265.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    139   2e-34   
ref|XP_004305452.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    139   2e-34   Fragaria vesca subsp. vesca
ref|XP_008789260.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    139   2e-34   Phoenix dactylifera
gb|KJB31285.1|  hypothetical protein B456_005G183800                    138   2e-34   Gossypium raimondii
emb|CDY10196.1|  BnaC05g04390D                                          136   2e-34   Brassica napus [oilseed rape]
ref|XP_003578837.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    139   3e-34   Brachypodium distachyon [annual false brome]
gb|AEB53179.1|  trehalose-6-phosphate synthase 3                        139   3e-34   Oryza sativa Indica Group [Indian rice]
gb|EAZ13427.1|  hypothetical protein OsJ_03344                          139   3e-34   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044141.1|  Os01g0730300                                       139   3e-34   
gb|KJB31283.1|  hypothetical protein B456_005G183800                    139   3e-34   Gossypium raimondii
emb|CDX86523.1|  BnaC08g01800D                                          139   4e-34   
ref|XP_008812813.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    139   4e-34   
ref|XP_009110992.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    139   4e-34   Brassica rapa
emb|CDY15577.1|  BnaA08g28610D                                          139   4e-34   Brassica napus [oilseed rape]
ref|XP_002521023.1|  trehalose-6-phosphate synthase, putative           139   4e-34   Ricinus communis
ref|XP_008446229.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    139   4e-34   Cucumis melo [Oriental melon]
ref|XP_010542724.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    138   5e-34   Tarenaya hassleriana [spider flower]
gb|KJB31284.1|  hypothetical protein B456_005G183800                    138   6e-34   Gossypium raimondii
ref|XP_004969951.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    138   8e-34   Setaria italica
emb|CDM84185.1|  unnamed protein product                                138   1e-33   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002989114.1|  trehalose phosphate synthase                       138   1e-33   Selaginella moellendorffii
ref|XP_002440081.1|  hypothetical protein SORBIDRAFT_09g025660          137   1e-33   Sorghum bicolor [broomcorn]
ref|XP_003569812.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    137   2e-33   Brachypodium distachyon [annual false brome]
ref|NP_001056050.1|  Os05g0517200                                       137   2e-33   
dbj|BAJ94864.1|  predicted protein                                      137   2e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002963442.1|  trehalose phosphate synthase                       136   3e-33   Selaginella moellendorffii
gb|AAV65494.1|  trehalose 6-phosphate synthase                          136   4e-33   Gossypium hirsutum [American cotton]
ref|XP_006826657.1|  hypothetical protein AMTR_s00137p00018220          136   4e-33   
ref|NP_001288502.1|  uncharacterized protein LOC103636651               135   6e-33   Zea mays [maize]
ref|XP_007044571.1|  Trehalose-phosphatase/synthase 9                   135   8e-33   
gb|KDP21328.1|  hypothetical protein JCGZ_21799                         135   1e-32   
ref|XP_006644707.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    135   1e-32   
emb|CDY06638.1|  BnaA10g04170D                                          131   1e-32   
dbj|BAJ94322.1|  predicted protein                                      134   2e-32   
gb|EEC71477.1|  hypothetical protein OsI_03737                          134   2e-32   
gb|AEB53178.1|  trehalose-6-phosphate synthase 2                        134   2e-32   
ref|NP_001044248.1|  Os01g0749400                                       134   2e-32   
gb|KDP31124.1|  hypothetical protein JCGZ_11500                         134   2e-32   
ref|XP_002983300.1|  trehalose phosphate synthase                       134   3e-32   
ref|XP_008792314.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    134   3e-32   
ref|XP_007225259.1|  hypothetical protein PRUPE_ppa001556mg             133   3e-32   
ref|XP_010682587.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    133   3e-32   
ref|XP_004135234.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    133   4e-32   
ref|XP_002322159.2|  glycosyl transferase family 20 family protein      132   7e-32   
gb|EMT15117.1|  Putative alpha,alpha-trehalose-phosphate synthase...    132   9e-32   
ref|XP_002456290.1|  hypothetical protein SORBIDRAFT_03g033590          132   1e-31   
emb|CBI32507.3|  unnamed protein product                                129   2e-31   
ref|XP_002511428.1|  trehalose-6-phosphate synthase, putative           131   2e-31   
ref|XP_002318643.1|  glycosyl transferase family 20 family protein      131   2e-31   
ref|XP_006340112.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    131   2e-31   
gb|EYU34289.1|  hypothetical protein MIMGU_mgv1a0016701mg               128   3e-31   
gb|AAV65495.1|  trehalose 6-phosphate synthase                          130   3e-31   
emb|CBI30721.3|  unnamed protein product                                130   3e-31   
ref|NP_001061805.1|  Os08g0414700                                       130   4e-31   
ref|XP_010917511.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    130   4e-31   
ref|XP_010251315.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    130   5e-31   
gb|EEE64369.1|  hypothetical protein OsJ_19211                          130   5e-31   
gb|EEE68684.1|  hypothetical protein OsJ_27312                          130   6e-31   
ref|XP_010511782.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    129   9e-31   
ref|XP_011044324.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    129   1e-30   
ref|XP_009785713.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    129   1e-30   
gb|ACJ86290.1|  unknown                                                 121   1e-30   
ref|XP_007036167.1|  Trehalose-phosphatase/synthase 9 isoform 2         128   2e-30   
ref|XP_007036166.1|  Trehalose-phosphatase/synthase 9 isoform 1         128   2e-30   
ref|XP_009605902.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    128   2e-30   
ref|XP_006659396.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    128   2e-30   
ref|XP_004297647.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    128   2e-30   
ref|XP_008353109.1|  PREDICTED: LOW QUALITY PROTEIN: probable alp...    124   2e-30   
ref|XP_010278047.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    128   3e-30   
ref|XP_010100492.1|  putative alpha,alpha-trehalose-phosphate syn...    128   3e-30   
ref|XP_011028589.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    128   3e-30   
ref|XP_010268369.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    127   3e-30   
ref|XP_004237260.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    127   5e-30   
gb|EEC83577.1|  hypothetical protein OsI_29236                          127   8e-30   
gb|EEC79533.1|  hypothetical protein OsI_20637                          126   9e-30   
gb|EPS59044.1|  hypothetical protein M569_15766                         126   1e-29   
gb|AJO70169.1|  alpha,alpha-trehalose-phosphate synthase 10             126   1e-29   
ref|XP_010102124.1|  putative alpha,alpha-trehalose-phosphate syn...    125   1e-29   
emb|CAN78769.1|  hypothetical protein VITISV_024248                     125   2e-29   
ref|XP_002264873.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    125   2e-29   
ref|XP_010547901.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    125   3e-29   
ref|XP_011079327.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    125   3e-29   
emb|CDP02920.1|  unnamed protein product                                125   3e-29   
gb|KCW87490.1|  hypothetical protein EUGRSUZ_B03950                     124   4e-29   
gb|AIN39848.1|  hypothetical protein                                    124   4e-29   
ref|XP_006306746.1|  hypothetical protein CARUB_v10008281mg             124   4e-29   
ref|XP_010271971.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    124   4e-29   
ref|XP_010045326.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    124   4e-29   
gb|KEH19955.1|  trehalose-6-phosphate synthase domain protein           124   5e-29   
gb|EYU29720.1|  hypothetical protein MIMGU_mgv1a001271mg                124   5e-29   
emb|CDP00187.1|  unnamed protein product                                124   7e-29   
ref|XP_006416048.1|  hypothetical protein EUTSA_v10006773mg             124   8e-29   
ref|XP_008781991.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    124   9e-29   
ref|XP_009768810.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    123   9e-29   
ref|XP_008340008.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    123   1e-28   
ref|XP_010913569.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    123   1e-28   
ref|XP_009615328.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    122   1e-28   
ref|XP_006392184.1|  hypothetical protein EUTSA_v10023265mg             122   3e-28   
ref|XP_008678555.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    122   3e-28   
ref|XP_004238680.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    122   3e-28   
ref|XP_008793857.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    122   3e-28   
ref|NP_001288476.1|  uncharacterized protein LOC103651208               122   4e-28   
ref|XP_009615327.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    122   4e-28   
ref|XP_007154820.1|  hypothetical protein PHAVU_003G150400g             121   6e-28   
gb|KHN34483.1|  Putative alpha,alpha-trehalose-phosphate synthase...    121   6e-28   
emb|CDY57320.1|  BnaA08g20280D                                          121   7e-28   
ref|XP_002283215.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    121   7e-28   
ref|XP_002890598.1|  hypothetical protein ARALYDRAFT_889930             120   8e-28   
ref|NP_173799.1|  putative alpha,alpha-trehalose-phosphate syntha...    120   9e-28   
ref|XP_007157471.1|  hypothetical protein PHAVU_002G072400g             120   9e-28   
gb|KFK40813.1|  trehalose-phosphate synthase                            120   9e-28   
ref|XP_010477691.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    120   9e-28   
ref|XP_009414014.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    120   9e-28   
tpg|DAA44158.1|  TPA: putative trehalose phosphatase/synthase fam...    120   1e-27   
ref|XP_011069859.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    120   1e-27   
ref|XP_009119065.1|  PREDICTED: LOW QUALITY PROTEIN: probable alp...    120   1e-27   
ref|XP_008664697.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    120   1e-27   
ref|XP_010928594.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    120   1e-27   
ref|XP_009783894.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    120   1e-27   
ref|XP_003519705.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    120   2e-27   
ref|XP_009391422.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    120   2e-27   
ref|XP_002445486.1|  hypothetical protein SORBIDRAFT_07g020270          120   2e-27   
ref|XP_009110077.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    119   2e-27   
ref|NP_176221.1|  putative alpha,alpha-trehalose-phosphate syntha...    119   2e-27   
dbj|BAF01061.1|  putative trehalose-6-phosphate synthase                119   2e-27   
ref|XP_009604621.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    119   3e-27   
gb|ADA67991.1|  trehalose-6-phosphate synthase                          119   3e-27   
gb|EMT14980.1|  Putative alpha,alpha-trehalose-phosphate synthase...    119   3e-27   
ref|XP_004973426.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    119   4e-27   
ref|XP_004973427.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    119   4e-27   
ref|XP_003578083.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    118   5e-27   
ref|XP_006300393.1|  hypothetical protein CARUB_v10019782mg             118   6e-27   
ref|XP_006573047.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    118   7e-27   
ref|XP_010460163.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    118   8e-27   
gb|KDO69720.1|  hypothetical protein CISIN_1g045882mg                   118   8e-27   
ref|XP_006476751.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    118   8e-27   
ref|XP_006439780.1|  hypothetical protein CICLE_v10018842mg             118   9e-27   
emb|CBI22022.3|  unnamed protein product                                117   1e-26   
ref|XP_006578621.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    117   1e-26   
ref|XP_002886635.1|  ATTPS10                                            117   2e-26   
ref|XP_003527027.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    117   2e-26   
gb|AGD98700.1|  trehalose-6-phosphate synthase                          117   2e-26   
ref|XP_010028137.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    117   2e-26   
ref|XP_008223545.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    117   2e-26   
ref|XP_010533498.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    116   3e-26   
emb|CDY62994.1|  BnaCnng41250D                                          116   3e-26   
ref|XP_010417957.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    116   3e-26   
ref|XP_010473203.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    116   3e-26   
gb|KJB08196.1|  hypothetical protein B456_001G070500                    116   4e-26   
gb|EYU42464.1|  hypothetical protein MIMGU_mgv1a001200mg                116   4e-26   
gb|KJB08195.1|  hypothetical protein B456_001G070500                    116   4e-26   
emb|CDO96859.1|  unnamed protein product                                115   5e-26   
gb|KHN17551.1|  Putative alpha,alpha-trehalose-phosphate synthase...    115   5e-26   
ref|XP_011086535.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    115   6e-26   
ref|XP_010498895.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    115   6e-26   
ref|XP_010510971.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    115   6e-26   
ref|XP_004498235.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    115   7e-26   
ref|XP_006355973.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    115   1e-25   
ref|XP_010471024.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    114   1e-25   
ref|XP_009417681.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    114   1e-25   
gb|EEC71425.1|  hypothetical protein OsI_03616                          114   2e-25   
ref|NP_177186.2|  putative alpha,alpha-trehalose-phosphate syntha...    114   2e-25   
ref|XP_007227009.1|  hypothetical protein PRUPE_ppa001301mg             114   3e-25   
ref|XP_010415706.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    114   3e-25   
ref|XP_004298929.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    114   3e-25   
emb|CBH32509.1|  trehalose synthase, putative, expressed                114   3e-25   
ref|XP_006390900.1|  hypothetical protein EUTSA_v10018114mg             113   3e-25   
ref|XP_010427800.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    113   3e-25   
ref|XP_009391250.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    113   4e-25   
gb|EYU22478.1|  hypothetical protein MIMGU_mgv1a001235mg                113   4e-25   
ref|XP_007225309.1|  hypothetical protein PRUPE_ppa001295mg             113   4e-25   
ref|XP_003574481.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    112   7e-25   
tpg|DAA61345.1|  TPA: putative trehalose phosphatase/synthase fam...    112   7e-25   
dbj|BAJ97342.1|  predicted protein                                      112   9e-25   
ref|XP_002465620.1|  hypothetical protein SORBIDRAFT_01g042380          111   2e-24   
ref|XP_008374461.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    111   2e-24   
tpg|DAA61344.1|  TPA: putative trehalose phosphatase/synthase fam...    111   2e-24   
emb|CDP15959.1|  unnamed protein product                                110   2e-24   
gb|KDO82521.1|  hypothetical protein CISIN_1g002979mg                   110   3e-24   
gb|KDO82516.1|  hypothetical protein CISIN_1g002979mg                   110   4e-24   
ref|XP_002460185.1|  hypothetical protein SORBIDRAFT_02g024140          110   4e-24   
emb|CDY31598.1|  BnaA03g54540D                                          110   5e-24   
ref|XP_009138560.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    110   5e-24   
ref|XP_006438435.1|  hypothetical protein CICLE_v10030691mg             110   5e-24   
ref|XP_007210899.1|  hypothetical protein PRUPE_ppa001397mg             109   7e-24   
ref|XP_009103647.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    109   7e-24   
emb|CDY24516.1|  BnaA01g22200D                                          109   7e-24   
gb|EPS67351.1|  hypothetical protein M569_07419                         109   7e-24   
ref|XP_008221778.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    108   1e-23   
ref|XP_011071074.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    108   3e-23   
ref|XP_001766049.1|  predicted protein                                  107   4e-23   
ref|XP_010107455.1|  putative alpha,alpha-trehalose-phosphate syn...    107   4e-23   
gb|ABO61744.1|  trehalose-phosphate synthase 5                          107   5e-23   
ref|XP_004501945.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    107   5e-23   
gb|AAN52740.1|  Putative trehalose-6-phosphate synthase                 107   5e-23   
gb|EEC74792.1|  hypothetical protein OsI_10580                          107   5e-23   
emb|CDY54952.1|  BnaC01g43070D                                          107   5e-23   
gb|AEO13239.1|  trehalose-6-phosphate synthase                          107   5e-23   
ref|NP_001063104.1|  Os09g0397300                                       107   6e-23   
ref|XP_007155406.1|  hypothetical protein PHAVU_003G198800g             107   6e-23   
ref|XP_010913570.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    106   1e-22   
ref|XP_003525494.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    106   1e-22   
ref|XP_009363520.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    105   1e-22   
ref|XP_002888764.1|  hypothetical protein ARALYDRAFT_894829             105   1e-22   
ref|XP_006660589.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    105   1e-22   
emb|CDX91726.1|  BnaC08g06450D                                          105   2e-22   
ref|XP_008389621.1|  PREDICTED: LOW QUALITY PROTEIN: probable alp...    105   2e-22   
ref|XP_004138116.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    105   2e-22   
ref|XP_004166499.1|  PREDICTED: LOW QUALITY PROTEIN: probable alp...    105   3e-22   
ref|XP_008239739.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    105   3e-22   
ref|XP_004985151.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    103   7e-22   
ref|XP_007138100.1|  hypothetical protein PHAVU_009G180300g             103   1e-21   
ref|XP_008453107.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    103   1e-21   
ref|XP_001765959.1|  trehalose-6-phosphate synthase                     102   2e-21   
ref|XP_010457769.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    102   2e-21   
ref|XP_009127784.1|  PREDICTED: LOW QUALITY PROTEIN: probable alp...    101   4e-21   
gb|AEB53185.1|  trehalose-6-phosphate synthase 10                       101   5e-21   
gb|EEC84539.1|  hypothetical protein OsI_31278                          101   5e-21   
ref|NP_001063045.1|  Os09g0376800                                     98.6    2e-20   
ref|XP_010678736.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  99.8    2e-20   
ref|XP_006844250.1|  hypothetical protein AMTR_s00006p00269110        99.4    3e-20   
emb|CBI15059.3|  unnamed protein product                              98.6    3e-20   
ref|XP_010913571.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  99.0    3e-20   
ref|XP_010228946.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...  98.6    3e-20   
emb|CBI32125.3|  unnamed protein product                              98.2    4e-20   
ref|XP_006581930.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  99.0    4e-20   
tpg|DAA61259.1|  TPA: putative trehalose phosphatase/synthase fam...  94.0    4e-20   
gb|EMT31860.1|  Alpha,alpha-trehalose-phosphate synthase (UDP-for...  98.6    4e-20   
ref|XP_003558453.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...  98.6    5e-20   
gb|EEC84489.1|  hypothetical protein OsI_31155                        98.2    5e-20   
ref|XP_004309955.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  98.2    6e-20   
gb|AEB53186.1|  trehalose-6-phosphate synthase 11                     98.2    6e-20   
ref|XP_002462305.1|  hypothetical protein SORBIDRAFT_02g023610        98.2    7e-20   
ref|XP_006453464.1|  hypothetical protein CICLE_v10007428mg           97.4    9e-20   
ref|XP_010687711.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  97.8    1e-19   
ref|XP_006453465.1|  hypothetical protein CICLE_v10007428mg           97.4    1e-19   
ref|XP_008781992.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  96.7    2e-19   
ref|XP_004956710.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  96.7    2e-19   
ref|XP_011010033.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  96.3    2e-19   
gb|KDO62387.1|  hypothetical protein CISIN_1g003042mg                 95.9    3e-19   
gb|KDO62386.1|  hypothetical protein CISIN_1g003042mg                 95.9    3e-19   
ref|XP_002884153.1|  predicted protein                                95.9    4e-19   
ref|NP_179460.1|  putative alpha,alpha-trehalose-phosphate syntha...  95.9    4e-19   
gb|KDO62385.1|  hypothetical protein CISIN_1g003042mg                 95.9    4e-19   
ref|XP_006651181.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...  95.5    5e-19   
ref|XP_008779630.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  95.1    7e-19   
ref|XP_009625114.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  94.7    9e-19   
ref|XP_004956711.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  94.7    9e-19   
ref|XP_010489579.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  94.7    1e-18   
ref|XP_008393046.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  94.4    1e-18   



>ref|XP_009606207.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Nicotiana tomentosiformis]
 ref|XP_009606214.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Nicotiana tomentosiformis]
Length=862

 Score =   255 bits (651),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 128/141 (91%), Positives = 133/141 (94%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDL SG+S TFGR G+KLSRVATVAGVLSELDDE+RSN  SD PSSISQER
Sbjct  1    MVSRSYSNLLDLTSGDSPTFGRGGRKLSRVATVAGVLSELDDENRSNA-SDAPSSISQER  59

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEE IDP+E
Sbjct  60   MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEE-IDPSE  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA TLLETFKCVPAF+PP
Sbjct  119  QDDVALTLLETFKCVPAFIPP  139



>ref|XP_009788524.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Nicotiana sylvestris]
 ref|XP_009788525.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Nicotiana sylvestris]
 ref|XP_009788526.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Nicotiana sylvestris]
Length=862

 Score =   253 bits (645),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 134/141 (95%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDL SG+S TFGR+G+KLSRVATVAGVLSELDDE+RSN  SD PSSISQER
Sbjct  1    MVSRSYSNLLDLTSGDSPTFGRSGRKLSRVATVAGVLSELDDENRSNA-SDAPSSISQER  59

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPLRA+RRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIY+GCLKEE IDP+E
Sbjct  60   MIIVGNQLPLRAYRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYIGCLKEE-IDPSE  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA TLLETFKCVPAF+PP
Sbjct  119  QDDVAQTLLETFKCVPAFIPP  139



>ref|XP_006352881.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Solanum tuberosum]
 ref|XP_006352882.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X2 [Solanum tuberosum]
Length=862

 Score =   248 bits (633),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 131/141 (93%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDL SG+S TFGR G+KLSRVATVAGVLSELDDESRSN  SD PSS++QER
Sbjct  1    MVSRSYSNLLDLTSGDSPTFGRGGRKLSRVATVAGVLSELDDESRSNA-SDAPSSVTQER  59

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPLRAHRR DGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVG LKEE IDP++
Sbjct  60   MIIVGNQLPLRAHRRKDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGSLKEE-IDPSQ  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA TLLETFKCVPAF+PP
Sbjct  119  QDDVAQTLLETFKCVPAFIPP  139



>ref|XP_004245918.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Solanum lycopersicum]
 ref|XP_010325563.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Solanum lycopersicum]
Length=862

 Score =   244 bits (624),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 123/141 (87%), Positives = 130/141 (92%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDL S +S TFGR G+KLSRVATVAGVLSELDDESRSN  SD PSS++QER
Sbjct  1    MVSRSYSNLLDLISDDSPTFGRGGRKLSRVATVAGVLSELDDESRSNA-SDAPSSVTQER  59

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPLRAHRR DGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVG LKEE IDP++
Sbjct  60   MIIVGNQLPLRAHRRQDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGSLKEE-IDPSQ  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA TLLETFKCVPAF+PP
Sbjct  119  QDDVAQTLLETFKCVPAFIPP  139



>ref|XP_011070302.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 isoform X1 [Sesamum indicum]
 ref|XP_011070303.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 isoform X1 [Sesamum indicum]
Length=864

 Score =   237 bits (605),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 129/141 (91%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDL SG S TF R GKK  RVATVAGVLS+LDDE+RSNGGSD PSSISQER
Sbjct  1    MVSRSYSNLLDLTSGGSPTFSRGGKKFPRVATVAGVLSDLDDENRSNGGSDAPSSISQER  60

Query  351  MIIVGNQLPLRAHRR-TDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  527
            MIIVGNQLPLRAHRR +DG++GW+FSWDEDSLLLQLKDGLGEDVEVIYVGCLKEE ID +
Sbjct  61   MIIVGNQLPLRAHRRESDGDKGWDFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEE-IDVS  119

Query  528  EQDDVAXTLLETFKCVPAFVP  590
            EQ+DVA TLLETFKCVPAF+P
Sbjct  120  EQEDVAQTLLETFKCVPAFIP  140



>ref|XP_010245191.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Nelumbo nucifera]
 ref|XP_010245192.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Nelumbo nucifera]
 ref|XP_010245193.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Nelumbo nucifera]
 ref|XP_010245194.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Nelumbo nucifera]
Length=856

 Score =   234 bits (597),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 129/141 (91%), Gaps = 1/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLL+LASG+S TFG+ GK+L RV TVAG++SELDDE+ ++  SD PSS++QER
Sbjct  1    MVSRSYSNLLELASGDSPTFGKVGKRLPRVMTVAGIISELDDENSNSASSDAPSSVTQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIVGNQLP+RAHRR+DG+ GWNFSWDEDSLLLQLKDGLGEDVEVIY+GCL+EE IDP+E
Sbjct  61   IIIVGNQLPIRAHRRSDGDGGWNFSWDEDSLLLQLKDGLGEDVEVIYIGCLREE-IDPSE  119

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA TLLETFKCVP F+PP
Sbjct  120  QDDVAQTLLETFKCVPTFIPP  140



>ref|XP_002277503.2| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Vitis vinifera]
 ref|XP_010663329.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Vitis vinifera]
 ref|XP_010663335.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Vitis vinifera]
Length=864

 Score =   231 bits (589),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 127/141 (90%), Gaps = 1/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDL SG+S TFGR GKK+SRVATVAGVLSELDDE+ ++  SD PSS+SQ+R
Sbjct  1    MVSRSYSNLLDLVSGDSPTFGRGGKKISRVATVAGVLSELDDETSNSVTSDAPSSVSQDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPLRAHR +DG   W FSWDEDSLLLQLKDGLGEDVEV+YVGCL+E+ IDP+E
Sbjct  61   MIIVGNQLPLRAHRSSDGSGEWCFSWDEDSLLLQLKDGLGEDVEVLYVGCLREQ-IDPSE  119

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA TLLETFKCVPAF+PP
Sbjct  120  QDDVAQTLLETFKCVPAFIPP  140



>emb|CAN61971.1| hypothetical protein VITISV_016593 [Vitis vinifera]
Length=859

 Score =   231 bits (589),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 127/141 (90%), Gaps = 1/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDL SG+S TFGR GKK+SRVATVAGVLSELDDE+ ++  SD PSS+SQ+R
Sbjct  1    MVSRSYSNLLDLVSGDSPTFGRGGKKISRVATVAGVLSELDDETSNSVTSDAPSSVSQDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPLRAHR +DG   W FSWDEDSLLLQLKDGLGEDVEV+YVGCL+E+ IDP+E
Sbjct  61   MIIVGNQLPLRAHRSSDGSGEWCFSWDEDSLLLQLKDGLGEDVEVLYVGCLREQ-IDPSE  119

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA TLLETFKCVPAF+PP
Sbjct  120  QDDVAQTLLETFKCVPAFIPP  140



>ref|XP_002527658.1| trehalose-6-phosphate synthase, putative [Ricinus communis]
 gb|EEF34729.1| trehalose-6-phosphate synthase, putative [Ricinus communis]
Length=814

 Score =   230 bits (586),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 124/141 (88%), Gaps = 1/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDL SG   TFGR  K+L RVATVAGVLSELDDE+ ++ GSD PSS+SQER
Sbjct  1    MVSRSYSNLLDLTSGGIPTFGREKKRLPRVATVAGVLSELDDENSNSVGSDAPSSVSQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPLRAHR  DG E W FSWDEDSLLLQLKDGLGED+EVIYVGCLKEE IDP+E
Sbjct  61   MIIVGNQLPLRAHRSPDGSEEWCFSWDEDSLLLQLKDGLGEDLEVIYVGCLKEE-IDPSE  119

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA TLLETFKCVPAF+PP
Sbjct  120  QDDVAQTLLETFKCVPAFIPP  140



>ref|XP_007210367.1| hypothetical protein PRUPE_ppa001305mg [Prunus persica]
 gb|EMJ11566.1| hypothetical protein PRUPE_ppa001305mg [Prunus persica]
Length=858

 Score =   227 bits (579),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 126/141 (89%), Gaps = 3/141 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDL SG+S TFGR  K+  RVATVAGVLSELDD++ ++ GSD PSSI+QER
Sbjct  1    MVSRSYSNLLDLTSGDSPTFGREKKRFPRVATVAGVLSELDDDNSNSVGSDAPSSIAQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLP+RAHRR DGE  W FSWDEDSLLLQLKDGLGEDVEV+Y+GCLKEE IDP+E
Sbjct  61   MIIVGNQLPIRAHRRDDGE--WYFSWDEDSLLLQLKDGLGEDVEVVYIGCLKEE-IDPSE  117

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA TLL+TFKCVPAF+PP
Sbjct  118  QDDVAQTLLDTFKCVPAFLPP  138



>ref|XP_004300232.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Fragaria vesca subsp. vesca]
Length=861

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 126/142 (89%), Gaps = 4/142 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNG-GSDVPSSISQE  347
            MVSRSYSNLLDL SG+SLTFGR  K+  RVATVAGVLSELDD++ +N  GSD PSSISQ+
Sbjct  1    MVSRSYSNLLDLTSGDSLTFGREKKRFPRVATVAGVLSELDDDASNNSVGSDAPSSISQD  60

Query  348  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  527
            RMIIVGNQLPLRAHR  DGE  W FSWDEDSLLLQLKDGLGEDVEVIY+GCLKEE IDP+
Sbjct  61   RMIIVGNQLPLRAHRSDDGE--WCFSWDEDSLLLQLKDGLGEDVEVIYIGCLKEE-IDPS  117

Query  528  EQDDVAXTLLETFKCVPAFVPP  593
            EQDDVA TLL+TFKCVPAF+PP
Sbjct  118  EQDDVAQTLLDTFKCVPAFLPP  139



>gb|AJO70167.1| alpha,alpha-trehalose-phosphate synthase 5 [Camellia sinensis]
Length=863

 Score =   225 bits (573),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 126/141 (89%), Gaps = 1/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDL SG S  FGR G+K SRVATVAGVLSELDD++ ++ GSD PSS+SQ+R
Sbjct  1    MVSRSYSNLLDLTSGGSPNFGRGGRKFSRVATVAGVLSELDDDNCNSVGSDAPSSVSQDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIVGNQLPL+AH+ +D + GWNFSWDEDSLLLQLKDGLG+D+EVIYVG LKEE IDP+E
Sbjct  61   IIIVGNQLPLKAHKSSDNDGGWNFSWDEDSLLLQLKDGLGDDLEVIYVGSLKEE-IDPDE  119

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA TLLETFKCVPAF+PP
Sbjct  120  QDDVAQTLLETFKCVPAFIPP  140



>ref|XP_006432795.1| hypothetical protein CICLE_v10000247mg [Citrus clementina]
 gb|ESR46035.1| hypothetical protein CICLE_v10000247mg [Citrus clementina]
Length=757

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 124/141 (88%), Gaps = 1/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDLASG+   F R  K+L RVATVAGVLSE+DDE+ ++ GSD PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGDFPNFSREKKRLPRVATVAGVLSEIDDENSNSVGSDAPSSVSQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPLRAHR +DG  GW FSWDEDSLLLQLKDGLGEDVEVIYVGC+KE+ ID +E
Sbjct  61   MIIVGNQLPLRAHRSSDGSGGWTFSWDEDSLLLQLKDGLGEDVEVIYVGCIKEQ-IDLSE  119

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QD+V+ TLLETFKCVPAF+PP
Sbjct  120  QDEVSQTLLETFKCVPAFIPP  140



>ref|XP_009371197.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Pyrus x bretschneideri]
 ref|XP_009371198.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Pyrus x bretschneideri]
 ref|XP_009371199.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Pyrus x bretschneideri]
Length=860

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 124/141 (88%), Gaps = 3/141 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYS+LLDL S +S TFGR  K+  RVATVAGVLSE DD++ ++ GSD PSSI+QER
Sbjct  1    MVSRSYSSLLDLTSSDSPTFGREKKRFPRVATVAGVLSEFDDDNSNSVGSDAPSSIAQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPLRAHRR DGE  W FSWDEDSLLLQLKDGLGEDVEV+Y+GCLKEE IDP+E
Sbjct  61   MIIVGNQLPLRAHRRDDGE--WYFSWDEDSLLLQLKDGLGEDVEVVYIGCLKEE-IDPSE  117

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA TLL+TFKCVPAF+PP
Sbjct  118  QDDVAQTLLDTFKCVPAFIPP  138



>ref|XP_008238210.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Prunus mume]
Length=858

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 125/141 (89%), Gaps = 3/141 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDL SG+S TFGR  K+  RVATVAGVLSELDD++ ++ GSD PSSI+QER
Sbjct  1    MVSRSYSNLLDLTSGDSPTFGREKKRFPRVATVAGVLSELDDDNSNSVGSDAPSSIAQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLP+RAHRR DGE  W FSWDEDSLLLQLKDGLGEDVEV+Y+GCLKEE ID +E
Sbjct  61   MIIVGNQLPIRAHRRDDGE--WYFSWDEDSLLLQLKDGLGEDVEVVYIGCLKEE-IDLSE  117

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA TLL+TFKCVPAF+PP
Sbjct  118  QDDVAQTLLDTFKCVPAFLPP  138



>ref|XP_006432796.1| hypothetical protein CICLE_v10000247mg [Citrus clementina]
 ref|XP_006432797.1| hypothetical protein CICLE_v10000247mg [Citrus clementina]
 ref|XP_006432798.1| hypothetical protein CICLE_v10000247mg [Citrus clementina]
 ref|XP_006432799.1| hypothetical protein CICLE_v10000247mg [Citrus clementina]
 ref|XP_006471585.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Citrus sinensis]
 ref|XP_006471586.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X2 [Citrus sinensis]
 ref|XP_006471587.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X3 [Citrus sinensis]
 ref|XP_006471588.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X4 [Citrus sinensis]
 ref|XP_006471589.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X5 [Citrus sinensis]
 ref|XP_006471590.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X6 [Citrus sinensis]
 gb|ESR46036.1| hypothetical protein CICLE_v10000247mg [Citrus clementina]
 gb|ESR46037.1| hypothetical protein CICLE_v10000247mg [Citrus clementina]
 gb|ESR46038.1| hypothetical protein CICLE_v10000247mg [Citrus clementina]
 gb|ESR46039.1| hypothetical protein CICLE_v10000247mg [Citrus clementina]
 gb|KDO53149.1| hypothetical protein CISIN_1g002958mg [Citrus sinensis]
 gb|KDO53150.1| hypothetical protein CISIN_1g002958mg [Citrus sinensis]
 gb|KDO53151.1| hypothetical protein CISIN_1g002958mg [Citrus sinensis]
 gb|KDO53152.1| hypothetical protein CISIN_1g002958mg [Citrus sinensis]
 gb|KDO53153.1| hypothetical protein CISIN_1g002958mg [Citrus sinensis]
 gb|KDO53154.1| hypothetical protein CISIN_1g002958mg [Citrus sinensis]
 gb|KDO53155.1| hypothetical protein CISIN_1g002958mg [Citrus sinensis]
 gb|KDO53156.1| hypothetical protein CISIN_1g002958mg [Citrus sinensis]
Length=863

 Score =   223 bits (567),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 124/141 (88%), Gaps = 1/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDLASG+   F R  K+L RVATVAGVLSE+DDE+ ++ GSD PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGDFPNFSREKKRLPRVATVAGVLSEIDDENSNSVGSDAPSSVSQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPLRAHR +DG  GW FSWDEDSLLLQLKDGLGEDVEVIYVGC+KE+ ID +E
Sbjct  61   MIIVGNQLPLRAHRSSDGSGGWTFSWDEDSLLLQLKDGLGEDVEVIYVGCIKEQ-IDLSE  119

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QD+V+ TLLETFKCVPAF+PP
Sbjct  120  QDEVSQTLLETFKCVPAFIPP  140



>gb|EYU33434.1| hypothetical protein MIMGU_mgv1a001209mg [Erythranthe guttata]
Length=866

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 127/144 (88%), Gaps = 4/144 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGE-SLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQE  347
            MVSRSYSNLLDL SG  S TFGR GKK  RVATVAGVLSEL+DE+RSN GS+ PSSISQ+
Sbjct  1    MVSRSYSNLLDLTSGSGSPTFGREGKKFPRVATVAGVLSELEDENRSNLGSETPSSISQD  60

Query  348  RMIIVGNQLPLRAHR--RTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIID  521
            RMIIVGNQLPLRAHR   +DG++ W FSWDEDSLLLQLKDGLG+DV+VIYVGCLKEE ID
Sbjct  61   RMIIVGNQLPLRAHRTESSDGKKHWTFSWDEDSLLLQLKDGLGDDVDVIYVGCLKEE-ID  119

Query  522  PNEQDDVAXTLLETFKCVPAFVPP  593
             +EQ++VA TLLETFKCVPAF+PP
Sbjct  120  LDEQEEVAQTLLETFKCVPAFIPP  143



>ref|XP_009401244.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Musa acuminata subsp. malaccensis]
 ref|XP_009401245.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Musa acuminata subsp. malaccensis]
 ref|XP_009401247.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Musa acuminata subsp. malaccensis]
 ref|XP_009401248.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Musa acuminata subsp. malaccensis]
Length=857

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 124/141 (88%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDLASGE   FGR GKKL RV TVAG++S+LD+E+ ++  SD PSS+SQ+R
Sbjct  1    MVSRSYSNLLDLASGEFPAFGRTGKKLPRVMTVAGIISDLDEENTNSMTSDGPSSVSQDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLP+RAHRR DG +GWNFSWDEDSLLLQLKDGLGEDVEV+Y+GCL+EE IDP E
Sbjct  61   MIIVGNQLPIRAHRRPDG-KGWNFSWDEDSLLLQLKDGLGEDVEVVYIGCLREE-IDPAE  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDV+ TLLETF+CVP F+ P
Sbjct  119  QDDVSQTLLETFRCVPTFLAP  139



>ref|XP_007040645.1| Trehalose phosphatase/synthase 5 isoform 3, partial [Theobroma 
cacao]
 gb|EOY25146.1| Trehalose phosphatase/synthase 5 isoform 3, partial [Theobroma 
cacao]
Length=761

 Score =   218 bits (554),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 123/141 (87%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDLASG+S TFGR  K+  RVATV G+LSE+DD++ ++ GSD PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGDSPTFGREKKRFPRVATVPGLLSEVDDDNCNSVGSDAPSSVSQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPLR+HR  D  E W FSWDEDSLLLQLKDGLGEDV+VIYVGCLKEEI  PNE
Sbjct  61   MIIVGNQLPLRSHRNADDGE-WCFSWDEDSLLLQLKDGLGEDVDVIYVGCLKEEIA-PNE  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA TLLETFKCVPAF+PP
Sbjct  119  QDDVAQTLLETFKCVPAFLPP  139



>ref|XP_007040643.1| Trehalose phosphatase/synthase 5 isoform 1 [Theobroma cacao]
 ref|XP_007040644.1| Trehalose phosphatase/synthase 5 isoform 1 [Theobroma cacao]
 gb|EOY25144.1| Trehalose phosphatase/synthase 5 isoform 1 [Theobroma cacao]
 gb|EOY25145.1| Trehalose phosphatase/synthase 5 isoform 1 [Theobroma cacao]
Length=862

 Score =   218 bits (555),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 123/141 (87%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDLASG+S TFGR  K+  RVATV G+LSE+DD++ ++ GSD PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGDSPTFGREKKRFPRVATVPGLLSEVDDDNCNSVGSDAPSSVSQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPLR+HR  D  E W FSWDEDSLLLQLKDGLGEDV+VIYVGCLKEEI  PNE
Sbjct  61   MIIVGNQLPLRSHRNADDGE-WCFSWDEDSLLLQLKDGLGEDVDVIYVGCLKEEIA-PNE  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA TLLETFKCVPAF+PP
Sbjct  119  QDDVAQTLLETFKCVPAFLPP  139



>ref|XP_002304347.1| glycosyl transferase family 20 family protein [Populus trichocarpa]
 gb|EEE79326.1| glycosyl transferase family 20 family protein [Populus trichocarpa]
Length=861

 Score =   218 bits (555),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 122/141 (87%), Gaps = 3/141 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDLASG++  FGR  K+L RVATVAG+L++LDDE+  +  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGDAPNFGRERKRLPRVATVAGILTDLDDEN--SVSSDAPSSVSQER  58

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPLRAHR  DG  GW FSWDEDSLLLQLKDGLGEDVEVIYVG LKEEI  P+E
Sbjct  59   MIIVGNQLPLRAHRSPDGSGGWCFSWDEDSLLLQLKDGLGEDVEVIYVGSLKEEIA-PSE  117

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA TLLETFKCVPAF+PP
Sbjct  118  QDDVAQTLLETFKCVPAFIPP  138



>gb|KDP26189.1| hypothetical protein JCGZ_22685 [Jatropha curcas]
Length=865

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 121/141 (86%), Gaps = 1/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDLASG+S T  R  K+L RVATVAGVLSELDDE+ ++  SD PSSISQER
Sbjct  1    MVSRSYSNLLDLASGQSPTLSRERKRLPRVATVAGVLSELDDENSNSVSSDAPSSISQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPLRA++  DG   W FSWDEDSLLLQLKDGLGEDVEVIYVGCLKEE ID +E
Sbjct  61   MIIVGNQLPLRAYKSPDGSGEWCFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEE-IDLSE  119

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA  LLE+FKCVPA++PP
Sbjct  120  QDDVAQILLESFKCVPAYIPP  140



>ref|XP_010096957.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 [Morus 
notabilis]
 gb|EXB66534.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 [Morus 
notabilis]
Length=857

 Score =   213 bits (542),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 124/141 (88%), Gaps = 3/141 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDLASG S TFGR  K+L RVATVAGVLSE+DD++ ++ GSD PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGGSPTFGRERKRLPRVATVAGVLSEIDDDNTNSVGSDAPSSVSQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPL+  RR +G+  W+FSWDEDSLLLQLKDGLGED EVIY+GCLKEE ID +E
Sbjct  61   MIIVGNQLPLKVQRRENGD--WDFSWDEDSLLLQLKDGLGEDAEVIYIGCLKEE-IDLDE  117

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA TLL+++KCVPAF+PP
Sbjct  118  QDDVAQTLLDSYKCVPAFLPP  138



>ref|XP_008800104.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Phoenix dactylifera]
 ref|XP_008800105.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Phoenix dactylifera]
 ref|XP_008800106.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Phoenix dactylifera]
 ref|XP_008800107.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Phoenix dactylifera]
 ref|XP_008800109.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Phoenix dactylifera]
 ref|XP_008800110.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Phoenix dactylifera]
 ref|XP_008800111.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Phoenix dactylifera]
Length=859

 Score =   211 bits (537),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 123/141 (87%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDL +G S T+GR GK+L RV TVAG++ +LD+E+ ++ GS+  SS+SQER
Sbjct  1    MVSRSYSNLLDLVTGGSPTYGRLGKRLPRVMTVAGIICDLDEENSNSVGSEALSSVSQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIVGNQLPLRAHRR D + GWNFSWDEDSLLLQLKDGLGEDVEVIY+GCL+EE I+P E
Sbjct  61   VIIVGNQLPLRAHRRPD-DSGWNFSWDEDSLLLQLKDGLGEDVEVIYIGCLREE-IEPGE  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDV+ TLLETFKCVP F+PP
Sbjct  119  QDDVSLTLLETFKCVPTFLPP  139



>gb|KHG14108.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 -like 
protein [Gossypium arboreum]
Length=756

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 121/141 (86%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDLASG+S +FG   K+  RVATV G+LSE+DDE+ ++ GS+ PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGDSPSFGGERKRFPRVATVPGLLSEVDDETCNSVGSEAPSSVSQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPLRAHR  D  + W FSWDEDSLLLQLKDGLGEDVEVIYVGCLKE++   NE
Sbjct  61   MIIVGNQLPLRAHRNEDNGD-WCFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEQVA-LNE  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA TLLETFKCVPAF+PP
Sbjct  119  QDDVAQTLLETFKCVPAFIPP  139



>gb|KHG01348.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 -like 
protein [Gossypium arboreum]
Length=862

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 121/141 (86%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDLA G + T  +  K+  RVATV G+LSE++D++ ++  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLAYGGTPTLSQEKKRFPRVATVPGLLSEVEDDNCNSVSSDAPSSVSQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPLRAH+ TD +EGW FSWDEDSLLLQLKDGLGEDVEVIYVGCLKEE + PNE
Sbjct  61   MIIVGNQLPLRAHQNTD-DEGWCFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEE-VPPNE  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA TLLETFKCVPAF+PP
Sbjct  119  QDDVAQTLLETFKCVPAFLPP  139



>ref|XP_011028149.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X3 [Populus euphratica]
Length=667

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 119/141 (84%), Gaps = 3/141 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDLASG++  FGR  K+L RVATVAG+L++LDDE+  +  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGDAPNFGRERKRLPRVATVAGILTDLDDEN--SVSSDAPSSVSQER  58

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPLRA R   G  GW FSWDEDSLLLQLKDGLGEDVEVIYVG LKEEI  P+E
Sbjct  59   MIIVGNQLPLRARRSPGGSGGWCFSWDEDSLLLQLKDGLGEDVEVIYVGSLKEEIA-PSE  117

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            Q+DVA TLLE FKCVPAF+PP
Sbjct  118  QEDVAQTLLENFKCVPAFIPP  138



>ref|XP_011028148.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X2 [Populus euphratica]
Length=673

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 119/141 (84%), Gaps = 3/141 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDLASG++  FGR  K+L RVATVAG+L++LDDE+  +  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGDAPNFGRERKRLPRVATVAGILTDLDDEN--SVSSDAPSSVSQER  58

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPLRA R   G  GW FSWDEDSLLLQLKDGLGEDVEVIYVG LKEEI  P+E
Sbjct  59   MIIVGNQLPLRARRSPGGSGGWCFSWDEDSLLLQLKDGLGEDVEVIYVGSLKEEIA-PSE  117

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            Q+DVA TLLE FKCVPAF+PP
Sbjct  118  QEDVAQTLLENFKCVPAFIPP  138



>ref|XP_006605933.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Glycine max]
 ref|XP_006605934.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X2 [Glycine max]
 ref|XP_006605935.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X3 [Glycine max]
 ref|XP_006605936.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X4 [Glycine max]
Length=852

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 120/141 (85%), Gaps = 3/141 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDL S  S TFGR  K+L RVATVAGVLSELDDE+ ++  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLTSCGSPTFGREKKRLPRVATVAGVLSELDDETSNSVCSDTPSSVSQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPL+AHR+ +G   W F+WDEDSLLLQLKDGLG+DVE IY+GCLKEE I+P+E
Sbjct  61   MIIVGNQLPLKAHRKDNGT--WEFTWDEDSLLLQLKDGLGDDVETIYIGCLKEE-IEPSE  117

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA  LL+TFKCVP F+PP
Sbjct  118  QDDVAQYLLDTFKCVPTFLPP  138



>gb|KHN42432.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 [Glycine 
soja]
Length=852

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 120/141 (85%), Gaps = 3/141 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDL S  S TFGR  K+L RVATVAGVLSELDDE+ ++  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLTSCGSPTFGREKKRLPRVATVAGVLSELDDETSNSVCSDTPSSVSQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPL+AHR+ +G   W F+WDEDSLLLQLKDGLG+DVE IY+GCLKEE I+P+E
Sbjct  61   MIIVGNQLPLKAHRKDNGT--WEFTWDEDSLLLQLKDGLGDDVETIYIGCLKEE-IEPSE  117

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA  LL+TFKCVP F+PP
Sbjct  118  QDDVAQYLLDTFKCVPTFLPP  138



>gb|KCW71761.1| hypothetical protein EUGRSUZ_E00259 [Eucalyptus grandis]
Length=686

 Score =   207 bits (526),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 122/141 (87%), Gaps = 3/141 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDL SGE+L FGR  ++ SRVATV+G LSELDD++ ++ GSD PSS+SQER
Sbjct  1    MVSRSYSNLLDLTSGEALGFGRERRRFSRVATVSGPLSELDDDNSNSVGSDAPSSLSQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLP+R+H+R +GE  W FSWDEDSLL QLKDG+ +DVEVIYVG LKEE ID ++
Sbjct  61   MIIVGNQLPIRSHKRDNGE--WYFSWDEDSLLYQLKDGIAQDVEVIYVGSLKEE-IDMSD  117

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDD+A TLL+TFKCVPAF+PP
Sbjct  118  QDDIAQTLLDTFKCVPAFIPP  138



>gb|KJB25286.1| hypothetical protein B456_004G183400 [Gossypium raimondii]
Length=760

 Score =   207 bits (528),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 120/141 (85%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDLA G + T  +  K+  RVATV G+LSE++D++ ++  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLAYGGTPTLSQEKKRFPRVATVPGLLSEVEDDNCNSVSSDAPSSVSQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPLR H+ TD +EGW FSWDEDSLLLQLKDGLGEDVEVIYVGCLKEE + PNE
Sbjct  61   MIIVGNQLPLRVHQNTD-DEGWCFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEE-VPPNE  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA TLLETFKCVPAF+PP
Sbjct  119  QDDVAQTLLETFKCVPAFLPP  139



>ref|XP_011028143.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Populus euphratica]
 ref|XP_011028145.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Populus euphratica]
 ref|XP_011028146.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Populus euphratica]
 ref|XP_011028147.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Populus euphratica]
Length=861

 Score =   208 bits (529),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 119/141 (84%), Gaps = 3/141 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDLASG++  FGR  K+L RVATVAG+L++LDDE+  +  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGDAPNFGRERKRLPRVATVAGILTDLDDEN--SVSSDAPSSVSQER  58

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPLRA R   G  GW FSWDEDSLLLQLKDGLGEDVEVIYVG LKEEI  P+E
Sbjct  59   MIIVGNQLPLRARRSPGGSGGWCFSWDEDSLLLQLKDGLGEDVEVIYVGSLKEEIA-PSE  117

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            Q+DVA TLLE FKCVPAF+PP
Sbjct  118  QEDVAQTLLENFKCVPAFIPP  138



>gb|KCW71760.1| hypothetical protein EUGRSUZ_E00259 [Eucalyptus grandis]
Length=681

 Score =   206 bits (525),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 122/141 (87%), Gaps = 3/141 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDL SGE+L FGR  ++ SRVATV+G LSELDD++ ++ GSD PSS+SQER
Sbjct  1    MVSRSYSNLLDLTSGEALGFGRERRRFSRVATVSGPLSELDDDNSNSVGSDAPSSLSQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLP+R+H+R +GE  W FSWDEDSLL QLKDG+ +DVEVIYVG LKEE ID ++
Sbjct  61   MIIVGNQLPIRSHKRDNGE--WYFSWDEDSLLYQLKDGIAQDVEVIYVGSLKEE-IDMSD  117

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDD+A TLL+TFKCVPAF+PP
Sbjct  118  QDDIAQTLLDTFKCVPAFIPP  138



>gb|KJB25285.1| hypothetical protein B456_004G183400 [Gossypium raimondii]
 gb|KJB25287.1| hypothetical protein B456_004G183400 [Gossypium raimondii]
Length=862

 Score =   207 bits (528),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 120/141 (85%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDLA G + T  +  K+  RVATV G+LSE++D++ ++  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLAYGGTPTLSQEKKRFPRVATVPGLLSEVEDDNCNSVSSDAPSSVSQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPLR H+ TD +EGW FSWDEDSLLLQLKDGLGEDVEVIYVGCLKEE + PNE
Sbjct  61   MIIVGNQLPLRVHQNTD-DEGWCFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEE-VPPNE  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA TLLETFKCVPAF+PP
Sbjct  119  QDDVAQTLLETFKCVPAFLPP  139



>ref|XP_010908489.1| PREDICTED: LOW QUALITY PROTEIN: alpha,alpha-trehalose-phosphate 
synthase [UDP-forming] 5-like [Elaeis guineensis]
Length=857

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 122/141 (87%), Gaps = 4/141 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDL SG+S TFGR GK+L RV TVAG++S+LD+E+  + GS+  SS+ QER
Sbjct  1    MVSRSYSNLLDLVSGDSPTFGRVGKRLPRVMTVAGIISDLDEEN--SVGSEALSSVCQER  58

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIVGNQLPLRAHRR D + GWNFSWDEDSLLLQLKDGLGEDVEVIY+GCL+EE I+P E
Sbjct  59   VIIVGNQLPLRAHRRPD-DSGWNFSWDEDSLLLQLKDGLGEDVEVIYIGCLREE-IEPGE  116

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDV+ TLLETFKCVP F+ P
Sbjct  117  QDDVSQTLLETFKCVPTFLSP  137



>gb|KHN06692.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 [Glycine 
soja]
Length=853

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 119/141 (84%), Gaps = 3/141 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDL S  S TF R  K+L RVATVAGVLSELDDE+ ++  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLTSCGSPTFSREKKRLPRVATVAGVLSELDDETSNSVCSDTPSSVSQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPL+AHR+ +G   W F+WDEDSLLLQLKDGLG+DVE IY+GCLKEE I+P+E
Sbjct  61   MIIVGNQLPLKAHRKDNGT--WEFTWDEDSLLLQLKDGLGDDVETIYIGCLKEE-IEPSE  117

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA  LL+TFKCVP F+PP
Sbjct  118  QDDVALYLLDTFKCVPTFLPP  138



>ref|XP_010055292.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Eucalyptus grandis]
 ref|XP_010055293.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Eucalyptus grandis]
 gb|KCW71759.1| hypothetical protein EUGRSUZ_E00259 [Eucalyptus grandis]
Length=864

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 122/141 (87%), Gaps = 3/141 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDL SGE+L FGR  ++ SRVATV+G LSELDD++ ++ GSD PSS+SQER
Sbjct  1    MVSRSYSNLLDLTSGEALGFGRERRRFSRVATVSGPLSELDDDNSNSVGSDAPSSLSQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLP+R+H+R +GE  W FSWDEDSLL QLKDG+ +DVEVIYVG LKEE ID ++
Sbjct  61   MIIVGNQLPIRSHKRDNGE--WYFSWDEDSLLYQLKDGIAQDVEVIYVGSLKEE-IDMSD  117

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDD+A TLL+TFKCVPAF+PP
Sbjct  118  QDDIAQTLLDTFKCVPAFIPP  138



>ref|XP_006589670.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Glycine max]
 ref|XP_006589671.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X2 [Glycine max]
 ref|XP_006589672.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X3 [Glycine max]
 ref|XP_006589673.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X4 [Glycine max]
 ref|XP_006589674.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X5 [Glycine max]
 ref|XP_006589675.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X6 [Glycine max]
Length=853

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 119/141 (84%), Gaps = 3/141 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDL S  S TF R  K+L RVATVAGVLSELDDE+ ++  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLTSCGSPTFSREKKRLPRVATVAGVLSELDDETSNSVCSDTPSSVSQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPL+AHR+ +G   W F+WDEDSLLLQLKDGLG+DVE IY+GCLKEE I+P+E
Sbjct  61   MIIVGNQLPLKAHRKDNGT--WEFTWDEDSLLLQLKDGLGDDVETIYIGCLKEE-IEPSE  117

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA  LL+TFKCVP F+PP
Sbjct  118  QDDVALYLLDTFKCVPTFLPP  138



>gb|KJB39837.1| hypothetical protein B456_007G033200 [Gossypium raimondii]
 gb|KJB39838.1| hypothetical protein B456_007G033200 [Gossypium raimondii]
 gb|KJB39839.1| hypothetical protein B456_007G033200 [Gossypium raimondii]
Length=864

 Score =   206 bits (524),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 120/140 (86%), Gaps = 2/140 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDLASG+S +FG   K+  RVATV G+LSE+DDE+ ++ GS+ PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGDSPSFGGERKRFPRVATVPGLLSEVDDETCNSVGSEAPSSVSQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPLRAHR  D  E W FSWDEDSLLLQLKDGLGED+EVIYVGCLKE++   NE
Sbjct  61   MIIVGNQLPLRAHRNEDNGE-WCFSWDEDSLLLQLKDGLGEDLEVIYVGCLKEQVA-LNE  118

Query  531  QDDVAXTLLETFKCVPAFVP  590
            QDDVA TLLETFKCVPAF+P
Sbjct  119  QDDVAQTLLETFKCVPAFIP  138



>ref|XP_006368376.1| hypothetical protein POPTR_0001s02190g [Populus trichocarpa]
 gb|ERP64945.1| hypothetical protein POPTR_0001s02190g [Populus trichocarpa]
Length=862

 Score =   205 bits (522),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 120/143 (84%), Gaps = 5/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESL--TFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            MVSRSYSNLLDLASG++   +FGR  K+  RVATVAG+L++LDDE+  N GSD PSS+S 
Sbjct  1    MVSRSYSNLLDLASGDAPIPSFGRERKRFPRVATVAGILTDLDDEN--NVGSDSPSSVSL  58

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
             RMIIVGNQLPLRAHR  D   GW FSWDEDSLLLQLKDGLGE VEVIYVG LKEE I+P
Sbjct  59   GRMIIVGNQLPLRAHRSPDSSGGWCFSWDEDSLLLQLKDGLGEGVEVIYVGSLKEE-IEP  117

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
            +EQDDVA TLLETFKCVPAF+PP
Sbjct  118  SEQDDVAQTLLETFKCVPAFIPP  140



>gb|KEH44193.1| trehalose-6-phosphate synthase domain protein [Medicago truncatula]
Length=855

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 117/141 (83%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M SRSYSNLLDL S  S +FGR  K+L RVATVAGVLSELDDE+ ++ GSD PSSISQER
Sbjct  1    MASRSYSNLLDLTSCGSPSFGREKKRLPRVATVAGVLSELDDETNNSVGSDAPSSISQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPL+A R+ +  + W F+WDEDSLLLQLKDGLG+DVE IY+GCLKEE IDP E
Sbjct  61   MIIVGNQLPLKAQRKEENGK-WEFTWDEDSLLLQLKDGLGDDVETIYIGCLKEE-IDPIE  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA  LL+ FKCVP F+PP
Sbjct  119  QDDVAQYLLDNFKCVPTFLPP  139



>ref|XP_011018523.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Populus euphratica]
 ref|XP_011018524.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Populus euphratica]
Length=863

 Score =   203 bits (516),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 121/144 (84%), Gaps = 6/144 (4%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESL--TFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSIS-  341
            MVS+SYSNLLDLASG++   +FGR  K+  RVATVAG+L++LDDE+  N GSD PSS+S 
Sbjct  1    MVSKSYSNLLDLASGDAPIPSFGRERKRFPRVATVAGILTDLDDEN--NVGSDAPSSVSL  58

Query  342  QERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIID  521
              RMIIVGNQLPLRAHR  D   GW F+WDEDSLLLQLKDGLGEDVEVIYVG LKEE I+
Sbjct  59   GRRMIIVGNQLPLRAHRSPDSSGGWCFNWDEDSLLLQLKDGLGEDVEVIYVGSLKEE-IE  117

Query  522  PNEQDDVAXTLLETFKCVPAFVPP  593
            P+EQDDVA TLLETFKCVPAF+PP
Sbjct  118  PSEQDDVALTLLETFKCVPAFIPP  141



>ref|XP_004497050.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Cicer arietinum]
 ref|XP_004497051.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X2 [Cicer arietinum]
 ref|XP_004497052.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X3 [Cicer arietinum]
Length=855

 Score =   202 bits (514),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 116/141 (82%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDL S  S  F R  K+L RVATVAGVLSELDDE+ ++ GSD PSSISQER
Sbjct  1    MVSRSYSNLLDLTSCGSPCFSREKKRLPRVATVAGVLSELDDETSNSVGSDAPSSISQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPL+A R+ +    W F+WDEDSLLLQLKDGLG+DVE IY+GCLKEE IDP+E
Sbjct  61   MIIVGNQLPLKAQRK-ENNGMWEFTWDEDSLLLQLKDGLGDDVETIYIGCLKEE-IDPSE  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA  LL+ FKCVP F+PP
Sbjct  119  QDDVAQYLLDNFKCVPTFLPP  139



>ref|XP_004497053.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X4 [Cicer arietinum]
Length=841

 Score =   202 bits (514),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 116/141 (82%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDL S  S  F R  K+L RVATVAGVLSELDDE+ ++ GSD PSSISQER
Sbjct  1    MVSRSYSNLLDLTSCGSPCFSREKKRLPRVATVAGVLSELDDETSNSVGSDAPSSISQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPL+A R+ +    W F+WDEDSLLLQLKDGLG+DVE IY+GCLKEE IDP+E
Sbjct  61   MIIVGNQLPLKAQRK-ENNGMWEFTWDEDSLLLQLKDGLGDDVETIYIGCLKEE-IDPSE  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA  LL+ FKCVP F+PP
Sbjct  119  QDDVAQYLLDNFKCVPTFLPP  139



>ref|XP_010276860.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Nelumbo nucifera]
 ref|XP_010276862.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Nelumbo nucifera]
 ref|XP_010276863.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Nelumbo nucifera]
 ref|XP_010276864.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Nelumbo nucifera]
 ref|XP_010276865.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Nelumbo nucifera]
Length=860

 Score =   200 bits (509),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 128/145 (88%), Gaps = 5/145 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDL SG+S +FGR GK+L RV TVAG++SELDD++ ++  SDVPSS+SQER
Sbjct  1    MVSRSYSNLLDLVSGDSPSFGRVGKRLPRVMTVAGIMSELDDDNSNSVSSDVPSSVSQER  60

Query  351  MIIVGNQLPLRAHRRT----DGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEII  518
            MIIVGNQLPLR HRR+    DG+ G NFSWDEDSLLLQLKDGLGEDVEVIY+GCL+EE I
Sbjct  61   MIIVGNQLPLRVHRRSDGDGDGDGGLNFSWDEDSLLLQLKDGLGEDVEVIYIGCLREE-I  119

Query  519  DPNEQDDVAXTLLETFKCVPAFVPP  593
            DP+EQDDVA TLLETFKCVPAF+PP
Sbjct  120  DPSEQDDVAQTLLETFKCVPAFIPP  144



>ref|XP_004148747.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Cucumis sativus]
 ref|XP_004165051.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Cucumis sativus]
 gb|KGN55736.1| hypothetical protein Csa_3G009420 [Cucumis sativus]
Length=864

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 120/144 (83%), Gaps = 6/144 (4%)
 Frame = +3

Query  171  MVSRSYSNLLDLASG---ESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSIS  341
            MVSRSYSNLL+LASG    +   GR  K+L RVATVAGVLSELDD+S ++ GSD PSS+S
Sbjct  1    MVSRSYSNLLELASGGCSPTFGLGRERKRLPRVATVAGVLSELDDDSCNSTGSDAPSSVS  60

Query  342  QERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIID  521
            Q+RMIIVGNQLP+RA+R  +G+  W FS DEDSLLLQLKDGLGEDVEVIY+GCL+EE +D
Sbjct  61   QDRMIIVGNQLPIRANRDENGD--WEFSMDEDSLLLQLKDGLGEDVEVIYIGCLREE-VD  117

Query  522  PNEQDDVAXTLLETFKCVPAFVPP  593
            P EQDDVA TLL+ FKCVP F+PP
Sbjct  118  PREQDDVAQTLLDRFKCVPTFLPP  141



>ref|XP_008448661.1| PREDICTED: LOW QUALITY PROTEIN: alpha,alpha-trehalose-phosphate 
synthase [UDP-forming] 5-like [Cucumis melo]
Length=864

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 120/144 (83%), Gaps = 6/144 (4%)
 Frame = +3

Query  171  MVSRSYSNLLDLASG---ESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSIS  341
            MVSRSYSNLL+LASG    +   GR  K+L RVATVAGVLSELDD+S ++ GSD PSS++
Sbjct  1    MVSRSYSNLLELASGGCSPTFGLGRERKRLPRVATVAGVLSELDDDSCNSTGSDAPSSVA  60

Query  342  QERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIID  521
            Q+RMIIVGNQLP+RA+R  +G+  W FS DEDSLLLQLKDGLGEDVEVIY+GCL+EE +D
Sbjct  61   QDRMIIVGNQLPIRANRNENGD--WEFSMDEDSLLLQLKDGLGEDVEVIYIGCLREE-VD  117

Query  522  PNEQDDVAXTLLETFKCVPAFVPP  593
            P EQDDVA TLL+ FKCVP F+PP
Sbjct  118  PREQDDVAQTLLDRFKCVPTFLPP  141



>ref|XP_010677331.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Beta vulgaris subsp. vulgaris]
 ref|XP_010677332.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Beta vulgaris subsp. vulgaris]
Length=866

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 116/142 (82%), Gaps = 2/142 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDLASG+  +  R  ++  RV TVAGVLSELDDE+ ++  SD PSSI+QER
Sbjct  1    MVSRSYSNLLDLASGQFPSICRGERRFPRVKTVAGVLSELDDETSNSVSSDAPSSITQER  60

Query  351  MIIVGNQLPLRAHRRTDGEE-GWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  527
            +IIVGNQLPLR H ++D E+ G  FSWDEDSLLLQLKDGL EDVE++Y+GCL+E+ IDP+
Sbjct  61   VIIVGNQLPLRVHHKSDDEKVGRYFSWDEDSLLLQLKDGLAEDVEIVYIGCLREQ-IDPS  119

Query  528  EQDDVAXTLLETFKCVPAFVPP  593
            EQD VA TL E FKCVP F+PP
Sbjct  120  EQDSVAHTLFENFKCVPTFLPP  141



>ref|XP_006854042.1| hypothetical protein AMTR_s00048p00069850 [Amborella trichopoda]
 gb|ERN15509.1| hypothetical protein AMTR_s00048p00069850 [Amborella trichopoda]
Length=852

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 116/141 (82%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M SRSYSNLLDL SG S +F R GK+L RV TVAG+LSE+DDE  ++ GS+ PSSI QER
Sbjct  1    MASRSYSNLLDLTSGNSPSFNRVGKRLPRVMTVAGLLSEIDDEGSNSVGSEGPSSICQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIVGNQLPLRAHRR + +  W+FSWDEDSLLLQL+DGLGE+ E +Y+GCLKEE IDP+E
Sbjct  61   IIIVGNQLPLRAHRRPN-QSSWDFSWDEDSLLLQLRDGLGEEKEFMYIGCLKEE-IDPSE  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QD+V+  LLE FKCVP F+ P
Sbjct  119  QDEVSQILLERFKCVPTFLSP  139



>gb|AAX16014.1| trehalose-6-phosphate synthase [Ginkgo biloba]
 gb|AAX16015.1| trehalose-6-phosphate synthase [Ginkgo biloba]
Length=868

 Score =   195 bits (496),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 114/141 (81%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+SRSY+NL+DLA+G    FGRA K+L RV TV G++SELDD++ ++  SDVPSSI QER
Sbjct  1    MMSRSYTNLMDLATGNFPAFGRATKRLPRVMTVPGIISELDDDNSNSVSSDVPSSICQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIV NQLPLRA RR D   GW FSWDEDSLLLQLKDGL ED+EV+YVG LK E +D +E
Sbjct  61   MIIVANQLPLRAQRRPDN-RGWAFSWDEDSLLLQLKDGLAEDMEVVYVGSLKVE-VDLSE  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA  LLE FKCVPAF+PP
Sbjct  119  QDDVAQILLENFKCVPAFLPP  139



>ref|XP_006849789.1| hypothetical protein AMTR_s00176p00032980 [Amborella trichopoda]
 gb|ERN11370.1| hypothetical protein AMTR_s00176p00032980 [Amborella trichopoda]
Length=859

 Score =   194 bits (493),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 118/143 (83%), Gaps = 4/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESL-TFGRAGKKLSRVATVAGVLSELDD-ESRSNGGSDVPSSISQ  344
            MVSRSYSNLLDL SG +  +FGR G++L RV TV G++S+ DD  S  + GSD PSS++Q
Sbjct  1    MVSRSYSNLLDLVSGGTPPSFGRMGRRLPRVMTVPGIISDFDDGASVHSTGSDPPSSVTQ  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +R IIV NQLP+RAHRR DG+ GW FSWDED+LLLQLKDGLGEDVEVIYVGCLKEE + P
Sbjct  61   DRTIIVANQLPIRAHRRDDGK-GWLFSWDEDALLLQLKDGLGEDVEVIYVGCLKEE-VPP  118

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
            +EQD+V+  LLETFKCVP F+PP
Sbjct  119  SEQDEVSQILLETFKCVPTFLPP  141



>emb|CDX90449.1| BnaA03g43320D [Brassica napus]
Length=857

 Score =   189 bits (480),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 116/142 (82%), Gaps = 4/142 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGG-SDVPSSISQE  347
            MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDTNSNSVCSDAPSSVAQD  60

Query  348  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  527
            R+IIVGNQLP+++HR + G+    F+WD DSLLLQLKDG+ ED+EV+Y+GCLK++ +DP+
Sbjct  61   RIIIVGNQLPIKSHRTSSGK--LTFTWDNDSLLLQLKDGMREDMEVVYIGCLKDQ-VDPS  117

Query  528  EQDDVAXTLLETFKCVPAFVPP  593
            EQDDVA  LLE FKCVPA++PP
Sbjct  118  EQDDVAQRLLENFKCVPAYIPP  139



>ref|XP_010518663.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Tarenaya hassleriana]
 ref|XP_010518664.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Tarenaya hassleriana]
Length=848

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 112/141 (79%), Gaps = 3/141 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M SRSYSNLLDLASG S T  R  K+  RVATV GVLSELD+E  +   SD PSS+ QER
Sbjct  1    MASRSYSNLLDLASGGSPTISREKKRFPRVATVPGVLSELDNEIGNGADSDAPSSVLQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIVGNQLP++A + +DG+  WNFSWD +SLL+QLKDG+ EDVEVIY+GCLK E I+P +
Sbjct  61   LIIVGNQLPIKAQQNSDGK--WNFSWDNNSLLVQLKDGVREDVEVIYIGCLKAE-IEPID  117

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA  LLE FKCVPA+VPP
Sbjct  118  QDDVAQRLLENFKCVPAYVPP  138



>gb|ABD65165.1| trehalose-6-phosphate synthase, putative [Brassica oleracea]
Length=857

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 115/142 (81%), Gaps = 4/142 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGG-SDVPSSISQE  347
            MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN   SD PSSI+Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDANSNSVCSDAPSSIAQD  60

Query  348  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  527
            R+IIVGNQLP+++HR   G+    F+WD DSLLLQLKDG+ ED+EV+Y+GCLK++ +DP+
Sbjct  61   RIIIVGNQLPIKSHRNPSGK--LTFTWDNDSLLLQLKDGMREDMEVVYIGCLKDQ-VDPS  117

Query  528  EQDDVAXTLLETFKCVPAFVPP  593
            EQDDV+  LLE FKCVPA++PP
Sbjct  118  EQDDVSQRLLENFKCVPAYIPP  139



>ref|XP_009136870.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Brassica rapa]
 ref|XP_009136871.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Brassica rapa]
Length=857

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 115/142 (81%), Gaps = 4/142 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGG-SDVPSSISQE  347
            MVSRSYSNLLDLASG   +F R  K+  RVAT  GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATFTGVLSELDDDTNSNSVCSDAPSSVAQD  60

Query  348  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  527
            R+IIVGNQLP+++HR + G+    F+WD DSLLLQLKDG+ ED+EV+Y+GCLK++ +DP+
Sbjct  61   RIIIVGNQLPIKSHRTSSGK--LTFTWDNDSLLLQLKDGMREDMEVVYIGCLKDQ-VDPS  117

Query  528  EQDDVAXTLLETFKCVPAFVPP  593
            EQDDVA  LLE FKCVPA++PP
Sbjct  118  EQDDVAQRLLENFKCVPAYIPP  139



>emb|CAB10557.1| trehalose-6-phosphate synthase like protein [Arabidopsis thaliana]
 emb|CAB78780.1| trehalose-6-phosphate synthase like protein [Arabidopsis thaliana]
Length=865

 Score =   186 bits (472),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 120/156 (77%), Gaps = 9/156 (6%)
 Frame = +3

Query  138  FERCIY---CGESTMVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRS  308
               CIY   C +  MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ S
Sbjct  6    LRHCIYFTCCRD--MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDNNS  63

Query  309  NG-GSDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEV  485
            N   SD PSS++Q+R+IIVGNQLP+++HR + G+   +FSWD DSLLLQLKDG+ ED+EV
Sbjct  64   NSVCSDAPSSVTQDRIIIVGNQLPIKSHRNSAGK--LSFSWDNDSLLLQLKDGMREDMEV  121

Query  486  IYVGCLKEEIIDPNEQDDVAXTLLETFKCVPAFVPP  593
            +Y+GCLKE+ ID  EQDDV+  LLE FKCVPA++PP
Sbjct  122  VYIGCLKEQ-IDTVEQDDVSQRLLENFKCVPAYIPP  156



>ref|NP_567538.1| putative trehalose phosphatase/synthase 5 [Arabidopsis thaliana]
 sp|O23617.2|TPS5_ARATH RecName: Full=Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5; AltName: Full=Trehalose-6-phosphate synthase 5; Short=AtTPS5 
[Arabidopsis thaliana]
 dbj|BAC43297.1| putative trehalose-6-phosphate synthase [Arabidopsis thaliana]
 gb|AAO64902.1| At4g17770 [Arabidopsis thaliana]
 gb|AEE83948.1| putative trehalose phosphatase/synthase 5 [Arabidopsis thaliana]
 gb|AHL38687.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=862

 Score =   185 bits (470),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 115/142 (81%), Gaps = 4/142 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGG-SDVPSSISQE  347
            MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDNNSNSVCSDAPSSVTQD  60

Query  348  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  527
            R+IIVGNQLP+++HR + G+   +FSWD DSLLLQLKDG+ ED+EV+Y+GCLKE+ ID  
Sbjct  61   RIIIVGNQLPIKSHRNSAGK--LSFSWDNDSLLLQLKDGMREDMEVVYIGCLKEQ-IDTV  117

Query  528  EQDDVAXTLLETFKCVPAFVPP  593
            EQDDV+  LLE FKCVPA++PP
Sbjct  118  EQDDVSQRLLENFKCVPAYIPP  139



>ref|XP_010449562.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X3 [Camelina sativa]
Length=844

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 115/142 (81%), Gaps = 4/142 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGG-SDVPSSISQE  347
            MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDNNSNSVCSDAPSSVTQD  60

Query  348  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  527
            R+I+VGNQLP+++HR + G+   +FSWD DSLLLQLKDG+ ED+EV+Y+GCLKE+ ID  
Sbjct  61   RIIVVGNQLPIKSHRNSAGK--LSFSWDNDSLLLQLKDGMREDMEVVYIGCLKEQ-IDTV  117

Query  528  EQDDVAXTLLETFKCVPAFVPP  593
            EQDDV+  LLE FKCVPA++PP
Sbjct  118  EQDDVSQRLLENFKCVPAYIPP  139



>emb|CBI33857.3| unnamed protein product [Vitis vinifera]
Length=223

 Score =   174 bits (442),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 103/141 (73%), Gaps = 28/141 (20%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLLDL                           LDDE+ ++  SD PSS+SQ+R
Sbjct  1    MVSRSYSNLLDL---------------------------LDDETSNSVTSDAPSSVSQDR  33

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPLRAHR +DG   W FSWDEDSLLLQLKDGLGEDVEV+YVGCL+E+ IDP+E
Sbjct  34   MIIVGNQLPLRAHRSSDGSGEWCFSWDEDSLLLQLKDGLGEDVEVLYVGCLREQ-IDPSE  92

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA TLLETFKCVPAF+PP
Sbjct  93   QDDVAQTLLETFKCVPAFIPP  113



>ref|XP_010434619.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Camelina sativa]
 ref|XP_010434620.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Camelina sativa]
Length=862

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 115/142 (81%), Gaps = 4/142 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGG-SDVPSSISQE  347
            MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDNNSNSVCSDAPSSVTQD  60

Query  348  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  527
            R+I+VGNQLP+++HR + G+   +FSWD DSLLLQLKDG+ ED+EV+Y+GCLKE+ ID  
Sbjct  61   RIIVVGNQLPIKSHRNSAGK--LSFSWDNDSLLLQLKDGMREDMEVVYIGCLKEQ-IDTV  117

Query  528  EQDDVAXTLLETFKCVPAFVPP  593
            EQDDV+  LLE FKCVPA++PP
Sbjct  118  EQDDVSQRLLENFKCVPAYIPP  139



>ref|XP_010449561.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X2 [Camelina sativa]
Length=858

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 115/142 (81%), Gaps = 4/142 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGG-SDVPSSISQE  347
            MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDNNSNSVCSDAPSSVTQD  60

Query  348  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  527
            R+I+VGNQLP+++HR + G+   +FSWD DSLLLQLKDG+ ED+EV+Y+GCLKE+ ID  
Sbjct  61   RIIVVGNQLPIKSHRNSAGK--LSFSWDNDSLLLQLKDGMREDMEVVYIGCLKEQ-IDTV  117

Query  528  EQDDVAXTLLETFKCVPAFVPP  593
            EQDDV+  LLE FKCVPA++PP
Sbjct  118  EQDDVSQRLLENFKCVPAYIPP  139



>ref|XP_010449559.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Camelina sativa]
 ref|XP_010449560.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Camelina sativa]
Length=859

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 115/142 (81%), Gaps = 4/142 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGG-SDVPSSISQE  347
            MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDNNSNSVCSDAPSSVTQD  60

Query  348  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  527
            R+I+VGNQLP+++HR + G+   +FSWD DSLLLQLKDG+ ED+EV+Y+GCLKE+ ID  
Sbjct  61   RIIVVGNQLPIKSHRNSAGK--LSFSWDNDSLLLQLKDGMREDMEVVYIGCLKEQ-IDTV  117

Query  528  EQDDVAXTLLETFKCVPAFVPP  593
            EQDDV+  LLE FKCVPA++PP
Sbjct  118  EQDDVSQRLLENFKCVPAYIPP  139



>ref|XP_002527520.1| trehalose-6-phosphate synthase, putative [Ricinus communis]
 gb|EEF34829.1| trehalose-6-phosphate synthase, putative [Ricinus communis]
Length=753

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 118/144 (82%), Gaps = 4/144 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPS-SISQE  347
            MVSRSYSNLL+LASGES +FGR  +++ R+ TVAG++S+LDD+   +  SD  S SI ++
Sbjct  1    MVSRSYSNLLELASGESPSFGRMNRRIPRIMTVAGIISDLDDDPSESVCSDPSSASIQKD  60

Query  348  RMIIVGNQLPLRAHRRTDG-EEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIID  521
            R+IIV NQLP+RA R++DG  + W F+WDE+SLLLQLKDGLG+D +EVIYVGCL+EEI  
Sbjct  61   RIIIVANQLPIRAQRKSDGSNKSWIFTWDENSLLLQLKDGLGDDEIEVIYVGCLREEI-H  119

Query  522  PNEQDDVAXTLLETFKCVPAFVPP  593
            PNEQD+V+  LLETFKCVP F+PP
Sbjct  120  PNEQDEVSQILLETFKCVPTFIPP  143



>ref|XP_010242150.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Nelumbo nucifera]
 ref|XP_010242151.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Nelumbo nucifera]
Length=848

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 112/141 (79%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+SRSY+NLLDLASG     GR  K+L RV TV G++SELDD+  ++  SDVPSSI Q+R
Sbjct  1    MLSRSYTNLLDLASGNFPALGREKKRLPRVMTVPGIVSELDDDQANSVSSDVPSSIIQDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIV NQLP++A RR D   GW+FSWDEDSLLLQLKDGL ED+EV+YVG L+ + +D NE
Sbjct  61   IIIVANQLPVKAKRRPDN-NGWSFSWDEDSLLLQLKDGLPEDMEVLYVGSLRAD-VDVNE  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDV+  LLE FKCVPAF+PP
Sbjct  119  QDDVSQILLERFKCVPAFLPP  139



>ref|XP_002870086.1| ATTPS5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46345.1| ATTPS5 [Arabidopsis lyrata subsp. lyrata]
Length=862

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 115/142 (81%), Gaps = 4/142 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGG-SDVPSSISQE  347
            MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDNNSNSVCSDAPSSVTQD  60

Query  348  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  527
            R+IIVGNQLP+++HR + G+   +FSWD DSLLLQLKDG+ ED+EV+Y+GCLKE+ ID  
Sbjct  61   RIIIVGNQLPIKSHRNSAGK--LSFSWDNDSLLLQLKDGMREDMEVVYIGCLKEQ-IDIV  117

Query  528  EQDDVAXTLLETFKCVPAFVPP  593
            EQDDV+  LLE FKCVPA++PP
Sbjct  118  EQDDVSQRLLENFKCVPAYLPP  139



>ref|XP_006283097.1| hypothetical protein CARUB_v10004115mg [Capsella rubella]
 gb|EOA15995.1| hypothetical protein CARUB_v10004115mg [Capsella rubella]
Length=862

 Score =   184 bits (466),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 115/142 (81%), Gaps = 4/142 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGG-SDVPSSISQE  347
            MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDNNSNSVCSDAPSSVTQD  60

Query  348  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  527
            R+IIVGNQLP++++R + G+   +FSWD DSLLLQLKDG+ ED+EV+Y+GCLKE+ ID  
Sbjct  61   RIIIVGNQLPIKSYRNSAGK--LSFSWDNDSLLLQLKDGMREDMEVVYIGCLKEQ-IDTA  117

Query  528  EQDDVAXTLLETFKCVPAFVPP  593
            EQDDV+  LLE FKCVPA++PP
Sbjct  118  EQDDVSQRLLENFKCVPAYIPP  139



>ref|XP_010271238.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Nelumbo nucifera]
 ref|XP_010271239.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Nelumbo nucifera]
Length=853

 Score =   182 bits (463),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 117/142 (82%), Gaps = 3/142 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLL+LASGES +FGR  +++ R+ TVAG++S+LDD+   +  SD  SS  +ER
Sbjct  1    MVSRSYSNLLELASGESPSFGRMSRRIPRIMTVAGIISDLDDDPADSVSSDPSSSAPRER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLG-EDVEVIYVGCLKEEIIDPN  527
            +IIV NQLP+RAH++ D  +GW FSWD+DSLLLQLKDGLG EDVEVIYVGCLKEE I P+
Sbjct  61   IIIVANQLPIRAHKKPDN-KGWTFSWDDDSLLLQLKDGLGDEDVEVIYVGCLKEE-IHPS  118

Query  528  EQDDVAXTLLETFKCVPAFVPP  593
            EQ+DV+  LLETFKCVP F+PP
Sbjct  119  EQEDVSQILLETFKCVPTFLPP  140



>ref|XP_009351564.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Pyrus x bretschneideri]
 ref|XP_009351565.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Pyrus x bretschneideri]
Length=848

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 114/142 (80%), Gaps = 7/142 (5%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVS+SYSNLL+LASGE  +FGR G+++ RV  VAGV+S++DDE     G    SS  ++R
Sbjct  1    MVSKSYSNLLELASGEGDSFGRIGRRIPRVMNVAGVMSDVDDE-----GYTSSSSSQRDR  55

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIIDPN  527
            +IIV NQLP++A R+TD  +GW FSWDE+SLLLQLKDGLG+D +EVIYVGCLKEEI  PN
Sbjct  56   IIIVANQLPIKAQRKTDDSKGWIFSWDENSLLLQLKDGLGDDEIEVIYVGCLKEEI-HPN  114

Query  528  EQDDVAXTLLETFKCVPAFVPP  593
            EQD+V+  LLETFKCVP F+PP
Sbjct  115  EQDEVSQFLLETFKCVPTFLPP  136



>ref|XP_008381762.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Malus domestica]
 ref|XP_008381764.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Malus domestica]
 ref|XP_008381765.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Malus domestica]
Length=848

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 113/142 (80%), Gaps = 7/142 (5%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVS+SYSNLL+LASGE  +FGR G+++ RV  VAGV+S++DDE     G    SS  ++R
Sbjct  1    MVSKSYSNLLELASGEGDSFGRIGRRIPRVMNVAGVMSDVDDE-----GYTSSSSSQRDR  55

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIIDPN  527
            +IIV NQLP+RA R+ D  +GW FSWDE+SLLLQLKDGLG+D +EVIYVGCLKEEI  PN
Sbjct  56   IIIVANQLPIRAQRKADDSKGWIFSWDENSLLLQLKDGLGDDEIEVIYVGCLKEEI-HPN  114

Query  528  EQDDVAXTLLETFKCVPAFVPP  593
            EQD+V+  LLETFKCVP F+PP
Sbjct  115  EQDEVSQILLETFKCVPTFLPP  136



>ref|XP_010439943.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Camelina sativa]
 ref|XP_010439944.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Camelina sativa]
Length=862

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 114/142 (80%), Gaps = 4/142 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGG-SDVPSSISQE  347
            MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDNNSNSVCSDAPSSVTQD  60

Query  348  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  527
            R+IIVGNQLP+++HR + G+   +FSWD DSLLLQLKDG+ ED+EV+Y+GCLKE+ ID  
Sbjct  61   RIIIVGNQLPIKSHRNSAGK--LSFSWDNDSLLLQLKDGMREDMEVVYIGCLKEQ-IDTV  117

Query  528  EQDDVAXTLLETFKCVPAFVPP  593
            EQDDV+  LLE FKCVPA++ P
Sbjct  118  EQDDVSQRLLENFKCVPAYISP  139



>ref|XP_011021751.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 isoform X2 [Populus euphratica]
Length=832

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 116/143 (81%), Gaps = 3/143 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  347
            MVSRSYSNLL+LASGES +FGR  +++ R+ TVAG++S++DD+ S S       SSI ++
Sbjct  1    MVSRSYSNLLELASGESPSFGRMSRRIPRIMTVAGIMSDIDDDPSESVCSDPSSSSIPKD  60

Query  348  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIIDP  524
            R+IIV NQLP+RA R++DG + W FSWDE+SLLLQLKDGLG+D +EVIYVGCLKEE+  P
Sbjct  61   RIIIVANQLPIRAQRKSDGSKSWIFSWDENSLLLQLKDGLGDDEIEVIYVGCLKEEV-HP  119

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
            NEQD+V   LLETFKCVP F+PP
Sbjct  120  NEQDEVYQILLETFKCVPTFLPP  142



>ref|XP_011021750.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 isoform X1 [Populus euphratica]
Length=854

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 116/143 (81%), Gaps = 3/143 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  347
            MVSRSYSNLL+LASGES +FGR  +++ R+ TVAG++S++DD+ S S       SSI ++
Sbjct  1    MVSRSYSNLLELASGESPSFGRMSRRIPRIMTVAGIMSDIDDDPSESVCSDPSSSSIPKD  60

Query  348  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIIDP  524
            R+IIV NQLP+RA R++DG + W FSWDE+SLLLQLKDGLG+D +EVIYVGCLKEE+  P
Sbjct  61   RIIIVANQLPIRAQRKSDGSKSWIFSWDENSLLLQLKDGLGDDEIEVIYVGCLKEEV-HP  119

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
            NEQD+V   LLETFKCVP F+PP
Sbjct  120  NEQDEVYQILLETFKCVPTFLPP  142



>ref|XP_009595830.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Nicotiana tomentosiformis]
Length=856

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 119/145 (82%), Gaps = 5/145 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGE--SLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            MVSRSYSNLL+LASGE  S +FGR  +++ R+ TVAG++S+LDD+   +  SD  SS +Q
Sbjct  1    MVSRSYSNLLELASGEAPSPSFGRMSRRIPRIMTVAGIMSDLDDDGSESVCSDPSSSSAQ  60

Query  345  -ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEII  518
             +R+IIVGNQLP+R  R+TDG +GW FSWDE+SLLLQLKDGLG+D +EVIYVGCLKEEI 
Sbjct  61   KDRIIIVGNQLPIRVQRKTDGSKGWLFSWDENSLLLQLKDGLGDDELEVIYVGCLKEEI-  119

Query  519  DPNEQDDVAXTLLETFKCVPAFVPP  593
             PNEQD+V+  LLETFKCVP FVPP
Sbjct  120  HPNEQDEVSQILLETFKCVPTFVPP  144



>ref|XP_004293972.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Fragaria vesca subsp. vesca]
Length=856

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 113/140 (81%), Gaps = 2/140 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+S+SY+NLLDLASG     GR  K+L RV TVAGV+SELDD++ ++  SDVPSSI Q+R
Sbjct  1    MMSKSYTNLLDLASGNFPIMGRERKRLPRVMTVAGVISELDDDNANSVSSDVPSSIVQDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIV NQLP++A RR D  +GW+FSWDEDSLLLQLKDGL ED+EV+YVG L  E +D NE
Sbjct  61   IIIVANQLPVKAKRRPDN-KGWSFSWDEDSLLLQLKDGLPEDMEVLYVGSLNVE-VDSNE  118

Query  531  QDDVAXTLLETFKCVPAFVP  590
            QDDV+  LL+ FKCVPAF+P
Sbjct  119  QDDVSQLLLDRFKCVPAFLP  138



>ref|XP_008383601.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Malus domestica]
Length=854

 Score =   181 bits (459),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 112/141 (79%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+S+SY+NLLDLASG     GR  ++L RV TVAGV+SELDD+   +  SDVPSSI Q+R
Sbjct  1    MMSKSYTNLLDLASGNFPVMGRERRRLPRVMTVAGVISELDDDQAGSVSSDVPSSIIQDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIV NQLP++A RR D  +GW+FSWDEDSL+LQLKDGL ED+EV+YVG L  E +D NE
Sbjct  61   IIIVANQLPVKAKRRPDN-KGWSFSWDEDSLVLQLKDGLPEDMEVLYVGSLSVE-VDSNE  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDV+  LL+ FKCVPAF+PP
Sbjct  119  QDDVSALLLDRFKCVPAFLPP  139



>ref|XP_002314777.2| hypothetical protein POPTR_0010s11510g [Populus trichocarpa]
 gb|EEF00948.2| hypothetical protein POPTR_0010s11510g [Populus trichocarpa]
Length=854

 Score =   181 bits (458),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 116/143 (81%), Gaps = 3/143 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  347
            MVSRSYSNLL+LASGES +FGR  +++ R+ TVAG++S++DD+ S S       SS  ++
Sbjct  1    MVSRSYSNLLELASGESPSFGRMSRRIPRIMTVAGIMSDIDDDPSESVCSDPSSSSTPKD  60

Query  348  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIIDP  524
            R+IIV NQLP+RA R++DG + W FSWDE+SLLLQLKDGLG+D +EVIYVGCLKEE+  P
Sbjct  61   RIIIVANQLPIRAQRKSDGSKSWIFSWDENSLLLQLKDGLGDDEIEVIYVGCLKEEV-HP  119

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
            NEQD+V+  LLETFKCVP F+PP
Sbjct  120  NEQDEVSQILLETFKCVPTFLPP  142



>ref|XP_006378432.1| hypothetical protein POPTR_0010s11510g [Populus trichocarpa]
 gb|ERP56229.1| hypothetical protein POPTR_0010s11510g [Populus trichocarpa]
Length=815

 Score =   180 bits (457),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 116/143 (81%), Gaps = 3/143 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  347
            MVSRSYSNLL+LASGES +FGR  +++ R+ TVAG++S++DD+ S S       SS  ++
Sbjct  1    MVSRSYSNLLELASGESPSFGRMSRRIPRIMTVAGIMSDIDDDPSESVCSDPSSSSTPKD  60

Query  348  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIIDP  524
            R+IIV NQLP+RA R++DG + W FSWDE+SLLLQLKDGLG+D +EVIYVGCLKEE+  P
Sbjct  61   RIIIVANQLPIRAQRKSDGSKSWIFSWDENSLLLQLKDGLGDDEIEVIYVGCLKEEV-HP  119

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
            NEQD+V+  LLETFKCVP F+PP
Sbjct  120  NEQDEVSQILLETFKCVPTFLPP  142



>ref|XP_004228746.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Solanum lycopersicum]
 ref|XP_010316481.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Solanum lycopersicum]
Length=857

 Score =   180 bits (456),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 118/145 (81%), Gaps = 5/145 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGE--SLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            MVSRSYSNLL+LASGE  S +FGR  +++ RV TVAG++S+LDD+   +  SD  SS +Q
Sbjct  1    MVSRSYSNLLELASGEAPSPSFGRMSRRIPRVMTVAGIMSDLDDDGSESVCSDPSSSSAQ  60

Query  345  -ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEII  518
             +R+I+V NQLP+R  R+TDG +GW FSWDE+SLLLQLKDGLG+D +EVIYVGCLKEEI 
Sbjct  61   KDRIIVVANQLPIRVQRKTDGSKGWLFSWDENSLLLQLKDGLGDDEIEVIYVGCLKEEI-  119

Query  519  DPNEQDDVAXTLLETFKCVPAFVPP  593
             PNEQD+V+  LLETFKCVP FVPP
Sbjct  120  HPNEQDEVSQILLETFKCVPTFVPP  144



>ref|XP_008220922.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Prunus mume]
Length=855

 Score =   180 bits (456),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 117/144 (81%), Gaps = 4/144 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSD--VPSSISQ  344
            MVS+SYSNLL+L SGE+ +FGR G+++ R+ TVA ++S++DD+   +  S+    SS+ +
Sbjct  1    MVSKSYSNLLELTSGEAPSFGRIGRRIPRIMTVASLISDVDDDPSESACSEDMSSSSVQR  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIID  521
            +R+IIV NQLP+RA R++D  +GW F+WDE+SLLLQLKDGLG+D +EVIYVGCLKEEI  
Sbjct  61   DRIIIVANQLPIRAQRKSDTSKGWIFNWDENSLLLQLKDGLGDDEIEVIYVGCLKEEI-H  119

Query  522  PNEQDDVAXTLLETFKCVPAFVPP  593
            PNEQD+V+  LLETFKCVP F+PP
Sbjct  120  PNEQDEVSQILLETFKCVPTFLPP  143



>ref|XP_004233035.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Solanum lycopersicum]
 ref|XP_010316843.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Solanum lycopersicum]
Length=851

 Score =   180 bits (456),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 113/141 (80%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+S+SY+NLLDLASG     GR  K+L RV TVAGV+SELDD+  ++  SDVPSSI  +R
Sbjct  1    MMSKSYTNLLDLASGNFPVMGREKKRLPRVMTVAGVISELDDDQANSVTSDVPSSIIVDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIV NQLP++A RR+D  +GWNFSWDEDSLLL +KDGL +D+EV+YVG LK E +D +E
Sbjct  61   IIIVANQLPVKAKRRSDN-KGWNFSWDEDSLLLHIKDGLPDDMEVLYVGSLKVE-VDSSE  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDV+  LL+ FKCVPAF+PP
Sbjct  119  QDDVSQLLLDRFKCVPAFLPP  139



>gb|KDP38139.1| hypothetical protein JCGZ_04782 [Jatropha curcas]
Length=855

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 117/143 (82%), Gaps = 3/143 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  347
            MVSRSYSNLL+LASGES +FGR  +++ R+ TVAG++S+LDD+ S S       SS+ ++
Sbjct  1    MVSRSYSNLLELASGESPSFGRMSRRIPRIMTVAGIISDLDDDPSESVCSDPSSSSVQKD  60

Query  348  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIIDP  524
            R+IIV NQLP+RA R++DG + W F+WDE+SLLLQLKDGLG+D +EVIYVGCL+EEI  P
Sbjct  61   RIIIVANQLPIRAQRKSDGSKSWIFTWDENSLLLQLKDGLGDDEIEVIYVGCLREEI-HP  119

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
            +EQD+V+  LLETFKCVP F+PP
Sbjct  120  SEQDEVSQILLETFKCVPTFLPP  142



>ref|XP_006364054.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Solanum tuberosum]
Length=857

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 118/145 (81%), Gaps = 5/145 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGE--SLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            MVSRSYSNLL+LASGE  S +FGR  +++ R+ TVAG++S+LDD+   +  SD  SS +Q
Sbjct  1    MVSRSYSNLLELASGEAPSPSFGRMSQRIPRIMTVAGIMSDLDDDGSESVCSDPSSSSAQ  60

Query  345  -ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEII  518
             +R+I+V NQLP+R  R+TDG +GW FSWDE+SLLLQLKDGLG+D +EVIYVGCLKEEI 
Sbjct  61   KDRIIVVANQLPIRVQRKTDGSKGWLFSWDENSLLLQLKDGLGDDEIEVIYVGCLKEEI-  119

Query  519  DPNEQDDVAXTLLETFKCVPAFVPP  593
             PNEQD+V+  LLETFKCVP FVPP
Sbjct  120  HPNEQDEVSQILLETFKCVPTFVPP  144



>ref|XP_009351624.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Pyrus x bretschneideri]
Length=854

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 111/141 (79%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+S+SY+NLLDLASG     GR  ++L RV TVAGV+SELDD+   +  SDVPSSI Q+R
Sbjct  1    MMSKSYTNLLDLASGNFPVMGRERRRLPRVMTVAGVISELDDDQAGSVSSDVPSSIVQDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIV NQLP++A RR D  +GW+FSWDEDSLLLQLKDGL ED+EV+YVG L  E +D NE
Sbjct  61   IIIVANQLPVKAKRRPDN-KGWSFSWDEDSLLLQLKDGLPEDMEVLYVGSLSVE-VDSNE  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDV+  LL+ FK VPAF+PP
Sbjct  119  QDDVSALLLDKFKSVPAFLPP  139



>ref|XP_006414189.1| hypothetical protein EUTSA_v10024381mg [Eutrema salsugineum]
 gb|ESQ55642.1| hypothetical protein EUTSA_v10024381mg [Eutrema salsugineum]
Length=862

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 113/142 (80%), Gaps = 4/142 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGG-SDVPSSISQE  347
            MVSRSYSNLLDLASG   +F R  K+  RV+TV GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVSTVTGVLSELDDDNNSNSVCSDAPSSVTQD  60

Query  348  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  527
            R+IIVGNQLP+++HR + G+    FSWD DSLLLQLKDG+ ED+EV+Y+GCLKE+ ID  
Sbjct  61   RIIIVGNQLPIKSHRNSAGK--LIFSWDNDSLLLQLKDGMREDMEVVYIGCLKEQ-IDVV  117

Query  528  EQDDVAXTLLETFKCVPAFVPP  593
            EQDDV+  LLE FKCVPA++ P
Sbjct  118  EQDDVSQRLLENFKCVPAYISP  139



>ref|XP_008371505.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Malus domestica]
Length=854

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 111/141 (79%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+S+SY+NLLDLASG     GR  ++L RV TVAGV+SELDD+   +  SDVPSSI Q+R
Sbjct  1    MMSKSYTNLLDLASGNFPVMGRERRRLPRVMTVAGVISELDDDQAGSVSSDVPSSIVQDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIV NQLP++A RR D  +GW+FSWDEDSLLLQLKDGL ED+EV+YVG L  E +D NE
Sbjct  61   IIIVANQLPVKAKRRPDN-KGWSFSWDEDSLLLQLKDGLPEDMEVLYVGSLSVE-VDSNE  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDV+  LL+ FK VPAF+PP
Sbjct  119  QDDVSALLLDRFKSVPAFLPP  139



>ref|XP_007214619.1| hypothetical protein PRUPE_ppa001324mg [Prunus persica]
 gb|EMJ15818.1| hypothetical protein PRUPE_ppa001324mg [Prunus persica]
Length=854

 Score =   178 bits (451),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 112/140 (80%), Gaps = 2/140 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+S+SY+NLLDLASG     GR  ++L RV TVAGV+SELDD+  ++  SDVPSSI Q+R
Sbjct  1    MMSKSYTNLLDLASGNFPIMGRERRRLPRVMTVAGVISELDDDQANSVSSDVPSSIMQDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIV NQLP++A RR D  +GW+FSWDEDSLLLQLKDGL E++EV+YVG L  E +D NE
Sbjct  61   IIIVANQLPVKAKRRPDN-KGWSFSWDEDSLLLQLKDGLPEEMEVLYVGSLNVE-VDSNE  118

Query  531  QDDVAXTLLETFKCVPAFVP  590
            QDDV+  LL+ FKCVPAF+P
Sbjct  119  QDDVSQLLLDRFKCVPAFLP  138



>gb|KHG01703.1| putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
7 [Gossypium arboreum]
Length=857

 Score =   178 bits (451),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 114/143 (80%), Gaps = 4/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+SRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SDVPSSI Q
Sbjct  1    MMSRSYTNLLDLASGNFPVMGQPREKKRLPRVMTVPGVISELDDDQANSVASDVPSSIIQ  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +R+IIV NQLP++A RR D  +GW+FSWD+DSLLLQLKDGL E++EV+YVG LK + +DP
Sbjct  61   DRIIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLQLKDGLPEEMEVLYVGSLKVD-VDP  118

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
            +EQDDV+  LL+ FKCVPAF+PP
Sbjct  119  SEQDDVSQLLLDRFKCVPAFLPP  141



>gb|KDP21135.1| hypothetical protein JCGZ_21606 [Jatropha curcas]
Length=857

 Score =   177 bits (450),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 113/143 (79%), Gaps = 4/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+SRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SDVPSS+ Q
Sbjct  1    MMSRSYTNLLDLASGNFPAMGQPREKKRLPRVMTVPGVISELDDDQANSVASDVPSSVVQ  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +R+IIV NQLP++A RR D  +GW+FSWDED+LLLQLKDGL ED+EVIYVG LK E +D 
Sbjct  61   DRIIIVANQLPVKAKRRPDN-KGWSFSWDEDALLLQLKDGLPEDMEVIYVGSLKVE-VDL  118

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
            +EQDDV+  LL+ FKCVPAF+PP
Sbjct  119  SEQDDVSQLLLDRFKCVPAFLPP  141



>ref|XP_006358103.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like [Solanum tuberosum]
Length=850

 Score =   177 bits (450),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 113/141 (80%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+S+SY+NLLDLASG     GR  K+L RV TVAGV+SELDD+  ++  SDVPSSI  +R
Sbjct  1    MMSKSYTNLLDLASGNFPVMGREKKRLPRVMTVAGVISELDDDQANSVTSDVPSSIIVDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIV NQLP++A RR+D  +GW+FSWDEDSLLL +KDGL +D+EV+YVG LK E +D +E
Sbjct  61   IIIVANQLPVKAKRRSDN-KGWSFSWDEDSLLLHIKDGLPDDMEVLYVGSLKVE-VDSSE  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDV+  LL+ FKCVPAF+PP
Sbjct  119  QDDVSQLLLDRFKCVPAFLPP  139



>ref|XP_009778367.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Nicotiana sylvestris]
Length=856

 Score =   177 bits (450),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 117/145 (81%), Gaps = 5/145 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGE--SLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            MVSRSYSNLL+LASGE  S +FGR  +++ R+ TVAG++S+LDD+   +  SD  SS +Q
Sbjct  1    MVSRSYSNLLELASGEAPSPSFGRMSRRIPRIMTVAGIMSDLDDDGSESVCSDPSSSSAQ  60

Query  345  -ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEII  518
             +R+IIV NQLP+R  R+ DG +GW FSWDE+SLLLQLKDGLG+D +EVIYVGCLKEEI 
Sbjct  61   KDRIIIVANQLPIRVQRKNDGSKGWLFSWDENSLLLQLKDGLGDDELEVIYVGCLKEEI-  119

Query  519  DPNEQDDVAXTLLETFKCVPAFVPP  593
             PNEQD+V+  LLETFKCVP FVPP
Sbjct  120  HPNEQDEVSQILLETFKCVPTFVPP  144



>ref|XP_010650494.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Vitis vinifera]
 emb|CAN76185.1| hypothetical protein VITISV_023086 [Vitis vinifera]
Length=854

 Score =   177 bits (449),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 115/143 (80%), Gaps = 3/143 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  347
            MVSRSYSNLL+LASGES +FGR  +++ R+ TVAG++S+LDD+ S S       SS+ ++
Sbjct  1    MVSRSYSNLLELASGESPSFGRMSRRIPRIMTVAGIISDLDDDPSESVCSDPSSSSVQRD  60

Query  348  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIIDP  524
            R+IIV NQLP+RA R+++   GW FSWDE+SLLLQLKDGLG+D +EVIYVGCLKEEI  P
Sbjct  61   RLIIVANQLPIRAQRKSENNNGWIFSWDENSLLLQLKDGLGDDEIEVIYVGCLKEEI-HP  119

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
             EQD+V+  LLETFKCVP F+PP
Sbjct  120  CEQDEVSQILLETFKCVPTFLPP  142



>ref|XP_010671073.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Beta vulgaris subsp. vulgaris]
 ref|XP_010671074.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Beta vulgaris subsp. vulgaris]
Length=857

 Score =   177 bits (449),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 113/142 (80%), Gaps = 4/142 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGE--SLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+SRSY+NLLDLASG   ++  GR  ++L RV TVAGV+SE+DD+  ++  SDVPSSI Q
Sbjct  1    MMSRSYTNLLDLASGNFPAMEMGREKRRLPRVMTVAGVISEMDDDQANSVSSDVPSSIVQ  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +R+IIV NQLP+RA RR D  +GW+FSWDEDSLLL LK GL ED+EV+YVG LK E +D 
Sbjct  61   DRIIIVANQLPVRAKRRPDN-KGWSFSWDEDSLLLHLKHGLPEDMEVLYVGSLKVE-VDV  118

Query  525  NEQDDVAXTLLETFKCVPAFVP  590
            +EQDDV+  LLE FKCVPAF+P
Sbjct  119  DEQDDVSQILLEKFKCVPAFLP  140



>gb|AJO70168.1| alpha,alpha-trehalose-phosphate synthase 7 [Camellia sinensis]
Length=855

 Score =   177 bits (448),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 111/141 (79%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+SRSY+NLLDLASG     GR  K+L RV TV GV+SELDD+  ++  SDV SS+  +R
Sbjct  1    MMSRSYTNLLDLASGNFPVMGREKKRLPRVMTVPGVISELDDDQANSVTSDVQSSLVVDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIV NQLP++A RR D  +GW+FSWDEDSLLL +KDGL +D+EVIYVG L+ E +DPNE
Sbjct  61   VIIVANQLPVKAKRRPDN-KGWSFSWDEDSLLLHIKDGLPDDMEVIYVGSLRVE-VDPNE  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDV+  LL+ FKCVPAF+PP
Sbjct  119  QDDVSQLLLDRFKCVPAFLPP  139



>ref|XP_007142959.1| hypothetical protein PHAVU_007G031800g [Phaseolus vulgaris]
 ref|XP_007142960.1| hypothetical protein PHAVU_007G031800g [Phaseolus vulgaris]
 gb|ESW14953.1| hypothetical protein PHAVU_007G031800g [Phaseolus vulgaris]
 gb|ESW14954.1| hypothetical protein PHAVU_007G031800g [Phaseolus vulgaris]
Length=853

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 118/141 (84%), Gaps = 3/141 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M SRSYSNLLDL S  S +FGR  K+L RVATVAGVLSELDDES ++ GSD PSS+SQER
Sbjct  1    MASRSYSNLLDLTSCGSPSFGREKKRLPRVATVAGVLSELDDESSNSVGSDTPSSVSQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPL+A R+ +G   W F+WDEDSLLLQL+D LG+DVE IY+GCLKEE I+P+E
Sbjct  61   MIIVGNQLPLKARRKDNG--SWEFTWDEDSLLLQLQDDLGDDVETIYIGCLKEE-IEPSE  117

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA  LL+TFKCVP F+PP
Sbjct  118  QDDVAQYLLDTFKCVPTFLPP  138



>gb|KJB57382.1| hypothetical protein B456_009G160400 [Gossypium raimondii]
Length=857

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 114/143 (80%), Gaps = 4/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+S+SY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SDVPSSI Q
Sbjct  1    MMSKSYTNLLDLASGNFPVMGQPREKKRLPRVMTVPGVISELDDDQANSVASDVPSSIIQ  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +R+IIV NQLP++A RR D  +GW+FSWD+DSLLLQLKDGL E++EV+YVG LK + +DP
Sbjct  61   DRIIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLQLKDGLPEEMEVLYVGSLKVD-VDP  118

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
            +EQDDV+  LL+ FKCVPAF+PP
Sbjct  119  SEQDDVSQLLLDRFKCVPAFLPP  141



>ref|XP_010106616.1| putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
7 [Morus notabilis]
 gb|EXC10946.1| putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
7 [Morus notabilis]
Length=856

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 112/141 (79%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+SRSY+NLLDLASG      R  K+L RV TV G++SELDD+  ++  SDVPSSI Q+R
Sbjct  1    MMSRSYTNLLDLASGNFPIMIREKKRLPRVMTVPGIISELDDDQANSVSSDVPSSIIQDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIVGNQLP++A RR D  +GW+FSWDEDSLLLQLK GL +D+EV+YVG L+ + +D NE
Sbjct  61   IIIVGNQLPVKAKRRPDN-KGWSFSWDEDSLLLQLKSGLPDDMEVLYVGSLRVD-VDLNE  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDV+  LL+ FKCVPAF+PP
Sbjct  119  QDDVSQLLLDRFKCVPAFLPP  139



>ref|XP_002522255.1| trehalose-6-phosphate synthase, putative [Ricinus communis]
 gb|EEF40113.1| trehalose-6-phosphate synthase, putative [Ricinus communis]
Length=853

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 113/143 (79%), Gaps = 4/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+SRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SDVPSS+ Q
Sbjct  1    MMSRSYTNLLDLASGNFPVMGQPREKKRLPRVMTVPGVISELDDDQANSVASDVPSSLVQ  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +R+IIV NQLP++A RR D  +GW+FSWD+DSLLLQLKDGL ED+EVIYVG L+ E +D 
Sbjct  61   DRIIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLQLKDGLPEDMEVIYVGSLRVE-VDM  118

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
            +EQDDV+  LL+ FKCVPAF+PP
Sbjct  119  SEQDDVSQLLLDRFKCVPAFLPP  141



>ref|XP_004503340.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Cicer arietinum]
Length=854

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 114/144 (79%), Gaps = 4/144 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDES--RSNGGSDVPSSISQ  344
            MVSRSYSNLL+LASGES +F    +++ R+ TVAG++S++DD+    S       SS+ +
Sbjct  1    MVSRSYSNLLELASGESPSFEHMNRRIPRIMTVAGLISDVDDDDPLESICSDPSSSSVQR  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIID  521
            ER+IIV NQLP++AHR+ DG + W FSWDE+SLLLQLKDGLG+D VEVIYVGCLKE++  
Sbjct  61   ERIIIVANQLPIKAHRKQDGNKNWFFSWDENSLLLQLKDGLGDDDVEVIYVGCLKEDV-H  119

Query  522  PNEQDDVAXTLLETFKCVPAFVPP  593
            PNEQD+V+  LLETFKCVP F+PP
Sbjct  120  PNEQDEVSQILLETFKCVPTFLPP  143



>ref|XP_011463160.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Fragaria vesca subsp. vesca]
Length=855

 Score =   175 bits (443),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 119/144 (83%), Gaps = 4/144 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGES-LTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ-  344
            MVS+SYSNLL+LASGES  TFGR G+++ R+ TVAG++S++DD+   +  S+V SS  Q 
Sbjct  1    MVSKSYSNLLELASGESSPTFGRIGRRMPRIMTVAGLISDVDDDKPESVCSEVSSSSVQR  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIID  521
            +R+IIV NQLP+RA R++D  +GW FSWDE+SLLLQLKDGLG+D +EVIYVGCLKEEI  
Sbjct  61   DRIIIVANQLPIRAQRKSDTSKGWIFSWDENSLLLQLKDGLGDDEIEVIYVGCLKEEI-H  119

Query  522  PNEQDDVAXTLLETFKCVPAFVPP  593
            PNEQ++V+  LLETFKCVP F+PP
Sbjct  120  PNEQEEVSQILLETFKCVPTFLPP  143



>ref|XP_009804181.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X3 [Nicotiana sylvestris]
Length=757

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 112/141 (79%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+S+SY+NLLDLASG     GR  ++L RV TVAGV+SELDD+  ++  SDVPSSI  +R
Sbjct  1    MLSKSYTNLLDLASGNFPVMGREKRRLPRVMTVAGVISELDDDQANSVTSDVPSSIIVDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIV NQLP++A RR D  +GW+FSWD+DSLLL +KDGL +D+EV+YVGCL+ E +D +E
Sbjct  61   IIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLHIKDGLPDDMEVLYVGCLRVE-VDSSE  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDV+  LL+ FK VPAF+PP
Sbjct  119  QDDVSQLLLDRFKSVPAFLPP  139



>ref|XP_009804180.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X2 [Nicotiana sylvestris]
Length=758

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 112/141 (79%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+S+SY+NLLDLASG     GR  ++L RV TVAGV+SELDD+  ++  SDVPSSI  +R
Sbjct  1    MLSKSYTNLLDLASGNFPVMGREKRRLPRVMTVAGVISELDDDQANSVTSDVPSSIIVDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIV NQLP++A RR D  +GW+FSWD+DSLLL +KDGL +D+EV+YVGCL+ E +D +E
Sbjct  61   IIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLHIKDGLPDDMEVLYVGCLRVE-VDSSE  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDV+  LL+ FK VPAF+PP
Sbjct  119  QDDVSQLLLDRFKSVPAFLPP  139



>ref|XP_011039387.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Populus euphratica]
 ref|XP_011039388.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Populus euphratica]
Length=853

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 114/143 (80%), Gaps = 4/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+SRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SDVPSS+ Q
Sbjct  1    MMSRSYTNLLDLASGNFPAMGQPRERKRLPRVMTVPGVISELDDDVANSVTSDVPSSVVQ  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +R+IIVGNQLP++A RR D  +GW+FSWDEDSLLLQLKDGL E++EV+YVG L+ + ID 
Sbjct  61   DRIIIVGNQLPVKAKRRPDN-KGWSFSWDEDSLLLQLKDGLPEEMEVLYVGSLRAD-IDL  118

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
            +EQ+DV+  LL+ FKCVPAF+PP
Sbjct  119  SEQEDVSQVLLDRFKCVPAFLPP  141



>ref|XP_002317392.1| hypothetical protein POPTR_0011s06910g [Populus trichocarpa]
 ref|XP_006377536.1| glycosyl transferase family 20 family protein [Populus trichocarpa]
 ref|XP_006377537.1| hypothetical protein POPTR_0011s06910g [Populus trichocarpa]
 gb|EEE98004.1| hypothetical protein POPTR_0011s06910g [Populus trichocarpa]
 gb|ERP55333.1| glycosyl transferase family 20 family protein [Populus trichocarpa]
 gb|ERP55334.1| hypothetical protein POPTR_0011s06910g [Populus trichocarpa]
Length=853

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 114/143 (80%), Gaps = 4/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+SRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SDVPSS+ Q
Sbjct  1    MMSRSYTNLLDLASGNFPAMGQPRERKRLPRVMTVPGVISELDDDVANSVTSDVPSSVVQ  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +R+IIVGNQLP++A RR D  +GW+FSWDEDSLLLQLKDGL E++EV+YVG L+ + ID 
Sbjct  61   DRIIIVGNQLPVKAKRRPDN-KGWSFSWDEDSLLLQLKDGLPEEMEVLYVGSLRAD-IDL  118

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
            +EQ+DV+  LL+ FKCVPAF+PP
Sbjct  119  SEQEDVSQILLDRFKCVPAFLPP  141



>ref|XP_010043976.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Eucalyptus grandis]
 gb|KCW85984.1| hypothetical protein EUGRSUZ_B02686 [Eucalyptus grandis]
Length=856

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 115/144 (80%), Gaps = 5/144 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSS--ISQ  344
            MVSRSYSNLL+LASGES +F R  +++ R+ TV G++S++DD++RS G    PSS    +
Sbjct  1    MVSRSYSNLLELASGESPSFSRMSRRIPRIMTVPGIISDVDDDNRSEGSCSDPSSSTTQR  60

Query  345  ERMIIVGNQLPLRAHRRTDGE-EGWNFSWDEDSLLLQLKDGLGE-DVEVIYVGCLKEEII  518
            +R+IIV NQLP+RA R++DG  +GW F+WDE+SLLLQLKDGLG+ D E IYVGCLK++ I
Sbjct  61   DRIIIVANQLPIRAQRKSDGNGKGWIFNWDENSLLLQLKDGLGDNDTEFIYVGCLKDD-I  119

Query  519  DPNEQDDVAXTLLETFKCVPAFVP  590
             P+EQD+V+  LLETF+CVP F+P
Sbjct  120  HPSEQDEVSQILLETFRCVPTFLP  143



>ref|XP_009804177.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X1 [Nicotiana sylvestris]
 ref|XP_009804178.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X1 [Nicotiana sylvestris]
 ref|XP_009804179.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X1 [Nicotiana sylvestris]
Length=849

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 112/141 (79%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+S+SY+NLLDLASG     GR  ++L RV TVAGV+SELDD+  ++  SDVPSSI  +R
Sbjct  1    MLSKSYTNLLDLASGNFPVMGREKRRLPRVMTVAGVISELDDDQANSVTSDVPSSIIVDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIV NQLP++A RR D  +GW+FSWD+DSLLL +KDGL +D+EV+YVGCL+ E +D +E
Sbjct  61   IIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLHIKDGLPDDMEVLYVGCLRVE-VDSSE  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDV+  LL+ FK VPAF+PP
Sbjct  119  QDDVSQLLLDRFKSVPAFLPP  139



>ref|XP_010052171.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Eucalyptus grandis]
 gb|KCW76087.1| hypothetical protein EUGRSUZ_D00465 [Eucalyptus grandis]
Length=864

 Score =   172 bits (437),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 110/141 (78%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+S+SY+NLLDLASG     GR  K+L RV TV   +SELDD+  ++  SDVPSSI Q+R
Sbjct  1    MLSKSYTNLLDLASGNFPVMGREKKRLPRVMTVPVDISELDDDQANSVSSDVPSSIIQDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIV NQLP++A RR D  +GW  SWD+DSLLLQLKDGL +D+EV+YVG L+ + +DP+E
Sbjct  61   IIIVANQLPVKAKRRPDN-KGWALSWDDDSLLLQLKDGLPDDMEVLYVGSLRVD-VDPSE  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDV+  LLE FKCVPAF+PP
Sbjct  119  QDDVSQLLLEKFKCVPAFLPP  139



>ref|XP_002268174.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Vitis vinifera]
Length=853

 Score =   172 bits (436),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 112/140 (80%), Gaps = 3/140 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+SRSY+NLLDLASG     G+  K+L RV TV GV+SELDD+  ++  SDVPSSI Q+R
Sbjct  1    MMSRSYTNLLDLASGNFPLMGQR-KRLPRVMTVPGVISELDDDQANSVTSDVPSSIVQDR  59

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIV NQLP++A RR D  +GW+FSWDEDSLLLQLKDGL +D+EV+YVG L+ + +D NE
Sbjct  60   VIIVANQLPVKAKRRPDN-KGWSFSWDEDSLLLQLKDGLPDDMEVLYVGSLRVD-VDSNE  117

Query  531  QDDVAXTLLETFKCVPAFVP  590
            QDDV+  LL+ FKCVPAF+P
Sbjct  118  QDDVSQVLLDRFKCVPAFLP  137



>ref|XP_004171547.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like, partial [Cucumis sativus]
Length=654

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 111/140 (79%), Gaps = 2/140 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+S+SY+NLLDLASG     GR  K+L RV TVAGV+SELDD+  ++  S+ PSS+ Q+R
Sbjct  1    MMSKSYTNLLDLASGNFPIMGREKKRLPRVMTVAGVISELDDDQANSVTSEGPSSVVQDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIV NQLP++A RR D  +GW+FSWDEDSLL QLKDGL ED+EV+YVG L+ + +D +E
Sbjct  61   IIIVANQLPIKAKRRPDN-KGWSFSWDEDSLLWQLKDGLPEDMEVLYVGSLRVD-VDFSE  118

Query  531  QDDVAXTLLETFKCVPAFVP  590
            Q+DV+  LLE FKCVPAF+P
Sbjct  119  QEDVSQLLLERFKCVPAFLP  138



>ref|XP_008439718.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Cucumis melo]
 ref|XP_008439720.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Cucumis melo]
Length=850

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 111/140 (79%), Gaps = 2/140 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+S+SY+NLLDLASG     GR  K+L RV TVAGV+SELDD+  ++  S+ PSS+ Q+R
Sbjct  1    MMSKSYTNLLDLASGNFPIMGREKKRLPRVMTVAGVISELDDDQANSVTSEGPSSVVQDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIV NQLP++A RR D  +GW+FSWDEDSLL QLKDGL ED+EV+YVG L+ + +D +E
Sbjct  61   IIIVANQLPIKAKRRPDN-KGWSFSWDEDSLLWQLKDGLPEDMEVLYVGSLRVD-VDSSE  118

Query  531  QDDVAXTLLETFKCVPAFVP  590
            Q+DV+  LLE FKCVPAF+P
Sbjct  119  QEDVSQLLLERFKCVPAFLP  138



>gb|KJB69686.1| hypothetical protein B456_011G037000 [Gossypium raimondii]
Length=758

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 110/142 (77%), Gaps = 4/142 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+SRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SD PSS  Q
Sbjct  1    MMSRSYTNLLDLASGNFPAMGQPREKKRLPRVMTVPGVISELDDDQANSVTSDAPSSAIQ  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +R+IIV NQLP++A RR D  +GW+FSWD+DSLLLQLKDGL E++EV+YVG LK + +DP
Sbjct  61   DRIIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLQLKDGLPEEMEVLYVGSLKVD-VDP  118

Query  525  NEQDDVAXTLLETFKCVPAFVP  590
             EQDDV+  LL+ FKCVPAF+P
Sbjct  119  VEQDDVSQLLLDKFKCVPAFLP  140



>gb|ACD56638.1| trehalose synthase-like protein [Gossypioides kirkii]
Length=857

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 110/143 (77%), Gaps = 4/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+SRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SD PSS  Q
Sbjct  1    MMSRSYTNLLDLASGNFPAMGQPREKKRLPRVMTVPGVISELDDDQANSVTSDAPSSAIQ  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +R+IIV NQLP++A RR D  +GW+FSWD+DSLLLQLKDGL E++EV+YVG L  + +DP
Sbjct  61   DRIIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLQLKDGLPEEMEVLYVGSLTVD-VDP  118

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
             EQDDV+  LL+ FKCVPAF+PP
Sbjct  119  VEQDDVSQLLLDKFKCVPAFLPP  141



>gb|AHL29280.1| trehalose-phosphate synthase 6 [Camellia sinensis]
Length=856

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 115/144 (80%), Gaps = 5/144 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESL--TFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSIS  341
            MVSRSYSNLL+LASGES   +F R G+++ R+ TVAG++S+LDD+ S S       SS+ 
Sbjct  1    MVSRSYSNLLELASGESPVPSFSRMGRRIPRIMTVAGIMSDLDDDPSESVCSDRSSSSVH  60

Query  342  QERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEII  518
            ++R+IIV NQLP+R  R+T+  +GW F+WDE+SLLLQLKDGLG+D ++VIYVGCLKEE I
Sbjct  61   RDRIIIVANQLPIRVQRKTENGKGWIFTWDENSLLLQLKDGLGDDEIDVIYVGCLKEE-I  119

Query  519  DPNEQDDVAXTLLETFKCVPAFVP  590
             PNEQD+V+  LLETFKCVP F+P
Sbjct  120  HPNEQDEVSQILLETFKCVPTFLP  143



>gb|KHG11600.1| putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
7 -like protein [Gossypium arboreum]
Length=857

 Score =   169 bits (428),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 110/142 (77%), Gaps = 4/142 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+SRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SD PSS  Q
Sbjct  1    MMSRSYTNLLDLASGNFPAMGQPREKKRLPRVMTVPGVISELDDDQANSVTSDAPSSAIQ  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +R+IIV NQLP++A RR D  +GW+FSWD+DSLLLQLKDGL E++EV+YVG LK + +DP
Sbjct  61   DRIIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLQLKDGLPEEMEVLYVGSLKVD-VDP  118

Query  525  NEQDDVAXTLLETFKCVPAFVP  590
             EQDDV+  LL+ FKCVPAF+P
Sbjct  119  VEQDDVSQLLLDKFKCVPAFLP  140



>ref|XP_002312472.1| hypothetical protein POPTR_0008s13590g [Populus trichocarpa]
 gb|EEE89839.1| hypothetical protein POPTR_0008s13590g [Populus trichocarpa]
Length=851

 Score =   169 bits (428),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 114/143 (80%), Gaps = 3/143 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  347
            MVSRSYSNLL+LASGES +F R  +++ R+ TVAG++S++DD+ S S       SS+   
Sbjct  1    MVSRSYSNLLELASGESPSFERMNRRIPRIMTVAGIMSDIDDDPSESVCSDPSSSSVQMC  60

Query  348  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIIDP  524
            R+IIV NQLP+RA R++DG + W F+WDE+SLLLQLKDGLG+D +EVIYVGCLKEE+   
Sbjct  61   RIIIVANQLPIRAQRKSDGSKSWIFNWDENSLLLQLKDGLGDDEIEVIYVGCLKEEV-HL  119

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
            +EQ++V+ TLLETFKCVP F+PP
Sbjct  120  SEQEEVSQTLLETFKCVPTFLPP  142



>gb|KJB69685.1| hypothetical protein B456_011G037000 [Gossypium raimondii]
Length=857

 Score =   169 bits (428),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 110/142 (77%), Gaps = 4/142 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+SRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SD PSS  Q
Sbjct  1    MMSRSYTNLLDLASGNFPAMGQPREKKRLPRVMTVPGVISELDDDQANSVTSDAPSSAIQ  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +R+IIV NQLP++A RR D  +GW+FSWD+DSLLLQLKDGL E++EV+YVG LK + +DP
Sbjct  61   DRIIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLQLKDGLPEEMEVLYVGSLKVD-VDP  118

Query  525  NEQDDVAXTLLETFKCVPAFVP  590
             EQDDV+  LL+ FKCVPAF+P
Sbjct  119  VEQDDVSQLLLDKFKCVPAFLP  140



>ref|XP_010052868.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X2 [Eucalyptus grandis]
 gb|KCW89661.1| hypothetical protein EUGRSUZ_A01931 [Eucalyptus grandis]
Length=862

 Score =   169 bits (428),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 106/140 (76%), Gaps = 2/140 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+SRSY+NL+DLA+G     GR  K+  R  TV G ++ELDD+   +  S+ PSS++ +R
Sbjct  1    MMSRSYTNLVDLATGNFPAMGREKKRFPRTMTVPGNIAELDDDQAYSVTSENPSSVTSDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPL+A RR D + GW+FSW+EDSLLLQLKDG  +D+EV YVG LK   +DP+E
Sbjct  61   MIIVGNQLPLKATRRPD-DTGWSFSWNEDSLLLQLKDGFADDMEVFYVGLLKVS-VDPSE  118

Query  531  QDDVAXTLLETFKCVPAFVP  590
            QDDV+ TLLE FKCVP F+P
Sbjct  119  QDDVSQTLLEKFKCVPTFLP  138



>ref|XP_010052859.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X1 [Eucalyptus grandis]
Length=876

 Score =   169 bits (428),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 106/140 (76%), Gaps = 2/140 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+SRSY+NL+DLA+G     GR  K+  R  TV G ++ELDD+   +  S+ PSS++ +R
Sbjct  15   MMSRSYTNLVDLATGNFPAMGREKKRFPRTMTVPGNIAELDDDQAYSVTSENPSSVTSDR  74

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPL+A RR D + GW+FSW+EDSLLLQLKDG  +D+EV YVG LK   +DP+E
Sbjct  75   MIIVGNQLPLKATRRPD-DTGWSFSWNEDSLLLQLKDGFADDMEVFYVGLLKVS-VDPSE  132

Query  531  QDDVAXTLLETFKCVPAFVP  590
            QDDV+ TLLE FKCVP F+P
Sbjct  133  QDDVSQTLLEKFKCVPTFLP  152



>ref|XP_008775883.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Phoenix dactylifera]
 ref|XP_008775884.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Phoenix dactylifera]
Length=864

 Score =   169 bits (428),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 115/146 (79%), Gaps = 8/146 (5%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGE--SLTFGRAG---KKLSRVATVAGVLSELDDESRSNG-GSDVPS  332
            M+SRSY+NLLDLASG   +L+ G  G   +++ RV T+ G L+ELD+E R+    SDVPS
Sbjct  1    MMSRSYTNLLDLASGNFAALSVGSQGASRRRMPRVMTMPGALAELDEEDRAGSVSSDVPS  60

Query  333  SISQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEE  512
            SI+Q+R+IIV NQLP+RA RR DG  GW+FSWDEDSLLLQLKDGL +D+EV+YVG L+ +
Sbjct  61   SIAQDRIIIVANQLPVRAKRRPDGR-GWSFSWDEDSLLLQLKDGLPDDMEVLYVGSLRVD  119

Query  513  IIDPNEQDDVAXTLLETFKCVPAFVP  590
             ++ +EQDD+A  LLE FKCVPAF+P
Sbjct  120  -VEVHEQDDIAQALLERFKCVPAFLP  144



>ref|XP_004134569.1| PREDICTED: LOW QUALITY PROTEIN: probable alpha,alpha-trehalose-phosphate 
synthase [UDP-forming] 7-like [Cucumis sativus]
Length=838

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 110/140 (79%), Gaps = 2/140 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+S+SY+NLLDLASG     GR  K+L RV TVAGV+SELDD+  ++  S+ PSS+ Q+R
Sbjct  1    MMSKSYTNLLDLASGNFPIMGREKKRLPRVMTVAGVISELDDDQANSVTSEGPSSVVQDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIV NQLP++A RR D  +GW+FSWDEDSLL QLKDGL ED+EV+YVG L+ + +D  E
Sbjct  61   IIIVANQLPIKAKRRPDN-KGWSFSWDEDSLLWQLKDGLPEDMEVLYVGSLRVD-VDFCE  118

Query  531  QDDVAXTLLETFKCVPAFVP  590
            Q+DV+  LLE FKCVPAF+P
Sbjct  119  QEDVSQLLLERFKCVPAFLP  138



>gb|KGN49325.1| Trehalose-6-phosphate synthase [Cucumis sativus]
Length=850

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 110/140 (79%), Gaps = 2/140 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+S+SY+NLLDLASG     GR  K+L RV TVAGV+SELDD+  ++  S+ PSS+ Q+R
Sbjct  1    MMSKSYTNLLDLASGNFPIMGREKKRLPRVMTVAGVISELDDDQANSVTSEGPSSVVQDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIV NQLP++A RR D  +GW+FSWDEDSLL QLKDGL ED+EV+YVG L+ + +D  E
Sbjct  61   IIIVANQLPIKAKRRPDN-KGWSFSWDEDSLLWQLKDGLPEDMEVLYVGSLRVD-VDFCE  118

Query  531  QDDVAXTLLETFKCVPAFVP  590
            Q+DV+  LLE FKCVPAF+P
Sbjct  119  QEDVSQLLLERFKCVPAFLP  138



>ref|XP_002305726.1| hypothetical protein POPTR_0004s06000g [Populus trichocarpa]
 gb|EEE86237.1| hypothetical protein POPTR_0004s06000g [Populus trichocarpa]
Length=849

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 109/143 (76%), Gaps = 8/143 (6%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            MVSRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD++     SDVPSS+ Q
Sbjct  1    MVSRSYTNLLDLASGNFPAMGQPRERKQLPRVMTVPGVISELDDDA----ASDVPSSVVQ  56

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +RMIIV NQLP++A R  D + GW+FSWDEDSLLL LKDGL ED+EV+YVG L+ + +D 
Sbjct  57   DRMIIVANQLPVKAKRMPDNK-GWSFSWDEDSLLLHLKDGLPEDMEVLYVGSLRAD-VDL  114

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
            +EQDDV+  LL+ F CVPAF+PP
Sbjct  115  SEQDDVSQVLLDRFNCVPAFLPP  137



>ref|XP_009624608.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X3 [Nicotiana tomentosiformis]
Length=754

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 111/140 (79%), Gaps = 5/140 (4%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+S+SY+NLLDLASG    F    ++L RV TVAGV+SELDD+  ++  SDVPSSI  +R
Sbjct  1    MLSKSYTNLLDLASG---NFPVMKRRLPRVMTVAGVISELDDDQANSVTSDVPSSIIVDR  57

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIV NQLP++A RR D + GW+FSWD+DSLLL +KDGL +D+EV+YVGCL+ E +D +E
Sbjct  58   IIIVANQLPVKAKRRPDNK-GWSFSWDDDSLLLHIKDGLPDDMEVLYVGCLRVE-VDSSE  115

Query  531  QDDVAXTLLETFKCVPAFVP  590
            QDDV+  LL+ FKCVPAF+P
Sbjct  116  QDDVSQLLLDRFKCVPAFLP  135



>ref|XP_011024382.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Populus euphratica]
 ref|XP_011024390.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Populus euphratica]
 ref|XP_011024395.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Populus euphratica]
Length=854

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 114/143 (80%), Gaps = 3/143 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQE-  347
            MVSRSYSNLL+LASGES +F R  +++ R+ TVAG++S++DD+   +  SD  SS  Q  
Sbjct  1    MVSRSYSNLLELASGESPSFERMNRRIPRIMTVAGIMSDIDDDPSESVCSDPSSSSGQMY  60

Query  348  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIIDP  524
            R+IIV NQLP+RA R++DG + W FSWDE+SLLLQLKDGLG+D +EVIYVGCLKEE+   
Sbjct  61   RIIIVANQLPIRAQRKSDGSKSWIFSWDENSLLLQLKDGLGDDEIEVIYVGCLKEEV-HL  119

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
            +EQ++V+  LLETFKCVP F+PP
Sbjct  120  SEQEEVSQILLETFKCVPTFLPP  142



>ref|XP_009624607.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X2 [Nicotiana tomentosiformis]
Length=755

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 111/140 (79%), Gaps = 5/140 (4%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+S+SY+NLLDLASG    F    ++L RV TVAGV+SELDD+  ++  SDVPSSI  +R
Sbjct  1    MLSKSYTNLLDLASG---NFPVMKRRLPRVMTVAGVISELDDDQANSVTSDVPSSIIVDR  57

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIV NQLP++A RR D + GW+FSWD+DSLLL +KDGL +D+EV+YVGCL+ E +D +E
Sbjct  58   IIIVANQLPVKAKRRPDNK-GWSFSWDDDSLLLHIKDGLPDDMEVLYVGCLRVE-VDSSE  115

Query  531  QDDVAXTLLETFKCVPAFVP  590
            QDDV+  LL+ FKCVPAF+P
Sbjct  116  QDDVSQLLLDRFKCVPAFLP  135



>ref|XP_010999788.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Populus euphratica]
Length=849

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 110/143 (77%), Gaps = 8/143 (6%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            MVSRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD++     SDVPSS+ Q
Sbjct  1    MVSRSYTNLLDLASGNFPAMGQPRERKQLPRVMTVPGVISELDDDA----ASDVPSSVVQ  56

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +RMIIV NQLP++A RR D + GW+FSWD+DSLLL LKDGL E++EV+YVG L+ + +D 
Sbjct  57   DRMIIVANQLPVKAKRRPDNK-GWSFSWDDDSLLLHLKDGLPEEMEVLYVGSLRAD-VDL  114

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
            +EQDDV+  LL+ F CVPAF+PP
Sbjct  115  SEQDDVSQVLLDRFNCVPAFLPP  137



>gb|KJB68366.1| hypothetical protein B456_010G241200 [Gossypium raimondii]
Length=690

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 112/143 (78%), Gaps = 4/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+SRSY+NLLDLASG     G  R  K+L+RV TV GV+SELDD+  ++  SDV SS++Q
Sbjct  1    MMSRSYTNLLDLASGNFPVMGPVRERKRLTRVMTVPGVVSELDDDQANSVNSDVHSSVNQ  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +R+IIV NQLP++A R  D  +GW+F+WD+ SLLLQLKDGL E++EV+YVG LK + +D 
Sbjct  61   DRIIIVANQLPVKAKRGPDN-KGWSFNWDDYSLLLQLKDGLPEEMEVLYVGSLKID-VDI  118

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
            NEQD+V+  LLE FKCVPAF+PP
Sbjct  119  NEQDEVSSVLLEKFKCVPAFLPP  141



>ref|XP_009624606.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X1 [Nicotiana tomentosiformis]
Length=851

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 111/140 (79%), Gaps = 5/140 (4%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+S+SY+NLLDLASG    F    ++L RV TVAGV+SELDD+  ++  SDVPSSI  +R
Sbjct  1    MLSKSYTNLLDLASG---NFPVMKRRLPRVMTVAGVISELDDDQANSVTSDVPSSIIVDR  57

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIV NQLP++A RR D + GW+FSWD+DSLLL +KDGL +D+EV+YVGCL+ E +D +E
Sbjct  58   IIIVANQLPVKAKRRPDNK-GWSFSWDDDSLLLHIKDGLPDDMEVLYVGCLRVE-VDSSE  115

Query  531  QDDVAXTLLETFKCVPAFVP  590
            QDDV+  LL+ FKCVPAF+P
Sbjct  116  QDDVSQLLLDRFKCVPAFLP  135



>gb|AAG52003.1|AC012563_13 putative trehalose-6-phosphate synthase; 46897-44149 [Arabidopsis 
thaliana]
Length=847

 Score =   167 bits (422),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 109/141 (77%), Gaps = 9/141 (6%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D++S+    S       ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKDTDLS------PKDR  54

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLG-EDVEVIYVGCLKEEIIDPN  527
            +IIV N+LP+RA RR DG  GWNFSWDE+SLLLQLKDGLG E +EVIYVGCLKEE I  N
Sbjct  55   IIIVANELPIRAQRRVDGN-GWNFSWDENSLLLQLKDGLGDEAIEVIYVGCLKEE-IPLN  112

Query  528  EQDDVAXTLLETFKCVPAFVP  590
            EQ++V   LLE+FKCVP F+P
Sbjct  113  EQEEVYQILLESFKCVPTFLP  133



>ref|XP_003630977.1| Alpha,alpha-trehalose-phosphate synthase [Medicago truncatula]
 gb|AET05453.1| trehalose-6-phosphate synthase domain protein [Medicago truncatula]
Length=853

 Score =   166 bits (421),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 111/144 (77%), Gaps = 5/144 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSD-VPSSISQE  347
            MVSRSYSNLL+L SG+S TF    +++ R+ TVAG++S++DD+    G S+   SS+ +E
Sbjct  1    MVSRSYSNLLELVSGDSPTFENINRRIPRIMTVAGLISDVDDDPLETGCSEPSSSSVQRE  60

Query  348  RMIIVGNQLPLRAHRRTDGEE--GWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEII  518
            R+IIV NQLP++A R+ DG     W FSWDE+SLLLQLKDGLG+D  +VIYVGCLKE++ 
Sbjct  61   RIIIVANQLPIKAQRKQDGNNMNKWFFSWDENSLLLQLKDGLGDDDTDVIYVGCLKEDV-  119

Query  519  DPNEQDDVAXTLLETFKCVPAFVP  590
             PNEQD+V+  LLETFKCVP F+P
Sbjct  120  HPNEQDEVSQILLETFKCVPTFLP  143



>gb|KJB68367.1| hypothetical protein B456_010G241200 [Gossypium raimondii]
Length=710

 Score =   165 bits (417),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 112/143 (78%), Gaps = 4/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+SRSY+NLLDLASG     G  R  K+L+RV TV GV+SELDD+  ++  SDV SS++Q
Sbjct  1    MMSRSYTNLLDLASGNFPVMGPVRERKRLTRVMTVPGVVSELDDDQANSVNSDVHSSVNQ  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +R+IIV NQLP++A R  D  +GW+F+WD+ SLLLQLKDGL E++EV+YVG LK + +D 
Sbjct  61   DRIIIVANQLPVKAKRGPDN-KGWSFNWDDYSLLLQLKDGLPEEMEVLYVGSLKID-VDI  118

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
            NEQD+V+  LLE FKCVPAF+PP
Sbjct  119  NEQDEVSSVLLEKFKCVPAFLPP  141



>ref|XP_006391193.1| hypothetical protein EUTSA_v10018111mg [Eutrema salsugineum]
 gb|ESQ28479.1| hypothetical protein EUTSA_v10018111mg [Eutrema salsugineum]
Length=863

 Score =   166 bits (420),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 115/154 (75%), Gaps = 19/154 (12%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSIS-QE  347
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D++S+ +    VPS +S ++
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKES----VPSDLSPKD  56

Query  348  RMIIVGNQLPLRAHRRTDGE------------EGWNFSWDEDSLLLQLKDGLG-EDVEVI  488
            R+IIV N+LP+RA R+ +              +GWNFSWDE+SLLLQLKDGLG E +EVI
Sbjct  57   RIIIVANELPIRAQRKLESNIGSTSTSSSCCSKGWNFSWDENSLLLQLKDGLGDEAIEVI  116

Query  489  YVGCLKEEIIDPNEQDDVAXTLLETFKCVPAFVP  590
            YVGCLKEE I PNEQ++V   LLE+FKCVP F+P
Sbjct  117  YVGCLKEE-IHPNEQEEVYQILLESFKCVPTFLP  149



>ref|XP_010093315.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Morus 
notabilis]
 gb|EXB53854.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Morus 
notabilis]
Length=855

 Score =   166 bits (420),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 112/143 (78%), Gaps = 3/143 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELD-DESRSNGGSDVPSSISQE  347
            MVS+SYSNLL+LASGE  +FGR   ++ R+ TV+G++SE+D D S S       SSI ++
Sbjct  1    MVSKSYSNLLELASGEPPSFGRISGRIPRLMTVSGLISEIDEDPSESVCSDWSSSSIHRD  60

Query  348  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIIDP  524
            R+I+V NQLP+RA RR D  +GW F+WD+ SLLLQ+KDGLG+D VEVIYVGCLKEEI  P
Sbjct  61   RIIMVANQLPIRAQRRLDCSKGWLFNWDDTSLLLQMKDGLGDDEVEVIYVGCLKEEI-HP  119

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
            +EQD+V+  LLE+F+CVP FVPP
Sbjct  120  SEQDEVSQILLESFRCVPTFVPP  142



>ref|XP_004136836.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like [Cucumis sativus]
 ref|XP_004170435.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like [Cucumis sativus]
Length=856

 Score =   166 bits (420),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 105/141 (74%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+SRSY+NLLDLASG         K+  RV TV G ++ELDD+   +  S+ PSSIS +R
Sbjct  1    MISRSYTNLLDLASGNFPAMEVKKKRFPRVMTVPGNVAELDDDQAYSVTSENPSSISSDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIV NQLPLRA RR D +  W+FSW+EDSLLLQLKDGL ED+E++YVG LK + I P E
Sbjct  61   MIIVANQLPLRAKRRED-DNSWSFSWNEDSLLLQLKDGLPEDMEILYVGSLKVD-IQPEE  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QD+V+  LLE F+C+PAF+PP
Sbjct  119  QDEVSQILLEKFRCIPAFLPP  139



>ref|XP_008455290.1| PREDICTED: LOW QUALITY PROTEIN: probable alpha,alpha-trehalose-phosphate 
synthase [UDP-forming] 7 [Cucumis melo]
Length=856

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 105/141 (74%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+SRSY+NLLDLASG         K+  RV TV G ++ELDD+   +  S+ PSSIS +R
Sbjct  1    MISRSYTNLLDLASGNFPAMEVKKKRFPRVMTVPGNVAELDDDQAYSVTSENPSSISSDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIV NQLPLRA RR D +  W+FSW+EDSLLLQLKDGL ED+E++YVG LK + I P E
Sbjct  61   MIIVANQLPLRAKRRED-DNSWSFSWNEDSLLLQLKDGLPEDMEILYVGSLKVD-IQPEE  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QD+V+  LLE F+C+PAF+PP
Sbjct  119  QDEVSQILLERFRCIPAFLPP  139



>ref|XP_002281386.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Vitis vinifera]
Length=705

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 109/140 (78%), Gaps = 2/140 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+SRSY+NLLDLA+G     GR  K+L RV TV G + ELDD+  ++  SD PSS++Q+R
Sbjct  1    MMSRSYTNLLDLATGNFPAIGRERKRLPRVMTVPGNVYELDDDQANSVSSDNPSSVAQDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIV NQLP++A+RR D + GW FSW+EDSLLLQLK+GL ED+EV+YVG L+ + +D  E
Sbjct  61   LIIVANQLPVKANRRAD-DRGWVFSWNEDSLLLQLKEGLPEDMEVLYVGSLRVD-VDLTE  118

Query  531  QDDVAXTLLETFKCVPAFVP  590
            Q++V+  LLETFKCVP F+P
Sbjct  119  QEEVSQILLETFKCVPTFLP  138



>gb|KJB68365.1| hypothetical protein B456_010G241200 [Gossypium raimondii]
Length=857

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 112/143 (78%), Gaps = 4/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+SRSY+NLLDLASG     G  R  K+L+RV TV GV+SELDD+  ++  SDV SS++Q
Sbjct  1    MMSRSYTNLLDLASGNFPVMGPVRERKRLTRVMTVPGVVSELDDDQANSVNSDVHSSVNQ  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +R+IIV NQLP++A R  D  +GW+F+WD+ SLLLQLKDGL E++EV+YVG LK + +D 
Sbjct  61   DRIIIVANQLPVKAKRGPDN-KGWSFNWDDYSLLLQLKDGLPEEMEVLYVGSLKID-VDI  118

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
            NEQD+V+  LLE FKCVPAF+PP
Sbjct  119  NEQDEVSSVLLEKFKCVPAFLPP  141



>gb|KGN43637.1| hypothetical protein Csa_7G049190 [Cucumis sativus]
Length=971

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 106/144 (74%), Gaps = 2/144 (1%)
 Frame = +3

Query  162  ESTMVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSIS  341
            +  M+SRSY+NLLDLASG         K+  RV TV G ++ELDD+   +  S+ PSSIS
Sbjct  113  KRNMISRSYTNLLDLASGNFPAMEVKKKRFPRVMTVPGNVAELDDDQAYSVTSENPSSIS  172

Query  342  QERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIID  521
             +RMIIV NQLPLRA RR D +  W+FSW+EDSLLLQLKDGL ED+E++YVG LK + I 
Sbjct  173  SDRMIIVANQLPLRAKRRED-DNSWSFSWNEDSLLLQLKDGLPEDMEILYVGSLKVD-IQ  230

Query  522  PNEQDDVAXTLLETFKCVPAFVPP  593
            P EQD+V+  LLE F+C+PAF+PP
Sbjct  231  PEEQDEVSQILLEKFRCIPAFLPP  254



>ref|XP_007025310.1| Trehalose-phosphatase/synthase 7 isoform 4 [Theobroma cacao]
 gb|EOY27932.1| Trehalose-phosphatase/synthase 7 isoform 4 [Theobroma cacao]
Length=754

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 115/143 (80%), Gaps = 4/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRA--GKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+SRSY+NLLDLASG     G+A   K+L RV TV GV+SELDD+  ++  SDVPSS+ Q
Sbjct  1    MMSRSYTNLLDLASGNFPVMGQAREKKRLPRVMTVPGVISELDDDQANSVSSDVPSSVIQ  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +R+IIV NQLP++A RR D  +GW+FSWD+DSLLLQLKDGL E++EV+YVG LK + +DP
Sbjct  61   DRIIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLQLKDGLPEEMEVLYVGSLKVD-VDP  118

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
            NEQDDV+  LL+ FKCVPAF+PP
Sbjct  119  NEQDDVSQLLLDRFKCVPAFLPP  141



>ref|XP_010511784.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X5 [Camelina sativa]
Length=863

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 111/154 (72%), Gaps = 21/154 (14%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D+E++    S       ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNETKETDLS------PKDR  54

Query  351  MIIVGNQLPLRAHRRTDGE-------------EGWNFSWDEDSLLLQLKDGLGE-DVEVI  488
            +IIV N+LP+RA RR DG              +GWNFSWD++SLLLQLKDGLG+  +EVI
Sbjct  55   IIIVANELPIRAQRRVDGNGSSSSSTSSICCSKGWNFSWDKNSLLLQLKDGLGDGAIEVI  114

Query  489  YVGCLKEEIIDPNEQDDVAXTLLETFKCVPAFVP  590
            YVGCLKEE I PNEQ++V   LLE+FKCVP F+P
Sbjct  115  YVGCLKEE-IHPNEQEEVYQVLLESFKCVPTFLP  147



>ref|XP_010511780.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X1 [Camelina sativa]
 ref|XP_010511781.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X2 [Camelina sativa]
 ref|XP_010511783.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X4 [Camelina sativa]
Length=862

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 111/154 (72%), Gaps = 21/154 (14%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D+E++    S       ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNETKETDLS------PKDR  54

Query  351  MIIVGNQLPLRAHRRTDGE-------------EGWNFSWDEDSLLLQLKDGLGE-DVEVI  488
            +IIV N+LP+RA RR DG              +GWNFSWD++SLLLQLKDGLG+  +EVI
Sbjct  55   IIIVANELPIRAQRRVDGNGSSSSSTSSICCSKGWNFSWDKNSLLLQLKDGLGDGAIEVI  114

Query  489  YVGCLKEEIIDPNEQDDVAXTLLETFKCVPAFVP  590
            YVGCLKEE I PNEQ++V   LLE+FKCVP F+P
Sbjct  115  YVGCLKEE-IHPNEQEEVYQVLLESFKCVPTFLP  147



>ref|XP_007025309.1| Trehalose-phosphatase/synthase 7 isoform 3 [Theobroma cacao]
 gb|EOY27931.1| Trehalose-phosphatase/synthase 7 isoform 3 [Theobroma cacao]
Length=764

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 115/143 (80%), Gaps = 4/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRA--GKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+SRSY+NLLDLASG     G+A   K+L RV TV GV+SELDD+  ++  SDVPSS+ Q
Sbjct  1    MMSRSYTNLLDLASGNFPVMGQAREKKRLPRVMTVPGVISELDDDQANSVSSDVPSSVIQ  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +R+IIV NQLP++A RR D  +GW+FSWD+DSLLLQLKDGL E++EV+YVG LK + +DP
Sbjct  61   DRIIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLQLKDGLPEEMEVLYVGSLKVD-VDP  118

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
            NEQDDV+  LL+ FKCVPAF+PP
Sbjct  119  NEQDDVSQLLLDRFKCVPAFLPP  141



>ref|NP_564918.1| alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Arabidopsis 
thaliana]
 gb|AAK76702.1| putative trehalose-6-phosphate synthase [Arabidopsis thaliana]
 gb|AEE34737.1| alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Arabidopsis 
thaliana]
 gb|AHL38889.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=700

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 110/153 (72%), Gaps = 20/153 (13%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D++S+    S       ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKDTDLS------PKDR  54

Query  351  MIIVGNQLPLRAHRRTDGE------------EGWNFSWDEDSLLLQLKDGLG-EDVEVIY  491
            +IIV N+LP+RA RR DG             +GWNFSWDE+SLLLQLKDGLG E +EVIY
Sbjct  55   IIIVANELPIRAQRRVDGNGSGSSSSSTCCSKGWNFSWDENSLLLQLKDGLGDEAIEVIY  114

Query  492  VGCLKEEIIDPNEQDDVAXTLLETFKCVPAFVP  590
            VGCLKEE I  NEQ++V   LLE+FKCVP F+P
Sbjct  115  VGCLKEE-IPLNEQEEVYQILLESFKCVPTFLP  146



>gb|KJB30628.1| hypothetical protein B456_005G152400 [Gossypium raimondii]
Length=681

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 114/156 (73%), Gaps = 16/156 (10%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  347
            MVSRSYSNLL+LASGE+ + GR  +++ R+ TV G++S++DD+ S S       SS  ++
Sbjct  1    MVSRSYSNLLELASGEAPSLGRISRRIPRIMTVPGIISDIDDDPSESVCSDPSSSSSQKD  60

Query  348  RMIIVGNQLPLRAHRRTDGEE-------------GWNFSWDEDSLLLQLKDGLG-EDVEV  485
            R+I+V NQLP+RAHR++D  +              W FSWD++SLLLQ++DGLG +DVEV
Sbjct  61   RIIMVANQLPIRAHRKSDNNKNGSSSCSTTTTSNNWIFSWDDNSLLLQMRDGLGDDDVEV  120

Query  486  IYVGCLKEEIIDPNEQDDVAXTLLETFKCVPAFVPP  593
            IY+GCLKEE I PNEQD+V+  LLETFKCVP F+PP
Sbjct  121  IYIGCLKEE-IHPNEQDEVSQILLETFKCVPTFLPP  155



>ref|XP_007045543.1| UDP-Glycosyltransferase / trehalose-phosphatase family protein 
isoform 3 [Theobroma cacao]
 gb|EOY01375.1| UDP-Glycosyltransferase / trehalose-phosphatase family protein 
isoform 3 [Theobroma cacao]
Length=777

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 115/151 (76%), Gaps = 11/151 (7%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  347
            MVSRSYSNLL+LASGE+ +FGR  +++ R+ TV G++S++DD+ S S       SS+ ++
Sbjct  1    MVSRSYSNLLELASGEAPSFGRMSRRIPRIMTVPGIISDIDDDPSESVCSDPSSSSVQRD  60

Query  348  RMIIVGNQLPLRAHRR--------TDGEEGWNFSWDEDSLLLQLKDGLG-EDVEVIYVGC  500
            R+I+V NQLP+RA R+        +   +GW FSWDE+SLLLQ+KDGLG +D+EVIYVGC
Sbjct  61   RIIMVANQLPIRAQRKSDSTNNGSSSSSKGWIFSWDENSLLLQMKDGLGDDDIEVIYVGC  120

Query  501  LKEEIIDPNEQDDVAXTLLETFKCVPAFVPP  593
            LKEE I PNEQD+V+  LL+TF+CVP F+PP
Sbjct  121  LKEE-IHPNEQDEVSQILLDTFRCVPTFLPP  150



>ref|XP_010557135.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X1 [Tarenaya hassleriana]
 ref|XP_010557136.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X2 [Tarenaya hassleriana]
Length=851

 Score =   164 bits (415),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 103/141 (73%), Gaps = 4/141 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+SRSY+NLLDLASG     GR  ++L RV TV G +SE D++   +  SD PSSIS +R
Sbjct  1    MISRSYTNLLDLASGNFPVMGRERRRLPRVMTVPGNVSEFDEDQAYSVSSDNPSSISTDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIV N+LPL+A RR      WNFSW++DSL LQLKDGL ED+EV+YVG L  + +DP E
Sbjct  61   MIIVANRLPLKAERRNG---SWNFSWNQDSLYLQLKDGLPEDMEVLYVGSLDVD-VDPYE  116

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA  LL+ FKCVP F+PP
Sbjct  117  QDDVAQILLDGFKCVPTFLPP  137



>ref|XP_007025308.1| Trehalose-phosphatase/synthase 7 isoform 2 [Theobroma cacao]
 gb|EOY27930.1| Trehalose-phosphatase/synthase 7 isoform 2 [Theobroma cacao]
Length=857

 Score =   164 bits (415),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 115/143 (80%), Gaps = 4/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRA--GKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+SRSY+NLLDLASG     G+A   K+L RV TV GV+SELDD+  ++  SDVPSS+ Q
Sbjct  1    MMSRSYTNLLDLASGNFPVMGQAREKKRLPRVMTVPGVISELDDDQANSVSSDVPSSVIQ  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +R+IIV NQLP++A RR D  +GW+FSWD+DSLLLQLKDGL E++EV+YVG LK + +DP
Sbjct  61   DRIIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLQLKDGLPEEMEVLYVGSLKVD-VDP  118

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
            NEQDDV+  LL+ FKCVPAF+PP
Sbjct  119  NEQDDVSQLLLDRFKCVPAFLPP  141



>ref|XP_003633255.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Vitis vinifera]
Length=855

 Score =   164 bits (414),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 109/140 (78%), Gaps = 2/140 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+SRSY+NLLDLA+G     GR  K+L RV TV G + ELDD+  ++  SD PSS++Q+R
Sbjct  1    MMSRSYTNLLDLATGNFPAIGRERKRLPRVMTVPGNVYELDDDQANSVSSDNPSSVAQDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIV NQLP++A+RR D + GW FSW+EDSLLLQLK+GL ED+EV+YVG L+ + +D  E
Sbjct  61   LIIVANQLPVKANRRAD-DRGWVFSWNEDSLLLQLKEGLPEDMEVLYVGSLRVD-VDLEE  118

Query  531  QDDVAXTLLETFKCVPAFVP  590
            Q++V+  LLETFKCVP F+P
Sbjct  119  QEEVSQILLETFKCVPTFLP  138



>emb|CAN67058.1| hypothetical protein VITISV_036715 [Vitis vinifera]
Length=886

 Score =   164 bits (415),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 109/140 (78%), Gaps = 2/140 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+SRSY+NLLDLA+G     GR  K+L RV TV G + ELDD+  ++  SD PSS++Q+R
Sbjct  1    MMSRSYTNLLDLATGNFPAIGRERKRLPRVMTVPGNVYELDDDQANSVSSDNPSSVAQDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIV NQLP++A+RR D + GW FSW+EDSLLLQLK+GL ED+EV+YVG L+ + +D  E
Sbjct  61   LIIVANQLPVKANRRAD-DRGWVFSWNEDSLLLQLKEGLPEDMEVLYVGSLRVD-VDLEE  118

Query  531  QDDVAXTLLETFKCVPAFVP  590
            Q++V+  LLETFKCVP F+P
Sbjct  119  QEEVSQILLETFKCVPTFLP  138



>ref|XP_007045541.1| UDP-Glycosyltransferase / trehalose-phosphatase family protein 
isoform 1 [Theobroma cacao]
 ref|XP_007045542.1| UDP-Glycosyltransferase / trehalose-phosphatase family protein 
isoform 1 [Theobroma cacao]
 gb|EOY01373.1| UDP-Glycosyltransferase / trehalose-phosphatase family protein 
isoform 1 [Theobroma cacao]
 gb|EOY01374.1| UDP-Glycosyltransferase / trehalose-phosphatase family protein 
isoform 1 [Theobroma cacao]
Length=862

 Score =   164 bits (414),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 115/151 (76%), Gaps = 11/151 (7%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  347
            MVSRSYSNLL+LASGE+ +FGR  +++ R+ TV G++S++DD+ S S       SS+ ++
Sbjct  1    MVSRSYSNLLELASGEAPSFGRMSRRIPRIMTVPGIISDIDDDPSESVCSDPSSSSVQRD  60

Query  348  RMIIVGNQLPLRAHRR--------TDGEEGWNFSWDEDSLLLQLKDGLG-EDVEVIYVGC  500
            R+I+V NQLP+RA R+        +   +GW FSWDE+SLLLQ+KDGLG +D+EVIYVGC
Sbjct  61   RIIMVANQLPIRAQRKSDSTNNGSSSSSKGWIFSWDENSLLLQMKDGLGDDDIEVIYVGC  120

Query  501  LKEEIIDPNEQDDVAXTLLETFKCVPAFVPP  593
            LKEE I PNEQD+V+  LL+TF+CVP F+PP
Sbjct  121  LKEE-IHPNEQDEVSQILLDTFRCVPTFLPP  150



>gb|KJB30627.1| hypothetical protein B456_005G152400 [Gossypium raimondii]
Length=800

 Score =   163 bits (412),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 114/156 (73%), Gaps = 16/156 (10%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  347
            MVSRSYSNLL+LASGE+ + GR  +++ R+ TV G++S++DD+ S S       SS  ++
Sbjct  1    MVSRSYSNLLELASGEAPSLGRISRRIPRIMTVPGIISDIDDDPSESVCSDPSSSSSQKD  60

Query  348  RMIIVGNQLPLRAHRRTDGEE-------------GWNFSWDEDSLLLQLKDGLG-EDVEV  485
            R+I+V NQLP+RAHR++D  +              W FSWD++SLLLQ++DGLG +DVEV
Sbjct  61   RIIMVANQLPIRAHRKSDNNKNGSSSCSTTTTSNNWIFSWDDNSLLLQMRDGLGDDDVEV  120

Query  486  IYVGCLKEEIIDPNEQDDVAXTLLETFKCVPAFVPP  593
            IY+GCLKEE I PNEQD+V+  LLETFKCVP F+PP
Sbjct  121  IYIGCLKEE-IHPNEQDEVSQILLETFKCVPTFLPP  155



>ref|XP_007025307.1| Trehalose-phosphatase/synthase 7 isoform 1 [Theobroma cacao]
 gb|EOY27929.1| Trehalose-phosphatase/synthase 7 isoform 1 [Theobroma cacao]
Length=888

 Score =   164 bits (414),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 115/143 (80%), Gaps = 4/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRA--GKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+SRSY+NLLDLASG     G+A   K+L RV TV GV+SELDD+  ++  SDVPSS+ Q
Sbjct  1    MMSRSYTNLLDLASGNFPVMGQAREKKRLPRVMTVPGVISELDDDQANSVSSDVPSSVIQ  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +R+IIV NQLP++A RR D  +GW+FSWD+DSLLLQLKDGL E++EV+YVG LK + +DP
Sbjct  61   DRIIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLQLKDGLPEEMEVLYVGSLKVD-VDP  118

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
            NEQDDV+  LL+ FKCVPAF+PP
Sbjct  119  NEQDDVSQLLLDRFKCVPAFLPP  141



>gb|KDO60795.1| hypothetical protein CISIN_1g044635mg [Citrus sinensis]
Length=831

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 116/143 (81%), Gaps = 3/143 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ-E  347
            MVS+SYSNLL+LASGE+ +FGR  +++ R+ TVAG++S+LDD+   +  SD  SS  Q +
Sbjct  1    MVSKSYSNLLELASGEAPSFGRMRRRIPRIMTVAGIISDLDDDPADSVCSDPSSSSVQRD  60

Query  348  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLG-EDVEVIYVGCLKEEIIDP  524
            R+IIV NQLP+RA R++D  +GW FSWDE+SLLLQLKDGLG +D+EVIYVGCLKEE I  
Sbjct  61   RIIIVANQLPIRAQRKSDNSKGWIFSWDENSLLLQLKDGLGDDDIEVIYVGCLKEE-IHV  119

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
            NEQD+V+  LL+TFKCVP F+PP
Sbjct  120  NEQDEVSQILLDTFKCVPTFLPP  142



>ref|XP_003607607.1| Trehalose synthase-like protein [Medicago truncatula]
 gb|AES89804.1| trehalose-6-phosphate synthase domain protein [Medicago truncatula]
Length=861

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 110/148 (74%), Gaps = 9/148 (6%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFG-------RAGKKLSRVATVAGVLSELDDESRSNGGSDVP  329
            M+SRSY+NLLDLASG     G       +  +++ RV +V G++SE+DD+   +  SD P
Sbjct  1    MMSRSYTNLLDLASGNFPAMGSGSGREFKERRRMPRVMSVPGIVSEVDDDQAVSVSSDNP  60

Query  330  SSISQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKE  509
            S+I+ +R+IIV NQLPL+A++R D + GWNFSW+EDSLLLQLKDG  E++EV+YVG L+ 
Sbjct  61   STITTDRIIIVANQLPLKANKREDNK-GWNFSWNEDSLLLQLKDGFPEEMEVLYVGSLRV  119

Query  510  EIIDPNEQDDVAXTLLETFKCVPAFVPP  593
            + IDP EQDDV+  LLE FKCVP F+PP
Sbjct  120  D-IDPAEQDDVSQYLLEKFKCVPTFLPP  146



>ref|XP_006448141.1| hypothetical protein CICLE_v10014251mg [Citrus clementina]
 ref|XP_006448142.1| hypothetical protein CICLE_v10014251mg [Citrus clementina]
 ref|XP_006469268.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Citrus sinensis]
 gb|ESR61381.1| hypothetical protein CICLE_v10014251mg [Citrus clementina]
 gb|ESR61382.1| hypothetical protein CICLE_v10014251mg [Citrus clementina]
Length=854

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 116/143 (81%), Gaps = 3/143 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ-E  347
            MVS+SYSNLL+LASGE+ +FGR  +++ R+ TVAG++S+LDD+   +  SD  SS  Q +
Sbjct  1    MVSKSYSNLLELASGEAPSFGRMRRRIPRIMTVAGIISDLDDDPADSVCSDPSSSSVQRD  60

Query  348  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLG-EDVEVIYVGCLKEEIIDP  524
            R+IIV NQLP+RA R++D  +GW FSWDE+SLLLQLKDGLG +D+EVIYVGCLKEE I  
Sbjct  61   RIIIVANQLPIRAQRKSDNSKGWIFSWDENSLLLQLKDGLGDDDIEVIYVGCLKEE-IHV  119

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
            NEQD+V+  LL+TFKCVP F+PP
Sbjct  120  NEQDEVSQILLDTFKCVPTFLPP  142



>ref|XP_009411218.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Musa acuminata subsp. malaccensis]
Length=873

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 110/144 (76%), Gaps = 6/144 (4%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGE--SLTFGRAGKKLSRVATVAGVLSELD--DESRSNGGSDVPSSI  338
            M+SRSY+NLLDLASG   +L+ G   +++SR  TV G LS LD  D+   +  SDVPSSI
Sbjct  1    MMSRSYTNLLDLASGNFSALSLGGRSRRMSRTMTVPGSLSGLDEDDDRAISVSSDVPSSI  60

Query  339  SQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEII  518
            +Q+R+IIV NQLP+RA RR DG  GW+F+WD+DSLLLQLK GL +D+EV+YVG L+   +
Sbjct  61   AQDRVIIVANQLPVRARRRPDGH-GWSFAWDDDSLLLQLKGGLPDDMEVLYVGSLRVH-V  118

Query  519  DPNEQDDVAXTLLETFKCVPAFVP  590
            DP EQD+VA  LLE F+CVPAF+P
Sbjct  119  DPREQDEVAQALLERFRCVPAFLP  142



>ref|XP_003529226.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Glycine max]
 gb|KHN19098.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Glycine 
soja]
Length=853

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 114/143 (80%), Gaps = 5/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSIS-QE  347
            MVS+SYSNLL+LASGE+ +FG   +++ R+ TVAG++S++DD+   +  SD  SS + ++
Sbjct  1    MVSKSYSNLLELASGEAPSFGYMNRRIPRIMTVAGLISDVDDDPVESVCSDPSSSTAHRD  60

Query  348  RMIIVGNQLPLRAHRRTDGEEG-WNFSWDEDSLLLQLKDGLG-EDVEVIYVGCLKEEIID  521
            R+I+V NQLP+RA RR DG    W+F WDE++ LLQLKDGLG +D+EVIYVGCLKEE + 
Sbjct  61   RIIMVANQLPIRAQRRPDGNRSCWSFEWDENA-LLQLKDGLGDDDIEVIYVGCLKEE-VH  118

Query  522  PNEQDDVAXTLLETFKCVPAFVP  590
            P+EQD+V+ TLLETFKC+P F+P
Sbjct  119  PSEQDEVSQTLLETFKCIPTFLP  141



>ref|NP_974105.1| alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Arabidopsis 
thaliana]
 sp|Q94AH8.2|TPS6_ARATH RecName: Full=Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6; AltName: Full=Trehalose-6-phosphate synthase 6; Short=AtTPS6 
[Arabidopsis thaliana]
 gb|AEE34738.1| alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Arabidopsis 
thaliana]
Length=860

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 110/153 (72%), Gaps = 20/153 (13%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D++S+    S       ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKDTDLS------PKDR  54

Query  351  MIIVGNQLPLRAHRRTDGE------------EGWNFSWDEDSLLLQLKDGLG-EDVEVIY  491
            +IIV N+LP+RA RR DG             +GWNFSWDE+SLLLQLKDGLG E +EVIY
Sbjct  55   IIIVANELPIRAQRRVDGNGSGSSSSSTCCSKGWNFSWDENSLLLQLKDGLGDEAIEVIY  114

Query  492  VGCLKEEIIDPNEQDDVAXTLLETFKCVPAFVP  590
            VGCLKEE I  NEQ++V   LLE+FKCVP F+P
Sbjct  115  VGCLKEE-IPLNEQEEVYQILLESFKCVPTFLP  146



>ref|XP_004505467.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like [Cicer arietinum]
Length=860

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 110/146 (75%), Gaps = 7/146 (5%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFG-----RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSS  335
            M+SRSY+NLLDLASG     G     +  ++L RV +V G++SELDD+   +  SD PS+
Sbjct  1    MMSRSYTNLLDLASGNFPAMGSGREFKERRRLPRVMSVPGIVSELDDDQAVSVSSDNPST  60

Query  336  ISQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEI  515
            IS +R+IIV NQLPL+A RR D ++GW+FSW+ED+LLLQLKDG  E++EV+YVG L+ + 
Sbjct  61   ISTDRIIIVANQLPLKAKRRED-DKGWSFSWNEDALLLQLKDGFPEEMEVLYVGSLRID-  118

Query  516  IDPNEQDDVAXTLLETFKCVPAFVPP  593
            IDP EQDDV+  LL+ FKCVP F+PP
Sbjct  119  IDPAEQDDVSQYLLDKFKCVPTFLPP  144



>gb|KJB30625.1| hypothetical protein B456_005G152400 [Gossypium raimondii]
 gb|KJB30626.1| hypothetical protein B456_005G152400 [Gossypium raimondii]
Length=869

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 114/156 (73%), Gaps = 16/156 (10%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  347
            MVSRSYSNLL+LASGE+ + GR  +++ R+ TV G++S++DD+ S S       SS  ++
Sbjct  1    MVSRSYSNLLELASGEAPSLGRISRRIPRIMTVPGIISDIDDDPSESVCSDPSSSSSQKD  60

Query  348  RMIIVGNQLPLRAHRRTDGEE-------------GWNFSWDEDSLLLQLKDGLG-EDVEV  485
            R+I+V NQLP+RAHR++D  +              W FSWD++SLLLQ++DGLG +DVEV
Sbjct  61   RIIMVANQLPIRAHRKSDNNKNGSSSCSTTTTSNNWIFSWDDNSLLLQMRDGLGDDDVEV  120

Query  486  IYVGCLKEEIIDPNEQDDVAXTLLETFKCVPAFVPP  593
            IY+GCLKEE I PNEQD+V+  LLETFKCVP F+PP
Sbjct  121  IYIGCLKEE-IHPNEQDEVSQILLETFKCVPTFLPP  155



>ref|XP_010415412.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Camelina sativa]
Length=859

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 111/152 (73%), Gaps = 19/152 (13%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D+E++    S       ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNETKETDLS------PKDR  54

Query  351  MIIVGNQLPLRAHRRTDGE-----------EGWNFSWDEDSLLLQLKDGLGE-DVEVIYV  494
            +IIV N+LP+RA RR DG            +GWNFSWD++SLLLQLKDGLG+  +EVIYV
Sbjct  55   IIIVANELPIRAQRRVDGSTSGSTSSTCCSKGWNFSWDKNSLLLQLKDGLGDGAIEVIYV  114

Query  495  GCLKEEIIDPNEQDDVAXTLLETFKCVPAFVP  590
            GCLKEE I PNEQ++V   LLE+FKCVP F+P
Sbjct  115  GCLKEE-IHPNEQEEVYQVLLESFKCVPTFLP  145



>ref|XP_006300724.1| hypothetical protein CARUB_v10019781mg [Capsella rubella]
 gb|EOA33622.1| hypothetical protein CARUB_v10019781mg [Capsella rubella]
Length=863

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 111/155 (72%), Gaps = 22/155 (14%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D++S+    S       ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKETDLS------PKDR  54

Query  351  MIIVGNQLPLRAHRRTDGE--------------EGWNFSWDEDSLLLQLKDGLG-EDVEV  485
            +IIV N+LP+RA RR DG               +GWNFSWD++SLLLQLKDGLG E +EV
Sbjct  55   IIIVANELPIRAQRRVDGSSGSTSGGSTSTCCSKGWNFSWDKNSLLLQLKDGLGDEAIEV  114

Query  486  IYVGCLKEEIIDPNEQDDVAXTLLETFKCVPAFVP  590
            IYVGCLKEE I PNEQ++V   LLE+FKCVP F+P
Sbjct  115  IYVGCLKEE-IHPNEQEEVYQVLLESFKCVPTFLP  148



>gb|KDO77921.1| hypothetical protein CISIN_1g003025mg [Citrus sinensis]
Length=761

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 114/143 (80%), Gaps = 4/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+S+SY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SDVPSS++Q
Sbjct  1    MMSKSYTNLLDLASGNFPAMGPSREKKRLPRVMTVPGVISELDDDQANSVSSDVPSSVAQ  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +R+IIV NQLP++A RR D  +GW+FSWDEDSLLLQLKDGL ED+EVIYVG LK + +D 
Sbjct  61   DRVIIVANQLPVKAKRRPDN-KGWSFSWDEDSLLLQLKDGLPEDMEVIYVGSLKVD-VDL  118

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
            +EQDDV+  LL+ FKCVPAF+PP
Sbjct  119  SEQDDVSQLLLDRFKCVPAFLPP  141



>ref|XP_008225229.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Prunus mume]
Length=854

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 112/140 (80%), Gaps = 2/140 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+S+SY+NLLDLASG     GR  ++L RV TVAGV+SELDD+  ++  SDVPSS+ Q+R
Sbjct  1    MMSKSYTNLLDLASGNFPIMGRERRRLPRVMTVAGVISELDDDQANSVSSDVPSSVMQDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIV NQLP++A RR D  +GW+FSWDEDSLLLQLKDGL E++EV+YVG L  E +D NE
Sbjct  61   IIIVANQLPVKAKRRPDN-KGWSFSWDEDSLLLQLKDGLPEEMEVLYVGSLNVE-VDSNE  118

Query  531  QDDVAXTLLETFKCVPAFVP  590
            QDDV+  LL+ FKCVPAF+P
Sbjct  119  QDDVSQLLLDRFKCVPAFLP  138



>ref|XP_006467609.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like [Citrus sinensis]
 gb|KDO77917.1| hypothetical protein CISIN_1g003025mg [Citrus sinensis]
 gb|KDO77918.1| hypothetical protein CISIN_1g003025mg [Citrus sinensis]
 gb|KDO77919.1| hypothetical protein CISIN_1g003025mg [Citrus sinensis]
 gb|KDO77920.1| hypothetical protein CISIN_1g003025mg [Citrus sinensis]
Length=856

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 114/143 (80%), Gaps = 4/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+S+SY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SDVPSS++Q
Sbjct  1    MMSKSYTNLLDLASGNFPAMGPSREKKRLPRVMTVPGVISELDDDQANSVSSDVPSSVAQ  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +R+IIV NQLP++A RR D  +GW+FSWDEDSLLLQLKDGL ED+EVIYVG LK + +D 
Sbjct  61   DRVIIVANQLPVKAKRRPDN-KGWSFSWDEDSLLLQLKDGLPEDMEVIYVGSLKVD-VDL  118

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
            +EQDDV+  LL+ FKCVPAF+PP
Sbjct  119  SEQDDVSQLLLDRFKCVPAFLPP  141



>ref|XP_006449548.1| hypothetical protein CICLE_v10014248mg [Citrus clementina]
 ref|XP_006449549.1| hypothetical protein CICLE_v10014248mg [Citrus clementina]
 gb|ESR62788.1| hypothetical protein CICLE_v10014248mg [Citrus clementina]
 gb|ESR62789.1| hypothetical protein CICLE_v10014248mg [Citrus clementina]
Length=856

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 114/143 (80%), Gaps = 4/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+S+SY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SDVPSS++Q
Sbjct  1    MMSKSYTNLLDLASGNFPAMGPSREKKRLPRVMTVPGVISELDDDQANSVSSDVPSSVAQ  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +R+IIV NQLP++A RR D  +GW+FSWDEDSLLLQLKDGL ED+EVIYVG LK + +D 
Sbjct  61   DRVIIVANQLPVKAKRRPDN-KGWSFSWDEDSLLLQLKDGLPEDMEVIYVGSLKVD-VDL  118

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
            +EQDDV+  LL+ FKCVPAF+PP
Sbjct  119  SEQDDVSQLLLDRFKCVPAFLPP  141



>ref|XP_003540002.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like [Glycine max]
 gb|KHN34247.1| Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
7 [Glycine soja]
Length=862

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 108/144 (75%), Gaps = 6/144 (4%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFG----RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSI  338
            M+SRSY+NLLDLASG     G    R  K++ RV +V G L+E+DD+   +  SD PS++
Sbjct  1    MMSRSYTNLLDLASGNFPAMGGRETRERKRMPRVMSVPGFLTEVDDDQAVSVSSDNPSTV  60

Query  339  SQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEII  518
            + +RMIIV NQLPL+A R+ D + GW+FSW+EDSLLLQLKDGL +D+EV+YVG L+ + I
Sbjct  61   TTDRMIIVANQLPLKAKRKEDNK-GWSFSWNEDSLLLQLKDGLPDDMEVLYVGSLRVD-I  118

Query  519  DPNEQDDVAXTLLETFKCVPAFVP  590
            DP EQDDV+  LL+ FKCVP F+P
Sbjct  119  DPAEQDDVSQYLLDKFKCVPTFLP  142



>ref|XP_008381189.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Malus domestica]
Length=854

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 102/140 (73%), Gaps = 2/140 (1%)
 Frame = +3

Query  174  VSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQERM  353
            +S+SY NLLDLASG   T     ++  RV T  G LS+LDD+   +  SD PSSI+ +R+
Sbjct  1    MSQSYINLLDLASGNFPTMEGKRRRFPRVNTAPGNLSDLDDDQARSVSSDQPSSIASDRV  60

Query  354  IIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNEQ  533
            IIV NQLP++A RR D  +GW FSW+EDSLLLQLKDGL ED+EV+YVG LK   +DP EQ
Sbjct  61   IIVANQLPVKAKRREDN-KGWTFSWNEDSLLLQLKDGLPEDMEVLYVGSLKVS-VDPKEQ  118

Query  534  DDVAXTLLETFKCVPAFVPP  593
            DDV+  LLE FKCVP F+PP
Sbjct  119  DDVSQVLLERFKCVPTFLPP  138



>ref|XP_011070555.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Sesamum indicum]
Length=856

 Score =   161 bits (407),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 115/145 (79%), Gaps = 5/145 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGE--SLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            MVSRSYSNLL+LASGE  S +F R  ++L R+ TVAG++S++DD+   +  SD  SS +Q
Sbjct  1    MVSRSYSNLLELASGEAPSPSFSRMRRRLPRIMTVAGIMSDIDDDGSDSVSSDPSSSTAQ  60

Query  345  -ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEII  518
             +R+IIV NQLP++ HR+TD   GW FSWDE+SLLLQLKDGLG+D +E IYVGCLKE+ I
Sbjct  61   RDRIIIVANQLPIKVHRKTDESRGWTFSWDENSLLLQLKDGLGDDEMEFIYVGCLKED-I  119

Query  519  DPNEQDDVAXTLLETFKCVPAFVPP  593
             PN+QD+V+  LLETFKCVP F+PP
Sbjct  120  HPNDQDEVSQILLETFKCVPTFLPP  144



>ref|XP_006843713.1| hypothetical protein AMTR_s00007p00214170 [Amborella trichopoda]
 gb|ERN05388.1| hypothetical protein AMTR_s00007p00214170 [Amborella trichopoda]
Length=846

 Score =   160 bits (406),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 112/141 (79%), Gaps = 2/141 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M SRSY+NLLDLA+G      R+GK+L RV TV GV+SELDD++ ++  SDVPSS+SQER
Sbjct  1    MTSRSYTNLLDLATGNFPAPTRSGKRLPRVMTVPGVISELDDDNANSVSSDVPSSVSQER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIV NQLPLRA RR D   GW FSWD+DSLLLQLKDGL ++++VIY+G LK E +D NE
Sbjct  61   IIIVANQLPLRARRRPDN-RGWIFSWDDDSLLLQLKDGLPDELDVIYIGSLKVE-VDLNE  118

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            Q++VA  LLE FKCVPAF+ P
Sbjct  119  QEEVAQILLEKFKCVPAFLSP  139



>ref|XP_009416430.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Musa acuminata subsp. malaccensis]
 ref|XP_009416432.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Musa acuminata subsp. malaccensis]
Length=874

 Score =   160 bits (406),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 113/147 (77%), Gaps = 8/147 (5%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGE----SLTFGRAGKKLSRVATVAGVLSEL-DDESRSNG-GSDVPS  332
            M+SRSY+NLLDLASG     SL  GRA ++L RV TV G L++L ++E R+N   SDV S
Sbjct  1    MMSRSYTNLLDLASGNFSALSLGGGRAPRRLPRVMTVPGTLADLQEEEERANSVASDVQS  60

Query  333  SISQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEE  512
            S +Q+R+IIV NQLP+RA RR D + GW F+WD+DSL+LQLKDGL +D+EV+YVG L+ +
Sbjct  61   SQAQDRIIIVANQLPVRARRRPD-DRGWTFAWDDDSLILQLKDGLPDDMEVLYVGSLRVD  119

Query  513  IIDPNEQDDVAXTLLETFKCVPAFVPP  593
             ++ +EQDDVA  LLE F+CVP F+PP
Sbjct  120  -VEAHEQDDVAQALLERFQCVPTFLPP  145



>gb|KFK41224.1| hypothetical protein AALP_AA2G101500 [Arabis alpina]
Length=857

 Score =   160 bits (405),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 108/150 (72%), Gaps = 18/150 (12%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D++S+            ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKETLSP-------KDR  53

Query  351  MIIVGNQLPLRAHRRTDGE---------EGWNFSWDEDSLLLQLKDGLG-EDVEVIYVGC  500
            +IIV N+LP+RA R+ +           +GWNFSWDE+SLLLQLKDGLG E +EVIYVGC
Sbjct  54   IIIVANELPIRAQRKLETNIGTSSSSTSKGWNFSWDENSLLLQLKDGLGDEAIEVIYVGC  113

Query  501  LKEEIIDPNEQDDVAXTLLETFKCVPAFVP  590
            LKEE I PNEQ++V   LLE FKCVP F+P
Sbjct  114  LKEE-IHPNEQEEVYQLLLENFKCVPTFLP  142



>gb|KHN15462.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Glycine 
soja]
Length=870

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 114/144 (79%), Gaps = 6/144 (4%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSIS-QE  347
            MVS+SYSNLL+LASGE+ +FG   +++ R+ TVAG++S++DD+   +  SD  SS + ++
Sbjct  1    MVSKSYSNLLELASGEAPSFGYMNRRIPRIMTVAGLISDVDDDPVESVCSDPSSSTAHRD  60

Query  348  RMIIVGNQLPLRAHRRTDGEEG--WNFSWDEDSLLLQLKDGLG-EDVEVIYVGCLKEEII  518
            R+I+V NQLP+RA RR +G     W+F WDE++ LLQLKDGLG +D+EVIYVGCLKEE +
Sbjct  61   RIIMVANQLPIRAQRRPNGNNRSCWSFEWDENA-LLQLKDGLGDDDIEVIYVGCLKEE-V  118

Query  519  DPNEQDDVAXTLLETFKCVPAFVP  590
             P+EQD+V+ TLLETFKC+P F+P
Sbjct  119  HPSEQDEVSQTLLETFKCIPTFLP  142



>gb|ACJ61506.1| trehalose-6-phosphate synthase [Glycine max]
Length=842

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 114/144 (79%), Gaps = 6/144 (4%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSIS-QE  347
            MVS+SYSNLL+LASGE+ +FG   +++ R+ TVAG++S++DD+   +  SD  SS + ++
Sbjct  1    MVSKSYSNLLELASGEAPSFGYMNRRIPRIMTVAGLISDVDDDPVESVCSDPSSSTAHRD  60

Query  348  RMIIVGNQLPLRAHRRTDGEEG--WNFSWDEDSLLLQLKDGLG-EDVEVIYVGCLKEEII  518
            R+I+V NQLP+RA RR +G     W+F WDE++ LLQLKDGLG +D+EVIYVGCLKEE +
Sbjct  61   RIIMVANQLPIRAQRRPNGNNRSCWSFEWDENA-LLQLKDGLGDDDIEVIYVGCLKEE-V  118

Query  519  DPNEQDDVAXTLLETFKCVPAFVP  590
             P+EQD+V+ TLLETFKC+P F+P
Sbjct  119  HPSEQDEVSQTLLETFKCIPTFLP  142



>ref|XP_010522084.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Tarenaya hassleriana]
Length=845

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 102/141 (72%), Gaps = 4/141 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+SRSY+NLLDLASG     GR  ++L RV TV   + ELD++   +  SD PSSI  +R
Sbjct  1    MISRSYTNLLDLASGNFPVMGRERRRLPRVMTVPSNVCELDEDQAYSVSSDNPSSIPTDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIV N+LPL+A RR      W+FSW++DSL LQLKDGL ED+E++YVG L  + +DPNE
Sbjct  61   MIIVANRLPLKAERRNG---SWSFSWNQDSLYLQLKDGLPEDMEILYVGSLGVD-VDPNE  116

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA  LL+ FKCVP F+PP
Sbjct  117  QDDVAQILLDRFKCVPTFLPP  137



>ref|XP_008228949.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Prunus mume]
Length=856

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 102/140 (73%), Gaps = 2/140 (1%)
 Frame = +3

Query  174  VSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQERM  353
            +S+SY NLLDLASG   T     ++  RV T  G LS+LDD+   +  SD PSSI+ +RM
Sbjct  1    MSKSYVNLLDLASGNFPTMEGKRRRFPRVNTAPGNLSDLDDDQARSVSSDQPSSIASDRM  60

Query  354  IIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNEQ  533
            IIV NQLP++A RR D  +GW+FSW+ED+LLL LKDGL ED+EV+YVG LK   +DP EQ
Sbjct  61   IIVANQLPVKAKRREDN-KGWSFSWNEDALLLHLKDGLPEDMEVLYVGSLKVS-VDPKEQ  118

Query  534  DDVAXTLLETFKCVPAFVPP  593
            DDV+  LL+ F+CVP F+PP
Sbjct  119  DDVSQVLLDKFRCVPTFLPP  138



>ref|XP_010276900.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X1 [Nelumbo nucifera]
 ref|XP_010276976.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X1 [Nelumbo nucifera]
Length=853

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 111/141 (79%), Gaps = 3/141 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSR YSNLL+LASGES +FGR  +++ R+ TVAG++S+LDD+   +  SD  S   +ER
Sbjct  1    MVSRPYSNLLELASGESPSFGRMSRRIPRIMTVAGIISDLDDDPDDSVSSDPSSPAPRER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIIDPN  527
             IIV NQLP+R HR+ D  +GW FSW+EDSLLLQLKD LG+D VEVIYVGCL+EE I P+
Sbjct  61   TIIVANQLPIRVHRKPDN-KGWTFSWEEDSLLLQLKDRLGDDEVEVIYVGCLREE-IHPS  118

Query  528  EQDDVAXTLLETFKCVPAFVP  590
            EQD+V+  LL+TFKCVP F+P
Sbjct  119  EQDEVSQILLDTFKCVPTFLP  139



>emb|CDY04199.1| BnaC06g26160D [Brassica napus]
Length=851

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 107/143 (75%), Gaps = 7/143 (5%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D++S+ +  SD+     ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKESLSSDLS---PKDR  57

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED---VEVIYVGCLKEEIID  521
            +IIV N+LP+RA R+ +    W FS DE+SLLLQLKDGLG +    EVIYVGCLKE+ I 
Sbjct  58   IIIVANELPIRAQRKLESSTSWTFSLDENSLLLQLKDGLGSEEATTEVIYVGCLKED-IH  116

Query  522  PNEQDDVAXTLLETFKCVPAFVP  590
            PNEQ++V   LLE FKCVP F+P
Sbjct  117  PNEQEEVYQLLLENFKCVPTFLP  139



>ref|XP_011082978.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Sesamum indicum]
 ref|XP_011082980.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Sesamum indicum]
Length=867

 Score =   159 bits (402),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 106/143 (74%), Gaps = 4/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAG--KKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+SRSY+NLL+LASG     GR    K+  RV TV G + ELDDE  ++  S+ PSS++ 
Sbjct  1    MMSRSYTNLLELASGNFPVMGREKERKRFPRVMTVPGNIVELDDEQANSVTSENPSSVAG  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +RMIIV N LPL+A RR D + GW+FSW+EDSL+L++KDG  ED+EV+YVG L  + +DP
Sbjct  61   DRMIIVSNLLPLKAKRRPDNK-GWSFSWNEDSLILRVKDGFPEDMEVLYVGSLPVD-VDP  118

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
             EQDDVA  LLE FKCVPAF+PP
Sbjct  119  IEQDDVANYLLEKFKCVPAFLPP  141



>ref|XP_009409100.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Musa acuminata subsp. malaccensis]
Length=862

 Score =   159 bits (402),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 112/144 (78%), Gaps = 5/144 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLL+LASGE  +  +  +++ RV TVAG++S+LD +S S+G +  PSS +++R
Sbjct  1    MVSRSYSNLLELASGEPPSISQIRRRIPRVMTVAGIISDLDSDSDSDGSATGPSSTTRDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGE---DVEVIYVGCLKEEIID  521
             I+V NQLP+RA RR DG  GW+FSWDEDSLLLQLKD +G+   D+E  YVGCL++E I 
Sbjct  61   TIVVANQLPIRARRRPDG-RGWDFSWDEDSLLLQLKDAIGDRGADMEFFYVGCLRDE-IP  118

Query  522  PNEQDDVAXTLLETFKCVPAFVPP  593
            P +QDDV   LLE+FKCVPAF+PP
Sbjct  119  PADQDDVGQVLLESFKCVPAFLPP  142



>emb|CDY07404.1| BnaA07g24830D [Brassica napus]
Length=852

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 108/144 (75%), Gaps = 8/144 (6%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D++S+ +  SD+P    ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKESPSSDLP---PKDR  57

Query  351  MIIVGNQLPLRAHRRTD-GEEGWNFSWDEDSLLLQLKDGLGED---VEVIYVGCLKEEII  518
            +IIV N+LP+RA R+ +     W FS DE+SLLLQLKDGLG +    EVIYVGCLKE+ I
Sbjct  58   IIIVANELPIRAQRKLETSSTSWTFSLDENSLLLQLKDGLGSEATTTEVIYVGCLKED-I  116

Query  519  DPNEQDDVAXTLLETFKCVPAFVP  590
             PNEQ++V   LLE FKCVP F+P
Sbjct  117  HPNEQEEVYQLLLENFKCVPTFLP  140



>ref|XP_002888643.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64902.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=857

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 110/150 (73%), Gaps = 17/150 (11%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D++S+    S       ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKETDLS------PKDR  54

Query  351  MIIVGNQLPLRAHRRTDGE---------EGWNFSWDEDSLLLQLKDGLG-EDVEVIYVGC  500
            +IIV N+LP+RA RR +G          +GWNFSWDE+SLLLQLKDGLG E +EVIYVGC
Sbjct  55   IIIVANELPIRAQRRLEGSGSSTSTCCSKGWNFSWDENSLLLQLKDGLGDEAIEVIYVGC  114

Query  501  LKEEIIDPNEQDDVAXTLLETFKCVPAFVP  590
            LKEE I  NEQ++V   LLE+FKCVP F+P
Sbjct  115  LKEE-IPLNEQEEVYQVLLESFKCVPTFLP  143



>gb|ACA62945.1| trehalose-6-phosphate synthase [Zostera marina]
Length=870

 Score =   159 bits (401),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 108/147 (73%), Gaps = 10/147 (7%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGE--------SLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDV  326
            M+SRSY+NLLDLASG                 +++ RV TV   ++EL+DE  S+  SDV
Sbjct  1    MMSRSYTNLLDLASGNFPVISGGGRDGRSGGMRRMPRVMTVPSNIAELEDEQASSVASDV  60

Query  327  PSSISQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLK  506
             SSI Q+R+IIVGNQLP+ A RR+D   GW+FSWD++SLLLQLKDGL +D+EV+YVGCL+
Sbjct  61   QSSIIQDRLIIVGNQLPVVAKRRSDNA-GWDFSWDDESLLLQLKDGLPDDMEVLYVGCLR  119

Query  507  EEIIDPNEQDDVAXTLLETFKCVPAFV  587
              I+DP EQDDV+ TLLE FKCVPAF+
Sbjct  120  -VIVDPEEQDDVSQTLLEKFKCVPAFL  145



>ref|XP_006417924.1| hypothetical protein EUTSA_v10006783mg [Eutrema salsugineum]
 ref|XP_006417925.1| hypothetical protein EUTSA_v10006783mg [Eutrema salsugineum]
 ref|XP_006417926.1| hypothetical protein EUTSA_v10006783mg [Eutrema salsugineum]
 gb|ESQ36277.1| hypothetical protein EUTSA_v10006783mg [Eutrema salsugineum]
 gb|ESQ36278.1| hypothetical protein EUTSA_v10006783mg [Eutrema salsugineum]
 gb|ESQ36279.1| hypothetical protein EUTSA_v10006783mg [Eutrema salsugineum]
Length=851

 Score =   158 bits (399),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 102/141 (72%), Gaps = 4/141 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+SRSY+NLLDLASG     GR  ++L RV TV G +SE D++   +  SD PSS+S +R
Sbjct  1    MISRSYTNLLDLASGNFPVMGRERRRLPRVMTVPGNVSEFDEDQAYSVSSDNPSSVSCDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIV N+LPL+A RR      W+FSWD+D+L LQLKDGL ED+EV+YVG L  + ID +E
Sbjct  61   MIIVANRLPLKAERRNG---CWSFSWDQDALYLQLKDGLPEDMEVLYVGSLSVD-IDSHE  116

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA  LL+ FKCVP F PP
Sbjct  117  QDDVAQILLDKFKCVPTFFPP  137



>ref|XP_009365280.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X2 [Pyrus x bretschneideri]
Length=856

 Score =   158 bits (400),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 102/142 (72%), Gaps = 4/142 (3%)
 Frame = +3

Query  174  VSRSYSNLLDLASGESLTFGRAGKK--LSRVATVAGVLSELDDESRSNGGSDVPSSISQE  347
            +S+SY NLLDLASG        GK+    RV T  G LS+LDD+   +  SD PSSI+ +
Sbjct  1    MSQSYINLLDLASGNFPXXXMEGKRRRFPRVNTAPGNLSDLDDDQARSVSSDQPSSIASD  60

Query  348  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  527
            R+IIV NQLP++A RR D + GW FSW+EDSLLLQLKDGL ED+EV+YVG LK   +DP 
Sbjct  61   RVIIVANQLPVKAKRREDNK-GWTFSWNEDSLLLQLKDGLPEDMEVLYVGSLKVS-VDPK  118

Query  528  EQDDVAXTLLETFKCVPAFVPP  593
            EQDDV+  LLE FKCVP F+PP
Sbjct  119  EQDDVSQVLLERFKCVPTFLPP  140



>gb|KHG14143.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 -like 
protein [Gossypium arboreum]
Length=869

 Score =   158 bits (400),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 116/156 (74%), Gaps = 16/156 (10%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ-E  347
            MVSRSYSNLL+LASGE+ + GR  +++ R+ TV G++S++DD+   +  SD  SS +Q +
Sbjct  1    MVSRSYSNLLELASGEAPSLGRISRRIPRIMTVPGIISDIDDDPSESVCSDPSSSSTQKD  60

Query  348  RMIIVGNQLPLRAHRRTDGEEG-------------WNFSWDEDSLLLQLKDGLGED-VEV  485
            R+I+V NQLP+RAHR++D  +              W FSWD++SLLLQ++DGLG+D VEV
Sbjct  61   RIIMVANQLPIRAHRKSDNNKNGSSSSSTTTTSNNWIFSWDDNSLLLQMRDGLGDDDVEV  120

Query  486  IYVGCLKEEIIDPNEQDDVAXTLLETFKCVPAFVPP  593
            IYVGCLKEEI  PNEQD+V+  LLETFKCVP F+PP
Sbjct  121  IYVGCLKEEI-HPNEQDEVSQILLETFKCVPTFLPP  155



>emb|CAN71202.1| hypothetical protein VITISV_006369 [Vitis vinifera]
Length=733

 Score =   157 bits (396),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 105/133 (79%), Gaps = 3/133 (2%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+SRSY+NLLDLASG     G+  K+L RV TV GV+SELDD+  ++  SDVPSSI Q+R
Sbjct  1    MMSRSYTNLLDLASGNFPLMGQR-KRLPRVMTVPGVISELDDDQANSVTSDVPSSIVQDR  59

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            +IIV NQLP++A RR D  +GW+FSWDEDSLLLQLKDGL +D+EV+YVG L+ + +D NE
Sbjct  60   VIIVANQLPVKAKRRPDN-KGWSFSWDEDSLLLQLKDGLPDDMEVLYVGSLRVD-VDSNE  117

Query  531  QDDVAXTLLETFK  569
            QDDV+  LL+ FK
Sbjct  118  QDDVSQVLLDRFK  130



>gb|EPS71188.1| hypothetical protein M569_03569, partial [Genlisea aurea]
Length=861

 Score =   158 bits (399),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 107/143 (75%), Gaps = 4/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+SRSY+NLLDLASG     G  +  K+  RV TV G + ELDDE  S+  S+ PSS++ 
Sbjct  8    MLSRSYTNLLDLASGNFPVMGTEKEKKRFPRVMTVPGNIVELDDEQASSVTSENPSSVAG  67

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +RMIIV N LPL+A RR D + GW+FSW+EDSLLL++KDGL E++EV+YVG L  + +DP
Sbjct  68   DRMIIVSNLLPLKAKRRPDNK-GWSFSWNEDSLLLRVKDGLPEEMEVLYVGSLTVD-VDP  125

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
             EQ+DVA  LL+ FKCVPAF+PP
Sbjct  126  IEQEDVANYLLDKFKCVPAFLPP  148



>gb|EPS68578.1| hypothetical protein M569_06190 [Genlisea aurea]
Length=762

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 104/143 (73%), Gaps = 4/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAG--KKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+SRSY+NLLDLASG     GR    K+  RV TV G + ELDDE  S+  SD PSS++ 
Sbjct  1    MLSRSYTNLLDLASGNFPVMGRDKERKRFPRVNTVPGNIGELDDEQTSSFASDNPSSVAG  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +R+IIV N LPL+  RR D  + W+FSW+EDSLLL++KDG  ED++V+YVG L  + +DP
Sbjct  61   DRIIIVSNLLPLKVKRRPDN-KSWSFSWNEDSLLLRVKDGFPEDMDVLYVGSLPVD-VDP  118

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
             EQDDV+  LLE FKCVPAF+PP
Sbjct  119  VEQDDVSNYLLEKFKCVPAFLPP  141



>ref|XP_007214959.1| hypothetical protein PRUPE_ppa001387mg [Prunus persica]
 gb|EMJ16158.1| hypothetical protein PRUPE_ppa001387mg [Prunus persica]
Length=840

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 101/140 (72%), Gaps = 2/140 (1%)
 Frame = +3

Query  174  VSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQERM  353
            +S+SY NLLDLASG   T     ++  RV T  G LS++DD+   +  SD PSSI+ +RM
Sbjct  1    MSKSYVNLLDLASGNFPTMEGKRRRFPRVNTAPGNLSDVDDDQARSVSSDQPSSIASDRM  60

Query  354  IIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNEQ  533
            IIV NQLP++A RR D  +GW FSW+ED+LLL LKDGL ED+EV+YVG LK   +DP EQ
Sbjct  61   IIVANQLPVKAKRREDN-KGWIFSWNEDALLLHLKDGLPEDMEVLYVGSLKVS-VDPREQ  118

Query  534  DDVAXTLLETFKCVPAFVPP  593
            DDV+  LL+ F+CVP F+PP
Sbjct  119  DDVSQVLLDKFRCVPTFLPP  138



>gb|KHG01704.1| putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
7 [Gossypium arboreum]
Length=838

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 98/120 (82%), Gaps = 2/120 (2%)
 Frame = +3

Query  234  RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQERMIIVGNQLPLRAHRRTDGEEG  413
            R  K+L RV TV GV+SELDD+  ++  SDVPSSI Q+R+IIV NQLP++A RR D  +G
Sbjct  5    REKKRLPRVMTVPGVISELDDDQANSVASDVPSSIIQDRIIIVANQLPVKAKRRPDN-KG  63

Query  414  WNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNEQDDVAXTLLETFKCVPAFVPP  593
            W+FSWD+DSLLLQLKDGL E++EV+YVG LK + +DP+EQDDV+  LL+ FKCVPAF+PP
Sbjct  64   WSFSWDDDSLLLQLKDGLPEEMEVLYVGSLKVD-VDPSEQDDVSQLLLDRFKCVPAFLPP  122



>ref|XP_010556235.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Tarenaya hassleriana]
 ref|XP_010556236.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Tarenaya hassleriana]
 ref|XP_010556237.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Tarenaya hassleriana]
Length=866

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 112/155 (72%), Gaps = 15/155 (10%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  347
            MVSRSYSNLLDLASG+S +FGR  +++ R+ TVAG +S +DD+ + S       S+  ++
Sbjct  1    MVSRSYSNLLDLASGDSPSFGRMSRQIPRIMTVAGFMSNIDDDPAESVSSDPSSSTARKD  60

Query  348  RMIIVGNQLPLRAHRRTD-----------GEEGWNFSWDEDSLLLQLKDGLG--EDVEVI  488
            R+IIV NQLP+R  +R++           G + W F+WD++SLLLQLKDGLG  E+ EVI
Sbjct  61   RLIIVANQLPIRVQKRSENSSTSTSSSNIGYKNWIFTWDDNSLLLQLKDGLGDEEETEVI  120

Query  489  YVGCLKEEIIDPNEQDDVAXTLLETFKCVPAFVPP  593
            YVGCLK+E I PN+Q++V+  LLETFKCVP F+PP
Sbjct  121  YVGCLKDE-IHPNDQEEVSQILLETFKCVPTFLPP  154



>gb|KEH40650.1| trehalose-6-phosphate synthase domain protein [Medicago truncatula]
Length=855

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 111/146 (76%), Gaps = 7/146 (5%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSEL---DDESRSNGGSDVPSSIS  341
            MVSRSYSNL++LASGE+ +FG   +++ R+ TVAG++SE+   DD+  S       SS+ 
Sbjct  1    MVSRSYSNLVELASGETPSFGLMNRRIPRIMTVAGLISEVNIDDDQVESVASDLSSSSVH  60

Query  342  QERMIIVGNQLPLRAHRRTDGEEG-WNFSWDEDSLLLQLKDGLG-EDVEVIYVGCLKEEI  515
            ++R+IIV NQLP++A +  DG    W+F WDE+S LLQLKDG+G +D+EVIYVGCLKE+ 
Sbjct  61   RDRIIIVANQLPIKAQKNHDGNRSYWSFDWDENS-LLQLKDGIGDDDIEVIYVGCLKED-  118

Query  516  IDPNEQDDVAXTLLETFKCVPAFVPP  593
            + PNEQD+V+ TLLE FKCVP F+PP
Sbjct  119  VHPNEQDEVSMTLLENFKCVPTFLPP  144



>ref|XP_009628927.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Nicotiana tomentosiformis]
Length=857

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 109/143 (76%), Gaps = 4/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKK--LSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+SRSY+NLLDLASG   T GR  ++  + RV TV G + ELDD+  ++  S+ PSS++ 
Sbjct  1    MISRSYTNLLDLASGNFPTMGRERERRRMPRVMTVPGSICELDDDQANSVSSENPSSLAG  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +RMIIV N LPL+A RR D + GW+FSW+EDSLLL+LKDGL ED+EV+YVG L  + +DP
Sbjct  61   DRMIIVANLLPLKAKRRPDNK-GWSFSWNEDSLLLRLKDGLPEDMEVLYVGSLCVD-VDP  118

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
             EQDDV+  LL+ F+CVPAF+PP
Sbjct  119  IEQDDVSNYLLDKFRCVPAFLPP  141



>ref|XP_009782523.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Nicotiana sylvestris]
Length=857

 Score =   155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 109/143 (76%), Gaps = 4/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKK--LSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+SRSY+NLLDLASG   T GR  ++  + RV TV G + ELDD+  ++  S+ PSS++ 
Sbjct  1    MISRSYTNLLDLASGNFPTMGRERERRRMPRVMTVPGSICELDDDQANSVSSENPSSLAG  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +RMIIV N LPL+A RR D + GW+FSW+EDSLLL+LKDGL ED+EV+YVG L  + +DP
Sbjct  61   DRMIIVANLLPLKAKRRPDNK-GWSFSWNEDSLLLRLKDGLPEDMEVLYVGSLCVD-VDP  118

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
             EQDDV+  LL+ F+CVPAF+PP
Sbjct  119  IEQDDVSNYLLDKFRCVPAFLPP  141



>ref|XP_008775639.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Phoenix dactylifera]
 ref|XP_008775645.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Phoenix dactylifera]
Length=856

 Score =   155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 109/143 (76%), Gaps = 5/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLL+L SGE  + GR  +++ RV TVAG++S+LDD+S S+  +  PSS   +R
Sbjct  1    MVSRSYSNLLELTSGEPPSVGRIRRRIPRVMTVAGIISDLDDDSDSDTSAG-PSSSPGDR  59

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGE--DVEVIYVGCLKEEIIDP  524
             I+V N LP+RAHRR DG  GW FSWD+DSLLLQLKD +G+  D+E  YVGCL++E I P
Sbjct  60   TIVVANHLPIRAHRRPDG-RGWTFSWDKDSLLLQLKDAIGDRCDMEFFYVGCLRDE-IPP  117

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
             EQD+V   LLETFKCVPAF+PP
Sbjct  118  AEQDEVGQILLETFKCVPAFLPP  140



>gb|AEQ54916.1| trehalose-6-phosphate synthase [Salvia miltiorrhiza]
Length=857

 Score =   155 bits (392),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 113/145 (78%), Gaps = 5/145 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGE--SLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            MVSRSYSNLL+LASGE  S +F R  +++ R+ TVAG++S++DD+   +  SD  SS SQ
Sbjct  1    MVSRSYSNLLELASGEAPSPSFSRMSRRIPRIMTVAGIMSDIDDDGSDSVSSDPSSSSSQ  60

Query  345  -ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLG-EDVEVIYVGCLKEEII  518
             +R+IIV NQLP++ H++TD  +GW FSWD++SL LQLKD LG ED E IYVGCLKEE I
Sbjct  61   KDRIIIVANQLPIKVHKKTDNSKGWTFSWDDNSLYLQLKDCLGDEDTEFIYVGCLKEE-I  119

Query  519  DPNEQDDVAXTLLETFKCVPAFVPP  593
             PN+QD+V+  LLETFKC+P F+PP
Sbjct  120  HPNDQDEVSQILLETFKCIPTFLPP  144



>gb|EYU37347.1| hypothetical protein MIMGU_mgv1a001197mg [Erythranthe guttata]
Length=868

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 104/143 (73%), Gaps = 4/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAG--KKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+SRSY+NLL+LASG     GR    K+  RV TV G + E+DDE  ++  S+ PSSI+ 
Sbjct  1    MMSRSYTNLLELASGNFPVMGREKERKRFPRVMTVPGNIVEMDDEQDNSVTSENPSSIAG  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +RMIIV N LPL+A RR D  +GW FSW+EDSLLL +K GL ED+EV+YVG L  + +DP
Sbjct  61   DRMIIVANLLPLKAKRRPDN-KGWVFSWNEDSLLLWVKVGLPEDMEVLYVGSLPVD-VDP  118

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
             EQDDVA  LLE FKCVPAF+PP
Sbjct  119  IEQDDVANHLLEKFKCVPAFLPP  141



>emb|CBI26812.3| unnamed protein product [Vitis vinifera]
Length=702

 Score =   154 bits (388),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 99/142 (70%), Gaps = 27/142 (19%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLL+LASGES +FGR  +++ R+ T                         ++R
Sbjct  1    MVSRSYSNLLELASGESPSFGRMSRRIPRIMT-------------------------RDR  35

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIIDPN  527
            +IIV NQLP+RA R+++   GW FSWDE+SLLLQLKDGLG+D +EVIYVGCLKEEI  P 
Sbjct  36   LIIVANQLPIRAQRKSENNNGWIFSWDENSLLLQLKDGLGDDEIEVIYVGCLKEEI-HPC  94

Query  528  EQDDVAXTLLETFKCVPAFVPP  593
            EQD+V+  LLETFKCVP F+PP
Sbjct  95   EQDEVSQILLETFKCVPTFLPP  116



>ref|XP_010916234.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Elaeis guineensis]
Length=856

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 109/143 (76%), Gaps = 5/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLL+L SGE  + GR  +++ RV TVAG++S+LD++S S+  +   SS   +R
Sbjct  1    MVSRSYSNLLELTSGEPPSVGRIRRRIPRVMTVAGLISDLDEDSDSDTSAGTSSS-PHDR  59

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGE--DVEVIYVGCLKEEIIDP  524
             I+V N LP+RAHRR DG  GW FSWDEDSLLLQLKD +G+  D+E IYVGCL++E I P
Sbjct  60   TIVVANHLPVRAHRRPDG-RGWTFSWDEDSLLLQLKDAIGDHCDMEFIYVGCLRDE-IPP  117

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
             +QD+V   LLETFKCVPAF+PP
Sbjct  118  ADQDEVGQILLETFKCVPAFLPP  140



>ref|XP_007132825.1| hypothetical protein PHAVU_011G127700g [Phaseolus vulgaris]
 ref|XP_007132826.1| hypothetical protein PHAVU_011G127700g [Phaseolus vulgaris]
 gb|ESW04819.1| hypothetical protein PHAVU_011G127700g [Phaseolus vulgaris]
 gb|ESW04820.1| hypothetical protein PHAVU_011G127700g [Phaseolus vulgaris]
Length=862

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 108/144 (75%), Gaps = 6/144 (4%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFG----RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSI  338
            M+SRSY+NLLDLASG     G    R  +++ RV +V G L+E+DD+   +  SD PS++
Sbjct  1    MMSRSYTNLLDLASGNFPAMGGRESRERRRMPRVMSVPGFLTEVDDDQAVSVSSDNPSTV  60

Query  339  SQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEII  518
            + +RMIIV NQLPL+A RR D + GW+FSW+EDSLLLQLKDGL +D+EV+YVG L+ + I
Sbjct  61   TTDRMIIVANQLPLKAKRREDNK-GWSFSWNEDSLLLQLKDGLPDDMEVLYVGSLRVD-I  118

Query  519  DPNEQDDVAXTLLETFKCVPAFVP  590
            DP EQDDV+  LL+ FKCVP F+P
Sbjct  119  DPAEQDDVSQNLLDKFKCVPTFLP  142



>ref|XP_010531642.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Tarenaya hassleriana]
Length=865

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 109/153 (71%), Gaps = 14/153 (9%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  347
            MVSRSYSNLLDLASG+S +FGR  + + R+ TVAG +S +DD+ + S       S+  ++
Sbjct  1    MVSRSYSNLLDLASGDSPSFGRMSRGIPRIMTVAGFMSNIDDDPAESASSDPSSSTAHKD  60

Query  348  RMIIVGNQLPLRAHRRTDGE-----------EGWNFSWDEDSLLLQLKDGLG-EDVEVIY  491
            R+IIV NQLP+RA +R+D               W F+WDE+SLLLQLKD LG ED++V+Y
Sbjct  61   RLIIVANQLPIRAQKRSDKSSTSSSNNGGGCRNWIFNWDENSLLLQLKDALGKEDIDVLY  120

Query  492  VGCLKEEIIDPNEQDDVAXTLLETFKCVPAFVP  590
            VGCLK+E I PN+Q++V+  L+ETFKCVP F+P
Sbjct  121  VGCLKDE-IHPNDQEEVSQILVETFKCVPTFLP  152



>ref|XP_004248198.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Solanum lycopersicum]
Length=857

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 107/143 (75%), Gaps = 4/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKK--LSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+SRSY+NLLDLASG   T GR   +  + RV T+ G + E+DD+   +  S+ PSS++ 
Sbjct  1    MISRSYTNLLDLASGNFPTMGRDRDRRRMPRVMTLPGSICEMDDDQAHSVSSENPSSLAG  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +RMI+V N LPL+A RR D + GW+F+W+EDSLLL+L+DGL ED+EVIYVG L  + IDP
Sbjct  61   DRMIVVANLLPLKAKRRPDNK-GWSFNWNEDSLLLRLRDGLPEDMEVIYVGSLCVD-IDP  118

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
             EQDDV+  LLE F+CVPAF+PP
Sbjct  119  IEQDDVSSYLLEKFRCVPAFLPP  141



>gb|EYU30761.1| hypothetical protein MIMGU_mgv1a001183mg [Erythranthe guttata]
Length=871

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 104/143 (73%), Gaps = 4/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAG--KKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+SRSY+NLLDLASG     GR    K+  RV TV G + ELDDE  S+  S+ PS+++ 
Sbjct  1    MMSRSYTNLLDLASGNFPLTGREKERKRFPRVMTVPGNILELDDEQASSVTSENPSTVAG  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +R+I+V N LPL+A RR D + GW FSW+EDSLLL++KDG  E++EV+YVG L  + +DP
Sbjct  61   DRIIVVANLLPLKAKRRPDNK-GWTFSWNEDSLLLRIKDGFPEEMEVLYVGSLPVD-VDP  118

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
             EQDDVA  LLE FKCV AF+PP
Sbjct  119  IEQDDVASFLLEKFKCVAAFLPP  141



>gb|ACA62946.1| trehalose-6-phosphate synthase [Zostera marina]
Length=870

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 107/147 (73%), Gaps = 10/147 (7%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGE--------SLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDV  326
            M+SRSY+NLLDLASG                 +++ RV TV   ++EL+DE  S+  SDV
Sbjct  1    MMSRSYTNLLDLASGNFPVISGGGRDGRSGGMRRMPRVMTVPSNIAELEDEQASSVASDV  60

Query  327  PSSISQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLK  506
             SSI Q+R+IIVGNQLP+ A RR+D   G +FSWD++SLLLQLKDGL +D+EV+YVGCL+
Sbjct  61   QSSIIQDRLIIVGNQLPVVAKRRSDN-AGRDFSWDDESLLLQLKDGLPDDMEVLYVGCLR  119

Query  507  EEIIDPNEQDDVAXTLLETFKCVPAFV  587
              I+DP EQDDV+ TLLE FKCVPAF+
Sbjct  120  -VIVDPEEQDDVSQTLLEKFKCVPAFL  145



>ref|XP_009415178.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Musa acuminata subsp. malaccensis]
Length=881

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 110/151 (73%), Gaps = 12/151 (8%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGE--------SLTFGRAGKKLSRVATVAGVLSEL-DDESRSNG-GS  320
            M+SRSY+NLLDLASG             GR  +++ RV TV G L++L ++E R+N   S
Sbjct  1    MMSRSYTNLLDLASGNFAALSLGAGGGGGRGLRRMPRVMTVPGTLADLQEEEERANSVAS  60

Query  321  DVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGC  500
            DV SS +Q+R+IIV NQLP+RA RR DG  GW F+WDEDSLLLQLKDGL +D+EV+YVG 
Sbjct  61   DVQSSQAQDRIIIVANQLPVRARRRPDGR-GWTFAWDEDSLLLQLKDGLPDDMEVLYVGS  119

Query  501  LKEEIIDPNEQDDVAXTLLETFKCVPAFVPP  593
            L  + ++P+EQDDVA  LLE FKCVPAF+ P
Sbjct  120  LNVD-VEPHEQDDVAQALLERFKCVPAFLSP  149



>ref|XP_006364095.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like isoform X1 [Solanum tuberosum]
Length=857

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 107/143 (75%), Gaps = 4/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKK--LSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+SRSY+NLLDLASG   T GR   +  + RV T+ G + E+DD+   +  S+ PSS++ 
Sbjct  1    MISRSYTNLLDLASGNFPTMGRDRDRRRMPRVMTLPGSICEMDDDQAHSVSSENPSSLAG  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +RMI+V N LPL+A RR D + GW+F+W+EDSLLL+L+DGL ED+EV+YVG L  + IDP
Sbjct  61   DRMIVVANLLPLKAKRRPDNK-GWSFNWNEDSLLLRLRDGLPEDMEVVYVGSLCVD-IDP  118

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
             EQDDV+  LLE F+CVPAF+PP
Sbjct  119  IEQDDVSSYLLEKFRCVPAFLPP  141



>gb|ACD56625.1| trehalose synthase/phosphatase-like protein [Gossypium raimondii]
Length=1000

 Score =   153 bits (386),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 105/144 (73%), Gaps = 5/144 (3%)
 Frame = +3

Query  165  STMVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSI  338
            S M+S    N  DLASG     G  R  K+L RV TV GV+SELDD+  ++  SD PSS 
Sbjct  143  SHMISLLKPNA-DLASGNFPAMGQPREKKRLPRVMTVPGVISELDDDQANSVTSDAPSSA  201

Query  339  SQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEII  518
             Q+R+IIV NQLP++A RR D  +GW+FSWD+DSLLLQLKDGL E++EV+YVG LK + +
Sbjct  202  IQDRIIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLQLKDGLPEEMEVLYVGSLKVD-V  259

Query  519  DPNEQDDVAXTLLETFKCVPAFVP  590
            DP EQDDV+  LL+ FKCVPAF+P
Sbjct  260  DPVEQDDVSQLLLDKFKCVPAFLP  283



>emb|CDY01487.1| BnaC07g34770D [Brassica napus]
Length=837

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 100/142 (70%), Gaps = 24/142 (17%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGG-SDVPSSISQE  347
            MVSRSYSNLLDLASG   +F R                    E +SN   SD PSSI+Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSR--------------------EKKSNSVCSDAPSSIAQD  40

Query  348  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  527
            R+IIVGNQLP+++HR   G+    F+WD DSLLLQLKDG+ ED+EV+Y+GCLK++ +DP+
Sbjct  41   RIIIVGNQLPIKSHRNPSGK--LTFTWDNDSLLLQLKDGMREDMEVVYIGCLKDQ-VDPS  97

Query  528  EQDDVAXTLLETFKCVPAFVPP  593
            EQDDV+  LLE FKCVPA++PP
Sbjct  98   EQDDVSQRLLENFKCVPAYIPP  119



>ref|XP_010916659.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Elaeis guineensis]
Length=871

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 109/146 (75%), Gaps = 8/146 (5%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGE--SLTFGRAG---KKLSRVATVAGVLSELDDESRSNGGSDVPSS  335
            M+SRSY+NLLDLA+G   +L+ G  G   +++ RV T+ G L+ELDDE R+   S    S
Sbjct  1    MMSRSYTNLLDLATGNFAALSVGGPGGSRRRMPRVMTMPGTLTELDDEDRAGSVSSDVPS  60

Query  336  I-SQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEE  512
              +Q+R+IIV NQLP+RA RR DG  GW FSWDEDSLLLQLKDGL +D+EV+YVG L+ +
Sbjct  61   SVAQDRIIIVANQLPVRAKRRPDGR-GWCFSWDEDSLLLQLKDGLPDDMEVLYVGSLRVD  119

Query  513  IIDPNEQDDVAXTLLETFKCVPAFVP  590
             ++ +EQDDVA  LLE FKCVPAF+P
Sbjct  120  -VEGHEQDDVAQALLERFKCVPAFLP  144



>ref|XP_003527335.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like [Glycine max]
 gb|KHN33938.1| Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
7 [Glycine soja]
Length=862

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 108/144 (75%), Gaps = 6/144 (4%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFG----RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSI  338
            M+SRSY+NLLDLASG     G    R  ++L RV +V G ++E+DD+   +  SD PS++
Sbjct  1    MMSRSYTNLLDLASGNFPAMGGRETRERRRLPRVMSVPGFITEVDDDQAVSVSSDNPSTV  60

Query  339  SQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEII  518
            + +RMIIV NQLPL+A R+ D + GW+FSW+EDSLLLQLKDGL +D+EV+YVG L+ + I
Sbjct  61   TTDRMIIVANQLPLKAKRKEDNK-GWSFSWNEDSLLLQLKDGLPDDMEVLYVGSLRVD-I  118

Query  519  DPNEQDDVAXTLLETFKCVPAFVP  590
            DP EQDDV+  LL+ FKCVP F+P
Sbjct  119  DPAEQDDVSQYLLDKFKCVPTFLP  142



>ref|XP_009105068.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Brassica rapa]
Length=863

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 110/155 (71%), Gaps = 19/155 (12%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESR-SNGGSDVPSSISQE  347
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D++S+ S+  SD+     ++
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKESSPSSDLS---PKD  57

Query  348  RMIIVGNQLPLRAHRRTD-----------GEEGWNFSWDEDSLLLQLKDGLGED---VEV  485
            R+IIV N+LP+RA R+ +             +GW FS DE+SLLLQLKDGLG +    EV
Sbjct  58   RIIIVANELPIRAQRKLETSSTSTSTTHCSSKGWTFSLDENSLLLQLKDGLGSEATTTEV  117

Query  486  IYVGCLKEEIIDPNEQDDVAXTLLETFKCVPAFVP  590
            IYVGCLKE+ I PNEQ++V   LLE FKCVP F+P
Sbjct  118  IYVGCLKED-IHPNEQEEVYQLLLENFKCVPTFLP  151



>ref|XP_009595385.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Nicotiana tomentosiformis]
Length=858

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 105/144 (73%), Gaps = 5/144 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKK---LSRVATVAGVLSELDDESRSNGGSDVPSSIS  341
            M+SRSY+NLLDLASG     GR  ++   + RV TV G + ELDD+   +  SD  SS++
Sbjct  1    MMSRSYTNLLDLASGNFPVMGRERERPRMMPRVMTVPGSICELDDDLAHSVSSDNLSSLA  60

Query  342  QERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIID  521
             +RMIIV N LPL+A RR D + GW+FSW+EDSLLL+LKDGL ED+EV++VG L  + +D
Sbjct  61   GDRMIIVANLLPLKAKRRPDNK-GWSFSWNEDSLLLRLKDGLPEDMEVLFVGSLSID-VD  118

Query  522  PNEQDDVAXTLLETFKCVPAFVPP  593
            P EQDDV+  LL+ F+CVP F+PP
Sbjct  119  PIEQDDVSSYLLDKFRCVPTFLPP  142



>ref|XP_009768217.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Nicotiana sylvestris]
Length=858

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 105/144 (73%), Gaps = 5/144 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKK---LSRVATVAGVLSELDDESRSNGGSDVPSSIS  341
            M+SRSY+NLLDLASG     GR  ++   + RV TV G + ELDD+   +  SD  SS++
Sbjct  1    MMSRSYTNLLDLASGNFPVMGRERERPRMMPRVMTVPGSICELDDDLAHSVSSDNLSSLA  60

Query  342  QERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIID  521
             +RMIIV N LPL+A RR D + GW+FSW+EDSLLL+LKDGL ED+EV++VG L  + +D
Sbjct  61   GDRMIIVANLLPLKAKRRPDNK-GWSFSWNEDSLLLRLKDGLPEDMEVLFVGSLSID-VD  118

Query  522  PNEQDDVAXTLLETFKCVPAFVPP  593
            P EQDD++  LL+ F+CVP F+PP
Sbjct  119  PIEQDDISSYLLDKFRCVPTFLPP  142



>gb|ADN34028.1| trehalose-6-phosphate synthase [Cucumis melo subsp. melo]
Length=831

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 96/121 (79%), Gaps = 2/121 (2%)
 Frame = +3

Query  228  FGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQERMIIVGNQLPLRAHRRTDGE  407
             GR  K+L RV TVAGV+SELDD+  ++  S+ PSS+ Q+R+IIV NQLP++A RR D  
Sbjct  1    MGREKKRLPRVMTVAGVISELDDDQANSVTSEGPSSVVQDRIIIVANQLPIKAKRRPDN-  59

Query  408  EGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNEQDDVAXTLLETFKCVPAFV  587
            +GW+FSWDEDSLL QLKDGL ED+EV+YVG L+ + +D +EQ+DV+  LLE FKCVPAF+
Sbjct  60   KGWSFSWDEDSLLWQLKDGLPEDMEVLYVGSLRVD-VDSSEQEDVSQLLLERFKCVPAFL  118

Query  588  P  590
            P
Sbjct  119  P  119



>gb|EYU30144.1| hypothetical protein MIMGU_mgv1a001255mg [Erythranthe guttata]
Length=852

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 111/148 (75%), Gaps = 12/148 (8%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGE--SLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  344
            MVSRSYSNL+DLASGE  S +F R  +++ R+ TVAG++S+ DD   S+  S    +  +
Sbjct  1    MVSRSYSNLMDLASGEAQSPSFTRLSRRIPRIMTVAGIISDSDDGYSSSSSS----AAQR  56

Query  345  ERMIIVGNQLPLRAHRRTDGEEG----WNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKE  509
            +R+IIV NQLP++AHR+TDG  G    W F+WDEDS+LLQLKDGL  D ++ IYVGCLKE
Sbjct  57   DRIIIVANQLPIKAHRKTDGGGGGGGGWTFTWDEDSILLQLKDGLAPDEIDFIYVGCLKE  116

Query  510  EIIDPNEQDDVAXTLLETFKCVPAFVPP  593
            + I PN+QD+V+  LLE+FKCVP F+PP
Sbjct  117  D-IHPNDQDEVSQILLESFKCVPTFLPP  143



>ref|XP_010926098.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Elaeis guineensis]
Length=856

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 113/143 (79%), Gaps = 5/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            MVSRSYSNLL+LASGE  + GR  +++ RV TVAG++S+LDD+S S+  +  PSS  ++R
Sbjct  1    MVSRSYSNLLELASGEPPSIGRIRRRIPRVMTVAGIISDLDDDSDSDNSAG-PSSSPRDR  59

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGE--DVEVIYVGCLKEEIIDP  524
             I+V N LP+RAHRR DG  GW FSWDEDSLLLQLKD +G+  D+E IYVGCL++E I P
Sbjct  60   TIVVANHLPIRAHRRPDG-RGWTFSWDEDSLLLQLKDAIGDHCDMEFIYVGCLRDE-IPP  117

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
             +QD+V+  LL+TFKCVPAF+PP
Sbjct  118  ADQDEVSQILLDTFKCVPAFLPP  140



>ref|XP_006348895.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like [Solanum tuberosum]
Length=857

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 103/143 (72%), Gaps = 4/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSR--VATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+SRSY+NLLDLASG     GR   +     V TV G + ELDD+   +  SD  SS++ 
Sbjct  1    MMSRSYTNLLDLASGNFPVMGRERDRRRMSRVMTVPGSICELDDDQAVSVSSDNQSSLAG  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +RMI+V NQLPL+A RR D + GW+FSW+EDSLLL+LKDGL ED+EV++VG L  + +DP
Sbjct  61   DRMIVVANQLPLKAKRRPDNK-GWSFSWNEDSLLLRLKDGLPEDMEVLFVGSLSVD-VDP  118

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
             EQDDV+  LL+ F+CVP F+PP
Sbjct  119  IEQDDVSSYLLDKFRCVPTFLPP  141



>ref|XP_004243268.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Solanum lycopersicum]
Length=858

 Score =   147 bits (371),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 103/143 (72%), Gaps = 4/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSR--VATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+SRSY+NLLDLASG     GR   +     V TV G + ELDD+   +  SD  SS++ 
Sbjct  1    MMSRSYTNLLDLASGNFPVMGRERDRRRMSRVMTVPGSICELDDDQAVSVSSDNQSSLAG  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +RMI+V NQLPL+A RR D + GW+FSW+EDSLLL+LKDGL ED+EV++VG L  + +DP
Sbjct  61   DRMIVVANQLPLKAKRRPDNK-GWSFSWNEDSLLLRLKDGLPEDMEVLFVGSLSVD-VDP  118

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
             EQDDV+  LL+ F+CVP F+PP
Sbjct  119  IEQDDVSSYLLDKFRCVPTFLPP  141



>gb|AAL91978.1|AF483209_1 putative trehalose synthase [Solanum tuberosum]
Length=857

 Score =   147 bits (371),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 103/143 (72%), Gaps = 4/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSR--VATVAGVLSELDDESRSNGGSDVPSSISQ  344
            M+SRSY+NLLDLASG     GR   +     V TV G + ELDD+   +  SD  SS++ 
Sbjct  1    MMSRSYTNLLDLASGNFPVMGRERDRRRMSRVMTVPGSICELDDDQAVSVSSDNQSSLAG  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  524
            +RMI+V NQLPL+A RR D + GW+FSW+EDSLLL+LKDGL ED+EV++VG L  + +DP
Sbjct  61   DRMIVVANQLPLKAKRRPDNK-GWSFSWNEDSLLLRLKDGLPEDMEVLFVGSLSVD-VDP  118

Query  525  NEQDDVAXTLLETFKCVPAFVPP  593
             EQDDV+  LL+ F+CVP F+PP
Sbjct  119  IEQDDVSSYLLDKFRCVPTFLPP  141



>ref|NP_172129.1| putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
7 [Arabidopsis thaliana]
 sp|Q9LMI0.1|TPS7_ARATH RecName: Full=Probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7; AltName: Full=Trehalose-6-phosphate synthase 
7; Short=AtTPS7 [Arabidopsis thaliana]
 gb|AAF82169.1|AC068143_11 Contains similarity to a trehalose-6-phosphate synthase mRNA 
from Arabidopsis thaliana gb|Y08568 and contains a trehalose-6-phosphate 
synthase PF|00982 domain. ESTs gb|T76758, gb|T21695, 
gb|R30506, gb|T42298, gb|T42288 come from this gene [Arabidopsis 
thaliana]
 gb|AEE27983.1| putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
7 [Arabidopsis thaliana]
Length=851

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 102/141 (72%), Gaps = 4/141 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+SRSY+NLLDLASG     GR  ++L RV TV G +SE D++   +  SD PSS+S +R
Sbjct  1    MISRSYTNLLDLASGNFPVMGRERRRLPRVMTVPGNVSEFDEDQAYSVSSDNPSSVSSDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIV N+LPL+A +R      W+FSWD+DSL LQLKDGL ED+E++YVG L  + +D NE
Sbjct  61   MIIVANRLPLKAEKRNG---SWSFSWDQDSLYLQLKDGLPEDMEILYVGSLSVD-VDSNE  116

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA  LL+ FKCVP F PP
Sbjct  117  QDDVAQILLDKFKCVPTFFPP  137



>gb|KHG20430.1| putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
7 -like protein [Gossypium arboreum]
Length=838

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 96/120 (80%), Gaps = 2/120 (2%)
 Frame = +3

Query  234  RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQERMIIVGNQLPLRAHRRTDGEEG  413
            R  K+L+RV TV GV+SELDD+  ++  SDV SS++Q+R+IIV NQLP++  RR D  +G
Sbjct  5    RERKRLTRVMTVPGVVSELDDDQANSVNSDVHSSVNQDRIIIVANQLPVKVKRRPDN-KG  63

Query  414  WNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNEQDDVAXTLLETFKCVPAFVPP  593
            W+F+WD+ SLLLQLKDGL E++EV+YVG LK + +D NEQD+V+  LLE FKCVPAF+PP
Sbjct  64   WSFNWDDYSLLLQLKDGLPEEMEVLYVGSLKID-VDINEQDEVSSVLLEKFKCVPAFLPP  122



>ref|XP_008348581.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Malus domestica]
Length=851

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 89/120 (74%), Gaps = 2/120 (2%)
 Frame = +3

Query  234  RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQERMIIVGNQLPLRAHRRTDGEEG  413
            R  K + RV T  G LS+LDD+   +  SD PSSI+ +R+IIV NQLP++A RR D + G
Sbjct  18   RGKKTVPRVNTAPGNLSDLDDDQARSVSSDQPSSIASDRVIIVANQLPVKAKRREDNK-G  76

Query  414  WNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNEQDDVAXTLLETFKCVPAFVPP  593
            W FSW+EDSLLLQLKDGL ED+EV+YVG LK   +DP EQDDV+  LLE FKCVP F+PP
Sbjct  77   WTFSWNEDSLLLQLKDGLPEDMEVLYVGSLKVS-VDPKEQDDVSQVLLERFKCVPTFLPP  135



>ref|XP_007153210.1| hypothetical protein PHAVU_003G016300g [Phaseolus vulgaris]
 gb|ESW25204.1| hypothetical protein PHAVU_003G016300g [Phaseolus vulgaris]
Length=861

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 113/143 (79%), Gaps = 5/143 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSIS-QE  347
            MVS+SYSNLL+LASGE+ +FG   +++ R+ TVAG++S++DD+   +  SD  SS + ++
Sbjct  1    MVSKSYSNLLELASGEAPSFGYMNRRIPRIMTVAGLISDVDDDPVDSVCSDPSSSSAHRD  60

Query  348  RMIIVGNQLPLRAHRRTDGEEG-WNFSWDEDSLLLQLKDGLG-EDVEVIYVGCLKEEIID  521
            R+I+V NQLP+RA RR DG    W F WDE++ LLQLKDGLG +D+EVIYVGCLKEE + 
Sbjct  61   RIIMVANQLPIRAQRRPDGNRSCWCFEWDENA-LLQLKDGLGDDDIEVIYVGCLKEE-VH  118

Query  522  PNEQDDVAXTLLETFKCVPAFVP  590
            P+EQD+V+ TLLETFKCVP F+P
Sbjct  119  PSEQDEVSQTLLETFKCVPTFLP  141



>ref|XP_004498234.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X1 [Cicer arietinum]
Length=856

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 109/147 (74%), Gaps = 8/147 (5%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLS----ELDDESRSNGGSDVPSSI  338
            MVSRSYSNL++LASGE+ +FG   +++ R+ TVAG++S      DD+  S       SS+
Sbjct  1    MVSRSYSNLVELASGEAPSFGLMNRRIPRIMTVAGLISDVVVVDDDQVESVSSDFSSSSV  60

Query  339  SQERMIIVGNQLPLRAHRRTDGEEG-WNFSWDEDSLLLQLKDGLG-EDVEVIYVGCLKEE  512
             ++R+IIV NQLP++A +  DG    W+F WDE+S LLQLKDGLG +D+EVIYVGCLKE+
Sbjct  61   HRDRIIIVANQLPIKAQKNQDGNRNCWSFCWDENS-LLQLKDGLGDDDIEVIYVGCLKED  119

Query  513  IIDPNEQDDVAXTLLETFKCVPAFVPP  593
             ++PNEQD+V+  LLE FKCVP F+PP
Sbjct  120  -VNPNEQDEVSQILLENFKCVPVFLPP  145



>ref|XP_002889602.1| hypothetical protein ARALYDRAFT_470660 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65861.1| hypothetical protein ARALYDRAFT_470660 [Arabidopsis lyrata subsp. 
lyrata]
Length=851

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 102/141 (72%), Gaps = 4/141 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+SRSY+NLLDLASG     GR  ++L RV TV G +SE D++   +  SD PSS+S +R
Sbjct  1    MISRSYTNLLDLASGNFPVMGRERRRLPRVMTVPGNVSEFDEDQAYSVSSDNPSSVSSDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIV N+LPL+A RR      W+FSWD+DSL LQLKDGL ED+E++YVG L  + +D +E
Sbjct  61   MIIVANRLPLKAERRNG---SWSFSWDQDSLYLQLKDGLPEDMEILYVGSLSVD-VDSHE  116

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA  LL+ FKCVP F PP
Sbjct  117  QDDVAQILLDKFKCVPTFFPP  137



>ref|XP_007153644.1| hypothetical protein PHAVU_003G053000g [Phaseolus vulgaris]
 gb|ESW25638.1| hypothetical protein PHAVU_003G053000g [Phaseolus vulgaris]
Length=857

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M SRSY+NLLDLASG+ L   R  + L RV T+ G++S+LD    ++G SDV SS  +ER
Sbjct  1    MASRSYANLLDLASGDLLDIPRTPRALPRVMTIPGIISDLDGYGCNDGDSDVSSSGYRER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
             IIV N LPL+A R  +  + W FSWDEDS+LLQLKDG   D EVIYVG LK E ID  E
Sbjct  61   KIIVANMLPLQAKRDIETAK-WVFSWDEDSILLQLKDGFSSDTEVIYVGSLKIE-IDLCE  118

Query  531  QDDVAXTLLETFKCVPAFVP  590
            QD VA  LL+ F CVP F+P
Sbjct  119  QDAVAQRLLDEFNCVPTFLP  138



>ref|XP_003568093.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Brachypodium distachyon]
Length=902

 Score =   144 bits (364),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 107/156 (69%), Gaps = 18/156 (12%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAG-----------KKLSRVATVAGVLSELDDE-----S  302
            M+SRSY+NLLDLA+G     G AG           K++ RV TV G LSELDDE     +
Sbjct  1    MMSRSYTNLLDLAAGNFAALGPAGGGRRRSGSFAAKRMPRVMTVPGTLSELDDEDDELAA  60

Query  303  RSNGGSDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVE  482
             S+  SDVPSS   ER+I+V NQLP+ A RR DG  GW FSWD+DSLLL+L+DG+ +++E
Sbjct  61   TSSIASDVPSSAVGERLIVVANQLPVVARRRPDGR-GWLFSWDDDSLLLRLRDGVPDEME  119

Query  483  VIYVGCLKEEIIDPNEQDDVAXTLLETFKCVPAFVP  590
            V++VG L+ + +  +EQD+V+ TL++ F+C P F+P
Sbjct  120  VLFVGTLRAD-VPASEQDEVSQTLIDGFRCAPVFLP  154



>tpg|DAA57653.1| TPA: putative trehalose phosphatase/synthase family protein [Zea 
mays]
Length=912

 Score =   144 bits (364),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 107/158 (68%), Gaps = 20/158 (13%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAG------------KKLSRVATVAGVLSELDDE-----  299
            M+SRSY+NLLDLA G     G AG            +++SRV TV G LSELD E     
Sbjct  1    MMSRSYTNLLDLAEGNFAALGPAGGSGRQRHGSFGLRRMSRVMTVPGTLSELDGEDESEP  60

Query  300  -SRSNGGSDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED  476
             + S+  SDVPSS++ +R+I+V NQLP+ A RR DG  GW+FSWD DSLLLQL+DG+ ++
Sbjct  61   AATSSVASDVPSSVAVDRLIVVSNQLPIVARRRPDGR-GWSFSWDGDSLLLQLRDGIPDE  119

Query  477  VEVIYVGCLKEEIIDPNEQDDVAXTLLETFKCVPAFVP  590
            +EV++VG L+ + +   EQD+V+ TLL+ F+C P F+P
Sbjct  120  MEVLFVGSLRAD-VPAAEQDEVSQTLLDRFRCAPVFLP  156



>ref|XP_011070304.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 isoform X2 [Sesamum indicum]
 ref|XP_011070305.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 isoform X2 [Sesamum indicum]
Length=804

 Score =   144 bits (362),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 77/81 (95%), Gaps = 2/81 (2%)
 Frame = +3

Query  351  MIIVGNQLPLRAHRR-TDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  527
            MIIVGNQLPLRAHRR +DG++GW+FSWDEDSLLLQLKDGLGEDVEVIYVGCLKEE ID +
Sbjct  1    MIIVGNQLPLRAHRRESDGDKGWDFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEE-IDVS  59

Query  528  EQDDVAXTLLETFKCVPAFVP  590
            EQ+DVA TLLETFKCVPAF+P
Sbjct  60   EQEDVAQTLLETFKCVPAFIP  80



>ref|XP_009365279.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X1 [Pyrus x bretschneideri]
Length=836

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 88/117 (75%), Gaps = 2/117 (2%)
 Frame = +3

Query  243  KKLSRVATVAGVLSELDDESRSNGGSDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNF  422
            ++  RV T  G LS+LDD+   +  SD PSSI+ +R+IIV NQLP++A RR D + GW F
Sbjct  6    RRFPRVNTAPGNLSDLDDDQARSVSSDQPSSIASDRVIIVANQLPVKAKRREDNK-GWTF  64

Query  423  SWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNEQDDVAXTLLETFKCVPAFVPP  593
            SW+EDSLLLQLKDGL ED+EV+YVG LK   +DP EQDDV+  LLE FKCVP F+PP
Sbjct  65   SWNEDSLLLQLKDGLPEDMEVLYVGSLKVS-VDPKEQDDVSQVLLERFKCVPTFLPP  120



>ref|XP_010475368.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X1 [Camelina sativa]
 ref|XP_010475369.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X2 [Camelina sativa]
 ref|XP_010475370.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X1 [Camelina sativa]
 ref|XP_010475371.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X3 [Camelina sativa]
 ref|XP_010475372.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X3 [Camelina sativa]
Length=851

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 102/141 (72%), Gaps = 4/141 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+SRSY+NLLDLASG     GR  ++L RV TV G +SE D++   +  SD PSS+S +R
Sbjct  1    MISRSYTNLLDLASGNFPVMGRERRRLPRVMTVPGNVSEFDEDQAYSVSSDNPSSVSSDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIV N+LPL+A +R      W+FSWD+DSL LQLKDGL ED+E++YVG L  + +D +E
Sbjct  61   MIIVANRLPLKAEKRNG---SWSFSWDQDSLYLQLKDGLPEDMEILYVGSLSVD-VDSHE  116

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA  LL+ FKCVP F PP
Sbjct  117  QDDVAQILLDKFKCVPTFFPP  137



>ref|XP_006306755.1| hypothetical protein CARUB_v10008292mg [Capsella rubella]
 ref|XP_006306756.1| hypothetical protein CARUB_v10008292mg [Capsella rubella]
 gb|EOA39653.1| hypothetical protein CARUB_v10008292mg [Capsella rubella]
 gb|EOA39654.1| hypothetical protein CARUB_v10008292mg [Capsella rubella]
Length=851

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 102/141 (72%), Gaps = 4/141 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+SRSY+NLLDLASG     GR  ++L RV TV G +SE D++   +  SD PSS+S +R
Sbjct  1    MISRSYTNLLDLASGNFPVMGRERRRLPRVMTVPGNVSEFDEDQAYSVSSDNPSSVSSDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIV N+LPL+A +R      W+FSWD+DSL LQLKDGL ED+E++YVG L  + +D +E
Sbjct  61   MIIVANRLPLKAEKRNG---SWSFSWDQDSLYLQLKDGLPEDMEILYVGSLSVD-VDSHE  116

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA  LL+ FKCVP F PP
Sbjct  117  QDDVAQILLDKFKCVPTFFPP  137



>ref|XP_010486072.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Camelina sativa]
Length=851

 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 101/141 (72%), Gaps = 4/141 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M+SRSY+NLLDLASG     GR  ++L RV TV G +SE D++   +  SD PSS+S +R
Sbjct  1    MISRSYTNLLDLASGNFPVMGRERRRLPRVMTVPGNVSEFDEDQAYSVSSDNPSSVSSDR  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIV N+LPL+A +R      W+FSWD+DSL LQLKDGL ED+E++YVG L  + +D  E
Sbjct  61   MIIVANRLPLKAEKRNG---SWSFSWDQDSLYLQLKDGLPEDMEILYVGSLSVD-VDSQE  116

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QDDVA  LL+ FKCVP F PP
Sbjct  117  QDDVAQILLDKFKCVPTFFPP  137



>ref|XP_010268366.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 9 isoform X1 [Nelumbo nucifera]
 ref|XP_010268367.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 9 isoform X1 [Nelumbo nucifera]
Length=867

 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 103/148 (70%), Gaps = 12/148 (8%)
 Frame = +3

Query  171  MVSRSYSNLLDLAS----GESLTFGRAGKKLSRVATVAGVLSELD---DESRSN-GGSDV  326
            M+SRS +NLL+L S    G+    GR   +L RV TV G++S+ D   DE RS  GGSD 
Sbjct  1    MLSRSCANLLNLVSSGAVGDLPKIGRT--RLPRVMTVPGIISDFDGDEDEGRSECGGSDA  58

Query  327  PSSISQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLK  506
             SS  QER IIV NQLPL+A R  + ++ W F WD+D+L+LQLKDG   DVEV+YVGCLK
Sbjct  59   VSSTVQERRIIVANQLPLQAQRDPESKK-WCFEWDKDALVLQLKDGFSPDVEVVYVGCLK  117

Query  507  EEIIDPNEQDDVAXTLLETFKCVPAFVP  590
             E IDP+EQD+VA  LLE ++CVP F+P
Sbjct  118  AE-IDPSEQDEVAQFLLEKYRCVPTFLP  144



>ref|XP_004509840.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 9-like [Cicer arietinum]
Length=860

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 96/140 (69%), Gaps = 4/140 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M SRSY+NLLDLA G+        + L RV TV G++S+LD    ++G SDV SS  +ER
Sbjct  1    MTSRSYANLLDLAGGDLFDIPHTPRTLPRVMTVPGIISDLD--GCNDGDSDVSSSGCRER  58

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
             IIV N LPL+A R  D  + W FSWDEDS+LLQLKDG   D+EVIYVG LK E ID +E
Sbjct  59   KIIVANMLPLQAKRDIDTAK-WCFSWDEDSILLQLKDGFSSDIEVIYVGSLKVE-IDASE  116

Query  531  QDDVAXTLLETFKCVPAFVP  590
            QD+VA  LL+ F CVP F+P
Sbjct  117  QDEVAQRLLDDFNCVPTFLP  136



>ref|XP_004969834.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like [Setaria italica]
Length=878

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 101/155 (65%), Gaps = 17/155 (11%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGE--SLTFGRA-------------GKKLSRVATVAGVLSELDDESR  305
            M SRSY+NLLDLA+G   +L +G                +++ R  T  G L ELD+E  
Sbjct  1    MFSRSYTNLLDLANGNLSALDYGGGGGGGGGGGGRPPRARRMQRTMTTPGTLVELDEERA  60

Query  306  SNGGSDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEV  485
             +  SDV SS++ +R+I+V N LP+R  RR DG  GW FSWDEDSLL  L+DGL +D+EV
Sbjct  61   GSVASDVQSSLAGDRLIVVANTLPVRGERRPDGR-GWTFSWDEDSLLFHLRDGLPDDMEV  119

Query  486  IYVGCLKEEIIDPNEQDDVAXTLLETFKCVPAFVP  590
            +YVG L+ + + P EQDDVA  LLE F+CVPAF+P
Sbjct  120  LYVGSLRAD-VPPAEQDDVAQALLERFRCVPAFLP  153



>ref|XP_003532016.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 10-like isoform X1 [Glycine max]
 ref|XP_006585958.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 10-like isoform X2 [Glycine max]
Length=861

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 95/140 (68%), Gaps = 2/140 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M SRSY+NL DLASG+ L F    + L RV TV G++S+LD    ++G SDV SS  +ER
Sbjct  1    MASRSYANLFDLASGDFLDFPCPPRALPRVMTVPGIISDLDGYGCNDGDSDVSSSGCRER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
             IIV N LP++A R  +  + W FSWDEDS+LLQLKDG   D EVIYVG LK E ID  E
Sbjct  61   KIIVANMLPVQAKRDIETAK-WVFSWDEDSILLQLKDGFSADTEVIYVGSLKVE-IDACE  118

Query  531  QDDVAXTLLETFKCVPAFVP  590
            QD VA  LL+ F CVP F+P
Sbjct  119  QDAVAQRLLDEFNCVPTFLP  138



>gb|KDO53157.1| hypothetical protein CISIN_1g002958mg [Citrus sinensis]
Length=803

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 74/81 (91%), Gaps = 1/81 (1%)
 Frame = +3

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
            MIIVGNQLPLRAHR +DG  GW FSWDEDSLLLQLKDGLGEDVEVIYVGC+KE+ ID +E
Sbjct  1    MIIVGNQLPLRAHRSSDGSGGWTFSWDEDSLLLQLKDGLGEDVEVIYVGCIKEQ-IDLSE  59

Query  531  QDDVAXTLLETFKCVPAFVPP  593
            QD+V+ TLLETFKCVPAF+PP
Sbjct  60   QDEVSQTLLETFKCVPAFIPP  80



>ref|XP_006654654.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like [Oryza brachyantha]
Length=893

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 102/151 (68%), Gaps = 13/151 (9%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAG-----------KKLSRVATVAGVLSELDDESRSNGG  317
            M+SRSY+NLLDLA+G     G AG           K+++RV TV G LSELDDE      
Sbjct  1    MMSRSYTNLLDLAAGNFAALGPAGGGRRRSGSFGAKRMTRVMTVPGTLSELDDEDDEPVA  60

Query  318  SDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVG  497
            SDVPSS   ER+I+V NQLP+ A RR DG  GW  SWD+DSLLL+L+DG+ +++EV+++G
Sbjct  61   SDVPSSAVCERLIVVANQLPVVARRRADG-RGWTVSWDDDSLLLRLRDGVPDEMEVLFIG  119

Query  498  CLKEEIIDPNEQDDVAXTLLETFKCVPAFVP  590
             L+ + +   EQD+V+ TL++ F C P F+P
Sbjct  120  TLRAD-VPACEQDEVSQTLIDGFGCAPVFLP  149



>ref|XP_010932535.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Elaeis guineensis]
 ref|XP_010932536.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Elaeis guineensis]
 ref|XP_010932537.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Elaeis guineensis]
 ref|XP_010932538.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Elaeis guineensis]
 ref|XP_010932539.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Elaeis guineensis]
Length=859

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 108/144 (75%), Gaps = 6/144 (4%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDD--ESRSNGGSDVPSSISQ  344
            MVS+SYSNLL+LASGES + GR G+++ RV T  G++ +LD+  ++ SN  S++ S   +
Sbjct  1    MVSKSYSNLLELASGESQSLGRIGRRIPRVVTAPGIVPDLDESDDAASNSSSELASPSPR  60

Query  345  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGE--DVEVIYVGCLKEEII  518
            +R IIV NQLP+RA R+  G  GW+FSWD+DSLL Q+KD +G+  D+E IY+G L+EE I
Sbjct  61   DRTIIVANQLPIRAARQP-GVGGWSFSWDQDSLLHQVKDSIGDHKDMEFIYIGSLREE-I  118

Query  519  DPNEQDDVAXTLLETFKCVPAFVP  590
              +EQD+VA  LLETF CVPAF+P
Sbjct  119  PVSEQDEVAKILLETFNCVPAFLP  142



>ref|XP_003552011.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 9-like isoform X1 [Glycine max]
 ref|XP_006602379.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 9-like isoform X2 [Glycine max]
Length=861

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 95/140 (68%), Gaps = 2/140 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M SRSY+NL DLASG+ L F    + L RV TV G++S+LD    ++G SDV SS  +ER
Sbjct  1    MASRSYANLFDLASGDFLDFPCTPRALPRVMTVPGIISDLDGYGCNDGDSDVSSSGCRER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
             IIV N LP++A R  +  + W FSWDEDS+LLQLKDG   D EVIYVG LK E ID  E
Sbjct  61   KIIVANMLPVQAKRDIETAK-WVFSWDEDSILLQLKDGFSADSEVIYVGSLKVE-IDACE  118

Query  531  QDDVAXTLLETFKCVPAFVP  590
            QD VA  LL+ F CVP F+P
Sbjct  119  QDAVAQRLLDEFNCVPTFLP  138



>gb|KHN24134.1| Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
10 [Glycine soja]
Length=861

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 95/140 (68%), Gaps = 2/140 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M SRSY+NL DLASG+ L F    + L RV TV G++S+LD    ++G SDV SS  +ER
Sbjct  1    MASRSYANLFDLASGDFLDFPCTPRALPRVMTVPGIISDLDGYGCNDGDSDVSSSGCRER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
             IIV N LP++A R  +  + W FSWDEDS+LLQLKDG   D EVIYVG LK E ID  E
Sbjct  61   KIIVANMLPVQAKRDIETAK-WVFSWDEDSILLQLKDGFSADSEVIYVGSLKVE-IDACE  118

Query  531  QDDVAXTLLETFKCVPAFVP  590
            QD VA  LL+ F CVP F+P
Sbjct  119  QDAVAQRLLDEFNCVPTFLP  138



>gb|KHN10606.1| Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
10 [Glycine soja]
Length=857

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 95/140 (68%), Gaps = 2/140 (1%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M SRSY+NL DLASG+ L F    + L RV TV G++S+LD    ++G SDV SS  +ER
Sbjct  1    MASRSYANLFDLASGDFLDFPCPPRALPRVMTVPGIISDLDGYGCNDGDSDVSSSGCRER  60

Query  351  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  530
             IIV N LP++A R  +  + W FSWDEDS+LLQLKDG   D EVIYVG LK E ID  E
Sbjct  61   KIIVANMLPVQAKRDIETAK-WVFSWDEDSILLQLKDGFCADTEVIYVGSLKVE-IDACE  118

Query  531  QDDVAXTLLETFKCVPAFVP  590
            QD VA  LL+ F CVP F+P
Sbjct  119  QDAVAQRLLDEFNCVPTFLP  138



>ref|XP_010924709.1| PREDICTED: LOW QUALITY PROTEIN: probable alpha,alpha-trehalose-phosphate 
synthase [UDP-forming] 7 [Elaeis guineensis]
Length=894

 Score =   141 bits (356),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 109/171 (64%), Gaps = 13/171 (8%)
 Frame = +3

Query  105  FDFYHLLVLLIFE--------RCIYCGESTMVSRSYSNLLDLASGESLT-FGRAGKKLSR  257
            FD +  +V L F+        RC+  G + M SRSY+NL DL  G+S    G   K++SR
Sbjct  3    FDSWVWMVFLGFDLAFLGSAGRCL-LGTAKMTSRSYTNLQDLTLGDSTAQSGSKWKQMSR  61

Query  258  VATVAGVLSELDDESR-SNGGSDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFSWDE  434
              TV G  S+LDDE       S+  S+ + +R+IIV N+LP+RA+RRT G  GWNFSWD+
Sbjct  62   AMTVPGTPSKLDDEDPPGRSSSNATSTATHDRIIIVANELPVRANRRTGGC-GWNFSWDK  120

Query  435  DSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNEQDDVAXTLLETFKCVPAFV  587
            DSLL QLKDG  ED+EV YVG L    +D +E+D VA +LLE FKC+P F+
Sbjct  121  DSLLFQLKDGFPEDMEVFYVGSLHVN-VDCHEEDGVAQSLLEHFKCIPTFL  170



>dbj|BAJ87235.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=902

 Score =   141 bits (355),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 107/156 (69%), Gaps = 18/156 (12%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAG-----------KKLSRVATVAGVLSELDDE-----S  302
            M+SRSY+NLLDLA+G     G AG           +++ RV TV G LSELDDE     +
Sbjct  1    MMSRSYTNLLDLAAGNFAALGPAGGGRRRSGSFASRRMPRVMTVPGTLSELDDEDDERAA  60

Query  303  RSNGGSDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVE  482
             S+  SDVPSS   ER+I+V NQLP+ A RR DG  GW FSWD+DSLLL+L+DG+ +++E
Sbjct  61   TSSVASDVPSSAICERLIVVANQLPVVARRRPDGR-GWVFSWDDDSLLLRLRDGVPDEME  119

Query  483  VIYVGCLKEEIIDPNEQDDVAXTLLETFKCVPAFVP  590
            V+++G L+ + +  +EQ++V+ TL++ F+C P F+P
Sbjct  120  VLFIGTLRAD-VPASEQEEVSQTLIDGFRCAPVFLP  154



>gb|ACI62866.1| trehalose 6-phosphate synthase [Gossypium arboreum]
 gb|KHG27950.1| putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
9 -like protein [Gossypium arboreum]
Length=861

 Score =   141 bits (355),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 95/141 (67%), Gaps = 4/141 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M SRS +N L LASG  L   +  + L RV TV G++S++D  S ++G SDV SS  +ER
Sbjct  1    MASRSCANFLHLASGNLLDIPQTPRGLPRVMTVPGIISDMDSCSSNDGDSDVASSGCRER  60

Query  351  MIIVGNQLPLRAHRRTDGEEG-WNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  527
             IIV N LPL A R  DGE   W FSWDEDSLLL LKDG   ++EV+YVG LK + ID N
Sbjct  61   KIIVANMLPLHAKR--DGETSKWRFSWDEDSLLLHLKDGFSPEMEVVYVGSLKVD-IDVN  117

Query  528  EQDDVAXTLLETFKCVPAFVP  590
            EQ++VA  LLE F CVP FVP
Sbjct  118  EQEEVAQKLLEDFNCVPTFVP  138



>tpg|DAA57651.1| TPA: putative trehalose phosphatase/synthase family protein [Zea 
mays]
Length=912

 Score =   141 bits (355),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 105/158 (66%), Gaps = 20/158 (13%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAG------------KKLSRVATVAGVLSELDDE-----  299
            M+SRSY+NLLDLA G     G  G            +++SRV TV G L+ELD E     
Sbjct  1    MMSRSYTNLLDLAEGNFAALGPVGGSGRQRHGSFGLRRMSRVMTVPGTLTELDGEDESEP  60

Query  300  -SRSNGGSDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED  476
             + S+  SDVPSS++ +R+I+V NQLP+ A RR DG  GW+FSWD+DSLLLQL+DG+ ++
Sbjct  61   AATSSVASDVPSSVAADRLIVVSNQLPIVARRRPDGR-GWSFSWDDDSLLLQLRDGIPDE  119

Query  477  VEVIYVGCLKEEIIDPNEQDDVAXTLLETFKCVPAFVP  590
            +EV++VG L+ + +   EQD V+  LL+ F+C P F+P
Sbjct  120  MEVLFVGSLRAD-VPAAEQDAVSQALLDRFRCAPVFLP  156



>ref|XP_002458490.1| hypothetical protein SORBIDRAFT_03g034640 [Sorghum bicolor]
 gb|EES03610.1| hypothetical protein SORBIDRAFT_03g034640 [Sorghum bicolor]
Length=910

 Score =   140 bits (354),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 104/158 (66%), Gaps = 20/158 (13%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAG------------KKLSRVATVAGVLSELDDESRSNG  314
            M+SRSY+NLLDLA G     G AG            +++SRV TV G LSELD E  S  
Sbjct  1    MMSRSYTNLLDLAEGNFAALGPAGGSGRQRQGSFGMRRMSRVMTVPGTLSELDGEDESEP  60

Query  315  G------SDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED  476
                   SD PSS++ +R+I+V NQLP+ A RR DG  GW+FSWD+DSLLLQL+DG+ ++
Sbjct  61   AATNSVASDAPSSLAADRVIVVSNQLPIVARRRPDGR-GWSFSWDDDSLLLQLRDGIPDE  119

Query  477  VEVIYVGCLKEEIIDPNEQDDVAXTLLETFKCVPAFVP  590
            +EV++VG L+ + +   EQD+V+  LL+ F+C P F+P
Sbjct  120  MEVLFVGSLRAD-VPVAEQDEVSQALLDRFRCAPVFLP  156



>gb|KJB31282.1| hypothetical protein B456_005G183800 [Gossypium raimondii]
Length=663

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 95/141 (67%), Gaps = 4/141 (3%)
 Frame = +3

Query  171  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  350
            M SRS +N L LASG  L   +  + L RV TV G++S++D  S ++G SDV SS  +ER
Sbjct  1    MASRSCANFLHLASGNLLDIPQTPRGLPRVMTVPGIISDMDSCSSNDGDSDVASSGCRER  60

Query  351  MIIVGNQLPLRAHRRTDGEEG-WNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  527
             IIV N LPL A R  DGE   W+FSWDEDSLLL LKDG   + EV++VG LK + ID N
Sbjct  61   KIIVANMLPLHAKR--DGETSKWHFSWDEDSLLLHLKDGFSPETEVVFVGSLKVD-IDVN  117

Query  528  EQDDVAXTLLETFKCVPAFVP  590
            EQ++VA  LLE F CVP F+P
Sbjct  118  EQEEVAQKLLEDFNCVPTFLP  138



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 778590373395