BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS012C08

Length=619
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO43322.1|  hypothetical protein CISIN_1g0039661mg                  289   7e-96   Citrus sinensis [apfelsine]
ref|XP_006357190.1|  PREDICTED: chloride channel protein CLC-b-like     303   2e-94   Solanum tuberosum [potatoes]
ref|XP_004233300.1|  PREDICTED: chloride channel protein CLC-b          303   4e-94   Solanum lycopersicum
ref|XP_008353449.1|  PREDICTED: chloride channel protein CLC-b-like     284   1e-93   
gb|AAD29679.1|AF133209_1  CLC-Nt2 protein                               300   4e-93   Nicotiana tabacum [American tobacco]
ref|XP_009761471.1|  PREDICTED: chloride channel protein CLC-b-like     300   4e-93   Nicotiana sylvestris
emb|CDP16685.1|  unnamed protein product                                299   8e-93   Coffea canephora [robusta coffee]
ref|XP_011097296.1|  PREDICTED: chloride channel protein CLC-b-like     295   4e-91   Sesamum indicum [beniseed]
ref|XP_008379123.1|  PREDICTED: chloride channel protein CLC-b is...    293   2e-90   
ref|XP_008379124.1|  PREDICTED: chloride channel protein CLC-b is...    293   3e-90   
ref|XP_009596046.1|  PREDICTED: chloride channel protein CLC-b-like     293   3e-90   Nicotiana tomentosiformis
ref|XP_010111585.1|  Chloride channel protein CLC-b                     288   1e-88   Morus notabilis
gb|KDP46292.1|  hypothetical protein JCGZ_10132                         287   3e-88   Jatropha curcas
ref|XP_006447084.1|  hypothetical protein CICLE_v10014341mg             287   4e-88   Citrus clementina [clementine]
gb|KHN10806.1|  Chloride channel protein CLC-b                          286   5e-88   Glycine soja [wild soybean]
ref|NP_001267676.1|  chloride channel protein CLC-b-like                285   4e-87   Cucumis sativus [cucumbers]
ref|XP_007151531.1|  hypothetical protein PHAVU_004G054600g             284   4e-87   Phaseolus vulgaris [French bean]
gb|KHN01525.1|  Chloride channel protein CLC-b                          284   5e-87   Glycine soja [wild soybean]
ref|XP_007217037.1|  hypothetical protein PRUPE_ppa001619mg             284   6e-87   Prunus persica
ref|NP_001236494.1|  chloride channel                                   284   6e-87   
ref|XP_002300101.1|  Chloride channel protein CLC-a                     283   8e-87   Populus trichocarpa [western balsam poplar]
ref|XP_008441347.1|  PREDICTED: chloride channel protein CLC-b-like     283   9e-87   Cucumis melo [Oriental melon]
ref|XP_003553925.1|  PREDICTED: chloride channel protein CLC-b-li...    283   2e-86   Glycine max [soybeans]
ref|XP_006604142.1|  PREDICTED: chloride channel protein CLC-b-li...    282   2e-86   Glycine max [soybeans]
ref|XP_009371657.1|  PREDICTED: chloride channel protein CLC-b-like     282   3e-86   
ref|XP_007161741.1|  hypothetical protein PHAVU_001G094700g             280   1e-85   Phaseolus vulgaris [French bean]
ref|XP_007161742.1|  hypothetical protein PHAVU_001G094700g             280   2e-85   Phaseolus vulgaris [French bean]
ref|XP_002509531.1|  chloride channel clc, putative                     279   4e-85   Ricinus communis
ref|XP_008231135.1|  PREDICTED: chloride channel protein CLC-b          279   5e-85   Prunus mume [ume]
ref|XP_011003929.1|  PREDICTED: chloride channel protein CLC-b          279   5e-85   Populus euphratica
gb|KJB76407.1|  hypothetical protein B456_012G087500                    278   1e-84   Gossypium raimondii
gb|KJB76409.1|  hypothetical protein B456_012G087500                    278   1e-84   Gossypium raimondii
gb|KJB76408.1|  hypothetical protein B456_012G087500                    278   1e-84   Gossypium raimondii
gb|EYU45399.1|  hypothetical protein MIMGU_mgv1a001597mg                277   2e-84   Erythranthe guttata [common monkey flower]
ref|XP_010029007.1|  PREDICTED: chloride channel protein CLC-b          276   4e-84   Eucalyptus grandis [rose gum]
gb|KHN24330.1|  Chloride channel protein CLC-b                          276   4e-84   Glycine soja [wild soybean]
gb|AES75065.2|  ClC chloride channel family protein                     275   9e-84   Medicago truncatula
ref|XP_003618847.1|  Chloride channel protein CLC-a                     275   1e-83   
gb|EYU34803.1|  hypothetical protein MIMGU_mgv1a001623mg                275   2e-83   Erythranthe guttata [common monkey flower]
gb|KJB11653.1|  hypothetical protein B456_001G270200                    274   4e-83   Gossypium raimondii
ref|XP_007031848.1|  Chloride channel B isoform 2                       273   5e-83   
ref|XP_007031850.1|  Chloride channel B isoform 4                       273   9e-83   
ref|NP_001268190.1|  uncharacterized protein LOC100260066               272   2e-82   Vitis vinifera
ref|XP_010660593.1|  PREDICTED: uncharacterized protein LOC100260...    271   3e-82   Vitis vinifera
emb|CAN82189.1|  hypothetical protein VITISV_031114                     270   5e-82   Vitis vinifera
ref|XP_004513192.1|  PREDICTED: chloride channel protein CLC-b-like     270   7e-82   Cicer arietinum [garbanzo]
ref|XP_011098867.1|  PREDICTED: chloride channel protein CLC-a-like     270   8e-82   Sesamum indicum [beniseed]
ref|XP_010248967.1|  PREDICTED: chloride channel protein CLC-b          268   6e-81   Nelumbo nucifera [Indian lotus]
ref|XP_006395477.1|  hypothetical protein EUTSA_v10003679mg             266   2e-80   Eutrema salsugineum [saltwater cress]
ref|XP_010905204.1|  PREDICTED: chloride channel protein CLC-b-like     266   3e-80   
ref|XP_006290621.1|  hypothetical protein CARUB_v10016713mg             265   6e-80   Capsella rubella
ref|XP_010678325.1|  PREDICTED: chloride channel protein CLC-b-li...    265   1e-79   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002875360.1|  CLC-B                                              264   2e-79   
gb|KEH22046.1|  ClC chloride channel family protein                     264   3e-79   Medicago truncatula
ref|XP_010425455.1|  PREDICTED: chloride channel protein CLC-b-li...    262   4e-79   Camelina sativa [gold-of-pleasure]
ref|NP_189353.1|  chloride channel protein CLC-b                        262   8e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010425454.1|  PREDICTED: chloride channel protein CLC-b-li...    262   8e-79   Camelina sativa [gold-of-pleasure]
ref|XP_004303984.1|  PREDICTED: chloride channel protein CLC-b-like     262   8e-79   Fragaria vesca subsp. vesca
emb|CDY13685.1|  BnaA06g32380D                                          261   1e-78   Brassica napus [oilseed rape]
ref|XP_009151988.1|  PREDICTED: chloride channel protein CLC-b          261   1e-78   Brassica rapa
ref|XP_008806046.1|  PREDICTED: chloride channel protein CLC-a-like     261   2e-78   
gb|KFK33637.1|  hypothetical protein AALP_AA5G039600                    261   2e-78   Arabis alpina [alpine rockcress]
emb|CDX83663.1|  BnaC07g24030D                                          261   3e-78   
ref|XP_010514406.1|  PREDICTED: chloride channel protein CLC-b          261   3e-78   Camelina sativa [gold-of-pleasure]
gb|AFW87644.1|  hypothetical protein ZEAMMB73_318834                    245   7e-78   
ref|XP_010502678.1|  PREDICTED: chloride channel protein CLC-b-li...    258   1e-77   Camelina sativa [gold-of-pleasure]
ref|XP_010502677.1|  PREDICTED: chloride channel protein CLC-b-li...    259   1e-77   Camelina sativa [gold-of-pleasure]
ref|XP_006338691.1|  PREDICTED: chloride channel protein CLC-a-like     258   2e-77   Solanum tuberosum [potatoes]
emb|CDY34173.1|  BnaA02g28670D                                          258   3e-77   Brassica napus [oilseed rape]
ref|XP_009129444.1|  PREDICTED: chloride channel protein CLC-b-like     258   3e-77   Brassica rapa
ref|XP_010670516.1|  PREDICTED: chloride channel protein CLC-b-like     258   3e-77   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX99630.1|  BnaC04g33870D                                          258   3e-77   
emb|CDY28488.1|  BnaC02g36720D                                          258   4e-77   Brassica napus [oilseed rape]
emb|CAA96057.1|  CLC-a chloride channel protein                         256   1e-76   Arabidopsis thaliana [mouse-ear cress]
gb|AAL24139.1|  putative anion channel protein                          256   1e-76   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198905.1|  chloride channel protein CLC-a                        256   1e-76   Arabidopsis thaliana [mouse-ear cress]
gb|AAB17007.1|  voltage-gated chloride channel                          256   2e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009392485.1|  PREDICTED: chloride channel protein CLC-a-like     256   2e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008788897.1|  PREDICTED: chloride channel protein CLC-b-like     255   4e-76   
gb|KFK33054.1|  hypothetical protein AALP_AA6G324100                    253   2e-75   Arabis alpina [alpine rockcress]
gb|EMT23598.1|  hypothetical protein F775_52599                         249   5e-75   
dbj|BAJ33828.1|  unnamed protein product                                241   6e-75   Eutrema halophilum
ref|XP_006285462.1|  hypothetical protein CARUB_v10006880mg             251   7e-75   Capsella rubella
dbj|BAJ96369.1|  predicted protein                                      249   4e-74   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ92499.1|  predicted protein                                      249   4e-74   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ88201.1|  predicted protein                                      249   4e-74   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY11722.1|  BnaC06g13300D                                          249   4e-74   Brassica napus [oilseed rape]
gb|EMT27070.1|  Chloride channel protein CLC-b                          243   1e-73   
ref|XP_002868624.1|  ATCLC-A                                            248   1e-73   
ref|XP_004231786.1|  PREDICTED: chloride channel protein CLC-a-like     248   1e-73   Solanum lycopersicum
gb|EEE53145.1|  hypothetical protein OsJ_35963                          247   2e-73   Oryza sativa Japonica Group [Japonica rice]
emb|CDX67478.1|  BnaA07g15180D                                          248   2e-73   
ref|XP_009125164.1|  PREDICTED: chloride channel protein CLC-a-like     248   2e-73   Brassica rapa
ref|XP_002438781.1|  hypothetical protein SORBIDRAFT_10g026090          248   2e-73   Sorghum bicolor [broomcorn]
ref|XP_010528167.1|  PREDICTED: chloride channel protein CLC-b-like     247   3e-73   Tarenaya hassleriana [spider flower]
ref|XP_006664534.1|  PREDICTED: chloride channel protein CLC-a-like     246   9e-73   Oryza brachyantha
ref|NP_001183936.1|  chloride channel protein                           246   1e-72   Zea mays [maize]
ref|XP_008658999.1|  PREDICTED: chloride channel protein isoform X1     246   2e-72   Zea mays [maize]
ref|XP_004962545.1|  PREDICTED: chloride channel protein CLC-a-li...    245   2e-72   Setaria italica
ref|XP_010929772.1|  PREDICTED: chloride channel protein CLC-b-like     245   3e-72   
ref|XP_003576525.1|  PREDICTED: chloride channel protein CLC-a-like     244   5e-72   Brachypodium distachyon [annual false brome]
ref|XP_004962544.1|  PREDICTED: chloride channel protein CLC-a-li...    245   5e-72   
dbj|BAJ91019.1|  predicted protein                                      244   6e-72   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009140242.1|  PREDICTED: chloride channel protein CLC-a          243   8e-72   Brassica rapa
emb|CDY15925.1|  BnaA04g11860D                                          243   9e-72   Brassica napus [oilseed rape]
ref|XP_006405416.1|  hypothetical protein EUTSA_v10027650mg             241   3e-71   Eutrema salsugineum [saltwater cress]
gb|ADD09860.1|  chloride channel A                                      241   3e-71   Eutrema halophilum
ref|XP_010441254.1|  PREDICTED: chloride channel protein CLC-a          239   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010436030.1|  PREDICTED: chloride channel protein CLC-a-like     239   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010450591.1|  PREDICTED: chloride channel protein CLC-a          239   2e-70   Camelina sativa [gold-of-pleasure]
gb|KDO43323.1|  hypothetical protein CISIN_1g0039661mg                  218   1e-68   Citrus sinensis [apfelsine]
gb|KEH25446.1|  ClC chloride channel family protein                     216   7e-62   Medicago truncatula
gb|EMS65031.1|  Chloride channel protein CLC-b                          186   7e-52   Triticum urartu
gb|EEC77341.1|  hypothetical protein OsI_16021                          174   4e-49   Oryza sativa Indica Group [Indian rice]
ref|XP_010250239.1|  PREDICTED: putative chloride channel-like pr...    180   5e-49   Nelumbo nucifera [Indian lotus]
ref|NP_001268053.1|  uncharacterized protein LOC100245380               179   1e-48   Vitis vinifera
ref|XP_010657885.1|  PREDICTED: uncharacterized protein LOC100245...    179   1e-48   Vitis vinifera
ref|XP_009618449.1|  PREDICTED: chloride channel protein CLC-c-like     178   2e-48   Nicotiana tomentosiformis
emb|CBI29647.3|  unnamed protein product                                178   2e-48   Vitis vinifera
emb|CDO97645.1|  unnamed protein product                                178   2e-48   Coffea canephora [robusta coffee]
ref|XP_010682061.1|  PREDICTED: chloride channel protein CLC-c-like     178   2e-48   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU35026.1|  hypothetical protein MIMGU_mgv1a001577mg                178   3e-48   Erythranthe guttata [common monkey flower]
ref|XP_009791971.1|  PREDICTED: chloride channel protein CLC-c-like     178   3e-48   Nicotiana sylvestris
ref|XP_006402220.1|  hypothetical protein EUTSA_v10012744mg             177   6e-48   Eutrema salsugineum [saltwater cress]
gb|ADD09861.1|  chloride channel C                                      177   6e-48   Eutrema halophilum
ref|XP_002865761.1|  CLC-C                                              176   1e-47   
ref|NP_199800.1|  chloride channel protein CLC-c                        175   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010442463.1|  PREDICTED: chloride channel protein CLC-c          175   3e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010482284.1|  PREDICTED: chloride channel protein CLC-c-like     175   3e-47   Camelina sativa [gold-of-pleasure]
ref|XP_009127371.1|  PREDICTED: chloride channel protein CLC-c          175   4e-47   Brassica rapa
emb|CDY21447.1|  BnaC03g27500D                                          174   5e-47   Brassica napus [oilseed rape]
ref|XP_009134029.1|  PREDICTED: chloride channel protein CLC-c          174   5e-47   Brassica rapa
gb|EEE60792.1|  hypothetical protein OsJ_14377                          174   5e-47   Oryza sativa Japonica Group [Japonica rice]
emb|CDX83179.1|  BnaA03g23270D                                          174   5e-47   
emb|CDX91539.1|  BnaC02g16210D                                          174   5e-47   
ref|XP_006349289.1|  PREDICTED: chloride channel protein CLC-c-like     174   6e-47   Solanum tuberosum [potatoes]
gb|EAY94258.1|  hypothetical protein OsI_16029                          174   7e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_010441249.1|  PREDICTED: chloride channel protein CLC-c-like     174   7e-47   Camelina sativa [gold-of-pleasure]
ref|XP_004230422.1|  PREDICTED: chloride channel protein CLC-c          174   1e-46   Solanum lycopersicum
ref|XP_006280044.1|  hypothetical protein CARUB_v10025921mg             173   2e-46   Capsella rubella
ref|XP_006652320.1|  PREDICTED: chloride channel protein CLC-c-like     173   2e-46   Oryza brachyantha
ref|NP_001267998.1|  uncharacterized protein LOC100255837               172   3e-46   Vitis vinifera
ref|XP_010656505.1|  PREDICTED: uncharacterized protein LOC100255...    172   3e-46   Vitis vinifera
ref|XP_011087632.1|  PREDICTED: chloride channel protein CLC-c          172   3e-46   
gb|EMT27046.1|  Chloride channel protein CLC-c                          172   3e-46   
ref|XP_009586704.1|  PREDICTED: putative chloride channel-like pr...    172   3e-46   Nicotiana tomentosiformis
emb|CAN62616.1|  hypothetical protein VITISV_036165                     172   4e-46   Vitis vinifera
ref|XP_002530769.1|  chloride channel clc, putative                     172   5e-46   Ricinus communis
ref|XP_001756485.1|  predicted protein                                  172   7e-46   
ref|XP_010674330.1|  PREDICTED: chloride channel protein CLC-c-like     171   1e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006836849.1|  hypothetical protein AMTR_s00099p00074960          171   1e-45   Amborella trichopoda
ref|XP_006381102.1|  chloride channel-like family protein               171   1e-45   
ref|XP_010050093.1|  PREDICTED: putative chloride channel-like pr...    171   1e-45   Eucalyptus grandis [rose gum]
ref|XP_004248849.1|  PREDICTED: chloride channel protein CLC-c-like     171   1e-45   Solanum lycopersicum
ref|XP_008801915.1|  PREDICTED: putative chloride channel-like pr...    170   3e-45   Phoenix dactylifera
dbj|BAB97267.1|  chloride channel                                       169   3e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008801913.1|  PREDICTED: putative chloride channel-like pr...    169   4e-45   Phoenix dactylifera
ref|XP_003581281.1|  PREDICTED: chloride channel protein CLC-c-like     169   4e-45   Brachypodium distachyon [annual false brome]
ref|XP_011028391.1|  PREDICTED: chloride channel protein CLC-c-like     169   4e-45   Populus euphratica
gb|ADW93911.1|  chloride channel 1                                      169   4e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011016274.1|  PREDICTED: chloride channel protein CLC-c-like     169   4e-45   Populus euphratica
ref|NP_001275140.1|  chloride channel protein CLC-c-like                169   4e-45   Solanum tuberosum [potatoes]
ref|XP_010241599.1|  PREDICTED: LOW QUALITY PROTEIN: putative chl...    169   5e-45   
ref|XP_008242835.1|  PREDICTED: putative chloride channel-like pr...    169   6e-45   Prunus mume [ume]
ref|XP_010541946.1|  PREDICTED: putative chloride channel-like pr...    168   1e-44   Tarenaya hassleriana [spider flower]
ref|XP_006388251.1|  hypothetical protein POPTR_0261s002202g            158   1e-44   
ref|XP_007204268.1|  hypothetical protein PRUPE_ppa001699mg             167   2e-44   Prunus persica
emb|CDY47559.1|  BnaA08g07280D                                          167   3e-44   Brassica napus [oilseed rape]
ref|XP_009108066.1|  PREDICTED: putative chloride channel-like pr...    167   3e-44   Brassica rapa
emb|CDP10469.1|  unnamed protein product                                166   4e-44   Coffea canephora [robusta coffee]
gb|EPS68170.1|  hypothetical protein M569_06601                         166   4e-44   Genlisea aurea
ref|XP_010025693.1|  PREDICTED: chloride channel protein CLC-c-like     166   5e-44   Eucalyptus grandis [rose gum]
ref|XP_006359489.1|  PREDICTED: putative chloride channel-like pr...    166   5e-44   Solanum tuberosum [potatoes]
ref|XP_006395982.1|  hypothetical protein EUTSA_v10003685mg             166   5e-44   Eutrema salsugineum [saltwater cress]
ref|XP_006389435.1|  chloride channel-like family protein               166   6e-44   Populus trichocarpa [western balsam poplar]
ref|XP_002974253.1|  hypothetical protein SELMODRAFT_100906             166   7e-44   Selaginella moellendorffii
ref|XP_003573678.1|  PREDICTED: putative chloride channel-like pr...    166   7e-44   Brachypodium distachyon [annual false brome]
gb|EMS50378.1|  Chloride channel protein CLC-c                          166   7e-44   Triticum urartu
ref|XP_004242745.2|  PREDICTED: putative chloride channel-like pr...    166   7e-44   Solanum lycopersicum
ref|XP_011084085.1|  PREDICTED: putative chloride channel-like pr...    166   8e-44   Sesamum indicum [beniseed]
ref|XP_010030223.1|  PREDICTED: chloride channel protein CLC-c-li...    166   9e-44   Eucalyptus grandis [rose gum]
ref|XP_011020210.1|  PREDICTED: putative chloride channel-like pr...    166   1e-43   Populus euphratica
ref|XP_003592890.1|  Chloride channel protein CLC-c                     165   1e-43   Medicago truncatula
emb|CDY12393.1|  BnaC08g08120D                                          165   1e-43   Brassica napus [oilseed rape]
ref|XP_009777968.1|  PREDICTED: putative chloride channel-like pr...    165   2e-43   Nicotiana sylvestris
ref|XP_002870407.1|  hypothetical protein ARALYDRAFT_493576             165   2e-43   
ref|NP_198313.2|  putative chloride channel-like protein CLC-g          164   2e-43   Arabidopsis thaliana [mouse-ear cress]
gb|KDP30234.1|  hypothetical protein JCGZ_17016                         165   2e-43   Jatropha curcas
ref|XP_002985623.1|  hypothetical protein SELMODRAFT_181899             164   2e-43   Selaginella moellendorffii
ref|XP_008452224.1|  PREDICTED: LOW QUALITY PROTEIN: chloride cha...    164   3e-43   Cucumis melo [Oriental melon]
ref|XP_011017858.1|  PREDICTED: putative chloride channel-like pr...    164   3e-43   Populus euphratica
ref|XP_007013578.1|  Voltage-gated chloride channel family protei...    164   4e-43   
ref|XP_011017857.1|  PREDICTED: putative chloride channel-like pr...    163   5e-43   Populus euphratica
ref|XP_007013577.1|  Voltage-gated chloride channel family protei...    163   5e-43   
gb|AFW70590.1|  hypothetical protein ZEAMMB73_498282                    155   6e-43   
ref|XP_008793993.1|  PREDICTED: putative chloride channel-like pr...    163   6e-43   Phoenix dactylifera
ref|XP_008365471.1|  PREDICTED: chloride channel protein CLC-a-like     151   6e-43   
gb|ADF30876.1|  chloride channel protein                                163   9e-43   Citrus trifoliata [hardy orange]
ref|XP_010274995.1|  PREDICTED: chloride channel protein CLC-c          162   1e-42   Nelumbo nucifera [Indian lotus]
gb|EMT06377.1|  Putative chloride channel-like protein CLC-g            163   1e-42   
ref|XP_009392135.1|  PREDICTED: putative chloride channel-like pr...    162   1e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006283171.1|  hypothetical protein CARUB_v10004204mg             162   1e-42   
ref|XP_009392134.1|  PREDICTED: putative chloride channel-like pr...    162   2e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009392132.1|  PREDICTED: putative chloride channel-like pr...    162   2e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010905336.1|  PREDICTED: putative chloride channel-like pr...    162   2e-42   Elaeis guineensis
gb|KDP42489.1|  hypothetical protein JCGZ_00286                         161   3e-42   Jatropha curcas
gb|EEC69203.1|  hypothetical protein OsI_38196                          150   3e-42   Oryza sativa Indica Group [Indian rice]
ref|XP_006470992.1|  PREDICTED: chloride channel protein CLC-c-li...    161   3e-42   Citrus sinensis [apfelsine]
ref|XP_004508447.1|  PREDICTED: putative chloride channel-like pr...    161   3e-42   Cicer arietinum [garbanzo]
ref|XP_010435388.1|  PREDICTED: putative chloride channel-like pr...    161   3e-42   Camelina sativa [gold-of-pleasure]
ref|XP_009405902.1|  PREDICTED: chloride channel protein CLC-c-like     161   4e-42   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK30515.1|  hypothetical protein AALP_AA7G272300                    160   8e-42   Arabis alpina [alpine rockcress]
ref|XP_010450335.1|  PREDICTED: putative chloride channel-like pr...    160   9e-42   Camelina sativa [gold-of-pleasure]
ref|XP_006431490.1|  hypothetical protein CICLE_v10000336mg             160   9e-42   Citrus clementina [clementine]
gb|KDO42564.1|  hypothetical protein CISIN_1g003885mg                   160   9e-42   Citrus sinensis [apfelsine]
ref|XP_008336976.1|  PREDICTED: putative chloride channel-like pr...    160   9e-42   
ref|XP_008385147.1|  PREDICTED: LOW QUALITY PROTEIN: putative chl...    159   1e-41   
gb|KJB46914.1|  hypothetical protein B456_008G001200                    159   1e-41   Gossypium raimondii
ref|XP_009403721.1|  PREDICTED: chloride channel protein CLC-c-like     159   1e-41   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO73468.1|  hypothetical protein CISIN_1g003801mg                   159   2e-41   Citrus sinensis [apfelsine]
ref|XP_008354360.1|  PREDICTED: putative chloride channel-like pr...    159   2e-41   
ref|XP_010930514.1|  PREDICTED: chloride channel protein CLC-c-like     159   2e-41   Elaeis guineensis
ref|XP_004979167.1|  PREDICTED: putative chloride channel-like pr...    159   3e-41   Setaria italica
ref|XP_009363967.1|  PREDICTED: putative chloride channel-like pr...    159   3e-41   Pyrus x bretschneideri [bai li]
ref|XP_004486231.1|  PREDICTED: chloride channel protein CLC-c-like     158   3e-41   Cicer arietinum [garbanzo]
gb|KHN47107.1|  Putative chloride channel-like protein CLC-g            158   4e-41   Glycine soja [wild soybean]
ref|XP_003542650.1|  PREDICTED: putative chloride channel-like pr...    158   4e-41   Glycine max [soybeans]
ref|XP_010927804.1|  PREDICTED: chloride channel protein CLC-c-like     158   5e-41   
ref|XP_009358559.1|  PREDICTED: putative chloride channel-like pr...    158   5e-41   Pyrus x bretschneideri [bai li]
ref|XP_010999722.1|  PREDICTED: chloride channel protein CLC-c-like     157   7e-41   Populus euphratica
ref|XP_008786445.1|  PREDICTED: chloride channel protein CLC-c-like     157   8e-41   Phoenix dactylifera
emb|CBI27719.3|  unnamed protein product                                157   8e-41   Vitis vinifera
ref|XP_008806106.1|  PREDICTED: chloride channel protein CLC-c-like     157   8e-41   
ref|NP_001268085.1|  uncharacterized protein LOC100259734               157   1e-40   Vitis vinifera
ref|XP_009393492.1|  PREDICTED: chloride channel protein CLC-c          157   1e-40   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDM85188.1|  unnamed protein product                                157   1e-40   Triticum aestivum [Canadian hard winter wheat]
gb|AAQ56538.1|  putative chloride channel                               157   1e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004952777.1|  PREDICTED: chloride channel protein CLC-c-like     157   2e-40   Setaria italica
gb|KJB64678.1|  hypothetical protein B456_010G060300                    156   2e-40   Gossypium raimondii
ref|XP_008457165.1|  PREDICTED: putative chloride channel-like pr...    156   2e-40   Cucumis melo [Oriental melon]
gb|EYU34964.1|  hypothetical protein MIMGU_mgv1a001646mg                156   2e-40   Erythranthe guttata [common monkey flower]
ref|XP_011078419.1|  PREDICTED: putative chloride channel-like pr...    156   3e-40   Sesamum indicum [beniseed]
ref|NP_001267618.1|  putative chloride channel-like protein CLC-g...    156   3e-40   Cucumis sativus [cucumbers]
ref|XP_011047852.1|  PREDICTED: chloride channel protein CLC-c-like     155   3e-40   Populus euphratica
ref|XP_004165980.1|  PREDICTED: putative chloride channel-like pr...    156   3e-40   
ref|NP_001105216.1|  LOC542114                                          156   3e-40   Zea mays [maize]
dbj|BAJ97961.1|  predicted protein                                      155   3e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010928311.1|  PREDICTED: putative chloride channel-like pr...    156   3e-40   Elaeis guineensis
ref|XP_008644266.1|  PREDICTED: LOC542114 isoform X1                    156   3e-40   Zea mays [maize]
gb|EEC73409.1|  hypothetical protein OsI_07665                          154   5e-40   Oryza sativa Indica Group [Indian rice]
gb|EMS55037.1|  Chloride channel protein CLC-c                          155   5e-40   Triticum urartu
ref|XP_006647383.1|  PREDICTED: chloride channel protein CLC-c-like     155   5e-40   Oryza brachyantha
ref|XP_008788815.1|  PREDICTED: putative chloride channel-like pr...    155   6e-40   Phoenix dactylifera
ref|XP_003575152.1|  PREDICTED: chloride channel protein CLC-c-like     155   6e-40   Brachypodium distachyon [annual false brome]
ref|XP_002447212.1|  hypothetical protein SORBIDRAFT_06g030530          155   6e-40   Sorghum bicolor [broomcorn]
ref|XP_010096974.1|  Putative chloride channel-like protein CLC-g       155   7e-40   
gb|EMT28663.1|  Chloride channel protein CLC-c                          155   7e-40   
dbj|BAJ92873.1|  predicted protein                                      155   8e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007225226.1|  hypothetical protein PRUPE_ppa001898mg             154   8e-40   
ref|XP_009401374.1|  PREDICTED: putative chloride channel-like pr...    154   8e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403199.1|  PREDICTED: putative chloride channel-like pr...    154   8e-40   
ref|XP_008218680.1|  PREDICTED: chloride channel protein CLC-c          154   9e-40   
gb|EMT13398.1|  Chloride channel protein CLC-c                          153   1e-39   
ref|XP_006852872.1|  hypothetical protein AMTR_s00033p00206270          154   1e-39   Amborella trichopoda
ref|XP_009401373.1|  PREDICTED: putative chloride channel-like pr...    154   1e-39   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAD16425.1|  chloride channel                                       154   1e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008788814.1|  PREDICTED: putative chloride channel-like pr...    154   1e-39   Phoenix dactylifera
emb|CAD41919.2|  OSJNBa0033G05.20                                       154   1e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006385193.1|  Chloride channel protein CLC-c                     154   1e-39   
ref|XP_006385076.1|  Chloride channel protein CLC-c                     154   1e-39   
emb|CAJ86158.1|  H0413E07.11                                            154   1e-39   Oryza sativa [red rice]
gb|AFW58337.1|  hypothetical protein ZEAMMB73_926410                    154   1e-39   
gb|ABB86548.1|  chloride channel-like protein Osclc                     154   1e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011003711.1|  PREDICTED: chloride channel protein CLC-c-like     154   1e-39   Populus euphratica
ref|XP_009403198.1|  PREDICTED: putative chloride channel-like pr...    154   2e-39   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE61792.1|  hypothetical protein OsJ_16396                          154   2e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006848424.1|  hypothetical protein AMTR_s00013p00233520          142   2e-39   
gb|KDP44103.1|  hypothetical protein JCGZ_05570                         153   2e-39   Jatropha curcas
ref|XP_002454002.1|  hypothetical protein SORBIDRAFT_04g022890          154   2e-39   Sorghum bicolor [broomcorn]
ref|XP_009418228.1|  PREDICTED: putative chloride channel-like pr...    153   3e-39   
gb|EMS67360.1|  Chloride channel protein CLC-c                          153   3e-39   
ref|XP_008644088.1|  PREDICTED: uncharacterized protein LOC100383...    153   3e-39   
ref|XP_010099780.1|  Chloride channel protein CLC-c                     152   4e-39   
gb|EPS73799.1|  hypothetical protein M569_00956                         152   5e-39   
dbj|BAD82092.1|  putative chloride channel                              152   6e-39   
ref|XP_009355373.1|  PREDICTED: chloride channel protein CLC-c-like     152   6e-39   
gb|EEC71893.1|  hypothetical protein OsI_04638                          152   6e-39   
ref|XP_003609433.1|  hypothetical protein MTR_4g115640                  152   7e-39   
ref|XP_007155066.1|  hypothetical protein PHAVU_003G170300g             152   7e-39   
ref|XP_002447895.1|  hypothetical protein SORBIDRAFT_06g017570          152   7e-39   
gb|ACF87782.1|  unknown                                                 146   8e-39   
gb|EEE55755.1|  hypothetical protein OsJ_04269                          152   9e-39   
ref|XP_010241601.1|  PREDICTED: putative chloride channel-like pr...    151   9e-39   
ref|XP_004287270.1|  PREDICTED: putative chloride channel-like pr...    151   9e-39   
ref|XP_010909770.1|  PREDICTED: chloride channel protein CLC-c-like     151   1e-38   
ref|XP_004287269.1|  PREDICTED: putative chloride channel-like pr...    151   1e-38   
dbj|BAB97268.1|  chloride channel                                       151   1e-38   
ref|XP_010529978.1|  PREDICTED: chloride channel protein CLC-c          151   1e-38   
gb|KJB53990.1|  hypothetical protein B456_009G015100                    151   1e-38   
ref|XP_010241600.1|  PREDICTED: putative chloride channel-like pr...    151   1e-38   
ref|XP_007214607.1|  hypothetical protein PRUPE_ppa001700mg             151   1e-38   
gb|AIY56605.1|  CLC                                                     151   1e-38   
ref|XP_002885387.1|  hypothetical protein ARALYDRAFT_898491             140   2e-38   
gb|KCW74788.1|  hypothetical protein EUGRSUZ_E03522                     150   2e-38   
ref|XP_007152471.1|  hypothetical protein PHAVU_004G133400g             151   2e-38   
ref|XP_004975701.1|  PREDICTED: chloride channel protein CLC-c-li...    151   2e-38   
ref|XP_004975699.1|  PREDICTED: chloride channel protein CLC-c-li...    151   2e-38   
ref|XP_004975700.1|  PREDICTED: chloride channel protein CLC-c-li...    151   2e-38   
ref|XP_009411882.1|  PREDICTED: chloride channel protein CLC-c-like     150   3e-38   
ref|XP_004512643.1|  PREDICTED: chloride channel protein CLC-c-li...    150   3e-38   
ref|XP_010057598.1|  PREDICTED: putative chloride channel-like pr...    150   3e-38   
ref|XP_004512644.1|  PREDICTED: chloride channel protein CLC-c-li...    150   3e-38   
ref|XP_004975698.1|  PREDICTED: chloride channel protein CLC-c-li...    150   3e-38   
dbj|BAB97269.1|  chloride channel                                       149   4e-38   
ref|XP_008378937.1|  PREDICTED: chloride channel protein CLC-c-li...    141   5e-38   
ref|XP_002453459.1|  hypothetical protein SORBIDRAFT_04g006250          149   7e-38   
ref|XP_003580671.2|  PREDICTED: putative chloride channel-like pr...    149   7e-38   
ref|XP_008365341.1|  PREDICTED: chloride channel protein CLC-c-like     141   7e-38   
ref|XP_004288642.1|  PREDICTED: chloride channel protein CLC-c          149   8e-38   
ref|XP_003619757.1|  Chloride channel protein CLC-c                     149   8e-38   
gb|AES75975.2|  chloride channel ClC1 protein                           149   9e-38   
ref|XP_009599120.1|  PREDICTED: chloride channel protein CLC-c-like     149   9e-38   
ref|XP_006453099.1|  hypothetical protein CICLE_v10007502mg             149   9e-38   
ref|XP_003533268.2|  PREDICTED: chloride channel protein CLC-c-li...    149   1e-37   
gb|KHM99790.1|  Chloride channel protein CLC-c                          149   1e-37   
ref|XP_009768532.1|  PREDICTED: chloride channel protein CLC-c-like     149   1e-37   
ref|XP_008378936.1|  PREDICTED: chloride channel protein CLC-c-li...    140   2e-37   
gb|KEH32756.1|  chloride channel ClC1 protein                           147   4e-37   
gb|EMS56861.1|  Putative chloride channel-like protein CLC-g            146   4e-37   
ref|XP_002980983.1|  hypothetical protein SELMODRAFT_420553             145   1e-36   
tpg|DAA35719.1|  TPA: hypothetical protein ZEAMMB73_781870              145   2e-36   
ref|XP_008667038.1|  PREDICTED: chloride channel G isoform X1           145   2e-36   
ref|XP_006599656.1|  PREDICTED: chloride channel protein CLC-c-li...    145   3e-36   
ref|XP_004499372.1|  PREDICTED: chloride channel protein CLC-c-like     144   6e-36   
dbj|BAJ97313.1|  predicted protein                                      142   8e-36   
gb|EMS56130.1|  Putative chloride channel-like protein CLC-g            143   1e-35   
ref|XP_007048601.1|  Chloride channel C                                 142   2e-35   
ref|XP_002456727.1|  hypothetical protein SORBIDRAFT_03g041480          142   2e-35   
ref|XP_004133730.1|  PREDICTED: chloride channel protein CLC-c-li...    141   5e-35   
gb|KJB40520.1|  hypothetical protein B456_007G067500                    140   7e-35   
gb|KJB40519.1|  hypothetical protein B456_007G067500                    140   9e-35   
ref|XP_006652911.1|  PREDICTED: putative chloride channel-like pr...    140   1e-34   
ref|XP_004977021.1|  PREDICTED: putative chloride channel-like pr...    139   2e-34   
ref|XP_004970759.1|  PREDICTED: chloride channel protein CLC-c-like     139   3e-34   
ref|XP_008227672.1|  PREDICTED: chloride channel protein CLC-c-like     139   4e-34   
gb|EMT23162.1|  Putative chloride channel-like protein CLC-g            139   5e-34   
ref|XP_010030224.1|  PREDICTED: chloride channel protein CLC-c-li...    137   1e-33   
ref|XP_009586705.1|  PREDICTED: putative chloride channel-like pr...    137   2e-33   
ref|XP_002982464.1|  hypothetical protein SELMODRAFT_233993             135   4e-33   
ref|XP_002974894.1|  hypothetical protein SELMODRAFT_442632             134   1e-32   
ref|XP_002988905.1|  hypothetical protein SELMODRAFT_427560             134   1e-32   
ref|XP_003567326.1|  PREDICTED: chloride channel protein CLC-c-like     134   3e-32   
tpg|DAA35720.1|  TPA: chloride channel G                                133   4e-32   
tpg|DAA35721.1|  TPA: hypothetical protein ZEAMMB73_781870              133   5e-32   
ref|NP_001130407.2|  chloride channel G                                 133   8e-32   
ref|XP_006587397.1|  PREDICTED: chloride channel protein CLC-c-li...    132   9e-32   
gb|ADF78069.1|  chloride channel protein                                132   1e-31   
ref|XP_010687880.1|  PREDICTED: putative chloride channel-like pr...    131   1e-31   
ref|XP_009777969.1|  PREDICTED: putative chloride channel-like pr...    132   1e-31   
tpg|DAA56573.1|  TPA: chloride channel protein                          131   2e-31   
ref|XP_008674757.1|  PREDICTED: chloride channel protein CLC-c          131   2e-31   
ref|XP_010687879.1|  PREDICTED: putative chloride channel-like pr...    131   2e-31   
ref|XP_006599664.1|  PREDICTED: chloride channel protein CLC-c-li...    130   5e-31   
ref|XP_009339814.1|  PREDICTED: chloride channel protein CLC-c-like     129   1e-30   
ref|XP_008368156.1|  PREDICTED: chloride channel protein CLC-c-like     127   6e-30   
ref|XP_008361634.1|  PREDICTED: LOW QUALITY PROTEIN: chloride cha...    127   7e-30   
ref|XP_006584242.1|  PREDICTED: uncharacterized protein LOC102666014    119   2e-28   
ref|XP_010099519.1|  Chloride channel protein CLC-c                     117   2e-27   
ref|XP_006838275.1|  hypothetical protein AMTR_s00103p00080940          115   1e-25   
ref|XP_004173256.1|  PREDICTED: chloride channel protein CLC-c-like     107   4e-25   
ref|XP_001771383.1|  predicted protein                                  111   1e-24   
ref|XP_007224823.1|  hypothetical protein PRUPE_ppa023512mg             111   2e-24   
dbj|BAC42034.1|  putative CLC-d chloride channel protein                105   3e-24   
ref|XP_008222944.1|  PREDICTED: chloride channel protein CLC-d is...    110   3e-24   
ref|XP_008222943.1|  PREDICTED: chloride channel protein CLC-d is...    110   3e-24   
ref|XP_008222942.1|  PREDICTED: chloride channel protein CLC-d is...    110   3e-24   
ref|XP_008222941.1|  PREDICTED: chloride channel protein CLC-d is...    110   4e-24   
ref|XP_008665235.1|  PREDICTED: chloride channel protein CLC-d is...    110   4e-24   
ref|XP_008665234.1|  PREDICTED: chloride channel protein CLC-d is...    110   4e-24   
ref|XP_008665233.1|  PREDICTED: chloride channel protein CLC-d is...    110   5e-24   
ref|XP_008665231.1|  PREDICTED: chloride channel protein CLC-d is...    110   6e-24   
ref|XP_004982102.1|  PREDICTED: LOW QUALITY PROTEIN: chloride cha...    108   2e-23   
ref|XP_008380364.1|  PREDICTED: chloride channel protein CLC-d-like     102   2e-23   
ref|XP_010277691.1|  PREDICTED: chloride channel protein CLC-d-li...    108   2e-23   
ref|XP_010277685.1|  PREDICTED: chloride channel protein CLC-d-li...    108   2e-23   
ref|XP_010277677.1|  PREDICTED: chloride channel protein CLC-d-li...    108   2e-23   
ref|XP_007157151.1|  hypothetical protein PHAVU_002G0470000g            105   3e-23   
ref|XP_010277670.1|  PREDICTED: chloride channel protein CLC-d-li...    108   3e-23   
gb|KFK26402.1|  hypothetical protein AALP_AA8G244100                    108   3e-23   
dbj|BAK05536.1|  predicted protein                                      107   3e-23   
gb|KFK26403.1|  hypothetical protein AALP_AA8G244100                    107   3e-23   
ref|XP_006650436.1|  PREDICTED: chloride channel protein CLC-d-like     107   4e-23   
ref|XP_010255989.1|  PREDICTED: chloride channel protein CLC-d is...    107   5e-23   
ref|XP_010255988.1|  PREDICTED: chloride channel protein CLC-d is...    107   6e-23   
ref|XP_010255990.1|  PREDICTED: chloride channel protein CLC-d is...    107   6e-23   
ref|XP_006394869.1|  hypothetical protein EUTSA_v10003643mg             107   6e-23   
gb|ABF98345.1|  Chloride channel protein CLC-d, putative, expressed     107   6e-23   
ref|XP_006394868.1|  hypothetical protein EUTSA_v10003643mg             107   6e-23   
gb|ABF98346.1|  Chloride channel protein CLC-d, putative, expressed     106   6e-23   
ref|XP_011021557.1|  PREDICTED: chloride channel protein CLC-d is...    107   7e-23   
ref|XP_002315783.2|  hypothetical protein POPTR_0010s10040g             107   7e-23   
gb|EEE59743.1|  hypothetical protein OsJ_12209                          107   7e-23   
gb|AAO19370.1|  putative CLC-d chloride channel protein                 107   7e-23   
ref|XP_011021556.1|  PREDICTED: chloride channel protein CLC-d is...    107   7e-23   
gb|EEC75998.1|  hypothetical protein OsI_13133                          106   8e-23   
ref|XP_006394870.1|  hypothetical protein EUTSA_v10003643mg             107   8e-23   
ref|XP_002974732.1|  hypothetical protein SELMODRAFT_101801             106   8e-23   
ref|XP_001782456.1|  predicted protein                                  106   8e-23   
ref|XP_009151133.1|  PREDICTED: chloride channel protein CLC-d is...    106   8e-23   
ref|XP_006290072.1|  hypothetical protein CARUB_v10003710mg             106   8e-23   
emb|CDY52633.1|  BnaC07g49590D                                          106   9e-23   
ref|NP_001267905.1|  uncharacterized protein LOC100261408               106   9e-23   
ref|XP_010649611.1|  PREDICTED: uncharacterized protein LOC100261...    106   9e-23   
ref|XP_002963642.1|  hypothetical protein SELMODRAFT_80232              106   9e-23   
gb|AGZ89689.2|  chloride channel protein CLC-d                          106   1e-22   
ref|XP_009151132.1|  PREDICTED: chloride channel protein CLC-d is...    106   1e-22   
gb|ADW93910.1|  chloride channel 1                                      106   1e-22   
gb|ADP02177.1|  putative chloride channel protein CLC-d                 106   1e-22   
ref|XP_010454978.1|  PREDICTED: chloride channel protein CLC-d is...    106   1e-22   
ref|XP_010421498.1|  PREDICTED: chloride channel protein CLC-d-li...    106   1e-22   
ref|XP_010454977.1|  PREDICTED: chloride channel protein CLC-d is...    106   1e-22   
ref|XP_010421497.1|  PREDICTED: chloride channel protein CLC-d-li...    106   1e-22   
ref|XP_003561001.1|  PREDICTED: chloride channel protein CLC-d is...    106   1e-22   
ref|XP_010231301.1|  PREDICTED: chloride channel protein CLC-d is...    105   1e-22   
ref|XP_009395588.1|  PREDICTED: chloride channel protein CLC-d is...    105   1e-22   
ref|XP_009395587.1|  PREDICTED: chloride channel protein CLC-d is...    105   2e-22   
ref|XP_008801698.1|  PREDICTED: chloride channel protein CLC-d is...    105   2e-22   
ref|XP_009395586.1|  PREDICTED: chloride channel protein CLC-d is...    105   2e-22   
ref|XP_008801699.1|  PREDICTED: chloride channel protein CLC-d is...    105   2e-22   
gb|AAC26247.2|  Arabidopsis thaliana CLC-d chloride channel prote...    105   2e-22   
ref|NP_197996.1|  chloride channel protein CLC-d                        105   2e-22   
emb|CAA96065.1|  CLC-d chloride channel protein                         105   2e-22   
ref|XP_002872208.1|  CLC-D                                              105   2e-22   
ref|XP_010546809.1|  PREDICTED: chloride channel protein CLC-d is...    105   3e-22   
ref|XP_010546808.1|  PREDICTED: chloride channel protein CLC-d is...    104   4e-22   
ref|XP_010493890.1|  PREDICTED: chloride channel protein CLC-d-like     104   4e-22   
ref|XP_008390873.1|  PREDICTED: chloride channel protein CLC-d is...    104   5e-22   
ref|XP_009364220.1|  PREDICTED: chloride channel protein CLC-d-like     104   5e-22   
ref|XP_008390872.1|  PREDICTED: chloride channel protein CLC-d is...    104   5e-22   
ref|XP_008390871.1|  PREDICTED: chloride channel protein CLC-d is...    104   5e-22   
ref|XP_004296904.1|  PREDICTED: chloride channel protein CLC-d          103   7e-22   
ref|XP_003539246.1|  PREDICTED: chloride channel protein CLC-d-li...    103   7e-22   
ref|XP_006590397.1|  PREDICTED: chloride channel protein CLC-d-li...    103   8e-22   
ref|XP_006573887.1|  PREDICTED: chloride channel protein CLC-d-li...    103   8e-22   
ref|XP_006573886.1|  PREDICTED: chloride channel protein CLC-d-li...    103   8e-22   
gb|KJB12550.1|  hypothetical protein B456_002G024000                    103   9e-22   
gb|KJB12549.1|  hypothetical protein B456_002G024000                    103   9e-22   
ref|XP_006573885.1|  PREDICTED: chloride channel protein CLC-d-li...    103   9e-22   
ref|XP_003517583.1|  PREDICTED: chloride channel protein CLC-d-li...    103   1e-21   
gb|KJB12552.1|  hypothetical protein B456_002G024000                    103   1e-21   
ref|XP_002517213.1|  chloride channel clc, putative                     103   1e-21   
ref|XP_004511350.1|  PREDICTED: chloride channel protein CLC-d-li...    103   1e-21   
ref|XP_004511351.1|  PREDICTED: chloride channel protein CLC-d-li...    103   1e-21   
gb|KEH27344.1|  chloride channel protein ClC-D protein, putative        103   1e-21   
ref|XP_003610692.1|  Chloride channel protein CLC-d                     102   2e-21   
ref|XP_003610693.1|  Chloride channel protein CLC-d                     103   2e-21   
ref|XP_010667430.1|  PREDICTED: chloride channel protein CLC-d is...    102   2e-21   
ref|XP_003610694.1|  Chloride channel protein CLC-d                     102   2e-21   
ref|XP_010667429.1|  PREDICTED: chloride channel protein CLC-d is...    102   2e-21   
ref|XP_004247370.1|  PREDICTED: chloride channel protein CLC-d          102   2e-21   
ref|XP_006359908.1|  PREDICTED: chloride channel protein CLC-d-li...    102   2e-21   
ref|XP_007034705.1|  Chloride channel protein CLC-d isoform 6           101   3e-21   
ref|XP_010905222.1|  PREDICTED: chloride channel protein CLC-d is...    102   3e-21   
ref|XP_010905223.1|  PREDICTED: chloride channel protein CLC-d is...    102   3e-21   
ref|XP_006359907.1|  PREDICTED: chloride channel protein CLC-d-li...    102   3e-21   
ref|XP_008348386.1|  PREDICTED: chloride channel protein CLC-d-like   97.8    3e-21   
gb|KHN35186.1|  Chloride channel protein CLC-d                          102   3e-21   
ref|XP_007034703.1|  Chloride channel clc, putative isoform 4           101   3e-21   
ref|XP_007034701.1|  Chloride channel clc, putative isoform 2           101   4e-21   
ref|XP_007034700.1|  Chloride channel clc, putative isoform 1           101   4e-21   
ref|XP_007034702.1|  Chloride channel clc, putative isoform 3           101   4e-21   
ref|XP_010524818.1|  PREDICTED: chloride channel protein CLC-d is...    101   5e-21   
ref|XP_010524816.1|  PREDICTED: chloride channel protein CLC-d is...    101   6e-21   
ref|XP_010524817.1|  PREDICTED: chloride channel protein CLC-d is...    101   6e-21   
gb|KEH25445.1|  ClC chloride channel family protein                   99.4    2e-20   
gb|KCW67762.1|  hypothetical protein EUGRSUZ_F014981                  99.4    3e-20   
gb|KDP40151.1|  hypothetical protein JCGZ_02149                       99.4    3e-20   
ref|XP_010064549.1|  PREDICTED: chloride channel protein CLC-d-like   99.4    3e-20   
ref|XP_009765643.1|  PREDICTED: chloride channel protein CLC-d is...  99.4    3e-20   
ref|XP_009765642.1|  PREDICTED: chloride channel protein CLC-d is...  99.4    3e-20   
ref|XP_009618208.1|  PREDICTED: chloride channel protein CLC-d        99.4    3e-20   
gb|KJB72281.1|  hypothetical protein B456_011G168600                  99.4    3e-20   
gb|KJB72282.1|  hypothetical protein B456_011G168600                  99.4    3e-20   
gb|KJB72279.1|  hypothetical protein B456_011G168600                  99.0    3e-20   
ref|XP_011426744.1|  PREDICTED: H(+)/Cl(-) exchange transporter 7...  99.0    3e-20   
ref|NP_001066692.1|  Os12g0438600                                     98.6    4e-20   
ref|XP_011476734.1|  PREDICTED: H(+)/Cl(-) exchange transporter 7...  98.6    5e-20   
ref|XP_011476733.1|  PREDICTED: H(+)/Cl(-) exchange transporter 7...  98.6    6e-20   
ref|XP_004071802.1|  PREDICTED: H(+)/Cl(-) exchange transporter 7...  98.6    6e-20   
ref|XP_010108000.1|  Chloride channel protein CLC-d                   97.8    9e-20   
ref|XP_011071571.1|  PREDICTED: chloride channel protein CLC-d is...  97.8    1e-19   
ref|XP_011071570.1|  PREDICTED: chloride channel protein CLC-d is...  97.4    1e-19   
ref|XP_011071568.1|  PREDICTED: chloride channel protein CLC-d is...  97.4    1e-19   
ref|XP_011071569.1|  PREDICTED: chloride channel protein CLC-d is...  97.4    1e-19   
gb|KHF97413.1|  Chloride channel CLC-b -like protein                  97.1    1e-19   
ref|XP_004169986.1|  PREDICTED: chloride channel protein CLC-d-like   96.7    2e-19   
ref|XP_008449563.1|  PREDICTED: chloride channel protein CLC-d        96.7    2e-19   
ref|XP_009672961.1|  PREDICTED: H(+)/Cl(-) exchange transporter 7     96.7    3e-19   
gb|KFV81154.1|  H(+)/Cl(-) exchange transporter 7                     96.3    3e-19   
ref|XP_005337903.1|  PREDICTED: H(+)/Cl(-) exchange transporter 7...  96.3    3e-19   



>gb|KDO43322.1| hypothetical protein CISIN_1g0039661mg, partial [Citrus sinensis]
Length=188

 Score =   289 bits (740),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 159/182 (87%), Gaps = 3/182 (2%)
 Frame = +3

Query  78   ESATTIAMAGQaeeee--aeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDY  251
            E++  +A A QA  E    ERDPESNSL QPLL KR+ TLSSSPLA+VGAKVSHIESLDY
Sbjct  3    ENSNPVARATQAHMEADEEERDPESNSLQQPLL-KRSRTLSSSPLALVGAKVSHIESLDY  61

Query  252  EINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAV  431
            EINENDLFKHDWRSRS+ QVLQY+FLKW+LA LVGLLTG+IATLINLAVENIAGYKLLAV
Sbjct  62   EINENDLFKHDWRSRSKVQVLQYIFLKWSLACLVGLLTGLIATLINLAVENIAGYKLLAV  121

Query  432  VDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFG  611
            V +I+K RYL GF YF G NF+LT VA+VLCV FAPTAAGPGIPEIKAYLNGVDTPNMFG
Sbjct  122  VSFIEKDRYLQGFLYFTGVNFLLTLVAAVLCVCFAPTAAGPGIPEIKAYLNGVDTPNMFG  181

Query  612  AT  617
            AT
Sbjct  182  AT  183



>ref|XP_006357190.1| PREDICTED: chloride channel protein CLC-b-like [Solanum tuberosum]
Length=784

 Score =   303 bits (777),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 165/187 (88%), Gaps = 4/187 (2%)
 Frame = +3

Query  60   MEEQ-YAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHI  236
            MEEQ   E ATT  + GQ  EEE  RDPESNS+ QPLL KRN TLSSSP A+VGAKVSHI
Sbjct  1    MEEQRLVEEATTNDINGQLNEEE--RDPESNSMRQPLL-KRNRTLSSSPFALVGAKVSHI  57

Query  237  ESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGY  416
            ESLDYEINENDLFKHDWR RSR QVLQYVFLKW+LAFLVGLLTG+ ATLINLA+ENIAGY
Sbjct  58   ESLDYEINENDLFKHDWRRRSRVQVLQYVFLKWSLAFLVGLLTGVTATLINLAIENIAGY  117

Query  417  KLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDT  596
            KL AVVDYID +RYLMGFAYFAGANFVLT +A++LCV FAPTAAGPGIPEIKAYLNGVDT
Sbjct  118  KLRAVVDYIDNRRYLMGFAYFAGANFVLTLIAALLCVCFAPTAAGPGIPEIKAYLNGVDT  177

Query  597  PNMFGAT  617
            PNMFGAT
Sbjct  178  PNMFGAT  184



>ref|XP_004233300.1| PREDICTED: chloride channel protein CLC-b [Solanum lycopersicum]
Length=784

 Score =   303 bits (775),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 165/187 (88%), Gaps = 4/187 (2%)
 Frame = +3

Query  60   MEE-QYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHI  236
            MEE +  E ATT  + GQ  EEE  RDPESNSL QPLL KRN TLSSSP A+VGAKVSHI
Sbjct  1    MEEPRLVEEATTNDINGQLNEEE--RDPESNSLRQPLL-KRNRTLSSSPFALVGAKVSHI  57

Query  237  ESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGY  416
            ESLDYEINENDLFKHDWR RSR QVLQYVFLKW+LAFLVGLLTG+ ATLINLA+ENIAGY
Sbjct  58   ESLDYEINENDLFKHDWRRRSRVQVLQYVFLKWSLAFLVGLLTGVTATLINLAIENIAGY  117

Query  417  KLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDT  596
            KL AVVDYID +RYLMGFAYFAGANFVLT +A++LCV FAPTAAGPGIPEIKAYLNGVDT
Sbjct  118  KLRAVVDYIDNRRYLMGFAYFAGANFVLTLIAALLCVCFAPTAAGPGIPEIKAYLNGVDT  177

Query  597  PNMFGAT  617
            PNMFGAT
Sbjct  178  PNMFGAT  184



>ref|XP_008353449.1| PREDICTED: chloride channel protein CLC-b-like [Malus domestica]
Length=196

 Score =   284 bits (726),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 147/162 (91%), Gaps = 1/162 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            RDPES SL QPLL KRN TLSS+PLAMVGAKVSHIESLDYEINEN LFKHDWRSRS+ QV
Sbjct  25   RDPESISLQQPLL-KRNRTLSSTPLAMVGAKVSHIESLDYEINENXLFKHDWRSRSKVQV  83

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
            LQYVFLKW LA LVGLLTGIIATLINLAVENIAGYKLLA V +I+K+RYLMGF + AGAN
Sbjct  84   LQYVFLKWILACLVGLLTGIIATLINLAVENIAGYKLLAAVSFIEKERYLMGFIFIAGAN  143

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             VLT +ASVLCV FAPTAAGPGIPEIKAYLNGV+TPNMFGAT
Sbjct  144  LVLTAIASVLCVCFAPTAAGPGIPEIKAYLNGVNTPNMFGAT  185



>gb|AAD29679.1|AF133209_1 CLC-Nt2 protein [Nicotiana tabacum]
Length=786

 Score =   300 bits (768),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 165/188 (88%), Gaps = 5/188 (3%)
 Frame = +3

Query  60   MEE--QYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSH  233
            MEE  +  E AT   M GQ  EEE  RDPESNSLHQPLL KRN TLSSSP A+VGAKVSH
Sbjct  1    MEEPTRLVEEATINNMDGQQNEEE--RDPESNSLHQPLL-KRNRTLSSSPFALVGAKVSH  57

Query  234  IESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAG  413
            IESLDYEINENDLFKHDWR RSR QVLQYVFLKWTLAFLVGLLTG+ ATLINLA+EN+AG
Sbjct  58   IESLDYEINENDLFKHDWRRRSRVQVLQYVFLKWTLAFLVGLLTGVTATLINLAIENMAG  117

Query  414  YKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            YKL AVV+YI+ +RYLMGFAYFAGANFVLT +A++LCV FAPTAAGPGIPEIKAYLNGVD
Sbjct  118  YKLRAVVNYIEDRRYLMGFAYFAGANFVLTLIAALLCVCFAPTAAGPGIPEIKAYLNGVD  177

Query  594  TPNMFGAT  617
            TPNM+GAT
Sbjct  178  TPNMYGAT  185



>ref|XP_009761471.1| PREDICTED: chloride channel protein CLC-b-like [Nicotiana sylvestris]
Length=786

 Score =   300 bits (768),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 165/188 (88%), Gaps = 5/188 (3%)
 Frame = +3

Query  60   MEE--QYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSH  233
            MEE  +  E AT   M GQ  EEE  RDPESNSLHQPLL KRN TLSSSP A+VGAKVSH
Sbjct  1    MEEPTRLVEEATINNMDGQQNEEE--RDPESNSLHQPLL-KRNRTLSSSPFALVGAKVSH  57

Query  234  IESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAG  413
            IESLDYEINENDLFKHDWR RSR QVLQYVFLKWTLAFLVGLLTG+ ATLINLA+EN+AG
Sbjct  58   IESLDYEINENDLFKHDWRRRSRVQVLQYVFLKWTLAFLVGLLTGVTATLINLAIENMAG  117

Query  414  YKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            YKL AVV+YI+ +RYLMGFAYFAGANFVLT +A++LCV FAPTAAGPGIPEIKAYLNGVD
Sbjct  118  YKLRAVVNYIEDRRYLMGFAYFAGANFVLTLIAALLCVCFAPTAAGPGIPEIKAYLNGVD  177

Query  594  TPNMFGAT  617
            TPNM+GAT
Sbjct  178  TPNMYGAT  185



>emb|CDP16685.1| unnamed protein product [Coffea canephora]
Length=786

 Score =   299 bits (766),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 170/188 (90%), Gaps = 5/188 (3%)
 Frame = +3

Query  60   MEE--QYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSH  233
            ME+  Q+A +A T  + GQA+ +E  RDPESNSLHQPLL KRN TLSS+PLA+VGAKVS+
Sbjct  1    MEDSNQFAAAAVTNDVDGQAQNQE--RDPESNSLHQPLL-KRNRTLSSNPLAVVGAKVSY  57

Query  234  IESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAG  413
            IESLDYEINENDLFKHDWRSR++ QVLQYVFLKWTLAFLVGLLTG+IATLINLAVENIAG
Sbjct  58   IESLDYEINENDLFKHDWRSRAQVQVLQYVFLKWTLAFLVGLLTGVIATLINLAVENIAG  117

Query  414  YKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            YKLL V+DYI+ KRYLMGF +FAG NF+LT +A+VLCVFFAPTAAGPGIPEIKAYLNGVD
Sbjct  118  YKLLKVIDYINNKRYLMGFLFFAGTNFLLTLLAAVLCVFFAPTAAGPGIPEIKAYLNGVD  177

Query  594  TPNMFGAT  617
            TPNM+GAT
Sbjct  178  TPNMYGAT  185



>ref|XP_011097296.1| PREDICTED: chloride channel protein CLC-b-like [Sesamum indicum]
Length=787

 Score =   295 bits (754),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 153/162 (94%), Gaps = 1/162 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            RDPESN+LHQPLL KRN TLSSSPLA+VGAKVSHIESLDYEINENDLFK DWRSRS+T+V
Sbjct  25   RDPESNTLHQPLL-KRNRTLSSSPLAIVGAKVSHIESLDYEINENDLFKQDWRSRSKTEV  83

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
            LQY+FLKW LAFLVGLLTG+IATLINLAVENIAGYKLLAVV YI++KRYLMGF Y AGAN
Sbjct  84   LQYIFLKWLLAFLVGLLTGLIATLINLAVENIAGYKLLAVVKYIEQKRYLMGFIYMAGAN  143

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
            F+LT VA+VLCV FAPTAAGPGIPEIKAYLNGVDTPNMFGAT
Sbjct  144  FLLTLVAAVLCVCFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  185



>ref|XP_008379123.1| PREDICTED: chloride channel protein CLC-b isoform X1 [Malus domestica]
Length=791

 Score =   293 bits (750),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 160/191 (84%), Gaps = 6/191 (3%)
 Frame = +3

Query  54   SRMEE---QYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAK  224
            S MEE   QYAE+A    M    E    ERDPES +LHQPLLLKRN TLSS+PLAMVGAK
Sbjct  2    SPMEEHSNQYAEAAVPQTMQ---ETGAEERDPESIALHQPLLLKRNRTLSSTPLAMVGAK  58

Query  225  VSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVEN  404
            VSHIESLDYEINENDLF HDWRSR++ QVLQYVFLKW LAFLVGLLTGIIATLINLA EN
Sbjct  59   VSHIESLDYEINENDLFMHDWRSRTKVQVLQYVFLKWILAFLVGLLTGIIATLINLATEN  118

Query  405  IAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLN  584
            IAGYKLLA V +I+K+RYLMGF + AG N +LT  ASVLCV FAPTAAGPGIPEIKAYLN
Sbjct  119  IAGYKLLAXVSFIEKERYLMGFIFIAGVNLLLTASASVLCVCFAPTAAGPGIPEIKAYLN  178

Query  585  GVDTPNMFGAT  617
            GVDTPNMFGAT
Sbjct  179  GVDTPNMFGAT  189



>ref|XP_008379124.1| PREDICTED: chloride channel protein CLC-b isoform X2 [Malus domestica]
Length=790

 Score =   293 bits (749),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 160/191 (84%), Gaps = 6/191 (3%)
 Frame = +3

Query  54   SRMEE---QYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAK  224
            S MEE   QYAE+A    M    E    ERDPES +LHQPLLLKRN TLSS+PLAMVGAK
Sbjct  2    SPMEEHSNQYAEAAVPQTMQ---ETGAEERDPESIALHQPLLLKRNRTLSSTPLAMVGAK  58

Query  225  VSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVEN  404
            VSHIESLDYEINENDLF HDWRSR++ QVLQYVFLKW LAFLVGLLTGIIATLINLA EN
Sbjct  59   VSHIESLDYEINENDLFMHDWRSRTKVQVLQYVFLKWILAFLVGLLTGIIATLINLATEN  118

Query  405  IAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLN  584
            IAGYKLLA V +I+K+RYLMGF + AG N +LT  ASVLCV FAPTAAGPGIPEIKAYLN
Sbjct  119  IAGYKLLAXVSFIEKERYLMGFIFIAGVNLLLTASASVLCVCFAPTAAGPGIPEIKAYLN  178

Query  585  GVDTPNMFGAT  617
            GVDTPNMFGAT
Sbjct  179  GVDTPNMFGAT  189



>ref|XP_009596046.1| PREDICTED: chloride channel protein CLC-b-like [Nicotiana tomentosiformis]
Length=786

 Score =   293 bits (749),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 164/188 (87%), Gaps = 5/188 (3%)
 Frame = +3

Query  60   MEE--QYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSH  233
            MEE  +  E AT   M GQ  EEE  RDPESNSL QPLL KRN TLSSSP A+VGAKVS+
Sbjct  1    MEEPTRLVEEATINNMDGQQNEEE--RDPESNSLRQPLL-KRNRTLSSSPFALVGAKVSY  57

Query  234  IESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAG  413
            IESLDYEINENDLFKHDWR RSR QVLQYVFLKWTLAFLVGLLTG+ A+LINLA+ENIAG
Sbjct  58   IESLDYEINENDLFKHDWRRRSRVQVLQYVFLKWTLAFLVGLLTGVTASLINLAIENIAG  117

Query  414  YKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            YKL AVV+YI+ +RYL+GFAYFAGANFVLT +A++LCV FAPTAAGPGIPEIKAYLNGVD
Sbjct  118  YKLRAVVNYIENRRYLVGFAYFAGANFVLTLIAALLCVCFAPTAAGPGIPEIKAYLNGVD  177

Query  594  TPNMFGAT  617
            TPNM+GAT
Sbjct  178  TPNMYGAT  185



>ref|XP_010111585.1| Chloride channel protein CLC-b [Morus notabilis]
 gb|EXC31330.1| Chloride channel protein CLC-b [Morus notabilis]
Length=788

 Score =   288 bits (738),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 160/189 (85%), Gaps = 6/189 (3%)
 Frame = +3

Query  60   MEE---QYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVS  230
            MEE   QYAE+A  I        +  ERDPESNSL +PLL KRN TLSSSPLA+VG KVS
Sbjct  1    MEENSKQYAETA--IPQVEAETVDLEERDPESNSLTRPLL-KRNRTLSSSPLAIVGTKVS  57

Query  231  HIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIA  410
            HIESLDYEINENDLFKHDWRSRSR QVLQYVFLKWTLA LVGLLTGIIATLINLAVENIA
Sbjct  58   HIESLDYEINENDLFKHDWRSRSRAQVLQYVFLKWTLACLVGLLTGIIATLINLAVENIA  117

Query  411  GYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGV  590
            GYKLLAVV YI+++RY+ G  YF   NF+LT VA+VLCVFFAPTAAGPGIPEIKAYLNGV
Sbjct  118  GYKLLAVVAYIEQERYITGLIYFTAVNFLLTSVAAVLCVFFAPTAAGPGIPEIKAYLNGV  177

Query  591  DTPNMFGAT  617
            DTP+MFGAT
Sbjct  178  DTPDMFGAT  186



>gb|KDP46292.1| hypothetical protein JCGZ_10132 [Jatropha curcas]
Length=788

 Score =   287 bits (735),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 161/189 (85%), Gaps = 5/189 (3%)
 Frame = +3

Query  60   MEE---QYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVS  230
            MEE   Q AE   T+  +   E  E ERDPESN+L QPLL KRN TLSS+PLA+VGAKVS
Sbjct  1    MEETSTQLAEEQATV-QSHNTEAGEDERDPESNTLQQPLL-KRNRTLSSNPLALVGAKVS  58

Query  231  HIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIA  410
            HIESLDYEINENDLFKHDWRSRS+ QVLQY+FLKWTLAFLVGLLTG+IATLINLAVENIA
Sbjct  59   HIESLDYEINENDLFKHDWRSRSQIQVLQYIFLKWTLAFLVGLLTGLIATLINLAVENIA  118

Query  411  GYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGV  590
            GYKLLAVV +I+ +RYL G AYF GAN VLT  AS+LCV FAPTAAGPGIPEIKAYLNG+
Sbjct  119  GYKLLAVVHFIENERYLTGLAYFTGANLVLTAFASILCVCFAPTAAGPGIPEIKAYLNGI  178

Query  591  DTPNMFGAT  617
            DTPNMFGAT
Sbjct  179  DTPNMFGAT  187



>ref|XP_006447084.1| hypothetical protein CICLE_v10014341mg [Citrus clementina]
 ref|XP_006470044.1| PREDICTED: chloride channel protein CLC-b-like [Citrus sinensis]
 gb|ESR60324.1| hypothetical protein CICLE_v10014341mg [Citrus clementina]
Length=783

 Score =   287 bits (734),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 159/182 (87%), Gaps = 3/182 (2%)
 Frame = +3

Query  78   ESATTIAMAGQaeeee--aeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDY  251
            E++  +A A QA  E    ERDPESNSL QPLL KR+ TLSSSPLA+VGAKVSHIESLDY
Sbjct  3    ENSNPVARATQAHMEADEEERDPESNSLQQPLL-KRSRTLSSSPLALVGAKVSHIESLDY  61

Query  252  EINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAV  431
            EINENDLFKHDWRSRS+ QVLQY+FLKW+LA LVGLLTG+IATLINLAVENIAGYKLLAV
Sbjct  62   EINENDLFKHDWRSRSKVQVLQYIFLKWSLACLVGLLTGLIATLINLAVENIAGYKLLAV  121

Query  432  VDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFG  611
            V +I+K RYL GF YF G NF+LT VA+VLCV FAPTAAGPGIPEIKAYLNGVDTPNMFG
Sbjct  122  VSFIEKDRYLQGFLYFTGVNFLLTLVAAVLCVCFAPTAAGPGIPEIKAYLNGVDTPNMFG  181

Query  612  AT  617
            AT
Sbjct  182  AT  183



>gb|KHN10806.1| Chloride channel protein CLC-b [Glycine soja]
Length=774

 Score =   286 bits (733),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPESN L++PLLLKR  TLSS+PLA+VG KVS+IESLDYEINENDLFKHDWRSRSR QVL
Sbjct  11   DPESNPLNEPLLLKRTRTLSSNPLALVGEKVSYIESLDYEINENDLFKHDWRSRSRVQVL  70

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+FLKW LAFLVGLLTGIIATLINLAVENIAGYKLLAV+ YI K+RYL GF YF G NF
Sbjct  71   QYIFLKWLLAFLVGLLTGIIATLINLAVENIAGYKLLAVLKYIHKERYLTGFLYFTGINF  130

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
            VLTFVA++LCV FAPTAAGPGIPEIKAYLNGVDTPNMFGAT
Sbjct  131  VLTFVAAILCVCFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  171



>ref|NP_001267676.1| chloride channel protein CLC-b-like [Cucumis sativus]
 gb|AFJ15538.1| chloride channel a [Cucumis sativus]
 gb|KGN63173.1| hypothetical protein Csa_2G406710 [Cucumis sativus]
Length=789

 Score =   285 bits (728),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 149/162 (92%), Gaps = 1/162 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            RDPESN L+QPLL KRN TLSSSPLA+VGAKVS IESLDYEINENDLFKHDWRSRS+ QV
Sbjct  26   RDPESNPLNQPLL-KRNRTLSSSPLAIVGAKVSLIESLDYEINENDLFKHDWRSRSKVQV  84

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
            LQY+F KWTLA LVGLLTGIIATLINLA+ENIAGYKLL VVDYI ++RYLMGFAYF  AN
Sbjct  85   LQYIFSKWTLACLVGLLTGIIATLINLAIENIAGYKLLKVVDYIKEERYLMGFAYFTTAN  144

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
            F+LTFVA+ LCV FAPTAAGPGIPEIKAYLNG+DTPNMFGAT
Sbjct  145  FLLTFVAAALCVCFAPTAAGPGIPEIKAYLNGIDTPNMFGAT  186



>ref|XP_007151531.1| hypothetical protein PHAVU_004G054600g [Phaseolus vulgaris]
 gb|ESW23525.1| hypothetical protein PHAVU_004G054600g [Phaseolus vulgaris]
Length=782

 Score =   284 bits (727),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 160/186 (86%), Gaps = 1/186 (1%)
 Frame = +3

Query  60   MEEQYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIE  239
            M E+ +    + +M     EE  ERDPESN L++PLL KRN TLSS+PLA+VGAKVS+IE
Sbjct  1    MSEESSLLKGSTSMNDTMVEEVEERDPESNPLNEPLL-KRNRTLSSNPLALVGAKVSYIE  59

Query  240  SLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYK  419
            SLDYEINENDLFK DWRSRSR QVLQY+F KW+LAFLVGLLTGIIATLINL+VENIAGYK
Sbjct  60   SLDYEINENDLFKQDWRSRSRAQVLQYIFWKWSLAFLVGLLTGIIATLINLSVENIAGYK  119

Query  420  LLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTP  599
            LLAVV++I  +RYL GF YF GANF+LTFVAS+LCV FAPTAAGPGIPEIKAYLNGVDTP
Sbjct  120  LLAVVNFIQNERYLTGFLYFTGANFILTFVASILCVCFAPTAAGPGIPEIKAYLNGVDTP  179

Query  600  NMFGAT  617
            NM+GAT
Sbjct  180  NMYGAT  185



>gb|KHN01525.1| Chloride channel protein CLC-b [Glycine soja]
Length=783

 Score =   284 bits (726),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 150/162 (93%), Gaps = 1/162 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            RDPESN L++PLL KRN TLSS+PLA+VGAKVS+IESLDYEINENDLFK DWRSRSRTQV
Sbjct  26   RDPESNPLNEPLL-KRNRTLSSNPLALVGAKVSYIESLDYEINENDLFKQDWRSRSRTQV  84

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
            LQY+F KWTLAFLVGLLTG+IATLINLAVENIAGYK LAVV++I K+RYL GF YF G N
Sbjct  85   LQYIFWKWTLAFLVGLLTGVIATLINLAVENIAGYKFLAVVNFIQKERYLRGFLYFTGIN  144

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
            F+LTFVAS+LCV FAPTAAGPGIPEIKAYLNGVDTPNM+GAT
Sbjct  145  FLLTFVASILCVCFAPTAAGPGIPEIKAYLNGVDTPNMYGAT  186



>ref|XP_007217037.1| hypothetical protein PRUPE_ppa001619mg [Prunus persica]
 gb|EMJ18236.1| hypothetical protein PRUPE_ppa001619mg [Prunus persica]
Length=791

 Score =   284 bits (726),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 149/162 (92%), Gaps = 1/162 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            RDPES SL QPLL +RN TLSSSPLA+VGAKVS+IESLDYEINENDLFKHDWRSRS+ QV
Sbjct  29   RDPESISLSQPLL-RRNRTLSSSPLAIVGAKVSYIESLDYEINENDLFKHDWRSRSKVQV  87

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
            LQY+FLKW LAFLVGLLTGIIATLINLAVENIAGYKLLA V +I+K+RYLMGF Y AGAN
Sbjct  88   LQYIFLKWILAFLVGLLTGIIATLINLAVENIAGYKLLAAVSFIEKERYLMGFIYLAGAN  147

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             +LT VASVLCV FAPTAAGPGIPEIKAYLNGVDTPNMFGAT
Sbjct  148  LLLTTVASVLCVCFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  189



>ref|NP_001236494.1| chloride channel [Glycine max]
 gb|AAY43007.1| chloride channel [Glycine max]
Length=783

 Score =   284 bits (726),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 150/162 (93%), Gaps = 1/162 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            RDPESN L++PLL KRN TLSS+PLA+VGAKVS+IESLDYEINENDLFK DWRSRSRTQV
Sbjct  26   RDPESNPLNEPLL-KRNRTLSSNPLALVGAKVSYIESLDYEINENDLFKQDWRSRSRTQV  84

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
            LQY+F KWTLAFLVGLLTG+IATLINLAVENIAGYK LAVV++I K+RYL GF YF G N
Sbjct  85   LQYIFWKWTLAFLVGLLTGVIATLINLAVENIAGYKFLAVVNFIQKERYLRGFLYFTGIN  144

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
            F+LTFVAS+LCV FAPTAAGPGIPEIKAYLNGVDTPNM+GAT
Sbjct  145  FLLTFVASILCVCFAPTAAGPGIPEIKAYLNGVDTPNMYGAT  186



>ref|XP_002300101.1| Chloride channel protein CLC-a [Populus trichocarpa]
 gb|EEE84906.1| Chloride channel protein CLC-a [Populus trichocarpa]
Length=785

 Score =   283 bits (725),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 146/162 (90%), Gaps = 1/162 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            RDPESN+LHQPLL KRN TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWRSRS+ QV
Sbjct  24   RDPESNTLHQPLL-KRNRTLSSNPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKVQV  82

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
            LQY+F KWTLAFLVGLLTG+IAT INLAVENIAGYK+LAVV +I+ KRYL G  YF GAN
Sbjct  83   LQYIFWKWTLAFLVGLLTGLIATFINLAVENIAGYKILAVVHFIENKRYLTGLVYFTGAN  142

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             +LT  ASVLCV FAPTAAGPGIPEIKAYLNGVDTPNMFG T
Sbjct  143  LLLTLFASVLCVCFAPTAAGPGIPEIKAYLNGVDTPNMFGVT  184



>ref|XP_008441347.1| PREDICTED: chloride channel protein CLC-b-like [Cucumis melo]
Length=789

 Score =   283 bits (725),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 162/189 (86%), Gaps = 6/189 (3%)
 Frame = +3

Query  60   MEEQ---YAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVS  230
            MEE      ES  T +M  + +EEE  RDPESN L+QPLL KR+ TLSSSPLA+VGAKVS
Sbjct  1    MEENPSFVTESTLTNSMEAEPQEEE--RDPESNPLNQPLL-KRSRTLSSSPLAIVGAKVS  57

Query  231  HIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIA  410
             IESLDYEINENDLFKHDWRSRS+ QVLQY+F KWTLA LVGLLTGIIATLINLA+ENIA
Sbjct  58   LIESLDYEINENDLFKHDWRSRSKVQVLQYIFSKWTLACLVGLLTGIIATLINLAIENIA  117

Query  411  GYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGV  590
            GYKLL VVDYI ++RYLMGFAYF  ANF+LTFVA+ LCV FAPTAAGPGIPEIKAYLNG+
Sbjct  118  GYKLLKVVDYIKQERYLMGFAYFTTANFLLTFVAASLCVCFAPTAAGPGIPEIKAYLNGI  177

Query  591  DTPNMFGAT  617
            DTPNMFGAT
Sbjct  178  DTPNMFGAT  186



>ref|XP_003553925.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Glycine 
max]
Length=790

 Score =   283 bits (723),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 148/161 (92%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPESN L++PLL KRN TLSS+PLA+VG KVS+IESLDYEINENDLFKHDWRSRSR QVL
Sbjct  28   DPESNPLNEPLL-KRNRTLSSNPLALVGEKVSYIESLDYEINENDLFKHDWRSRSRVQVL  86

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+FLKW LAFLVGLLTGIIATLINLAVENIAGYKLLAV+ YI K+RYL GF YF G NF
Sbjct  87   QYIFLKWLLAFLVGLLTGIIATLINLAVENIAGYKLLAVLKYIHKERYLTGFLYFTGINF  146

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
            VLTFVA++LCV FAPTAAGPGIPEIKAYLNGVDTPNMFGAT
Sbjct  147  VLTFVAAILCVCFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  187



>ref|XP_006604142.1| PREDICTED: chloride channel protein CLC-b-like isoform X2 [Glycine 
max]
Length=780

 Score =   282 bits (722),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 148/161 (92%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPESN L++PLL KRN TLSS+PLA+VG KVS+IESLDYEINENDLFKHDWRSRSR QVL
Sbjct  28   DPESNPLNEPLL-KRNRTLSSNPLALVGEKVSYIESLDYEINENDLFKHDWRSRSRVQVL  86

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+FLKW LAFLVGLLTGIIATLINLAVENIAGYKLLAV+ YI K+RYL GF YF G NF
Sbjct  87   QYIFLKWLLAFLVGLLTGIIATLINLAVENIAGYKLLAVLKYIHKERYLTGFLYFTGINF  146

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
            VLTFVA++LCV FAPTAAGPGIPEIKAYLNGVDTPNMFGAT
Sbjct  147  VLTFVAAILCVCFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  187



>ref|XP_009371657.1| PREDICTED: chloride channel protein CLC-b-like [Pyrus x bretschneideri]
Length=787

 Score =   282 bits (721),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 148/162 (91%), Gaps = 1/162 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            RDPES SL QPLL KR+ TLSS+PLAMVGAKVSHIESLDYEINENDLFKHDWRSRS+ QV
Sbjct  25   RDPESISLQQPLL-KRSRTLSSTPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSKVQV  83

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
            LQY+FLKW LA LVGLLTGIIATLINLAVENIAGYKLLA V +I+K+RYLMGF + AGAN
Sbjct  84   LQYIFLKWILACLVGLLTGIIATLINLAVENIAGYKLLAAVSFIEKERYLMGFIFIAGAN  143

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             +LT +ASVLCV FAPTAAGPGIPEIKAYLNGVDTPNMFGAT
Sbjct  144  LLLTAIASVLCVCFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  185



>ref|XP_007161741.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris]
 gb|ESW33735.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris]
Length=742

 Score =   280 bits (715),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 147/161 (91%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPE N L++PLL KRN TLSS+PLA+VG KVS+IESLDYEINENDLFKHDWRSRSR QVL
Sbjct  28   DPEGNPLNEPLL-KRNRTLSSNPLALVGEKVSYIESLDYEINENDLFKHDWRSRSRVQVL  86

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+FLKW LAFLVGLLTGIIATLINLAVENI+GYKLLAV+ YI K+RYL GF YF G NF
Sbjct  87   QYIFLKWLLAFLVGLLTGIIATLINLAVENISGYKLLAVLSYIHKERYLTGFLYFTGMNF  146

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
            +LTFVA++LCV FAPTAAGPGIPEIKAYLNGVDTPNMFGAT
Sbjct  147  ILTFVAAILCVCFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  187



>ref|XP_007161742.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris]
 gb|ESW33736.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris]
Length=791

 Score =   280 bits (716),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 147/161 (91%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPE N L++PLL KRN TLSS+PLA+VG KVS+IESLDYEINENDLFKHDWRSRSR QVL
Sbjct  28   DPEGNPLNEPLL-KRNRTLSSNPLALVGEKVSYIESLDYEINENDLFKHDWRSRSRVQVL  86

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+FLKW LAFLVGLLTGIIATLINLAVENI+GYKLLAV+ YI K+RYL GF YF G NF
Sbjct  87   QYIFLKWLLAFLVGLLTGIIATLINLAVENISGYKLLAVLSYIHKERYLTGFLYFTGMNF  146

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
            +LTFVA++LCV FAPTAAGPGIPEIKAYLNGVDTPNMFGAT
Sbjct  147  ILTFVAAILCVCFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  187



>ref|XP_002509531.1| chloride channel clc, putative [Ricinus communis]
 gb|EEF50918.1| chloride channel clc, putative [Ricinus communis]
Length=787

 Score =   279 bits (713),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 146/162 (90%), Gaps = 1/162 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            RDPESNSL QPLL KRN TLSSSPLA+VGAKVS+IESLDYEINENDLFKHDWRSRS  Q+
Sbjct  26   RDPESNSLQQPLL-KRNRTLSSSPLAIVGAKVSYIESLDYEINENDLFKHDWRSRSNVQI  84

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
            LQY+FLKW LAFLVGLLTG+IATLINLAVENIAGYKLLAVV +I+ +RYL G AYF G N
Sbjct  85   LQYIFLKWILAFLVGLLTGLIATLINLAVENIAGYKLLAVVRFIENERYLTGLAYFTGVN  144

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             +LT  AS LCV+FAPTAAGPGIPEIKAYLNG+DTPNMFGAT
Sbjct  145  LILTAFASALCVWFAPTAAGPGIPEIKAYLNGIDTPNMFGAT  186



>ref|XP_008231135.1| PREDICTED: chloride channel protein CLC-b [Prunus mume]
Length=791

 Score =   279 bits (713),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 147/162 (91%), Gaps = 1/162 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            RDPES SL QPLL +RN TLSSSPLA+VGAKVS+IESLDYEINENDLFKHDWRSRS+ QV
Sbjct  29   RDPESISLSQPLL-RRNRTLSSSPLAIVGAKVSYIESLDYEINENDLFKHDWRSRSKVQV  87

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
            LQY+FLKW LAFLVGLLTGIIATLINLAVENIAGYKLLA V +I K+RYLMGF + AGAN
Sbjct  88   LQYIFLKWILAFLVGLLTGIIATLINLAVENIAGYKLLAAVSFIQKERYLMGFIHLAGAN  147

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             +LT  AS+LCV FAPTAAGPGIPEIKAYLNGVDTPNMFGAT
Sbjct  148  LLLTTFASILCVCFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  189



>ref|XP_011003929.1| PREDICTED: chloride channel protein CLC-b [Populus euphratica]
Length=802

 Score =   279 bits (713),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 146/162 (90%), Gaps = 1/162 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            RDPESN+LH+PLL KRN TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWRSRS+ QV
Sbjct  24   RDPESNALHKPLL-KRNTTLSSNPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKVQV  82

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
            LQY+F KWTLAFLVGL TG+IATLINLAVENIAGYK+LAVV +I+ +RYL G  YF GAN
Sbjct  83   LQYIFWKWTLAFLVGLSTGLIATLINLAVENIAGYKILAVVHFIENERYLTGLVYFTGAN  142

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             +LT  ASVLCV FAPTAAGPGIPEIKAYLNGVDTPNMFG T
Sbjct  143  LLLTLFASVLCVCFAPTAAGPGIPEIKAYLNGVDTPNMFGVT  184



>gb|KJB76407.1| hypothetical protein B456_012G087500 [Gossypium raimondii]
Length=785

 Score =   278 bits (710),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 147/162 (91%), Gaps = 1/162 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            RDPESNSL QPLL KRN TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWR RS+ QV
Sbjct  28   RDPESNSLRQPLL-KRNRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRRRSKVQV  86

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
            LQY+FLKW+LAFLVGLLTG+IATLINLA+ENIAGYKLLA+V +I++ RY+ G  +F G N
Sbjct  87   LQYIFLKWSLAFLVGLLTGLIATLINLAIENIAGYKLLAIVGFIEEGRYISGLIFFTGIN  146

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
            F LT +A+VLCV FAPTAAGPGIPEIKAYLNGVDTPNMFGAT
Sbjct  147  FFLTLIAAVLCVCFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  188



>gb|KJB76409.1| hypothetical protein B456_012G087500 [Gossypium raimondii]
Length=785

 Score =   278 bits (710),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 147/162 (91%), Gaps = 1/162 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            RDPESNSL QPLL KRN TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWR RS+ QV
Sbjct  28   RDPESNSLRQPLL-KRNRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRRRSKVQV  86

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
            LQY+FLKW+LAFLVGLLTG+IATLINLA+ENIAGYKLLA+V +I++ RY+ G  +F G N
Sbjct  87   LQYIFLKWSLAFLVGLLTGLIATLINLAIENIAGYKLLAIVGFIEEGRYISGLIFFTGIN  146

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
            F LT +A+VLCV FAPTAAGPGIPEIKAYLNGVDTPNMFGAT
Sbjct  147  FFLTLIAAVLCVCFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  188



>gb|KJB76408.1| hypothetical protein B456_012G087500 [Gossypium raimondii]
Length=818

 Score =   278 bits (712),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 147/162 (91%), Gaps = 1/162 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            RDPESNSL QPLL KRN TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWR RS+ QV
Sbjct  28   RDPESNSLRQPLL-KRNRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRRRSKVQV  86

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
            LQY+FLKW+LAFLVGLLTG+IATLINLA+ENIAGYKLLA+V +I++ RY+ G  +F G N
Sbjct  87   LQYIFLKWSLAFLVGLLTGLIATLINLAIENIAGYKLLAIVGFIEEGRYISGLIFFTGIN  146

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
            F LT +A+VLCV FAPTAAGPGIPEIKAYLNGVDTPNMFGAT
Sbjct  147  FFLTLIAAVLCVCFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  188



>gb|EYU45399.1| hypothetical protein MIMGU_mgv1a001597mg [Erythranthe guttata]
Length=788

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 146/162 (90%), Gaps = 1/162 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            RD  SN+LHQ LL KRN TLSS+ LA VG KVSHIESLDYEINENDLFK DWRSRS+ QV
Sbjct  24   RDCSSNNLHQSLL-KRNRTLSSNQLAFVGTKVSHIESLDYEINENDLFKQDWRSRSKVQV  82

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
            LQY+FLKW LAFLVGLLTG+IATLINLAVENIAGYKL AVV YID++RYLMGF Y AGAN
Sbjct  83   LQYIFLKWLLAFLVGLLTGVIATLINLAVENIAGYKLRAVVKYIDQERYLMGFVYMAGAN  142

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
            F+LTFVA++LCV FAPTAAGPGIPEIKAYLNGVDTP+MFGAT
Sbjct  143  FLLTFVAAILCVCFAPTAAGPGIPEIKAYLNGVDTPDMFGAT  184



>ref|XP_010029007.1| PREDICTED: chloride channel protein CLC-b [Eucalyptus grandis]
 gb|KCW55840.1| hypothetical protein EUGRSUZ_I01654 [Eucalyptus grandis]
Length=788

 Score =   276 bits (707),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 164/189 (87%), Gaps = 6/189 (3%)
 Frame = +3

Query  60   MEE---QYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVS  230
            MEE   + AE ++   MAG+ +EEE +   ESNSL+QPLL +R+ TLSS+PLAMVGAKV+
Sbjct  2    MEEDPNRVAEESSPNGMAGEEDEEERDP--ESNSLNQPLL-RRHRTLSSNPLAMVGAKVA  58

Query  231  HIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIA  410
            HIESLDYEINENDLFKHDWRSRS+ QVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIA
Sbjct  59   HIESLDYEINENDLFKHDWRSRSKVQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIA  118

Query  411  GYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGV  590
            GYKLLAVV +ID++RY  GF  F G+NFVLT  A+VLCV FAPTAAGPGIPEIKAYLNGV
Sbjct  119  GYKLLAVVHFIDEERYFTGFLLFTGSNFVLTLFAAVLCVCFAPTAAGPGIPEIKAYLNGV  178

Query  591  DTPNMFGAT  617
            DTPNMFGA+
Sbjct  179  DTPNMFGAS  187



>gb|KHN24330.1| Chloride channel protein CLC-b [Glycine soja]
Length=773

 Score =   276 bits (706),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 146/161 (91%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPESN L++PLL KRN TLSS+PLA+VG KVS+IESLDYEINENDLFKHDWRSRSR QVL
Sbjct  11   DPESNPLNEPLL-KRNRTLSSNPLALVGEKVSYIESLDYEINENDLFKHDWRSRSRVQVL  69

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+FLKW LAFLVGLLTGIIATLINLAVENIAGYKLLAV+ YI K+RYL GF YF G NF
Sbjct  70   QYIFLKWLLAFLVGLLTGIIATLINLAVENIAGYKLLAVLKYIHKERYLTGFLYFTGINF  129

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
            VLTFVA++LCV  APTAAGPGIPE KAYLNGVDTPNMFGAT
Sbjct  130  VLTFVAAILCVCSAPTAAGPGIPENKAYLNGVDTPNMFGAT  170



>gb|AES75065.2| ClC chloride channel family protein [Medicago truncatula]
Length=775

 Score =   275 bits (704),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 147/162 (91%), Gaps = 1/162 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            RDPE N +++PLL KRN TLSS+PLA+VGAKVS+IESLDYEINENDLFK DWRSRSR QV
Sbjct  21   RDPERNPMNEPLL-KRNRTLSSNPLALVGAKVSYIESLDYEINENDLFKQDWRSRSRGQV  79

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
            +QY+ LKW LAFLVGLLTG+IATLINLAVENI+GYKLL VV YI ++RYLMGF YF G N
Sbjct  80   MQYIILKWLLAFLVGLLTGVIATLINLAVENISGYKLLTVVGYIQQERYLMGFLYFLGTN  139

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
            F+LTF+AS+LCV FAPTAAGPGIPEIKAYLNGVDTPNM+GAT
Sbjct  140  FLLTFIASILCVCFAPTAAGPGIPEIKAYLNGVDTPNMYGAT  181



>ref|XP_003618847.1| Chloride channel protein CLC-a [Medicago truncatula]
Length=780

 Score =   275 bits (703),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 147/162 (91%), Gaps = 1/162 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            RDPE N +++PLL KRN TLSS+PLA+VGAKVS+IESLDYEINENDLFK DWRSRSR QV
Sbjct  21   RDPERNPMNEPLL-KRNRTLSSNPLALVGAKVSYIESLDYEINENDLFKQDWRSRSRGQV  79

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
            +QY+ LKW LAFLVGLLTG+IATLINLAVENI+GYKLL VV YI ++RYLMGF YF G N
Sbjct  80   MQYIILKWLLAFLVGLLTGVIATLINLAVENISGYKLLTVVGYIQQERYLMGFLYFLGTN  139

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
            F+LTF+AS+LCV FAPTAAGPGIPEIKAYLNGVDTPNM+GAT
Sbjct  140  FLLTFIASILCVCFAPTAAGPGIPEIKAYLNGVDTPNMYGAT  181



>gb|EYU34803.1| hypothetical protein MIMGU_mgv1a001623mg [Erythranthe guttata]
Length=783

 Score =   275 bits (702),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 144/161 (89%), Gaps = 1/161 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
             DPESN+LH+PLL K N TLSS+ LA+VG KVSHIESLDYEINENDLFK DWRSRS+ QV
Sbjct  28   HDPESNTLHEPLL-KVNRTLSSNQLAIVGGKVSHIESLDYEINENDLFKQDWRSRSKVQV  86

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
            LQY+FLKW LAFLVGLLTG+IATLINLAVENIAGYKLL V  YI++KRYL GF Y AGAN
Sbjct  87   LQYIFLKWLLAFLVGLLTGLIATLINLAVENIAGYKLLVVAKYIEQKRYLAGFVYLAGAN  146

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGA  614
            F+LT VASVLCV FAPTAAGPGIPEIKAYLNG+DTPNMFGA
Sbjct  147  FLLTLVASVLCVCFAPTAAGPGIPEIKAYLNGIDTPNMFGA  187



>gb|KJB11653.1| hypothetical protein B456_001G270200 [Gossypium raimondii]
Length=788

 Score =   274 bits (700),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            RDPESNS     LLKRN TLSS+PLA+VGA VSHIESLDYEINENDLFKHDWRSRS+ QV
Sbjct  26   RDPESNSSLSEPLLKRNRTLSSNPLALVGATVSHIESLDYEINENDLFKHDWRSRSKVQV  85

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
            LQY+FLKWTLAFLVGLLTG+IATLINLA+ENIAGYK LA+V +I ++RYL G  +F G N
Sbjct  86   LQYIFLKWTLAFLVGLLTGLIATLINLAIENIAGYKFLAIVGFIKEERYLSGLVFFTGVN  145

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
            FVLT VA+VLCV FAPTAAGPGIPEIKAYLNGVDTP+MFGAT
Sbjct  146  FVLTLVAAVLCVCFAPTAAGPGIPEIKAYLNGVDTPDMFGAT  187



>ref|XP_007031848.1| Chloride channel B isoform 2 [Theobroma cacao]
 gb|EOY02774.1| Chloride channel B isoform 2 [Theobroma cacao]
Length=787

 Score =   273 bits (699),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 145/160 (91%), Gaps = 1/160 (1%)
 Frame = +3

Query  138  PESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQ  317
            PESNSL +PLL KRN TLSSSPLA+VGAKVSHIESLDYEINEND+FKHDWRSRS+ QVLQ
Sbjct  28   PESNSLGEPLL-KRNRTLSSSPLALVGAKVSHIESLDYEINENDIFKHDWRSRSKAQVLQ  86

Query  318  YVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFV  497
            Y+FLKWTLAFLVGLLTG+IATLINLA+ENIAGYKLLA+V +I++ RYL G  +F G NF 
Sbjct  87   YIFLKWTLAFLVGLLTGLIATLINLAIENIAGYKLLAIVGFIEEGRYLSGLVFFTGVNFS  146

Query  498  LTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
            LT  A++LCV FAPTAAGPGIPEIKAYLNGVDTPNMFGAT
Sbjct  147  LTLAAALLCVCFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  186



>ref|XP_007031850.1| Chloride channel B isoform 4, partial [Theobroma cacao]
 gb|EOY02776.1| Chloride channel B isoform 4, partial [Theobroma cacao]
Length=799

 Score =   273 bits (698),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 145/160 (91%), Gaps = 1/160 (1%)
 Frame = +3

Query  138  PESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQ  317
            PESNSL +PLL KRN TLSSSPLA+VGAKVSHIESLDYEINEND+FKHDWRSRS+ QVLQ
Sbjct  26   PESNSLGEPLL-KRNRTLSSSPLALVGAKVSHIESLDYEINENDIFKHDWRSRSKAQVLQ  84

Query  318  YVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFV  497
            Y+FLKWTLAFLVGLLTG+IATLINLA+ENIAGYKLLA+V +I++ RYL G  +F G NF 
Sbjct  85   YIFLKWTLAFLVGLLTGLIATLINLAIENIAGYKLLAIVGFIEEGRYLSGLVFFTGVNFS  144

Query  498  LTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
            LT  A++LCV FAPTAAGPGIPEIKAYLNGVDTPNMFGAT
Sbjct  145  LTLAAALLCVCFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  184



>ref|NP_001268190.1| uncharacterized protein LOC100260066 [Vitis vinifera]
 gb|ADK66982.1| chloride channel ClC4 [Vitis vinifera]
Length=789

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 157/189 (83%), Gaps = 4/189 (2%)
 Frame = +3

Query  60   MEE---QYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVS  230
            MEE   Q AE+ TT   + +   E  ERD ESN L+QPLL KR+ TLSS+PLA+VGAKVS
Sbjct  1    MEEDPSQVAETTTTTTSSVEGVGEGEERDLESNPLNQPLL-KRSRTLSSNPLAIVGAKVS  59

Query  231  HIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIA  410
            HIESLDYEINENDLFKHDWRSRS  QVLQY+FLKW+LAFLVGLLTG+IATLINLAVENIA
Sbjct  60   HIESLDYEINENDLFKHDWRSRSSAQVLQYIFLKWSLAFLVGLLTGLIATLINLAVENIA  119

Query  411  GYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGV  590
            GYKLLAV   ++KKRYL GF Y   ANFVLT  A+ LCV FAPTAAGPGIPEIKAYLNGV
Sbjct  120  GYKLLAVSGLVEKKRYLTGFIYLTTANFVLTLFAAFLCVCFAPTAAGPGIPEIKAYLNGV  179

Query  591  DTPNMFGAT  617
            DTPNMFGA+
Sbjct  180  DTPNMFGAS  188



>ref|XP_010660593.1| PREDICTED: uncharacterized protein LOC100260066 isoform X1 [Vitis 
vinifera]
 ref|XP_010660594.1| PREDICTED: uncharacterized protein LOC100260066 isoform X1 [Vitis 
vinifera]
 emb|CBI21361.3| unnamed protein product [Vitis vinifera]
Length=789

 Score =   271 bits (694),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 157/189 (83%), Gaps = 4/189 (2%)
 Frame = +3

Query  60   MEE---QYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVS  230
            MEE   Q AE+ TT   + +   E  ERD ESN L+QPLL KR+ TLSS+PLA+VGAKVS
Sbjct  1    MEEDPSQVAETTTTTTSSVEGVGEGEERDLESNPLNQPLL-KRSRTLSSNPLAIVGAKVS  59

Query  231  HIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIA  410
            HIESLDYEINENDLFKHDWRSRS  QVLQY+FLKW+LAFLVGLLTG+IATLINLAVENIA
Sbjct  60   HIESLDYEINENDLFKHDWRSRSSAQVLQYIFLKWSLAFLVGLLTGLIATLINLAVENIA  119

Query  411  GYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGV  590
            GYKLLAV   ++KKRYL GF Y   ANFVLT  A+ LCV FAPTAAGPGIPEIKAYLNGV
Sbjct  120  GYKLLAVSGLVEKKRYLTGFIYLTTANFVLTLFAAFLCVCFAPTAAGPGIPEIKAYLNGV  179

Query  591  DTPNMFGAT  617
            DTPNMFGA+
Sbjct  180  DTPNMFGAS  188



>emb|CAN82189.1| hypothetical protein VITISV_031114 [Vitis vinifera]
Length=753

 Score =   270 bits (690),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 144/162 (89%), Gaps = 1/162 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            RD ESN L+QPLL KR+ TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWRSRS  QV
Sbjct  23   RDLESNPLNQPLL-KRSRTLSSNPLAIVGAKVSHIESLDYEINENDLFKHDWRSRSSAQV  81

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
            LQY+FLKW+LAFLVGLLTG+IATLINLAVENIAGYKLLAV   ++KKRYL GF Y   AN
Sbjct  82   LQYIFLKWSLAFLVGLLTGLIATLINLAVENIAGYKLLAVSGLVEKKRYLTGFIYLTTAN  141

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
            FVLT  A+ LCV FAPTAAGPGIPEIKAYLNGVDTPNMFGA+
Sbjct  142  FVLTLFAAFLCVCFAPTAAGPGIPEIKAYLNGVDTPNMFGAS  183



>ref|XP_004513192.1| PREDICTED: chloride channel protein CLC-b-like [Cicer arietinum]
Length=792

 Score =   270 bits (691),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 147/162 (91%), Gaps = 2/162 (1%)
 Frame = +3

Query  135  DPES-NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            DPES NSL+QPL+ KRN TLSS+PLA+VG KVS+IESLDYEINENDLFKH WRSRSR +V
Sbjct  26   DPESSNSLNQPLI-KRNRTLSSNPLALVGEKVSYIESLDYEINENDLFKHGWRSRSRIEV  84

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
            LQY+FLKW LAFLVG LTG+IATLINLAVENIAGYKLLAV+ YI ++RYL GF +F G N
Sbjct  85   LQYIFLKWLLAFLVGFLTGLIATLINLAVENIAGYKLLAVLKYIQRERYLTGFLFFTGIN  144

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
            F+LTFVA++LCV FAPTAAGPGIPEIKAYLNGVDTPNMFGAT
Sbjct  145  FILTFVAAILCVCFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  186



>ref|XP_011098867.1| PREDICTED: chloride channel protein CLC-a-like [Sesamum indicum]
Length=787

 Score =   270 bits (691),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 145/158 (92%), Gaps = 1/158 (1%)
 Frame = +3

Query  144  SNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYV  323
             N+LHQPLL KRN TLSSSPLA+VGAKVS+IESLDYEINENDLFK DWRSRSR QVLQY+
Sbjct  29   CNNLHQPLL-KRNRTLSSSPLAIVGAKVSYIESLDYEINENDLFKQDWRSRSRVQVLQYI  87

Query  324  FLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLT  503
            FLKW LAFLVGLLTG IATLINLAVENI+GYKLLAVV YI+++RYLMGF Y AGANF+LT
Sbjct  88   FLKWLLAFLVGLLTGGIATLINLAVENISGYKLLAVVRYIEQERYLMGFLYMAGANFLLT  147

Query  504  FVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             VA+VL V FAPTAAGPGIPEIKAYLNGVDTPNMFGA+
Sbjct  148  LVAAVLVVCFAPTAAGPGIPEIKAYLNGVDTPNMFGAS  185



>ref|XP_010248967.1| PREDICTED: chloride channel protein CLC-b [Nelumbo nucifera]
Length=781

 Score =   268 bits (684),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 145/162 (90%), Gaps = 1/162 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            R+ ESN LHQ LL KR+ TL S+PLAMVGAKV+H+ESLDYEINENDLFKHDWRSRSR QV
Sbjct  10   REVESNYLHQTLL-KRSPTLPSNPLAMVGAKVTHMESLDYEINENDLFKHDWRSRSRIQV  68

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
            LQY+FLKWTLAFLVGLLTGI+AT INLAVENI+G+K+LAV D + K+RY++GF YF GAN
Sbjct  69   LQYIFLKWTLAFLVGLLTGIVATFINLAVENISGFKILAVTDLVTKRRYVLGFLYFTGAN  128

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
              LT VA++LCV FAPTAAGPGIPEIKAYLNGV+TPNMFGA+
Sbjct  129  LALTMVAAILCVCFAPTAAGPGIPEIKAYLNGVNTPNMFGAS  170



>ref|XP_006395477.1| hypothetical protein EUTSA_v10003679mg [Eutrema salsugineum]
 gb|ESQ32763.1| hypothetical protein EUTSA_v10003679mg [Eutrema salsugineum]
Length=778

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 143/161 (89%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPESN+L+QPL+ K N TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWR RS+TQVL
Sbjct  19   DPESNTLNQPLV-KANRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRKRSKTQVL  77

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+FLKWTLA LVGL TG+IAT INLAVENIAGYKLLAV  ++ ++RY+ G   FAGAN 
Sbjct  78   QYIFLKWTLACLVGLFTGLIATFINLAVENIAGYKLLAVGHFLAQERYVTGLMMFAGANL  137

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             LT VASVLCV FAPTAAGPGIPEIKAYLNGVDTPNMFGAT
Sbjct  138  GLTLVASVLCVCFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  178



>ref|XP_010905204.1| PREDICTED: chloride channel protein CLC-b-like [Elaeis guineensis]
Length=784

 Score =   266 bits (680),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 155/188 (82%), Gaps = 3/188 (2%)
 Frame = +3

Query  60   MEE--QYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSH  233
            MEE  +     TT A   + + EE E+DPES+SLHQPLL KR  TL++  LAMVGAK+SH
Sbjct  1    MEETSKLIPEPTTAAADLEVDGEEDEQDPESHSLHQPLL-KRTPTLTTHHLAMVGAKISH  59

Query  234  IESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAG  413
            IESLDYEINENDLFKHDWRSRS  QVLQY+FLKWTLAFLVGLLTG++A+LINLA+ENIAG
Sbjct  60   IESLDYEINENDLFKHDWRSRSSVQVLQYIFLKWTLAFLVGLLTGVVASLINLAIENIAG  119

Query  414  YKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
             K+L V   +++ RY+ GFAYF GANF LT VA+ LCV FAPTAAGPG+PEIKAYLNGVD
Sbjct  120  IKMLHVARLVNESRYVTGFAYFTGANFALTIVAATLCVVFAPTAAGPGVPEIKAYLNGVD  179

Query  594  TPNMFGAT  617
            TPNMFGA+
Sbjct  180  TPNMFGAS  187



>ref|XP_006290621.1| hypothetical protein CARUB_v10016713mg [Capsella rubella]
 gb|EOA23519.1| hypothetical protein CARUB_v10016713mg [Capsella rubella]
Length=779

 Score =   265 bits (677),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 143/162 (88%), Gaps = 1/162 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            RDPE+N+L+QPL+ K N TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWR RS+ QV
Sbjct  19   RDPENNTLNQPLV-KANRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRKRSKAQV  77

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
            LQYVFLKWTLA LVGL TG+IATLINLAVENIAGYKLLAV  ++ ++RY+ G    AGAN
Sbjct  78   LQYVFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGHFLTQERYVTGLMVLAGAN  137

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
              LT VASVLCV FAPTAAGPGIPEIKAYLNGVDTPNMFGAT
Sbjct  138  LGLTLVASVLCVCFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  179



>ref|XP_010678325.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=831

 Score =   265 bits (678),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 154/193 (80%), Gaps = 7/193 (4%)
 Frame = +3

Query  36   DLRVSASRMEEQYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMV  215
            DL  S+ ++  Q  E+     + G+A       D ESNSLHQPLL K N TLS++ LAMV
Sbjct  43   DLNDSSEQVTLQSMEADAETLVNGEA------EDLESNSLHQPLL-KGNRTLSANHLAMV  95

Query  216  GAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLA  395
            GAKVSHIESLDYEINENDLFK DWRSRS+ QVLQYVFLKW LAFL+GLLTG+IATLINLA
Sbjct  96   GAKVSHIESLDYEINENDLFKQDWRSRSKMQVLQYVFLKWKLAFLIGLLTGLIATLINLA  155

Query  396  VENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKA  575
            VENIAGYKLL V DY+++KRY+ G     GANF+LT  A+VL VFFAPTAAGPGIPEIKA
Sbjct  156  VENIAGYKLLLVSDYVEQKRYMTGLIMLTGANFLLTLSATVLVVFFAPTAAGPGIPEIKA  215

Query  576  YLNGVDTPNMFGA  614
            YLNGVDTPNM+GA
Sbjct  216  YLNGVDTPNMYGA  228



>ref|XP_002875360.1| CLC-B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51619.1| CLC-B [Arabidopsis lyrata subsp. lyrata]
Length=779

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 142/161 (88%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPESN+L+QPL+ K N TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWR RS+ QVL
Sbjct  20   DPESNTLNQPLV-KANRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRKRSKAQVL  78

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QYVFLKWTLA LVGL TG+IATLINLAVENIAGYKLLAV  ++ ++RY+ G    AGAN 
Sbjct  79   QYVFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGHFLTQERYVTGLMVLAGANL  138

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             LT VASVLCV FAPTAAGPGIPEIKAYLNGVDTPNMFGAT
Sbjct  139  GLTLVASVLCVCFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  179



>gb|KEH22046.1| ClC chloride channel family protein [Medicago truncatula]
Length=796

 Score =   264 bits (674),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPESN+     L+KR+ TLSSSPLA+VG KVS+IESLDYE NENDLFK  WRSRSR +VL
Sbjct  33   DPESNNPLNQRLIKRSRTLSSSPLALVGEKVSYIESLDYETNENDLFKDGWRSRSRIEVL  92

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+F+KW LAFLVGLLTGIIATLINLAVENIAGYK LAV+ +I+++RYL GF YF G NF
Sbjct  93   QYIFMKWVLAFLVGLLTGIIATLINLAVENIAGYKFLAVLKFINRERYLEGFLYFMGINF  152

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
            VLTFVA++LCV FAPTAAGPGIPEIKAYLNGVDTPNMFGAT
Sbjct  153  VLTFVAAILCVCFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  193



>ref|XP_010425455.1| PREDICTED: chloride channel protein CLC-b-like isoform X2 [Camelina 
sativa]
Length=743

 Score =   262 bits (670),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 140/161 (87%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPESN+L+QPL+ K N TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWR RS+ QVL
Sbjct  20   DPESNTLNQPLV-KANRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRSKAQVL  78

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QYVFLKWTLA LVGL TG+IATLINLAVENIAGYKLLAV  ++ ++RY  G    AGAN 
Sbjct  79   QYVFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGHFLSQERYATGLMVLAGANL  138

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             LT VASVLCVFFAPTAAGPGIPEIKAYLNGVD PNMFGAT
Sbjct  139  GLTLVASVLCVFFAPTAAGPGIPEIKAYLNGVDLPNMFGAT  179



>ref|NP_189353.1| chloride channel protein CLC-b [Arabidopsis thaliana]
 sp|P92942.1|CLCB_ARATH RecName: Full=Chloride channel protein CLC-b; Short=AtCLC-b; 
AltName: Full=CBS domain-containing protein CBSCLC7 [Arabidopsis 
thaliana]
 emb|CAA96058.1| CLC-b chloride channel protein [Arabidopsis thaliana]
 dbj|BAB01934.1| CLC-d chloride channel; anion channel protein [Arabidopsis thaliana]
 gb|AAL32596.1| CLC-d chloride channel; anion channel protein [Arabidopsis thaliana]
 gb|AEE77275.1| chloride channel protein CLC-b [Arabidopsis thaliana]
Length=780

 Score =   262 bits (670),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPESN+L+QPL+ K N TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWR RS+ QVL
Sbjct  21   DPESNTLNQPLV-KANRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRKRSKAQVL  79

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QYVFLKWTLA LVGL TG+IATLINLAVENIAGYKLLAV  ++ ++RY+ G     GAN 
Sbjct  80   QYVFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGHFLTQERYVTGLMVLVGANL  139

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             LT VASVLCV FAPTAAGPGIPEIKAYLNGVDTPNMFGAT
Sbjct  140  GLTLVASVLCVCFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  180



>ref|XP_010425454.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Camelina 
sativa]
Length=779

 Score =   262 bits (670),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 140/161 (87%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPESN+L+QPL+ K N TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWR RS+ QVL
Sbjct  20   DPESNTLNQPLV-KANRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRSKAQVL  78

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QYVFLKWTLA LVGL TG+IATLINLAVENIAGYKLLAV  ++ ++RY  G    AGAN 
Sbjct  79   QYVFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGHFLSQERYATGLMVLAGANL  138

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             LT VASVLCVFFAPTAAGPGIPEIKAYLNGVD PNMFGAT
Sbjct  139  GLTLVASVLCVFFAPTAAGPGIPEIKAYLNGVDLPNMFGAT  179



>ref|XP_004303984.1| PREDICTED: chloride channel protein CLC-b-like [Fragaria vesca 
subsp. vesca]
Length=790

 Score =   262 bits (670),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 160/188 (85%), Gaps = 2/188 (1%)
 Frame = +3

Query  60   MEEQYAESATTIAMAG--QaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSH  233
            MEE    SA++ A+    +   E  ERD ESNSL QPLLLKRN TLSS+PLA+VGAKVSH
Sbjct  1    MEEHLKHSASSAAIPQSIEGVVESEERDLESNSLIQPLLLKRNRTLSSNPLALVGAKVSH  60

Query  234  IESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAG  413
            IESLDYEINENDLFKHDWRSRS+ QVLQY+ LKWTLA L+GLLTG+IATLINLAVENIAG
Sbjct  61   IESLDYEINENDLFKHDWRSRSKVQVLQYILLKWTLALLIGLLTGLIATLINLAVENIAG  120

Query  414  YKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            YKLLAVV YID++RYLMGF + A AN + T VA+VLCV FAPTAAGPGIPEIKAYLNGVD
Sbjct  121  YKLLAVVAYIDEERYLMGFIFLAVANLLFTTVAAVLCVCFAPTAAGPGIPEIKAYLNGVD  180

Query  594  TPNMFGAT  617
            TPNMFGAT
Sbjct  181  TPNMFGAT  188



>emb|CDY13685.1| BnaA06g32380D [Brassica napus]
Length=783

 Score =   261 bits (668),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPESN+L+QPL+ K N TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWR RS+TQVL
Sbjct  23   DPESNTLNQPLV-KANRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRSKTQVL  81

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+FLKWT A L+GL TG+IATLINLAVENIAGYKLLAV  ++ ++RY+ G   FAG N 
Sbjct  82   QYIFLKWTFACLIGLFTGLIATLINLAVENIAGYKLLAVGHFLAQERYVTGLMVFAGGNL  141

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             LT VASVLCV FAPTAAGPGIPEIKAYLNG+DTPNMFGAT
Sbjct  142  GLTLVASVLCVCFAPTAAGPGIPEIKAYLNGIDTPNMFGAT  182



>ref|XP_009151988.1| PREDICTED: chloride channel protein CLC-b [Brassica rapa]
Length=783

 Score =   261 bits (668),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPESN+L+QPL+ K N TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWR RS+TQVL
Sbjct  23   DPESNTLNQPLV-KANRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRSKTQVL  81

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+FLKWT A L+GL TG+IATLINLAVENIAGYKLLAV  ++ ++RY+ G   FAG N 
Sbjct  82   QYIFLKWTFACLIGLFTGLIATLINLAVENIAGYKLLAVGHFLAQERYVTGLMVFAGGNL  141

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             LT VASVLCV FAPTAAGPGIPEIKAYLNG+DTPNMFGAT
Sbjct  142  GLTLVASVLCVCFAPTAAGPGIPEIKAYLNGIDTPNMFGAT  182



>ref|XP_008806046.1| PREDICTED: chloride channel protein CLC-a-like [Phoenix dactylifera]
Length=792

 Score =   261 bits (667),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 144/169 (85%), Gaps = 8/169 (5%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            +DPESNSLHQPLL  R  TL+++ LAMVGAKVSHIESLDYEINENDLFKHDWRSRS  QV
Sbjct  27   QDPESNSLHQPLL-GRTPTLTTNHLAMVGAKVSHIESLDYEINENDLFKHDWRSRSSVQV  85

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKK-------RYLMGF  470
            LQYVFLKWTL FLVGLLTG+IA+LINLA+ENIAG+K+L V   +++K       RYL GF
Sbjct  86   LQYVFLKWTLVFLVGLLTGVIASLINLAIENIAGFKMLLVGRLVNEKSLFGWWCRYLTGF  145

Query  471  AYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
            AYF GANF LT V++ LCV FAPTAAGPGIPEIKAYLNGVDTPNMFGA+
Sbjct  146  AYFTGANFALTIVSATLCVVFAPTAAGPGIPEIKAYLNGVDTPNMFGAS  194



>gb|KFK33637.1| hypothetical protein AALP_AA5G039600 [Arabis alpina]
Length=778

 Score =   261 bits (667),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 142/161 (88%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPESN+L+QPL+ K N TLSS+PLA+VGAKVS+IESLDYEINENDLFKHDWR RS+ QVL
Sbjct  19   DPESNTLNQPLV-KANRTLSSTPLALVGAKVSYIESLDYEINENDLFKHDWRKRSKAQVL  77

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QYVFLKWTLA LVGL TG+IATLINLAVENIAGYKLLAV  ++ ++RY+ G   FAGAN 
Sbjct  78   QYVFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGHFLGQERYVTGLMLFAGANL  137

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             LT VASVLCV FAPTAAGPGIPEIKAYLNGVDTPNMFG T
Sbjct  138  GLTLVASVLCVCFAPTAAGPGIPEIKAYLNGVDTPNMFGFT  178



>emb|CDX83663.1| BnaC07g24030D [Brassica napus]
Length=783

 Score =   261 bits (666),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPESN+L+QPL+ K N TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWR RS+TQVL
Sbjct  23   DPESNTLNQPLV-KANRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRSKTQVL  81

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+FLKWT A L+GL TG+IATLINLAVENIAGYKLLAV  ++ ++RY+ G   FAG N 
Sbjct  82   QYIFLKWTFACLIGLFTGLIATLINLAVENIAGYKLLAVGHFLAQERYVTGLMVFAGGNL  141

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             LT VA+VLCV FAPTAAGPGIPEIKAYLNG+DTPNMFGAT
Sbjct  142  GLTLVATVLCVCFAPTAAGPGIPEIKAYLNGIDTPNMFGAT  182



>ref|XP_010514406.1| PREDICTED: chloride channel protein CLC-b [Camelina sativa]
Length=779

 Score =   261 bits (666),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 140/161 (87%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPESN+L+QPL+ K N TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWR RS+ QVL
Sbjct  20   DPESNTLNQPLV-KANRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRSKAQVL  78

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QYVFLKWTLA LVGL TG+IATLINLAVENIAGYKLLAV  ++ ++RY  G    AGAN 
Sbjct  79   QYVFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGHFLSQERYATGLMVLAGANL  138

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             LT VASVLCV+FAPTAAGPGIPEIKAYLNGVD PNMFGAT
Sbjct  139  GLTLVASVLCVYFAPTAAGPGIPEIKAYLNGVDLPNMFGAT  179



>gb|AFW87644.1| hypothetical protein ZEAMMB73_318834, partial [Zea mays]
Length=252

 Score =   245 bits (626),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 135/154 (88%), Gaps = 1/154 (1%)
 Frame = +3

Query  153  LHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  332
            L QPLL KR+ TL++S LA+VGAKVSHIESLDYEI ENDLFKHDWRSRS  +VLQY+FLK
Sbjct  55   LEQPLL-KRSTTLTASHLAIVGAKVSHIESLDYEIIENDLFKHDWRSRSNVEVLQYIFLK  113

Query  333  WTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVA  512
            W +AFLVGLLTG+IA+LINLA+ENI+G K+L +V+ +  KRY  GF YFAG NF LTFVA
Sbjct  114  WAMAFLVGLLTGVIASLINLAIENISGLKMLQMVNLVRGKRYWAGFLYFAGVNFALTFVA  173

Query  513  SVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGA  614
            +VLCV FAPTAAGPGIPEIKAYLNGVDTPNMFGA
Sbjct  174  AVLCVVFAPTAAGPGIPEIKAYLNGVDTPNMFGA  207



>ref|XP_010502678.1| PREDICTED: chloride channel protein CLC-b-like isoform X2 [Camelina 
sativa]
Length=743

 Score =   258 bits (660),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 139/161 (86%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPESN+L+QPL+ K N TLSS+PLA+VG KVSHIESL+YEINENDLFKHDWR RS+ QVL
Sbjct  20   DPESNTLNQPLV-KANRTLSSTPLALVGTKVSHIESLNYEINENDLFKHDWRKRSKAQVL  78

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QYVFLKWTLA  VGL TG+IATLINLAVENIAGYKLLAV  ++ ++RY  G    AGAN 
Sbjct  79   QYVFLKWTLACFVGLFTGLIATLINLAVENIAGYKLLAVGHFLSQERYATGLMVLAGANL  138

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             LT VASVLCVFFAPTAAGPGIPEIKAYLNGVD PNMFGAT
Sbjct  139  GLTLVASVLCVFFAPTAAGPGIPEIKAYLNGVDLPNMFGAT  179



>ref|XP_010502677.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Camelina 
sativa]
Length=779

 Score =   259 bits (661),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 139/161 (86%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPESN+L+QPL+ K N TLSS+PLA+VG KVSHIESL+YEINENDLFKHDWR RS+ QVL
Sbjct  20   DPESNTLNQPLV-KANRTLSSTPLALVGTKVSHIESLNYEINENDLFKHDWRKRSKAQVL  78

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QYVFLKWTLA  VGL TG+IATLINLAVENIAGYKLLAV  ++ ++RY  G    AGAN 
Sbjct  79   QYVFLKWTLACFVGLFTGLIATLINLAVENIAGYKLLAVGHFLSQERYATGLMVLAGANL  138

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             LT VASVLCVFFAPTAAGPGIPEIKAYLNGVD PNMFGAT
Sbjct  139  GLTLVASVLCVFFAPTAAGPGIPEIKAYLNGVDLPNMFGAT  179



>ref|XP_006338691.1| PREDICTED: chloride channel protein CLC-a-like [Solanum tuberosum]
Length=774

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 151/190 (79%), Gaps = 11/190 (6%)
 Frame = +3

Query  60   MEEQ--YAESATTIAMA--GQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKV  227
            MEE   +AE AT I M   GQ   EE     ESN L       RN TLSS+ +A+VGAKV
Sbjct  1    MEEPNGFAEVATIIDMELEGQHNNEEERESTESNYL-------RNRTLSSTSVAIVGAKV  53

Query  228  SHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENI  407
            SHIESLDYEINENDLFKHDWR RSR Q LQYVF+KWTLAFLVGL TG +ATLI+L++ENI
Sbjct  54   SHIESLDYEINENDLFKHDWRKRSRLQTLQYVFIKWTLAFLVGLFTGGVATLISLSIENI  113

Query  408  AGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNG  587
            +GYKL A V+YID KRY MGFA+FAGANF+LT VA+ + V+FAPTAAGPG+PEIKAYLNG
Sbjct  114  SGYKLRATVNYIDDKRYFMGFAFFAGANFLLTLVAAFITVYFAPTAAGPGVPEIKAYLNG  173

Query  588  VDTPNMFGAT  617
            VDTPNMFGAT
Sbjct  174  VDTPNMFGAT  183



>emb|CDY34173.1| BnaA02g28670D [Brassica napus]
Length=780

 Score =   258 bits (659),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 140/161 (87%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            D ESN+L+QPL+ K N  LSS+PLA+VG KVSHIESLDYEINENDLFKHDWR RS+TQVL
Sbjct  23   DAESNTLNQPLV-KANRKLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRSKTQVL  81

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+FLKWT A LVGL TG+IATLINLAVENIAGYKLLAV  ++ ++RY+ G   FAGAN 
Sbjct  82   QYIFLKWTFACLVGLFTGLIATLINLAVENIAGYKLLAVGHFLAQERYVTGLMMFAGANL  141

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             LT +ASVLCV FAPTAAGPGIPEIKAYLNG+DTPNMFGAT
Sbjct  142  GLTLIASVLCVCFAPTAAGPGIPEIKAYLNGIDTPNMFGAT  182



>ref|XP_009129444.1| PREDICTED: chloride channel protein CLC-b-like [Brassica rapa]
Length=783

 Score =   258 bits (659),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 140/161 (87%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            D ESN+L+QPL+ K N  LSS+PLA+VG KVSHIESLDYEINENDLFKHDWR RS+TQVL
Sbjct  23   DAESNTLNQPLV-KANRKLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRSKTQVL  81

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+FLKWT A LVGL TG+IATLINLAVENIAGYKLLAV  ++ ++RY+ G   FAGAN 
Sbjct  82   QYIFLKWTFACLVGLFTGLIATLINLAVENIAGYKLLAVGHFLAQERYVTGLMMFAGANL  141

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             LT +ASVLCV FAPTAAGPGIPEIKAYLNG+DTPNMFGAT
Sbjct  142  GLTLIASVLCVCFAPTAAGPGIPEIKAYLNGIDTPNMFGAT  182



>ref|XP_010670516.1| PREDICTED: chloride channel protein CLC-b-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670517.1| PREDICTED: chloride channel protein CLC-b-like [Beta vulgaris 
subsp. vulgaris]
Length=804

 Score =   258 bits (659),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 149/180 (83%), Gaps = 2/180 (1%)
 Frame = +3

Query  75   AESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYE  254
            +E A+T +M  +A       D ESN LHQPLL KRN TLS+S LAMVGAKVS+IESLDYE
Sbjct  24   SELASTPSMEAEAVANGDA-DLESNVLHQPLL-KRNRTLSASHLAMVGAKVSYIESLDYE  81

Query  255  INENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVV  434
            INENDLFK DWRSRS+ QVLQYVFLKW LAFLVGLLTG++ATLINLAVENIAGYKLL V 
Sbjct  82   INENDLFKQDWRSRSKVQVLQYVFLKWKLAFLVGLLTGLVATLINLAVENIAGYKLLLVS  141

Query  435  DYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGA  614
             YI +KRY+MG     GANF+LT  ++VL VFFAPTAAGPGIPEIKAYLNG+DTPNM+GA
Sbjct  142  GYIVEKRYVMGLIMLTGANFLLTLSSTVLVVFFAPTAAGPGIPEIKAYLNGIDTPNMYGA  201



>emb|CDX99630.1| BnaC04g33870D [Brassica napus]
Length=776

 Score =   258 bits (658),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 140/161 (87%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPE+N+++QPLL KR+ TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWRSRS+ QV 
Sbjct  21   DPENNTMNQPLL-KRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRSRSKAQVF  79

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+F KWTLA LVGLLTG+IATLINLAVENIAGYKLLAV  YI + RYL G   F GAN 
Sbjct  80   QYIFAKWTLACLVGLLTGLIATLINLAVENIAGYKLLAVGYYIAQDRYLTGLLIFTGANL  139

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             LT VA++L V FAPTAAGPGIPEIKAYLNGVDTPNMFGAT
Sbjct  140  GLTLVATILVVVFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  180



>emb|CDY28488.1| BnaC02g36720D [Brassica napus]
Length=783

 Score =   258 bits (658),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 140/161 (87%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            D ESN+L+QPL+ K N  LSS+PLA+VG KVSHIESLDYEINENDLFKHDWR RS+TQVL
Sbjct  23   DAESNTLNQPLV-KANRKLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRSKTQVL  81

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+FLKWT A LVGL TG+IATLINLAVENIAGYKLLAV  ++ ++RY+ G   FAGAN 
Sbjct  82   QYIFLKWTFACLVGLFTGLIATLINLAVENIAGYKLLAVGHFLAQERYVTGLMMFAGANL  141

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             LT +ASVLCV FAPTAAGPGIPEIKAYLNG+DTPNMFGAT
Sbjct  142  GLTLIASVLCVCFAPTAAGPGIPEIKAYLNGIDTPNMFGAT  182



>emb|CAA96057.1| CLC-a chloride channel protein [Arabidopsis thaliana]
Length=775

 Score =   256 bits (654),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 140/162 (86%), Gaps = 1/162 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
             DPE+N+L+QPLL KR+ TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWRSRS+ QV
Sbjct  21   EDPENNTLNQPLL-KRHRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKAQV  79

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
             QY+FLKWTLA LVGL TG+IATLINLAVENIAGYKLLAV  YI + R+  G   F GAN
Sbjct  80   FQYIFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGYYIAQDRFWTGLMVFTGAN  139

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
              LT VA+VL V+FAPTAAGPGIPEIKAYLNG+DTPNMFG T
Sbjct  140  LGLTLVATVLVVYFAPTAAGPGIPEIKAYLNGIDTPNMFGFT  181



>gb|AAL24139.1| putative anion channel protein [Arabidopsis thaliana]
Length=775

 Score =   256 bits (654),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 140/162 (86%), Gaps = 1/162 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
             DPE+N+L+QPLL KR+ TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWRSRS+ QV
Sbjct  21   EDPENNTLNQPLL-KRHRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKAQV  79

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
             QY+FLKWTLA LVGL TG+IATLINLAVENIAGYKLLAV  YI + R+  G   F GAN
Sbjct  80   FQYIFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGYYIAQDRFWTGLMVFTGAN  139

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
              LT VA+VL V+FAPTAAGPGIPEIKAYLNG+DTPNMFG T
Sbjct  140  LGLTLVATVLVVYFAPTAAGPGIPEIKAYLNGIDTPNMFGFT  181



>ref|NP_198905.1| chloride channel protein CLC-a [Arabidopsis thaliana]
 sp|P92941.2|CLCA_ARATH RecName: Full=Chloride channel protein CLC-a; Short=AtCLC-a; 
AltName: Full=CBS domain-containing protein CBSCLC5 [Arabidopsis 
thaliana]
 gb|AAC05742.1| anion channel protein [Arabidopsis thaliana]
 dbj|BAB11351.1| anion channel protein [Arabidopsis thaliana]
 gb|AAN13022.1| anion channel protein [Arabidopsis thaliana]
 gb|AED94612.1| chloride channel protein CLC-a [Arabidopsis thaliana]
Length=775

 Score =   256 bits (654),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 140/162 (86%), Gaps = 1/162 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
             DPE+N+L+QPLL KR+ TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWRSRS+ QV
Sbjct  21   EDPENNTLNQPLL-KRHRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKAQV  79

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
             QY+FLKWTLA LVGL TG+IATLINLAVENIAGYKLLAV  YI + R+  G   F GAN
Sbjct  80   FQYIFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGYYIAQDRFWTGLMVFTGAN  139

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
              LT VA+VL V+FAPTAAGPGIPEIKAYLNG+DTPNMFG T
Sbjct  140  LGLTLVATVLVVYFAPTAAGPGIPEIKAYLNGIDTPNMFGFT  181



>gb|AAB17007.1| voltage-gated chloride channel [Arabidopsis thaliana]
Length=773

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 140/162 (86%), Gaps = 1/162 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
             DPE+N+L+QPLL KR+ TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWRSRS+ QV
Sbjct  21   EDPENNTLNQPLL-KRHRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKAQV  79

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
             QY+FLKWTLA LVGL TG+IATLINLAVENIAGYKLLAV  YI + R+  G   F GAN
Sbjct  80   FQYIFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGYYIAQDRFWTGLMVFTGAN  139

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
              LT VA+VL V+FAPTAAGPGIPEIKAYLNG+DTPNMFG T
Sbjct  140  LGLTLVATVLVVYFAPTAAGPGIPEIKAYLNGIDTPNMFGFT  181



>ref|XP_009392485.1| PREDICTED: chloride channel protein CLC-a-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009392486.1| PREDICTED: chloride channel protein CLC-a-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009392487.1| PREDICTED: chloride channel protein CLC-a-like [Musa acuminata 
subsp. malaccensis]
Length=798

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 138/161 (86%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPESNSL QPLL KR+ TL+SS  AMVGAKVSHIESLDYEINENDLFKHDWRSRS T+VL
Sbjct  25   DPESNSLQQPLL-KRSPTLTSSHYAMVGAKVSHIESLDYEINENDLFKHDWRSRSSTEVL  83

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+FLKWTLAFLVGLLTG+ A+LINLA+ENIAG K+L +  ++  +RY+ GF Y AG N 
Sbjct  84   QYIFLKWTLAFLVGLLTGVTASLINLAIENIAGIKMLYLARFVKDQRYITGFVYLAGVNL  143

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             LT VA+ LCV FAPTAAGPGIPEIKAYLNGVDTPNMFG +
Sbjct  144  ALTTVAASLCVVFAPTAAGPGIPEIKAYLNGVDTPNMFGVS  184



>ref|XP_008788897.1| PREDICTED: chloride channel protein CLC-b-like [Phoenix dactylifera]
Length=785

 Score =   255 bits (651),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 138/162 (85%), Gaps = 1/162 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
             DPE NSLHQPLL KR  TL+++ LAMVGAKVSHIESLDYEINEND+FKHDW SRS  QV
Sbjct  28   HDPERNSLHQPLL-KRTATLTTNHLAMVGAKVSHIESLDYEINENDIFKHDWTSRSSVQV  86

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
            LQYVFLKW  AFLVGLLTG+IA+LINLA+ENIAG K+L +   +++ RY+ GF YFAGAN
Sbjct  87   LQYVFLKWMSAFLVGLLTGVIASLINLAIENIAGIKMLLMARLVNESRYINGFVYFAGAN  146

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
            F LT VA+ LCV FAPTAAGPGIPEIKAYLNGVDTPNMF A+
Sbjct  147  FALTMVAATLCVVFAPTAAGPGIPEIKAYLNGVDTPNMFVAS  188



>gb|KFK33054.1| hypothetical protein AALP_AA6G324100 [Arabis alpina]
Length=776

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 138/161 (86%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPESN L+ PLL KR+ TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWRSRS+TQV 
Sbjct  21   DPESNILNTPLL-KRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRSRSKTQVF  79

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+F KWTLA LVGL TG+IATLINLAVENIAGYKLLAV  YI + R++ G   F GAN 
Sbjct  80   QYIFAKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGYYIGQDRFMTGLLVFTGANL  139

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             LT VA++L V+FAPTAAGPGIPEIKAYLNGVDTPNMFG T
Sbjct  140  GLTLVATILVVYFAPTAAGPGIPEIKAYLNGVDTPNMFGFT  180



>gb|EMT23598.1| hypothetical protein F775_52599 [Aegilops tauschii]
Length=664

 Score =   249 bits (637),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 142/165 (86%), Gaps = 6/165 (4%)
 Frame = +3

Query  135  DPES-----NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRS  299
            DP S     +SL +PLL KR+ TL+SS LAMVGAKVSHIESLDYEI ENDLFKHDWRSRS
Sbjct  30   DPGSAGDGISSLEKPLL-KRSNTLTSSHLAMVGAKVSHIESLDYEIIENDLFKHDWRSRS  88

Query  300  RTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYF  479
              +VLQY+FLKW+LAFLVGLLTG+IA+LINLA+ENI+G K+L +V  + +KRY  GF YF
Sbjct  89   NVEVLQYIFLKWSLAFLVGLLTGVIASLINLAIENISGLKMLHMVHLVREKRYWAGFFYF  148

Query  480  AGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGA  614
            +G NFVLTF+A+VLCV FAPTAAGPGIPEIKAYLNGVDTPNMFGA
Sbjct  149  SGFNFVLTFIAAVLCVVFAPTAAGPGIPEIKAYLNGVDTPNMFGA  193



>dbj|BAJ33828.1| unnamed protein product [Thellungiella halophila]
Length=363

 Score =   241 bits (616),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 140/161 (87%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPE+N+++QPLL KR+ TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWRSRS+ QV 
Sbjct  21   DPENNTMNQPLL-KRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRSRSKAQVY  79

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+F KWTLA LVGLLTG+IATLINLAVENIAGYKLLAV  YI + RY+ G   F GAN 
Sbjct  80   QYIFAKWTLACLVGLLTGLIATLINLAVENIAGYKLLAVGYYIGQDRYVTGLLIFTGANL  139

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             LT VA+VL V FAPTAAGPGIPEIKAYLNGVDTPNMFGAT
Sbjct  140  GLTLVATVLVVVFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  180



>ref|XP_006285462.1| hypothetical protein CARUB_v10006880mg [Capsella rubella]
 gb|EOA18360.1| hypothetical protein CARUB_v10006880mg [Capsella rubella]
Length=777

 Score =   251 bits (642),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 140/162 (86%), Gaps = 2/162 (1%)
 Frame = +3

Query  135  DPESN-SLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            DPE+N +L+QPLL KR+ TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWRSRS+TQV
Sbjct  23   DPENNMALNQPLL-KRHRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKTQV  81

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
             QY+FLKWTLA LVGL TG+IATLINLAVENIAGYKLLAV  YI + R+  G   F GAN
Sbjct  82   FQYIFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGYYIAQDRFWTGLMVFTGAN  141

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
              LT VA+VL V FAPTAAGPGIPEIKAYLNG+DTPNMFG T
Sbjct  142  LGLTLVATVLVVCFAPTAAGPGIPEIKAYLNGIDTPNMFGFT  183



>dbj|BAJ96369.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=787

 Score =   249 bits (637),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 142/166 (86%), Gaps = 6/166 (4%)
 Frame = +3

Query  132  RDPES-----NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSR  296
             DP S     +SL +PLL KR+ TL+SS LAMVGAKVSHIESLDYEI ENDLFKHDWRSR
Sbjct  29   EDPGSAGDGISSLEKPLL-KRSNTLTSSHLAMVGAKVSHIESLDYEIIENDLFKHDWRSR  87

Query  297  SRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAY  476
            S  +VLQY+FLKW+LAFLVGLLTG+IA+LINLA+ENI+G K+L +V  + +KRY  GF Y
Sbjct  88   SNVEVLQYIFLKWSLAFLVGLLTGVIASLINLAIENISGLKMLHMVQLVREKRYWAGFFY  147

Query  477  FAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGA  614
            F+G NFVLTF+A+VLCV FAPTAAGPGIPEIKAYLNGVDTPNMFGA
Sbjct  148  FSGINFVLTFIAAVLCVVFAPTAAGPGIPEIKAYLNGVDTPNMFGA  193



>dbj|BAJ92499.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=787

 Score =   249 bits (637),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 142/166 (86%), Gaps = 6/166 (4%)
 Frame = +3

Query  132  RDPES-----NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSR  296
             DP S     +SL +PLL KR+ TL+SS LAMVGAKVSHIESLDYEI ENDLFKHDWRSR
Sbjct  29   EDPGSAGDGISSLEKPLL-KRSNTLTSSHLAMVGAKVSHIESLDYEIIENDLFKHDWRSR  87

Query  297  SRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAY  476
            S  +VLQY+FLKW+LAFLVGLLTG+IA+LINLA+ENI+G K+L +V  + +KRY  GF Y
Sbjct  88   SNVEVLQYIFLKWSLAFLVGLLTGVIASLINLAIENISGLKMLHMVQLVREKRYWAGFFY  147

Query  477  FAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGA  614
            F+G NFVLTF+A+VLCV FAPTAAGPGIPEIKAYLNGVDTPNMFGA
Sbjct  148  FSGINFVLTFIAAVLCVVFAPTAAGPGIPEIKAYLNGVDTPNMFGA  193



>dbj|BAJ88201.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=787

 Score =   249 bits (637),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 142/166 (86%), Gaps = 6/166 (4%)
 Frame = +3

Query  132  RDPES-----NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSR  296
             DP S     +SL +PLL KR+ TL+SS LAMVGAKVSHIESLDYEI ENDLFKHDWRSR
Sbjct  29   EDPGSAGDGISSLEKPLL-KRSNTLTSSHLAMVGAKVSHIESLDYEIIENDLFKHDWRSR  87

Query  297  SRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAY  476
            S  +VLQY+FLKW+LAFLVGLLTG+IA+LINLA+ENI+G K+L +V  + +KRY  GF Y
Sbjct  88   SNVEVLQYIFLKWSLAFLVGLLTGVIASLINLAIENISGLKMLHMVQLVREKRYWAGFFY  147

Query  477  FAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGA  614
            F+G NFVLTF+A+VLCV FAPTAAGPGIPEIKAYLNGVDTPNMFGA
Sbjct  148  FSGINFVLTFIAAVLCVVFAPTAAGPGIPEIKAYLNGVDTPNMFGA  193



>emb|CDY11722.1| BnaC06g13300D [Brassica napus]
Length=770

 Score =   249 bits (636),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 142/161 (88%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPE+N+++QPLL KR+ TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWRSRS+TQVL
Sbjct  21   DPENNTMNQPLL-KRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRSRSKTQVL  79

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+F KWTLAFLVGLLTG+IATLINLAVENIAGYKLLAV  YI + RY+ G   F GAN 
Sbjct  80   QYIFAKWTLAFLVGLLTGLIATLINLAVENIAGYKLLAVGHYIGQDRYVTGLLVFTGANL  139

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             LT V +VL V FAPTAAGPGIPEIKAYLNG+DTPNMFGAT
Sbjct  140  GLTLVGTVLVVVFAPTAAGPGIPEIKAYLNGIDTPNMFGAT  180



>gb|EMT27070.1| Chloride channel protein CLC-b [Aegilops tauschii]
Length=537

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 134/156 (86%), Gaps = 1/156 (1%)
 Frame = +3

Query  147  NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVF  326
            +SL QPLL K N TL+++ LAMVGAKVSHIESLDYEI ENDLFKHDWRSRS  +VLQYVF
Sbjct  36   SSLEQPLLKKSN-TLTANHLAMVGAKVSHIESLDYEIIENDLFKHDWRSRSTVEVLQYVF  94

Query  327  LKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTF  506
            LKW LAFLVGLLTG+IA+LINLA+ENI+G K+L +V  +  KRY  GF YF+G N  LTF
Sbjct  95   LKWALAFLVGLLTGVIASLINLAIENISGIKMLHMVQLVRDKRYWAGFFYFSGFNLALTF  154

Query  507  VASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGA  614
            VA+VLCV FAPTAAGPGIPEIKAYLNGVDTPNMFGA
Sbjct  155  VAAVLCVVFAPTAAGPGIPEIKAYLNGVDTPNMFGA  190



>ref|XP_002868624.1| ATCLC-A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44883.1| ATCLC-A [Arabidopsis lyrata subsp. lyrata]
Length=776

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 136/156 (87%), Gaps = 1/156 (1%)
 Frame = +3

Query  150  SLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFL  329
            +L+QPLL KR+ TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWRSRS+TQV QY+FL
Sbjct  28   TLNQPLL-KRHRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKTQVFQYIFL  86

Query  330  KWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFV  509
            KWTLA LVGL TG+IATLINLAVENIAGYKLLAV  YI + R+  G   F GAN  LT V
Sbjct  87   KWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGYYIGQDRFWTGLMIFTGANLGLTLV  146

Query  510  ASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
            A+VL V+FAPTAAGPGIPEIKAYLNG+DTPNMFG T
Sbjct  147  ATVLVVYFAPTAAGPGIPEIKAYLNGIDTPNMFGFT  182



>ref|XP_004231786.1| PREDICTED: chloride channel protein CLC-a-like [Solanum lycopersicum]
Length=763

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            D E       +   RN TLSS+ +A+ GAKVSHIESLDYEINENDLFKHDWR RSR Q L
Sbjct  12   DMEEERESTDINYSRNRTLSSTSVALEGAKVSHIESLDYEINENDLFKHDWRKRSRVQTL  71

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QYVF+KWTLAFLVGL TG +ATLI+L++ENI+GYKL A V+YID KRY MGFA+FAGANF
Sbjct  72   QYVFIKWTLAFLVGLFTGGVATLISLSIENISGYKLRATVNYIDDKRYFMGFAFFAGANF  131

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
            +LT +A+ + V+FAPTAAGPG+PEIKAYLNGVDTPNMFGAT
Sbjct  132  LLTLLAAFITVYFAPTAAGPGVPEIKAYLNGVDTPNMFGAT  172



>gb|EEE53145.1| hypothetical protein OsJ_35963 [Oryza sativa Japonica Group]
Length=716

 Score =   247 bits (630),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 136/156 (87%), Gaps = 1/156 (1%)
 Frame = +3

Query  147  NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVF  326
            +SL QPLL KR+ TL++S LAMVGAKVSHIESLDYEI ENDLFKHDWR RS  +VLQY+F
Sbjct  37   SSLEQPLL-KRSNTLTASHLAMVGAKVSHIESLDYEIIENDLFKHDWRRRSNVEVLQYIF  95

Query  327  LKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTF  506
            LKW +AFLVGLLTG+IA+LINLA+ENI+G K+L +V  + KKRY  GF YFAG NF LTF
Sbjct  96   LKWAMAFLVGLLTGVIASLINLAIENISGLKMLHMVQLVRKKRYWAGFLYFAGVNFGLTF  155

Query  507  VASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGA  614
            +A++LCV FAPTAAGPGIPEIKAYLNGVDTPNMFGA
Sbjct  156  IAAMLCVVFAPTAAGPGIPEIKAYLNGVDTPNMFGA  191



>emb|CDX67478.1| BnaA07g15180D [Brassica napus]
Length=770

 Score =   248 bits (632),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 142/161 (88%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPE+N+++QPLL KR+ TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWRSRS+ QVL
Sbjct  21   DPENNTMNQPLL-KRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRSRSKAQVL  79

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+F KWTLAFLVGLLTG+IATLINLAVENIAGYKLLAV  YI + RY+ G   F GAN 
Sbjct  80   QYIFAKWTLAFLVGLLTGLIATLINLAVENIAGYKLLAVGHYISQDRYVTGLLVFTGANL  139

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             LT VA+VL V FAPTAAGPGIPEIKAYLNG+DTPNMFGAT
Sbjct  140  GLTLVATVLVVVFAPTAAGPGIPEIKAYLNGIDTPNMFGAT  180



>ref|XP_009125164.1| PREDICTED: chloride channel protein CLC-a-like [Brassica rapa]
Length=770

 Score =   248 bits (632),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 142/161 (88%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPE+N+++QPLL KR+ TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWRSRS+ QVL
Sbjct  21   DPENNTMNQPLL-KRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRSRSKAQVL  79

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+F KWTLAFLVGLLTG+IATLINLAVENIAGYKLLAV  YI + RY+ G   F GAN 
Sbjct  80   QYIFAKWTLAFLVGLLTGLIATLINLAVENIAGYKLLAVGHYISQDRYVTGLLVFTGANL  139

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             LT VA+VL V FAPTAAGPGIPEIKAYLNG+DTPNMFGAT
Sbjct  140  GLTLVATVLVVVFAPTAAGPGIPEIKAYLNGIDTPNMFGAT  180



>ref|XP_002438781.1| hypothetical protein SORBIDRAFT_10g026090 [Sorghum bicolor]
 gb|EER90148.1| hypothetical protein SORBIDRAFT_10g026090 [Sorghum bicolor]
Length=801

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 141/171 (82%), Gaps = 11/171 (6%)
 Frame = +3

Query  132  RDPES----------NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKH  281
             DPES          +SL QPLL KR+ TL++S LA+VGAKVSHIESLDYEI ENDLFKH
Sbjct  38   EDPESTGGGGDGNGISSLEQPLL-KRSTTLTASHLAIVGAKVSHIESLDYEIIENDLFKH  96

Query  282  DWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYL  461
            DWRSRS  +VLQY+FLKW +AFLVGLLTG+IA+LINLA+ENI+G K+  +V+ + +KRY 
Sbjct  97   DWRSRSNVEVLQYIFLKWAMAFLVGLLTGVIASLINLAIENISGLKMQHMVNLVREKRYW  156

Query  462  MGFAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGA  614
             GF YFAG NF LTFVA+VLCV FAPTAAGPGIPEIKAYLNGVDTPNMFGA
Sbjct  157  AGFLYFAGVNFALTFVAAVLCVVFAPTAAGPGIPEIKAYLNGVDTPNMFGA  207



>ref|XP_010528167.1| PREDICTED: chloride channel protein CLC-b-like [Tarenaya hassleriana]
Length=781

 Score =   247 bits (630),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 138/162 (85%), Gaps = 1/162 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNL-TLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            DPE+N+++Q  LLKR+  TLSS+PLA+VGA VS IESLDYEINENDLFKHDWRSR +TQV
Sbjct  20   DPENNAVNQQPLLKRHTRTLSSTPLALVGANVSKIESLDYEINENDLFKHDWRSRKKTQV  79

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
            +QY+FLKW LA LVGLLTG+IATLINLA ENI G+KLLAV  +I +KRY+ G   F GAN
Sbjct  80   IQYIFLKWALACLVGLLTGLIATLINLAGENITGFKLLAVAHFISQKRYVAGLIIFTGAN  139

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
              LT VA+VLCV FAPTAAGP IPEIKAYLNGVDTPNMFGA+
Sbjct  140  LGLTLVAAVLCVCFAPTAAGPTIPEIKAYLNGVDTPNMFGAS  181



>ref|XP_006664534.1| PREDICTED: chloride channel protein CLC-a-like [Oryza brachyantha]
Length=784

 Score =   246 bits (628),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 138/166 (83%), Gaps = 6/166 (4%)
 Frame = +3

Query  132  RDPESN-----SLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSR  296
             DPES      SL QPLL KR+ TL++S LAMVGAKVS IESLDYEI ENDLFKHDWRSR
Sbjct  28   EDPESTGGPITSLEQPLL-KRSNTLTASHLAMVGAKVSRIESLDYEIIENDLFKHDWRSR  86

Query  297  SRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAY  476
            S  +VLQY+FLKW +AFL+GLLTG+IA+LINLA+ENI+G K+L +V  +  KRY  GF Y
Sbjct  87   SNVEVLQYIFLKWAMAFLIGLLTGVIASLINLAIENISGLKMLHMVQLVRDKRYWAGFLY  146

Query  477  FAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGA  614
            FAG NF LTFVA+VLCV FAPTAAGPGIPEIKAYLNGVDTPNMFGA
Sbjct  147  FAGINFGLTFVAAVLCVVFAPTAAGPGIPEIKAYLNGVDTPNMFGA  192



>ref|NP_001183936.1| chloride channel protein [Zea mays]
 gb|ACV66338.1| chloride channel protein [Zea mays]
Length=792

 Score =   246 bits (627),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 135/154 (88%), Gaps = 1/154 (1%)
 Frame = +3

Query  153  LHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  332
            L QPLL KR+ TL++S LA+VGAKVSHIESLDYEI ENDLFKHDWRSRS  +VLQY+FLK
Sbjct  55   LEQPLL-KRSTTLTASHLAIVGAKVSHIESLDYEIIENDLFKHDWRSRSNVEVLQYIFLK  113

Query  333  WTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVA  512
            W +AFLVGLLTG+IA+LINLA+ENI+G K+L +V+ +  KRY  GF YFAG NF LTFVA
Sbjct  114  WAMAFLVGLLTGVIASLINLAIENISGLKMLQMVNLVRGKRYWAGFLYFAGVNFALTFVA  173

Query  513  SVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGA  614
            +VLCV FAPTAAGPGIPEIKAYLNGVDTPNMFGA
Sbjct  174  AVLCVVFAPTAAGPGIPEIKAYLNGVDTPNMFGA  207



>ref|XP_008658999.1| PREDICTED: chloride channel protein isoform X1 [Zea mays]
 gb|AFW87643.1| chloride channel protein [Zea mays]
Length=801

 Score =   246 bits (627),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 135/154 (88%), Gaps = 1/154 (1%)
 Frame = +3

Query  153  LHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  332
            L QPLL KR+ TL++S LA+VGAKVSHIESLDYEI ENDLFKHDWRSRS  +VLQY+FLK
Sbjct  55   LEQPLL-KRSTTLTASHLAIVGAKVSHIESLDYEIIENDLFKHDWRSRSNVEVLQYIFLK  113

Query  333  WTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVA  512
            W +AFLVGLLTG+IA+LINLA+ENI+G K+L +V+ +  KRY  GF YFAG NF LTFVA
Sbjct  114  WAMAFLVGLLTGVIASLINLAIENISGLKMLQMVNLVRGKRYWAGFLYFAGVNFALTFVA  173

Query  513  SVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGA  614
            +VLCV FAPTAAGPGIPEIKAYLNGVDTPNMFGA
Sbjct  174  AVLCVVFAPTAAGPGIPEIKAYLNGVDTPNMFGA  207



>ref|XP_004962545.1| PREDICTED: chloride channel protein CLC-a-like isoform X2 [Setaria 
italica]
Length=794

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 138/167 (83%), Gaps = 7/167 (4%)
 Frame = +3

Query  132  RDPES------NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRS  293
             DPES      +SL QPLL KR+ TL++S LA+VGAKVSHIESLDYEI ENDLFKHDWRS
Sbjct  35   EDPESTAGNGISSLEQPLL-KRSPTLTASHLAIVGAKVSHIESLDYEIIENDLFKHDWRS  93

Query  294  RSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFA  473
            RS  +VLQY+FLKW +AFLVGLLTG+IA+LINLA+ENI G K+L +V  + + RY  GF 
Sbjct  94   RSNVEVLQYIFLKWAMAFLVGLLTGVIASLINLAIENITGLKMLHMVGLVREGRYWAGFL  153

Query  474  YFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGA  614
            YFAG N  LTFVA+VLCV FAPTAAGPGIPEIKAYLNGVDTPNMFGA
Sbjct  154  YFAGVNLALTFVAAVLCVVFAPTAAGPGIPEIKAYLNGVDTPNMFGA  200



>ref|XP_010929772.1| PREDICTED: chloride channel protein CLC-b-like [Elaeis guineensis]
Length=795

 Score =   245 bits (625),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 135/164 (82%), Gaps = 7/164 (4%)
 Frame = +3

Query  144  SNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYV  323
            S SLHQPLL KR  TL+++ LAMVGAKVSHIESLDYEINENDLFKHDWRSRS  QVLQYV
Sbjct  31   SISLHQPLL-KRTPTLTTNHLAMVGAKVSHIESLDYEINENDLFKHDWRSRSSVQVLQYV  89

Query  324  FLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKK------RYLMGFAYFAG  485
            FLKW LAFLVGLLTG IA+LINLA+ENIAG K+L V  +   +      RY+ GF YF G
Sbjct  90   FLKWMLAFLVGLLTGAIASLINLAIENIAGIKMLLVGQFCKPEIGIVWCRYINGFIYFTG  149

Query  486  ANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
            ANF LT VA+ LCV FAPTAAGPGIPEIKAYLNGVDTPNMFGA+
Sbjct  150  ANFALTMVAATLCVMFAPTAAGPGIPEIKAYLNGVDTPNMFGAS  193



>ref|XP_003576525.1| PREDICTED: chloride channel protein CLC-a-like [Brachypodium 
distachyon]
Length=790

 Score =   244 bits (623),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 137/168 (82%), Gaps = 9/168 (5%)
 Frame = +3

Query  132  RDPESN--------SLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDW  287
             DPE+         SL QPLL KR+ TL++S LAMVGAKVSHIESLDYEI ENDLFKHDW
Sbjct  36   EDPENQESGNGGIRSLEQPLL-KRSNTLTASHLAMVGAKVSHIESLDYEIIENDLFKHDW  94

Query  288  RSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMG  467
            R RS  +VLQY+FLKW LAFLVGLLTG+IA+LINLA+ENI+G K+L +V  +  KRY  G
Sbjct  95   RRRSNGEVLQYIFLKWALAFLVGLLTGVIASLINLAIENISGLKMLHMVQLVRDKRYWAG  154

Query  468  FAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFG  611
            F YF+G NF LTFVA+VLCV FAPTAAGPGIPEIKAYLNGVDTPNMFG
Sbjct  155  FLYFSGINFALTFVAAVLCVVFAPTAAGPGIPEIKAYLNGVDTPNMFG  202



>ref|XP_004962544.1| PREDICTED: chloride channel protein CLC-a-like isoform X1 [Setaria 
italica]
Length=876

 Score =   245 bits (625),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 138/167 (83%), Gaps = 7/167 (4%)
 Frame = +3

Query  132  RDPES------NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRS  293
             DPES      +SL QPLL KR+ TL++S LA+VGAKVSHIESLDYEI ENDLFKHDWRS
Sbjct  35   EDPESTAGNGISSLEQPLL-KRSPTLTASHLAIVGAKVSHIESLDYEIIENDLFKHDWRS  93

Query  294  RSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFA  473
            RS  +VLQY+FLKW +AFLVGLLTG+IA+LINLA+ENI G K+L +V  + + RY  GF 
Sbjct  94   RSNVEVLQYIFLKWAMAFLVGLLTGVIASLINLAIENITGLKMLHMVGLVREGRYWAGFL  153

Query  474  YFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGA  614
            YFAG N  LTFVA+VLCV FAPTAAGPGIPEIKAYLNGVDTPNMFGA
Sbjct  154  YFAGVNLALTFVAAVLCVVFAPTAAGPGIPEIKAYLNGVDTPNMFGA  200



>dbj|BAJ91019.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=782

 Score =   244 bits (622),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 139/166 (84%), Gaps = 6/166 (4%)
 Frame = +3

Query  132  RDPES-----NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSR  296
             DP S     +SL QPLL KR+ TL+++ LAMVGAKVSHIESLDYEI ENDLFKHDWRSR
Sbjct  24   EDPVSTGNGISSLQQPLL-KRSNTLTANHLAMVGAKVSHIESLDYEIIENDLFKHDWRSR  82

Query  297  SRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAY  476
            S  +VLQYVFLKW LAFLVGLLTG+IA+LINLA+ENI+G K+L +V  + +KRY  GF Y
Sbjct  83   STVEVLQYVFLKWALAFLVGLLTGVIASLINLAIENISGIKMLHMVQLVREKRYWAGFFY  142

Query  477  FAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGA  614
            F+G N  LTFVA+VLCV FAPTAAGPGIPEIKAYLNGVDTPNMFGA
Sbjct  143  FSGFNLALTFVAAVLCVVFAPTAAGPGIPEIKAYLNGVDTPNMFGA  188



>ref|XP_009140242.1| PREDICTED: chloride channel protein CLC-a [Brassica rapa]
Length=776

 Score =   243 bits (621),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 140/161 (87%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPE+N+++QPLL KR+ TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWRSRS+ QV 
Sbjct  21   DPENNTMNQPLL-KRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRSRSKAQVF  79

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+F KWTLA LVGLLTG+IATLINLAVENIAGYKLLAV  YI + RYL G   F GAN 
Sbjct  80   QYIFAKWTLACLVGLLTGLIATLINLAVENIAGYKLLAVGYYIAQDRYLTGLLIFTGANL  139

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             LT VA+VL V FAPTAAGPGIPEIKAYLNGVDTPNMFGAT
Sbjct  140  GLTLVATVLVVVFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  180



>emb|CDY15925.1| BnaA04g11860D [Brassica napus]
Length=776

 Score =   243 bits (620),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 140/161 (87%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPE+N+++QPLL KR+ TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWRSRS+ QV 
Sbjct  21   DPENNTMNQPLL-KRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRSRSKAQVF  79

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+F KWTLA LVGLLTG+IATLINLAVENIAGYKLLAV  YI + RYL G   F GAN 
Sbjct  80   QYIFAKWTLACLVGLLTGLIATLINLAVENIAGYKLLAVGYYIAQDRYLTGLLIFTGANL  139

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             LT VA+VL V FAPTAAGPGIPEIKAYLNGVDTPNMFGAT
Sbjct  140  GLTLVATVLVVVFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  180



>ref|XP_006405416.1| hypothetical protein EUTSA_v10027650mg [Eutrema salsugineum]
 gb|ESQ46869.1| hypothetical protein EUTSA_v10027650mg [Eutrema salsugineum]
Length=776

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 140/161 (87%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPE+N+++QPLL KR+ TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWRSRS+ QV 
Sbjct  21   DPENNTMNQPLL-KRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRSRSKAQVY  79

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+F KWTLA LVGLLTG+IATLINLAVENIAGYKLLAV  YI + RY+ G   F GAN 
Sbjct  80   QYIFAKWTLACLVGLLTGLIATLINLAVENIAGYKLLAVGYYIGQDRYVTGLLIFTGANL  139

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             LT VA+VL V FAPTAAGPGIPEIKAYLNGVDTPNMFGAT
Sbjct  140  GLTLVATVLVVVFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  180



>gb|ADD09860.1| chloride channel A [Eutrema halophilum]
Length=776

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 140/161 (87%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPE+N+++QPLL KR+ TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWRSRS+ QV 
Sbjct  21   DPENNTMNQPLL-KRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRSRSKAQVY  79

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+F KWTLA LVGLLTG+IATLINLAVENIAGYKLLAV  YI + RY+ G   F GAN 
Sbjct  80   QYIFAKWTLACLVGLLTGLIATLINLAVENIAGYKLLAVGYYIGQDRYVTGLLIFTGANL  139

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             LT VA+VL V FAPTAAGPGIPEIKAYLNGVDTPNMFGAT
Sbjct  140  GLTLVATVLVVVFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  180



>ref|XP_010441254.1| PREDICTED: chloride channel protein CLC-a [Camelina sativa]
Length=775

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 139/161 (86%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPE+N+L+QPLL KR+ TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWRSRS+ QV 
Sbjct  22   DPENNTLNQPLL-KRHRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKAQVF  80

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+FLKWTLA LVGL TG+IATLINLAVENIAGYKLLAV  YI + R+  G   F GAN 
Sbjct  81   QYIFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGYYIAQDRFWTGLMVFTGANL  140

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             LT VA+VL V FAPTAAGPGIPEIKAYLNG+DTPNMFG T
Sbjct  141  GLTLVATVLVVVFAPTAAGPGIPEIKAYLNGIDTPNMFGFT  181



>ref|XP_010436030.1| PREDICTED: chloride channel protein CLC-a-like [Camelina sativa]
Length=775

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 139/161 (86%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPE+N+L+QPLL KR+ TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWRSRS+ QV 
Sbjct  22   DPENNTLNQPLL-KRHRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKAQVF  80

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+FLKWTLA LVGL TG+IATLINLAVENIAGYKLLAV  YI + R+  G   F GAN 
Sbjct  81   QYIFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGYYIAQDRFWTGLMVFTGANL  140

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             LT VA+VL V FAPTAAGPGIPEIKAYLNG+DTPNMFG T
Sbjct  141  GLTLVATVLVVVFAPTAAGPGIPEIKAYLNGIDTPNMFGFT  181



>ref|XP_010450591.1| PREDICTED: chloride channel protein CLC-a [Camelina sativa]
Length=775

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 139/161 (86%), Gaps = 1/161 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            DPE+N+L+QPLL KR+ TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWRSRS+ QV 
Sbjct  22   DPENNTLNQPLL-KRHRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKAQVF  80

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+FLKWTLA LVGL TG+IATLINLAVENIAGYKLLAV  YI + R+  G   F GAN 
Sbjct  81   QYIFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGYYIAQDRFWTGLMVFTGANL  140

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             LT VA+VL V FAPTAAGPGIPEIKAYLNG+DTPNMFG T
Sbjct  141  GLTLVATVLVVVFAPTAAGPGIPEIKAYLNGIDTPNMFGFT  181



>gb|KDO43323.1| hypothetical protein CISIN_1g0039661mg, partial [Citrus sinensis]
Length=134

 Score =   218 bits (555),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +3

Query  252  EINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAV  431
             INENDLFKHDWRSRS+ QVLQY+FLKW+LA LVGLLTG+IATLINLAVENIAGYKLLAV
Sbjct  8    RINENDLFKHDWRSRSKVQVLQYIFLKWSLACLVGLLTGLIATLINLAVENIAGYKLLAV  67

Query  432  VDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFG  611
            V +I+K RYL GF YF G NF+LT VA+VLCV FAPTAAGPGIPEIKAYLNGVDTPNMFG
Sbjct  68   VSFIEKDRYLQGFLYFTGVNFLLTLVAAVLCVCFAPTAAGPGIPEIKAYLNGVDTPNMFG  127

Query  612  AT  617
            AT
Sbjct  128  AT  129



>gb|KEH25446.1| ClC chloride channel family protein [Medicago truncatula]
Length=722

 Score =   216 bits (549),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +3

Query  252  EINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAV  431
             INENDLFK DWRSRSR QV+QY+ LKW LAFLVGLLTG+IATLINLAVENI+GYKLL V
Sbjct  7    RINENDLFKQDWRSRSRGQVMQYIILKWLLAFLVGLLTGVIATLINLAVENISGYKLLTV  66

Query  432  VDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFG  611
            V YI ++RYLMGF YF G NF+LTF+AS+LCV FAPTAAGPGIPEIKAYLNGVDTPNM+G
Sbjct  67   VGYIQQERYLMGFLYFLGTNFLLTFIASILCVCFAPTAAGPGIPEIKAYLNGVDTPNMYG  126

Query  612  AT  617
            AT
Sbjct  127  AT  128



>gb|EMS65031.1| Chloride channel protein CLC-b [Triticum urartu]
Length=518

 Score =   186 bits (471),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 119/162 (73%), Gaps = 11/162 (7%)
 Frame = +3

Query  60   MEEQYAESATTIAMAGQaeeeeaeRDPES-----NSLHQPLLLKRNLTLSSSPLAMVGAK  224
            MEE+ A +A       + ++     DP S     +SL QPLL K N TL+++ LAMVGAK
Sbjct  1    MEEETATTA-----GRKHDDGVDSEDPGSAGNGISSLEQPLLKKSN-TLTANHLAMVGAK  54

Query  225  VSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVEN  404
            VSHIESLDYEI ENDLFKHDWRSRS  +VLQYVFLKW LAFLVGLLTG+IA+LINLA+EN
Sbjct  55   VSHIESLDYEIIENDLFKHDWRSRSTVEVLQYVFLKWALAFLVGLLTGVIASLINLAIEN  114

Query  405  IAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVF  530
            I+G K+L +V  +  KRY  GF YF+G N  LTFVA+VLC F
Sbjct  115  ISGVKMLHMVRLVRDKRYWAGFFYFSGFNLALTFVAAVLCAF  156



>gb|EEC77341.1| hypothetical protein OsI_16021 [Oryza sativa Indica Group]
Length=350

 Score =   174 bits (442),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 103/153 (67%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            D       QPLL KR +  ++S +A+VGA V  IESLDYEI ENDLFK DWRSR + Q+ 
Sbjct  51   DEAGGGPRQPLLRKRTMN-TTSQIAIVGANVCPIESLDYEIVENDLFKQDWRSRKKKQIF  109

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+ LKW L  L+G+LTGI+    NLAVENIAG KLL   D + K+RY   F  + G N 
Sbjct  110  QYIVLKWALVLLIGMLTGIVGFFNNLAVENIAGLKLLLTSDLMLKQRYFTAFLAYGGCNL  169

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            VL   A+ +C + AP AAG GIPE+KAYLNGVD
Sbjct  170  VLATTAAAICAYIAPAAAGSGIPEVKAYLNGVD  202



>ref|XP_010250239.1| PREDICTED: putative chloride channel-like protein CLC-g [Nelumbo 
nucifera]
Length=776

 Score =   180 bits (457),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 114/165 (69%), Gaps = 7/165 (4%)
 Frame = +3

Query  135  DPESNSLHQPLL-------LKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRS  293
            D E+  L +PLL       L+R+ + ++S +A+VG+ V  IESLDYEI END FK DWRS
Sbjct  6    DEEAPPLTEPLLNNHLQFQLRRSASNTTSQVAIVGSNVCPIESLDYEIIENDFFKQDWRS  65

Query  294  RSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFA  473
            R + Q+ QY+F+KW+L FL+GL  G++  LINLAVENIAG K +   + + +KRY   F 
Sbjct  66   RGKIQIFQYIFMKWSLCFLIGLFAGLVGFLINLAVENIAGIKFVITSNMMLEKRYATAFG  125

Query  474  YFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
             FA +NFVL   +SV+  F AP AAG GIPE+KAYLNGVD P +F
Sbjct  126  VFAASNFVLILFSSVITTFIAPAAAGSGIPEVKAYLNGVDAPGIF  170



>ref|NP_001268053.1| uncharacterized protein LOC100245380 [Vitis vinifera]
 gb|ADK66979.1| chloride channel ClC1 [Vitis vinifera]
Length=771

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 111/151 (74%), Gaps = 1/151 (1%)
 Frame = +3

Query  141  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  320
            +  ++ +PLL+++ L  S+S +A+VGA V  IESLDYEI EN+LFK DWRSR R Q+ QY
Sbjct  32   KDTAMREPLLVRKRLN-STSQIAIVGASVCPIESLDYEIVENELFKQDWRSRKRVQIFQY  90

Query  321  VFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVL  500
            + LKWTLA L+GL TG++    NLAVENIAG+KLL   + + K +Y + F  FAG N VL
Sbjct  91   IVLKWTLALLIGLGTGLVGFFNNLAVENIAGFKLLLASNLMLKDKYGLAFVTFAGCNMVL  150

Query  501  TFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
               A+VLC + AP+AAG GIPE+KAYLNG+D
Sbjct  151  AIAAAVLCAYIAPSAAGSGIPEVKAYLNGID  181



>ref|XP_010657885.1| PREDICTED: uncharacterized protein LOC100245380 isoform X1 [Vitis 
vinifera]
Length=777

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 111/151 (74%), Gaps = 1/151 (1%)
 Frame = +3

Query  141  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  320
            +  ++ +PLL+++ L  S+S +A+VGA V  IESLDYEI EN+LFK DWRSR R Q+ QY
Sbjct  32   KDTAMREPLLVRKRLN-STSQIAIVGASVCPIESLDYEIVENELFKQDWRSRKRVQIFQY  90

Query  321  VFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVL  500
            + LKWTLA L+GL TG++    NLAVENIAG+KLL   + + K +Y + F  FAG N VL
Sbjct  91   IVLKWTLALLIGLGTGLVGFFNNLAVENIAGFKLLLASNLMLKDKYGLAFVTFAGCNMVL  150

Query  501  TFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
               A+VLC + AP+AAG GIPE+KAYLNG+D
Sbjct  151  AIAAAVLCAYIAPSAAGSGIPEVKAYLNGID  181



>ref|XP_009618449.1| PREDICTED: chloride channel protein CLC-c-like [Nicotiana tomentosiformis]
Length=782

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/185 (48%), Positives = 115/185 (62%), Gaps = 7/185 (4%)
 Frame = +3

Query  60   MEEQYAESATTIAMAGQaeeeeaeRDPESN-------SLHQPLLLKRNLTLSSSPLAMVG  218
            ME+Q                 E  +D E N        + QPLL  ++   ++S +A++G
Sbjct  1    MEDQGDIENEGGGGGIGVMIMENGKDLERNISAVSESGVRQPLLSSKSRVNNTSQIAIIG  60

Query  219  AKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAV  398
            A V  IESLDYEI ENDLFK DWRSR + Q+ QY+FLKWTL  L+GL  G++   +N+AV
Sbjct  61   ANVCPIESLDYEIIENDLFKQDWRSRKKVQIFQYIFLKWTLVLLIGLSVGLVGFFLNIAV  120

Query  399  ENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAY  578
            ENIAG+KLL + D + + +Y  GFA +A  N VL   A +LC F AP AAG GIPE+KAY
Sbjct  121  ENIAGFKLLLISDLMLQDKYFRGFAAYACCNLVLATCAGILCAFIAPAAAGSGIPEVKAY  180

Query  579  LNGVD  593
            LNG+D
Sbjct  181  LNGID  185



>emb|CBI29647.3| unnamed protein product [Vitis vinifera]
Length=742

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 109/147 (74%), Gaps = 1/147 (1%)
 Frame = +3

Query  153  LHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  332
            + +PLL+++ L  S+S +A+VGA V  IESLDYEI EN+LFK DWRSR R Q+ QY+ LK
Sbjct  1    MREPLLVRKRLN-STSQIAIVGASVCPIESLDYEIVENELFKQDWRSRKRVQIFQYIVLK  59

Query  333  WTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVA  512
            WTLA L+GL TG++    NLAVENIAG+KLL   + + K +Y + F  FAG N VL   A
Sbjct  60   WTLALLIGLGTGLVGFFNNLAVENIAGFKLLLASNLMLKDKYGLAFVTFAGCNMVLAIAA  119

Query  513  SVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            +VLC + AP+AAG GIPE+KAYLNG+D
Sbjct  120  AVLCAYIAPSAAGSGIPEVKAYLNGID  146



>emb|CDO97645.1| unnamed protein product [Coffea canephora]
Length=816

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = +3

Query  153  LHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  332
            L +PLL  ++   ++S +A+VGA VS IESLDYEI EN+LFK DWRSR + ++ QYVFLK
Sbjct  67   LREPLLKSKSRINTTSQIAIVGANVSPIESLDYEIIENELFKQDWRSRKKVEIYQYVFLK  126

Query  333  WTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVA  512
            WTLA L+GL TG++    NLAVENIAG+K L   + + K +Y + FA +AG N VL   A
Sbjct  127  WTLALLIGLCTGLVGFFNNLAVENIAGFKFLLTNNLMLKHQYFLAFAAYAGCNVVLAVCA  186

Query  513  SVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            +VLC F AP AAG GIPE+KAYLNGVD
Sbjct  187  AVLCAFIAPAAAGSGIPEVKAYLNGVD  213



>ref|XP_010682061.1| PREDICTED: chloride channel protein CLC-c-like [Beta vulgaris 
subsp. vulgaris]
Length=781

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 119/188 (63%), Gaps = 15/188 (8%)
 Frame = +3

Query  36   DLRVSASRMEE--QYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLA  209
            D++V  +R  E     E  TT++  G             +   QPLL KR  T  +S LA
Sbjct  11   DIKVERTRSFEYGTNTEVVTTLSRYGS-----------DDEFKQPLLRKR--TNQTSQLA  57

Query  210  MVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLIN  389
            +VGA VS IESLDYEI EN+L K DWRS    ++ QY+F KWT+A L+GL TG+I    N
Sbjct  58   IVGANVSPIESLDYEIMENELLKEDWRSMKNFEIFQYIFFKWTMALLIGLCTGLIGFCNN  117

Query  390  LAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEI  569
            + VENIAG+K L  ++Y+ +++Y+ GF YFAG N +L  V + LC + AP AAG GIPE+
Sbjct  118  IGVENIAGFKFLQTINYVRQEKYVKGFTYFAGCNLLLATVTAALCAYIAPAAAGSGIPEV  177

Query  570  KAYLNGVD  593
            KAYLNGVD
Sbjct  178  KAYLNGVD  185



>gb|EYU35026.1| hypothetical protein MIMGU_mgv1a001577mg [Erythranthe guttata]
Length=791

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 109/153 (71%), Gaps = 0/153 (0%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            D E  ++ +PLL  R+   ++S +A+VGAKV  IESLDYEI EN+L K DWR+R R ++ 
Sbjct  43   DREGGAVREPLLNLRSRVNTTSQIAIVGAKVYPIESLDYEIFENELIKQDWRTRKRIEIF  102

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QYVFLKWTLA L+GL TG++    NLAVENIAG KLL   + + K++Y   FA FAG N 
Sbjct  103  QYVFLKWTLALLIGLFTGVVGFFNNLAVENIAGVKLLITSNLMLKEKYYQAFAAFAGINM  162

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            +L   A+ LC F AP AAG GIPE+KAYLNGVD
Sbjct  163  ILAVSAAALCAFIAPAAAGSGIPEVKAYLNGVD  195



>ref|XP_009791971.1| PREDICTED: chloride channel protein CLC-c-like [Nicotiana sylvestris]
 emb|CAA64829.1| C1C-Nt1 [Nicotiana tabacum]
Length=780

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 107/151 (71%), Gaps = 0/151 (0%)
 Frame = +3

Query  141  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  320
              + + QPLL  ++   ++S +A++GA V  IESLDYEI ENDLFK DWRSR + Q+ QY
Sbjct  33   SESGVRQPLLSSKSRVNNTSQIAIIGANVCPIESLDYEIIENDLFKQDWRSRKKVQIFQY  92

Query  321  VFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVL  500
            +FLKWTL  L+GL  G++   +N+AVENIAG+KLL + D + + +Y  GFA +A  N VL
Sbjct  93   IFLKWTLVLLIGLSVGLVGFFLNIAVENIAGFKLLLISDLMLQDKYFRGFAAYACCNLVL  152

Query  501  TFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
               A +LC F AP AAG GIPE+KAYLNG+D
Sbjct  153  ATCAGILCAFIAPAAAGSGIPEVKAYLNGID  183



>ref|XP_006402220.1| hypothetical protein EUTSA_v10012744mg [Eutrema salsugineum]
 gb|ESQ43673.1| hypothetical protein EUTSA_v10012744mg [Eutrema salsugineum]
Length=775

 Score =   177 bits (449),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 108/151 (72%), Gaps = 0/151 (0%)
 Frame = +3

Query  141  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  320
            + + ++QPLL  RN   ++S +A+VGA    IESLDYEI ENDLFK DWRSR + ++LQY
Sbjct  29   DGSVVYQPLLASRNRKNTTSQIAIVGANTCPIESLDYEIFENDLFKQDWRSRKKIEILQY  88

Query  321  VFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVL  500
              LKW LAFL+GL TG++  L NLAVENIAG+KLL   + + K++Y   F  F+G N +L
Sbjct  89   TILKWALAFLIGLSTGLVGFLNNLAVENIAGFKLLLTGNLMLKEKYFQAFFAFSGCNLIL  148

Query  501  TFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
               A+ LC F AP AAG GIPE+KAYLNG+D
Sbjct  149  ATAAASLCAFIAPAAAGSGIPEVKAYLNGID  179



>gb|ADD09861.1| chloride channel C [Eutrema halophilum]
Length=775

 Score =   177 bits (449),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 108/151 (72%), Gaps = 0/151 (0%)
 Frame = +3

Query  141  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  320
            + + ++QPLL  RN   ++S +A+VGA    IESLDYEI ENDLFK DWRSR + ++LQY
Sbjct  29   DGSVVYQPLLASRNRKNTTSQIAIVGANTCPIESLDYEIFENDLFKQDWRSRKKIEILQY  88

Query  321  VFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVL  500
              LKW LAFL+GL TG++  L NLAVENIAG+KLL   + + K++Y   F  F+G N +L
Sbjct  89   TILKWALAFLIGLSTGLVGFLNNLAVENIAGFKLLLTGNLMLKEKYFQAFFAFSGCNLIL  148

Query  501  TFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
               A+ LC F AP AAG GIPE+KAYLNG+D
Sbjct  149  ATAAASLCAFIAPAAAGSGIPEVKAYLNGID  179



>ref|XP_002865761.1| CLC-C [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42020.1| CLC-C [Arabidopsis lyrata subsp. lyrata]
Length=778

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 112/179 (63%), Gaps = 1/179 (1%)
 Frame = +3

Query  57   RMEEQYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHI  236
            R EE +       A  G   +     D  S    QPLL  RN   ++S +A+VGA    I
Sbjct  4    RSEEDHDIEVEGGAFQGYERKISGILDDGSVGFRQPLL-ARNRKNTTSQIAIVGANSCPI  62

Query  237  ESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGY  416
            ESLDYEI END FK DWRSR + ++LQY FLKW LAFL+GL TG++  L NL VENIAG+
Sbjct  63   ESLDYEIFENDFFKQDWRSRKKIEILQYTFLKWALAFLIGLATGLVGFLNNLGVENIAGF  122

Query  417  KLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            KLL +   + K++Y   F  FAG N +L   A+ LC F AP AAG GIPE+KAYLNG+D
Sbjct  123  KLLLIGYLMAKEKYFQAFFAFAGCNLILATAAASLCAFIAPAAAGSGIPEVKAYLNGID  181



>ref|NP_199800.1| chloride channel protein CLC-c [Arabidopsis thaliana]
 sp|Q96282.1|CLCC_ARATH RecName: Full=Chloride channel protein CLC-c; Short=AtCLC-c; 
AltName: Full=CBS domain-containing protein CBSCLC4 [Arabidopsis 
thaliana]
 emb|CAA70310.1| chloride channel [Arabidopsis thaliana]
 emb|CAA96059.1| CLC-c chloride channel protein [Arabidopsis thaliana]
 dbj|BAA97010.1| chloride channel [Arabidopsis thaliana]
 gb|AAM53312.1| chloride channel [Arabidopsis thaliana]
 gb|AAN65098.1| chloride channel [Arabidopsis thaliana]
 gb|AED95868.1| chloride channel protein CLC-c [Arabidopsis thaliana]
Length=779

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            D  S    QPLL  RN   ++S +A+VGA    IESLDYEI END FK DWRSR + ++L
Sbjct  31   DDGSVGFRQPLL-ARNRKNTTSQIAIVGANTCPIESLDYEIFENDFFKQDWRSRKKIEIL  89

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY FLKW LAFL+GL TG++  L NL VENIAG+KLL + + + K++Y   F  FAG N 
Sbjct  90   QYTFLKWALAFLIGLATGLVGFLNNLGVENIAGFKLLLIGNLMLKEKYFQAFFAFAGCNL  149

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            +L   A+ LC F AP AAG GIPE+KAYLNG+D
Sbjct  150  ILATAAASLCAFIAPAAAGSGIPEVKAYLNGID  182



>ref|XP_010442463.1| PREDICTED: chloride channel protein CLC-c [Camelina sativa]
Length=777

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            D  S    QPLL  RN   ++S +A+VGA    IESLDYEI END FK DWRSR + ++L
Sbjct  29   DDGSVGFRQPLL-ARNRKNTTSQIAIVGANSCPIESLDYEIFENDFFKQDWRSRKKIEIL  87

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY FLKW LAFL+GL TG++  L NLAVENIAG+KLL   + + K++Y   F  FAG N 
Sbjct  88   QYTFLKWALAFLIGLATGVVGFLNNLAVENIAGFKLLLTGNLMLKEKYFQAFFAFAGCNL  147

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            +L   A+ LC F AP AAG GIPE+KAYLNG+D
Sbjct  148  ILATAAASLCAFIAPAAAGSGIPEVKAYLNGID  180



>ref|XP_010482284.1| PREDICTED: chloride channel protein CLC-c-like [Camelina sativa]
Length=778

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            D  S    QPLL  RN   ++S +A+VGA    IESLDYEI END FK DWRSR + ++L
Sbjct  30   DDGSVGFRQPLL-ARNRKNTTSQIAIVGANSCPIESLDYEIFENDFFKQDWRSRKKIEIL  88

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY FLKW LAFL+GL TG++  L NLAVENIAG+KLL   + + K++Y   F  FAG N 
Sbjct  89   QYTFLKWALAFLIGLATGVVGFLNNLAVENIAGFKLLLTGNLMLKEKYFQAFFAFAGCNL  148

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            +L   A+ LC F AP AAG GIPE+KAYLNG+D
Sbjct  149  ILATAAASLCAFIAPAAAGSGIPEVKAYLNGID  181



>ref|XP_009127371.1| PREDICTED: chloride channel protein CLC-c [Brassica rapa]
 emb|CDY16376.1| BnaA02g11800D [Brassica napus]
Length=775

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            D  S    QPLL  RN   ++S +A+VGA    IESLDYEI ENDLFK DWRSR + ++L
Sbjct  28   DDGSVGFQQPLL-ARNRKNTTSQIAIVGANTCPIESLDYEIFENDLFKQDWRSRKKIEIL  86

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY  LKW LAFL+GL TG++  L NLAVENIAG+KLL   + + K++Y   F  FAG N 
Sbjct  87   QYTILKWALAFLIGLATGLVGFLNNLAVENIAGFKLLLTGNLMLKEKYFQAFFAFAGCNL  146

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            +L   A+ LC F AP AAG GIPE+KAYLNG+D
Sbjct  147  ILATAAASLCAFIAPAAAGSGIPEVKAYLNGID  179



>emb|CDY21447.1| BnaC03g27500D [Brassica napus]
Length=775

 Score =   174 bits (442),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            D  S    QPLL  RN   ++S +A+VGA    IESLDYEI ENDLFK DWRSR + ++L
Sbjct  28   DDGSVGFQQPLL-ARNRKNTTSQIAIVGANTCPIESLDYEIFENDLFKQDWRSRKKIEIL  86

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY  LKW LAFL+GL TG++  L NLAVENIAG+KLL   + + K++Y   F  FAG N 
Sbjct  87   QYTILKWALAFLIGLSTGLVGFLNNLAVENIAGFKLLLTGNLMLKEKYFQAFFAFAGCNL  146

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            +L   A+ LC F AP AAG GIPE+KAYLNG+D
Sbjct  147  ILATAAASLCAFIAPAAAGSGIPEVKAYLNGID  179



>ref|XP_009134029.1| PREDICTED: chloride channel protein CLC-c [Brassica rapa]
Length=775

 Score =   174 bits (442),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            D  S    QPLL  RN   ++S +A+VGA    IESLDYEI ENDLFK DWRSR + ++L
Sbjct  28   DDGSVGFQQPLL-ARNRKNTTSQIAIVGANTCPIESLDYEIFENDLFKQDWRSRKKIEIL  86

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY  LKW LAFL+GL TG++  L NLAVENIAG+KLL   + + K++Y   F  FAG N 
Sbjct  87   QYTILKWALAFLIGLSTGLVGFLNNLAVENIAGFKLLLTGNLMLKEKYFQAFFAFAGCNL  146

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            +L   A+ LC F AP AAG GIPE+KAYLNG+D
Sbjct  147  ILATAAASLCAFIAPAAAGSGIPEVKAYLNGID  179



>gb|EEE60792.1| hypothetical protein OsJ_14377 [Oryza sativa Japonica Group]
Length=773

 Score =   174 bits (442),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 103/153 (67%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            D       QPLL KR +  ++S +A+VGA V  IESLDYEI ENDLFK DWRSR + Q+ 
Sbjct  25   DEAGGGPRQPLLRKRTMN-TTSQIAIVGANVCPIESLDYEIVENDLFKQDWRSRKKKQIF  83

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+ LKW L  L+G+LTGI+    NLAVENIAG KLL   D + K+RY   F  + G N 
Sbjct  84   QYIVLKWALVLLIGMLTGIVGFFNNLAVENIAGLKLLLTSDLMLKQRYFTAFLAYGGCNL  143

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            VL   A+ +C + AP AAG GIPE+KAYLNGVD
Sbjct  144  VLATTAAAICAYIAPAAAGSGIPEVKAYLNGVD  176



>emb|CDX83179.1| BnaA03g23270D [Brassica napus]
Length=775

 Score =   174 bits (442),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            D  S    QPLL  RN   ++S +A+VGA    IESLDYEI ENDLFK DWRSR + ++L
Sbjct  28   DDGSVGFQQPLL-ARNRKNTTSQIAIVGANTCPIESLDYEIFENDLFKQDWRSRKKIEIL  86

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY  LKW LAFL+GL TG++  L NLAVENIAG+KLL   + + K++Y   F  FAG N 
Sbjct  87   QYTILKWALAFLIGLSTGLVGFLNNLAVENIAGFKLLLTGNLMLKEKYFQAFFAFAGCNL  146

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            +L   A+ LC F AP AAG GIPE+KAYLNG+D
Sbjct  147  ILATAAASLCAFIAPAAAGSGIPEVKAYLNGID  179



>emb|CDX91539.1| BnaC02g16210D [Brassica napus]
Length=775

 Score =   174 bits (442),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 105/153 (69%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            D  S    QPLL  RN   ++S +A+VGA    IESLDYEI ENDLFK DWRSR + ++L
Sbjct  28   DDGSVGFQQPLL-ARNRKNTTSQIAIVGANTCPIESLDYEIFENDLFKQDWRSRKKIEIL  86

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY  LKW LAFL+GL TG++  L NLAVENIAG+KLL   + + K++Y   F  FAG N 
Sbjct  87   QYTILKWALAFLIGLATGLVGFLNNLAVENIAGFKLLLTGNLMLKEKYFQAFFAFAGCNL  146

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            +L   A  LC F AP AAG GIPE+KAYLNG+D
Sbjct  147  ILATAAGSLCAFIAPAAAGSGIPEVKAYLNGID  179



>ref|XP_006349289.1| PREDICTED: chloride channel protein CLC-c-like [Solanum tuberosum]
Length=776

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 106/151 (70%), Gaps = 0/151 (0%)
 Frame = +3

Query  141  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  320
             ++   +PLL  ++   ++S +A++GA V  IESLDY+I ENDLFK DWRSR + Q+ QY
Sbjct  30   SASGFREPLLKSKSRVNNTSQIAIIGANVCPIESLDYDIVENDLFKQDWRSRKKVQIYQY  89

Query  321  VFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVL  500
            +FLKWTL  L+GL TG++   +N+AVENIAG+KLL   D + + +Y   F  FAG N  L
Sbjct  90   IFLKWTLVLLIGLSTGLVGFFLNIAVENIAGFKLLLASDLMLEDKYFRAFGTFAGCNLGL  149

Query  501  TFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
               A++LC F AP AAG GIPE+KAYLNGVD
Sbjct  150  ATCAAILCAFIAPAAAGSGIPEVKAYLNGVD  180



>gb|EAY94258.1| hypothetical protein OsI_16029 [Oryza sativa Indica Group]
Length=803

 Score =   174 bits (442),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 103/153 (67%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            D       QPLL KR +  ++S +A+VGA V  IESLDYEI ENDLFK DWRSR + Q+ 
Sbjct  55   DEAGGGPRQPLLRKRTMN-TTSQIAIVGANVCPIESLDYEIVENDLFKQDWRSRKKKQIF  113

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+ LKW L  L+G+LTGI+    NLAVENIAG KLL   D + K+RY   F  + G N 
Sbjct  114  QYIVLKWALVLLIGMLTGIVGFFNNLAVENIAGLKLLLTSDLMLKQRYFTAFLAYGGCNL  173

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            VL   A+ +C + AP AAG GIPE+KAYLNGVD
Sbjct  174  VLATTAAAICAYIAPAAAGSGIPEVKAYLNGVD  206



>ref|XP_010441249.1| PREDICTED: chloride channel protein CLC-c-like [Camelina sativa]
Length=779

 Score =   174 bits (441),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            D  S    QPLL  RN   ++S +A+VGA    IESLDYEI END FK DWRSR + ++L
Sbjct  31   DDGSVGFRQPLL-ARNRKNTTSQIAIVGANSCPIESLDYEIFENDFFKQDWRSRKKIEIL  89

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY FLKW LAFL+GL TG++  L NLAVENIAG+KLL   + + K++Y   F  FAG N 
Sbjct  90   QYTFLKWALAFLIGLATGVVGFLNNLAVENIAGFKLLLTGNLMLKEKYFQAFFAFAGCNL  149

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            +L   A+ LC + AP AAG GIPE+KAYLNG+D
Sbjct  150  ILATAAASLCAYIAPAAAGSGIPEVKAYLNGID  182



>ref|XP_004230422.1| PREDICTED: chloride channel protein CLC-c [Solanum lycopersicum]
Length=776

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 108/159 (68%), Gaps = 5/159 (3%)
 Frame = +3

Query  132  RDPESN-----SLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSR  296
            +D E N        +PLL  ++   ++S +A++GA V  IESLDY+I ENDLFK DWRSR
Sbjct  22   KDLERNISSEGGFREPLLKSKSRVNNTSQIAIIGANVCPIESLDYDIVENDLFKQDWRSR  81

Query  297  SRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAY  476
             + Q+ QY+FLKWTL  L+GL TG++   +N+AVENIAG+KLL   D + + +Y   FA 
Sbjct  82   KKVQIYQYIFLKWTLVLLIGLFTGLVGFFLNIAVENIAGFKLLLASDLMLEDKYFRAFAI  141

Query  477  FAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            FAG N  L   A++LC   AP AAG GIPE+KAYLNGVD
Sbjct  142  FAGCNLGLATCAAILCACIAPAAAGSGIPEVKAYLNGVD  180



>ref|XP_006280044.1| hypothetical protein CARUB_v10025921mg [Capsella rubella]
 gb|EOA12942.1| hypothetical protein CARUB_v10025921mg [Capsella rubella]
Length=776

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 105/153 (69%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            D  S    QPLL  RN   ++S +A+VGA    IESLDYEI END FK DWRSR + ++L
Sbjct  29   DDGSVGFQQPLL-ARNRKNTTSQIAIVGANTCPIESLDYEIFENDFFKQDWRSRKKIEIL  87

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY FLKW LAFL+GL TG++  L NL VENIAG+KLL   + + K++Y   F  FAG N 
Sbjct  88   QYTFLKWALAFLIGLATGLVGFLNNLGVENIAGFKLLLTGNLMLKEKYFQAFFAFAGCNL  147

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            +L   A+ LC + AP AAG GIPE+KAYLNG+D
Sbjct  148  ILATAAASLCAYIAPAAAGSGIPEVKAYLNGID  180



>ref|XP_006652320.1| PREDICTED: chloride channel protein CLC-c-like [Oryza brachyantha]
Length=803

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 102/153 (67%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            D       QPLL KR +  ++S +A+VGA V  IESLDYEI ENDLFK DWRSR + Q+ 
Sbjct  55   DEGDGGPRQPLLRKRTIN-TTSQIAIVGANVCPIESLDYEIVENDLFKQDWRSRKKKQIF  113

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+ LKW L  L+G+ TGI+    NLAVENIAG KLL   D + K+RY   F  + G N 
Sbjct  114  QYIVLKWALVLLIGMSTGIVGFFNNLAVENIAGLKLLLTSDLMLKQRYFTAFLAYGGCNL  173

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            VL   AS +C + AP AAG GIPE+KAYLNGVD
Sbjct  174  VLAATASAICAYIAPAAAGSGIPEVKAYLNGVD  206



>ref|NP_001267998.1| uncharacterized protein LOC100255837 [Vitis vinifera]
 gb|ADK66983.1| chloride channel ClC5 [Vitis vinifera]
Length=770

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 110/161 (68%), Gaps = 5/161 (3%)
 Frame = +3

Query  135  DPESNSLHQPLL---LKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRT  305
            D ES +  QPLL   L R+L+  +S +A+VG+ V  IESLDYEI END FK DWRSR + 
Sbjct  8    DEESQA--QPLLDPSLHRSLSNVTSQVAIVGSNVCPIESLDYEIYENDFFKQDWRSRGKV  65

Query  306  QVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAG  485
            Q+ QY+F+KW L FL+GL+  +I    NLAVEN+AG K +   + +  KRY M F  F  
Sbjct  66   QIFQYIFVKWLLCFLIGLIVSLIGFCNNLAVENLAGVKFVITSNMMLVKRYGMAFLVFFS  125

Query  486  ANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            +NFVLT  AS++  F AP AAG GIPE+KAYLNGVD P +F
Sbjct  126  SNFVLTLFASIITAFIAPAAAGSGIPEVKAYLNGVDAPGIF  166



>ref|XP_010656505.1| PREDICTED: uncharacterized protein LOC100255837 isoform X1 [Vitis 
vinifera]
 emb|CBI25542.3| unnamed protein product [Vitis vinifera]
Length=772

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 110/161 (68%), Gaps = 5/161 (3%)
 Frame = +3

Query  135  DPESNSLHQPLL---LKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRT  305
            D ES +  QPLL   L R+L+  +S +A+VG+ V  IESLDYEI END FK DWRSR + 
Sbjct  8    DEESQA--QPLLDPSLHRSLSNVTSQVAIVGSNVCPIESLDYEIYENDFFKQDWRSRGKV  65

Query  306  QVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAG  485
            Q+ QY+F+KW L FL+GL+  +I    NLAVEN+AG K +   + +  KRY M F  F  
Sbjct  66   QIFQYIFVKWLLCFLIGLIVSLIGFCNNLAVENLAGVKFVITSNMMLVKRYGMAFLVFFS  125

Query  486  ANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            +NFVLT  AS++  F AP AAG GIPE+KAYLNGVD P +F
Sbjct  126  SNFVLTLFASIITAFIAPAAAGSGIPEVKAYLNGVDAPGIF  166



>ref|XP_011087632.1| PREDICTED: chloride channel protein CLC-c [Sesamum indicum]
Length=789

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 106/150 (71%), Gaps = 0/150 (0%)
 Frame = +3

Query  144  SNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYV  323
            S S  +PLL  ++   ++S +A+VG+KV  IESLDYEI EN+L K DWRSR R ++ QY+
Sbjct  41   SESAREPLLHLKSRVNTTSQIAIVGSKVYPIESLDYEIFENELIKQDWRSRKRVEIFQYI  100

Query  324  FLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLT  503
            FLKWTLA  +GL TG++    N+AVENIAG+KLL   + +   +Y   FA +AG N +L 
Sbjct  101  FLKWTLALCIGLFTGLVGFFNNIAVENIAGFKLLLTSNLMLNAKYFQAFAAYAGINVILA  160

Query  504  FVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            F A+ LC F AP AAG GIPE+KAYLNGVD
Sbjct  161  FSAAALCAFIAPAAAGSGIPEVKAYLNGVD  190



>gb|EMT27046.1| Chloride channel protein CLC-c [Aegilops tauschii]
Length=768

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 105/151 (70%), Gaps = 1/151 (1%)
 Frame = +3

Query  141  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  320
            + +   +PLL KR +  ++S +A+VGA V  IESLDYEI ENDLFK DWRSR + Q+ QY
Sbjct  59   DDDGPREPLLRKRTMN-TTSQIAIVGANVFAIESLDYEIVENDLFKQDWRSRKKNQIFQY  117

Query  321  VFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVL  500
            V LKW L  L+GLLTG++    NLAVENIAG+KL+   D + +KRY   F  + G N VL
Sbjct  118  VVLKWALVLLIGLLTGLVGFFNNLAVENIAGFKLVLTGDLMLQKRYFTAFLAYGGCNLVL  177

Query  501  TFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
               A+ LC + AP AAG GIPE+KAYLNGVD
Sbjct  178  GATAAALCAYIAPAAAGSGIPEVKAYLNGVD  208



>ref|XP_009586704.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Nicotiana tomentosiformis]
Length=788

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 110/161 (68%), Gaps = 3/161 (2%)
 Frame = +3

Query  135  DPESNSLHQPLLL---KRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRT  305
            + +  SL QPLLL   +R+ + ++S +A+VG+ V  IESLDYEI+END FK DWR R + 
Sbjct  22   EADEESLTQPLLLNGLRRSASNTTSQVAIVGSNVCPIESLDYEISENDYFKQDWRRREKI  81

Query  306  QVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAG  485
            Q LQYVF+KW + F +GLL G++    NLAVENIAG K +   + +  +RY   F  FA 
Sbjct  82   QTLQYVFMKWMMCFFIGLLVGLVGFCNNLAVENIAGTKFVVTSNMMLARRYTTAFLVFAS  141

Query  486  ANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            +NF LT  AS++  F AP AAG GIPE+KAYLNGVD P +F
Sbjct  142  SNFGLTLFASLITAFIAPEAAGSGIPEVKAYLNGVDAPAIF  182



>emb|CAN62616.1| hypothetical protein VITISV_036165 [Vitis vinifera]
Length=805

 Score =   172 bits (436),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 110/161 (68%), Gaps = 5/161 (3%)
 Frame = +3

Query  135  DPESNSLHQPLL---LKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRT  305
            D ES +  QPLL   L R+L+  +S +A+VG+ V  IESLDYEI END FK DWRSR + 
Sbjct  8    DEESQA--QPLLDPSLHRSLSNVTSQVAIVGSNVCPIESLDYEIYENDFFKQDWRSRGKV  65

Query  306  QVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAG  485
            Q+ QY+F+KW L FL+GL+  +I    NLAVEN+AG K +   + +  KRY M F  F  
Sbjct  66   QIFQYIFVKWLLCFLIGLIVSLIGFCNNLAVENLAGVKFVITSNMMLVKRYGMAFLVFFS  125

Query  486  ANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            +NFVLT  AS++  F AP AAG GIPE+KAYLNGVD P +F
Sbjct  126  SNFVLTLFASIITAFIAPAAAGSGIPEVKAYLNGVDAPGIF  166



>ref|XP_002530769.1| chloride channel clc, putative [Ricinus communis]
 gb|EEF31629.1| chloride channel clc, putative [Ricinus communis]
Length=775

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 109/160 (68%), Gaps = 1/160 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLL-KRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQ  308
            ++ E  SL  PLL  +R+L  S+S +A+VGA V  IESLDYEI END FK DWR+  + Q
Sbjct  11   QEQEHESLTLPLLTSQRSLINSTSQVAIVGANVCPIESLDYEIAENDFFKQDWRTHKKIQ  70

Query  309  VLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGA  488
            + QYVF+KW L FLVGL+  +I    NLAVENIAG K +   + +   RY M FA F+ +
Sbjct  71   IFQYVFMKWLLCFLVGLIVSLIGFFNNLAVENIAGVKFVITSNMMLANRYGMAFAVFSVS  130

Query  489  NFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            NFVLT  AS++    AP AAG GIPE+KAYLNGVD P +F
Sbjct  131  NFVLTLFASIITASVAPAAAGSGIPEVKAYLNGVDAPGIF  170



>ref|XP_001756485.1| predicted protein [Physcomitrella patens]
 gb|EDQ78881.1| predicted protein [Physcomitrella patens]
Length=801

 Score =   172 bits (435),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 112/167 (67%), Gaps = 10/167 (6%)
 Frame = +3

Query  138  PESNSLHQPLLLKR----------NLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDW  287
            P    L++PLL K           N+   +   AM+G +V+ IESLDYE+ EN+LF+ DW
Sbjct  17   PPHLDLYEPLLEKEKVATAGNANGNVINGTHHTAMIGTRVAPIESLDYELVENELFRQDW  76

Query  288  RSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMG  467
            RSR + ++LQYV +KWT  FLVG+LT I A  IN AVENIAG K L  V +++  R++  
Sbjct  77   RSRKKREILQYVAVKWTFVFLVGILTAIAALGINTAVENIAGVKFLLTVKFMESNRFVWA  136

Query  468  FAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            F  +AG N +L   A++LCV+  P+AAG GIPE+KAYLNGVDTPN+F
Sbjct  137  FLVYAGFNVMLVMSAALLCVYIGPSAAGSGIPEVKAYLNGVDTPNIF  183



>ref|XP_010674330.1| PREDICTED: chloride channel protein CLC-c-like [Beta vulgaris 
subsp. vulgaris]
Length=783

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 106/157 (68%), Gaps = 2/157 (1%)
 Frame = +3

Query  147  NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVF  326
            +S+  PLL KR  T ++S +A++GA    IESLDYEINEN+LFK DWRSR + Q+ QYVF
Sbjct  41   SSMRMPLLRKR--TNTTSQIAVIGANSCPIESLDYEINENELFKQDWRSRKKVQIFQYVF  98

Query  327  LKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTF  506
            LKW LA L+GL TG++    N+AVENIAG+KLL     + +  Y   F  FAG N     
Sbjct  99   LKWALALLIGLSTGLVGFFSNIAVENIAGFKLLLTNKLMLQGSYFKAFLAFAGCNIAFAT  158

Query  507  VASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
            +A  LC F AP AAG GIPE+K+YLNGVD P++   +
Sbjct  159  LAGTLCAFVAPAAAGSGIPEVKSYLNGVDAPSILAPS  195



>ref|XP_006836849.1| hypothetical protein AMTR_s00099p00074960 [Amborella trichopoda]
 gb|ERM99702.1| hypothetical protein AMTR_s00099p00074960 [Amborella trichopoda]
Length=772

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 106/147 (72%), Gaps = 2/147 (1%)
 Frame = +3

Query  153  LHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  332
            L  PLL +R  T  +S LA+VG+ V  +ESLDYEI END FK DWRSR R Q+ QYVFLK
Sbjct  31   LRVPLLKQRRNT--TSQLAIVGSNVCPVESLDYEIIENDTFKQDWRSRKRVQIFQYVFLK  88

Query  333  WTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVA  512
            WTLA L+GL TG +    N+AVENIAG+KLL   + + +++Y++ F  +AG N VL  V+
Sbjct  89   WTLALLIGLCTGFVGFFNNIAVENIAGFKLLLTNNLMLQQKYVLAFFAYAGCNLVLAAVS  148

Query  513  SVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            + +C + AP AAG GIPE+KAYLNGVD
Sbjct  149  ATVCAYIAPAAAGSGIPEVKAYLNGVD  175



>ref|XP_006381102.1| chloride channel-like family protein [Populus trichocarpa]
 gb|ERP58899.1| chloride channel-like family protein [Populus trichocarpa]
Length=775

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 110/159 (69%), Gaps = 1/159 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLL-KRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            + +  SL  PLL  +R+L  S+S +A+VGA V  IESLDYEI EN+ FK DWRSR + Q+
Sbjct  11   NTDQESLIIPLLSPRRSLINSTSQVAIVGANVCPIESLDYEIAENEFFKQDWRSRGKMQI  70

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
             QYVF+KW+L FL+GL+  +I    NLAVENIAG K +   + +  KR+ M F  F+ +N
Sbjct  71   FQYVFMKWSLCFLIGLIVSLIGFFNNLAVENIAGLKFVVTSNMMLAKRFGMAFLVFSVSN  130

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
             +LT  AS++  F AP AAG GIPE+KAYLNGVD P +F
Sbjct  131  LILTLFASIITAFIAPAAAGSGIPEVKAYLNGVDAPGIF  169



>ref|XP_010050093.1| PREDICTED: putative chloride channel-like protein CLC-g [Eucalyptus 
grandis]
 gb|KCW82982.1| hypothetical protein EUGRSUZ_C04372 [Eucalyptus grandis]
Length=770

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 111/159 (70%), Gaps = 3/159 (2%)
 Frame = +3

Query  135  DPESNSLHQPLL-LKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            DPES  L QP L L+R+   S+S +A+VGA V  IESLDYEI END FK DWR+R + Q+
Sbjct  8    DPES--LTQPFLALQRSTINSTSQVAIVGANVCPIESLDYEIAENDFFKQDWRTRGKMQI  65

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
             QY+F+KW L FL+G + G+I   INLAVEN+AG K +   D + ++R+ M F  F+ +N
Sbjct  66   FQYIFMKWLLCFLIGGIVGVIGFCINLAVENLAGVKFVVTSDMMLQRRFGMAFLVFSLSN  125

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            F LT  A+++    +P +AG GIPE+KAYLNGVD P +F
Sbjct  126  FGLTLFAALITALVSPASAGSGIPEVKAYLNGVDAPGIF  164



>ref|XP_004248849.1| PREDICTED: chloride channel protein CLC-c-like [Solanum lycopersicum]
Length=778

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 105/151 (70%), Gaps = 0/151 (0%)
 Frame = +3

Query  141  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  320
            E+ S+ +PLL  ++   ++S +A+VGA V  IESLDY+I ENDLFK DWRSR + ++ QY
Sbjct  32   ETGSIREPLLKSKSRVNNTSQIAIVGANVYPIESLDYDIVENDLFKQDWRSRKKVEIFQY  91

Query  321  VFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVL  500
            +FLKWTL  L+GL TG++    N+ VENIAG+KLL   + + + +Y   FA FAG N   
Sbjct  92   IFLKWTLVLLIGLSTGLVGFFNNIGVENIAGFKLLLTSNLMLEGKYFQAFAAFAGCNVFF  151

Query  501  TFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
               A+ LC F AP AAG GIPE+KAYLNG+D
Sbjct  152  ATCAAALCAFIAPAAAGSGIPEVKAYLNGID  182



>ref|XP_008801915.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Phoenix dactylifera]
Length=773

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 105/146 (72%), Gaps = 0/146 (0%)
 Frame = +3

Query  171  LKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFL  350
            L+R+ + ++S +A+VGA V  IESLDYE+ END FK DWRSR R+ + +YV LKW+L FL
Sbjct  23   LRRSASNTTSQVAIVGAHVCPIESLDYELIENDFFKQDWRSRGRSHIFRYVTLKWSLCFL  82

Query  351  VGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVF  530
            +G L G +    NLAVENIAG K +   + +  ++Y   FA FAG+NFVLT  ASV+  +
Sbjct  83   IGALAGAVGFFNNLAVENIAGVKFVVTSNMMLARKYGWAFAVFAGSNFVLTMFASVITAY  142

Query  531  FAPTAAGPGIPEIKAYLNGVDTPNMF  608
             AP AAG GIPE+KAYLNGVD P++F
Sbjct  143  MAPAAAGSGIPEVKAYLNGVDAPDIF  168



>dbj|BAB97267.1| chloride channel [Oryza sativa Japonica Group]
Length=801

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 102/155 (66%), Gaps = 3/155 (2%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            D       QPLL KR +  ++S +A+VGA V  IESLDYEI ENDLFK DWRSR + Q+ 
Sbjct  51   DEAGGGPRQPLLRKRTMN-TTSQIAIVGANVCPIESLDYEIVENDLFKQDWRSRKKKQIF  109

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYI--DKKRYLMGFAYFAGA  488
            QY+ LKW L  L+G+LTGI+    NLAVENIAG KLL   D +   K RY   F  + G 
Sbjct  110  QYIVLKWALVLLIGMLTGIVGFFNNLAVENIAGLKLLLTSDLMLKQKCRYFTAFLAYGGC  169

Query  489  NFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            N VL   A+ +C + AP AAG GIPE+KAYLNGVD
Sbjct  170  NLVLATTAAAICAYIAPAAAGSGIPEVKAYLNGVD  204



>ref|XP_008801913.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Phoenix dactylifera]
 ref|XP_008801914.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Phoenix dactylifera]
Length=778

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 105/146 (72%), Gaps = 0/146 (0%)
 Frame = +3

Query  171  LKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFL  350
            L+R+ + ++S +A+VGA V  IESLDYE+ END FK DWRSR R+ + +YV LKW+L FL
Sbjct  23   LRRSASNTTSQVAIVGAHVCPIESLDYELIENDFFKQDWRSRGRSHIFRYVTLKWSLCFL  82

Query  351  VGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVF  530
            +G L G +    NLAVENIAG K +   + +  ++Y   FA FAG+NFVLT  ASV+  +
Sbjct  83   IGALAGAVGFFNNLAVENIAGVKFVVTSNMMLARKYGWAFAVFAGSNFVLTMFASVITAY  142

Query  531  FAPTAAGPGIPEIKAYLNGVDTPNMF  608
             AP AAG GIPE+KAYLNGVD P++F
Sbjct  143  MAPAAAGSGIPEVKAYLNGVDAPDIF  168



>ref|XP_003581281.1| PREDICTED: chloride channel protein CLC-c-like [Brachypodium 
distachyon]
 ref|XP_010239959.1| PREDICTED: chloride channel protein CLC-c-like [Brachypodium 
distachyon]
Length=795

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 105/154 (68%), Gaps = 1/154 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            R  +     +PLL KR +  ++S +A+VGA V  IESLDYEI ENDLFK DWRSR + Q+
Sbjct  46   RYDDGEGPREPLLRKRTMN-TTSQIAIVGANVFPIESLDYEIVENDLFKQDWRSRKKKQI  104

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
             QY+ LKW L  L+G+LTG++    NLAVENIAG+KLL   D + ++RY   F  + G N
Sbjct  105  FQYIVLKWALVLLIGVLTGLVGFFNNLAVENIAGFKLLLTGDLMLQERYFTAFLAYGGCN  164

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
             VL   A+ +C + AP AAG GIPE+KAYLNGVD
Sbjct  165  LVLGATAAAICAYIAPAAAGSGIPEVKAYLNGVD  198



>ref|XP_011028391.1| PREDICTED: chloride channel protein CLC-c-like [Populus euphratica]
 ref|XP_011028392.1| PREDICTED: chloride channel protein CLC-c-like [Populus euphratica]
Length=766

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 106/155 (68%), Gaps = 1/155 (1%)
 Frame = +3

Query  153  LHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  332
            L +P L+ RN   ++S +A+VGA    IESLDYEI EN+LFK DWRSR + ++ QYV LK
Sbjct  25   LREPFLV-RNRKNNTSQVAIVGANTCPIESLDYEIVENELFKQDWRSRKKAEIFQYVVLK  83

Query  333  WTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVA  512
            WTLA L+GL TG+I    NLA+EN+AG+KLL   + + K  Y   FA +AG N VL   A
Sbjct  84   WTLALLIGLGTGLIGFFNNLAIENLAGFKLLVTNNLMLKDMYYQAFATYAGCNVVLAIAA  143

Query  513  SVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
              LC + AP AAG GIPE+KAYLNGVD P++   +
Sbjct  144  GALCAYVAPAAAGSGIPEVKAYLNGVDAPSILAPS  178



>gb|ADW93911.1| chloride channel 1 [Hordeum vulgare subsp. vulgare]
Length=799

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 104/151 (69%), Gaps = 1/151 (1%)
 Frame = +3

Query  141  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  320
            + +   +PL+ KR +  ++S +A+VGA V  IESLDYEI ENDLFK DWRSR + Q+ QY
Sbjct  53   DDDGPREPLMRKRTMN-TTSQIAIVGANVFAIESLDYEIVENDLFKQDWRSRKKNQIFQY  111

Query  321  VFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVL  500
            V LKW L  L+GLLTG++    NLAVENIAG+KL+   D + +KRY   F  + G N  L
Sbjct  112  VVLKWALVLLIGLLTGLVGFFNNLAVENIAGFKLVLTGDLMLQKRYFTAFLAYGGCNLFL  171

Query  501  TFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
               A+ LC + AP AAG GIPE+KAYLNGVD
Sbjct  172  GATAAALCAYIAPAAAGSGIPEVKAYLNGVD  202



>ref|XP_011016274.1| PREDICTED: chloride channel protein CLC-c-like [Populus euphratica]
Length=766

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 106/155 (68%), Gaps = 1/155 (1%)
 Frame = +3

Query  153  LHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  332
            L +P L+ RN   ++S +A+VGA    IESLDYEI EN+LFK DWRSR + ++ QYV LK
Sbjct  25   LREPFLV-RNRKNNTSQVAIVGANTCPIESLDYEIVENELFKQDWRSRKKAEIFQYVVLK  83

Query  333  WTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVA  512
            WTLA L+GL TG+I    NLA+EN+AG+KLL   + + K  Y   FA +AG N VL   A
Sbjct  84   WTLALLIGLGTGLIGFFNNLAIENLAGFKLLVTNNLMLKDMYYQAFATYAGCNVVLAIAA  143

Query  513  SVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
              LC + AP AAG GIPE+KAYLNGVD P++   +
Sbjct  144  GALCAYVAPAAAGSGIPEVKAYLNGVDAPSILAPS  178



>ref|NP_001275140.1| chloride channel protein CLC-c-like [Solanum tuberosum]
 emb|CAA71369.1| chloride channel Stclc1 [Solanum tuberosum]
Length=764

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 103/151 (68%), Gaps = 0/151 (0%)
 Frame = +3

Query  141  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  320
            ES S+  PLL  ++   ++S +A+VGA V  IESLDY+I ENDLFK DWRSR + ++ QY
Sbjct  18   ESGSIRVPLLKSKSRVNNTSQIAIVGANVYPIESLDYDIVENDLFKQDWRSRKKVEIFQY  77

Query  321  VFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVL  500
            +FLKWTL  L+GL TG++    N+ VENIAG+KLL   + +   +Y   FA FAG N   
Sbjct  78   IFLKWTLVLLIGLSTGLVGFFNNIGVENIAGFKLLLTSNLMLDGKYFQAFAAFAGCNVFF  137

Query  501  TFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
               A+ LC F AP AAG GIPE+KAYLNG+D
Sbjct  138  ATCAAALCAFIAPAAAGSGIPEVKAYLNGID  168



>ref|XP_010241599.1| PREDICTED: LOW QUALITY PROTEIN: putative chloride channel-like 
protein CLC-g [Nelumbo nucifera]
Length=781

 Score =   169 bits (428),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 102/145 (70%), Gaps = 0/145 (0%)
 Frame = +3

Query  174  KRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLV  353
            +R+ + ++S +A VG+ V  IESLDYEI END FK DWRSR + Q+LQY+F+KWTL FLV
Sbjct  26   RRSASNTTSQVAFVGSNVCPIESLDYEIIENDFFKQDWRSRGKVQILQYIFMKWTLCFLV  85

Query  354  GLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFF  533
            G+  G+I    NLAVENIAG K +   + + ++RY   F  FA  NFV+   +S++  F 
Sbjct  86   GIFAGLIGFFNNLAVENIAGMKFVITSNMMLERRYAAAFGVFASTNFVVILFSSLITTFI  145

Query  534  APTAAGPGIPEIKAYLNGVDTPNMF  608
            AP AAG GIPE+KAYLNGVD P +F
Sbjct  146  APAAAGSGIPEVKAYLNGVDAPRIF  170



>ref|XP_008242835.1| PREDICTED: putative chloride channel-like protein CLC-g [Prunus 
mume]
Length=775

 Score =   169 bits (427),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 110/160 (69%), Gaps = 3/160 (2%)
 Frame = +3

Query  132  RDPESNSLHQPLLL-KRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQ  308
             DPES  +  PL+  +R+   S+S +A+VGA V  +ESLDYEI EN+ FK DWRSR + Q
Sbjct  14   EDPES--ITAPLISGQRSAPNSTSQVALVGANVCPVESLDYEILENEFFKQDWRSRGKMQ  71

Query  309  VLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGA  488
            V QY+F+KW L FLVGL+ G+I    NLAVENIAG K +   + + K+R+L+ F  F  +
Sbjct  72   VFQYIFMKWILCFLVGLIVGLIGFCNNLAVENIAGIKFVITSNMMLKRRFLLAFIVFFFS  131

Query  489  NFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            N  LT  AS++  F AP AAG GIPE+KAYLNGVD P +F
Sbjct  132  NLALTLFASMITSFVAPVAAGSGIPEVKAYLNGVDAPGIF  171



>ref|XP_010541946.1| PREDICTED: putative chloride channel-like protein CLC-g [Tarenaya 
hassleriana]
Length=775

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 108/156 (69%), Gaps = 2/156 (1%)
 Frame = +3

Query  141  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  320
             S S+  PLL  R+ T S+S +A+VG+ VS IESLDYEI END FK DWR+R + Q+ QY
Sbjct  13   HSYSVSVPLL--RSATNSTSQVAIVGSDVSPIESLDYEIAENDFFKQDWRARGKAQIFQY  70

Query  321  VFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVL  500
            VF+KW L F +G++  +I   INLAVEN+AG K +   + +  +R+ MGF  F  +N VL
Sbjct  71   VFMKWLLCFFLGVIVSLIGFAINLAVENLAGVKFVVTSNMMLSRRFGMGFLVFTVSNLVL  130

Query  501  TFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            T  ASV+  F +P AAG GIPE+KAYLNGVD P +F
Sbjct  131  TLFASVITAFVSPAAAGSGIPEVKAYLNGVDAPGIF  166



>ref|XP_006388251.1| hypothetical protein POPTR_0261s002202g, partial [Populus trichocarpa]
 gb|ERP47165.1| hypothetical protein POPTR_0261s002202g, partial [Populus trichocarpa]
Length=202

 Score =   158 bits (400),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 103/145 (71%), Gaps = 2/145 (1%)
 Frame = +3

Query  159  QPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWT  338
            +PLL+KR  T S +  A+VGA +S IESLDYEI EN+LFK DWRSR + Q+ QY+ LKW 
Sbjct  46   EPLLVKRRNTTSQT--AIVGANISLIESLDYEIAENELFKQDWRSRKKVQIFQYILLKWA  103

Query  339  LAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASV  518
             A L+GL TG++    N+A+ENI+G+KLL     + K++Y   FA FAG N VL   A+ 
Sbjct  104  FALLIGLFTGLVGFFNNIAIENISGFKLLLTNKLMRKQQYYKAFAAFAGCNMVLAAAAAA  163

Query  519  LCVFFAPTAAGPGIPEIKAYLNGVD  593
            LC F AP AAG GIPE+KAYLNG+D
Sbjct  164  LCAFIAPAAAGSGIPEVKAYLNGID  188



>ref|XP_007204268.1| hypothetical protein PRUPE_ppa001699mg [Prunus persica]
 gb|EMJ05467.1| hypothetical protein PRUPE_ppa001699mg [Prunus persica]
Length=777

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 114/173 (66%), Gaps = 3/173 (2%)
 Frame = +3

Query  93   IAMAGQaeeeeaeRDPESNSLHQPLLL-KRNLTLSSSPLAMVGAKVSHIESLDYEINEND  269
            +++ G +       DPES  +  PL+  +R+   S+S +A+VGA V  IESLDYEI EN+
Sbjct  1    MSVNGNSNAFLNAEDPES--ITAPLISGQRSAPNSTSQVALVGANVCPIESLDYEILENE  58

Query  270  LFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDK  449
             FK DWRSR + QV QY+F+KW L FLVGL+ G+I    NLAVENIAG K +   + + K
Sbjct  59   FFKQDWRSRGKMQVFQYIFMKWFLCFLVGLIVGLIGFCNNLAVENIAGIKFVITSNMMLK  118

Query  450  KRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
             R+L+ F  F  +N  LT  AS++  F AP AAG GIPE+KAYLNGVD P +F
Sbjct  119  SRFLLAFIVFFFSNLALTLFASMITSFVAPVAAGSGIPEVKAYLNGVDAPGIF  171



>emb|CDY47559.1| BnaA08g07280D [Brassica napus]
Length=764

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 106/157 (68%), Gaps = 1/157 (1%)
 Frame = +3

Query  141  ESNSLHQPLLLK-RNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQ  317
              +S+  PLL   R+ T SSS +A+VG+ +  +ESLDYEI END FK DWR+RS+TQ+ Q
Sbjct  6    REDSVAVPLLPSLRHATNSSSQVAIVGSNLCPVESLDYEIAENDFFKQDWRARSKTQIFQ  65

Query  318  YVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFV  497
            YVF+KW L F +G++  +I    NLAVEN+AG K +   + +   RY MGF  F   N +
Sbjct  66   YVFMKWLLCFFIGIIVSLIGFTNNLAVENLAGVKFVVTSNMMLAGRYSMGFFVFTVTNLI  125

Query  498  LTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            LT  ASV+  F AP AAG GIPE+KAYLNGVD P +F
Sbjct  126  LTLFASVITAFVAPAAAGSGIPEVKAYLNGVDAPEIF  162



>ref|XP_009108066.1| PREDICTED: putative chloride channel-like protein CLC-g [Brassica 
rapa]
Length=764

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 106/157 (68%), Gaps = 1/157 (1%)
 Frame = +3

Query  141  ESNSLHQPLLLK-RNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQ  317
              +S+  PLL   R+ T SSS +A+VG+ +  +ESLDYEI END FK DWR+RS+TQ+ Q
Sbjct  6    REDSVAVPLLPSLRHATNSSSQVAIVGSNLCPVESLDYEIAENDFFKQDWRARSKTQIFQ  65

Query  318  YVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFV  497
            YVF+KW L F +G++  +I    NLAVEN+AG K +   + +   RY MGF  F   N +
Sbjct  66   YVFMKWLLCFFIGIIVSLIGFTNNLAVENLAGVKFVVTSNMMLAGRYSMGFFVFTVTNLI  125

Query  498  LTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            LT  ASV+  F AP AAG GIPE+KAYLNGVD P +F
Sbjct  126  LTLFASVITAFVAPAAAGSGIPEVKAYLNGVDAPEIF  162



>emb|CDP10469.1| unnamed protein product [Coffea canephora]
Length=784

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 109/165 (66%), Gaps = 9/165 (5%)
 Frame = +3

Query  141  ESNSLHQPLL---------LKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRS  293
            E + L QPLL         L+R+ + ++S LA+VG+ +  IESLDYEI EN LFK DWR+
Sbjct  14   EESLLSQPLLQQHEEQHHTLRRSASNTTSQLAIVGSNLCAIESLDYEIMENALFKQDWRN  73

Query  294  RSRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFA  473
              + Q+ QY+F+KWT  FL+GLL  ++    NLAVENIAG K +   D +  +R++  FA
Sbjct  74   NRKIQIFQYIFMKWTFCFLIGLLVSLVGFFNNLAVENIAGLKFVVTSDMMLARRFVAAFA  133

Query  474  YFAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
             F+ +NF LT  AS++  F AP  AG GIPE+KAYLNGVD P +F
Sbjct  134  IFSSSNFALTLFASLITAFIAPECAGSGIPEVKAYLNGVDAPAIF  178



>gb|EPS68170.1| hypothetical protein M569_06601 [Genlisea aurea]
Length=782

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 108/147 (73%), Gaps = 2/147 (1%)
 Frame = +3

Query  159  QPLLLK--RNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  332
            +PLLL   ++   ++S +A+VG+KV  IESLDYEI EN+LFK DWRSR + Q+ QY+FLK
Sbjct  40   EPLLLHHLKHRVNTTSQIAIVGSKVYPIESLDYEIIENELFKQDWRSRKKIQIFQYIFLK  99

Query  333  WTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVA  512
            WTL+ L+GLLTG++    NLAVENIAG KLL   + +   RY   FA FAG N +L   A
Sbjct  100  WTLSLLIGLLTGLVGFFNNLAVENIAGLKLLYTSNLMLNDRYFAAFAAFAGMNVILATCA  159

Query  513  SVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            +VLC FFAP AAG GIPE+KAYLNGVD
Sbjct  160  AVLCAFFAPAAAGSGIPEVKAYLNGVD  186



>ref|XP_010025693.1| PREDICTED: chloride channel protein CLC-c-like [Eucalyptus grandis]
 gb|KCW62414.1| hypothetical protein EUGRSUZ_H05062 [Eucalyptus grandis]
Length=783

 Score =   166 bits (421),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 103/148 (70%), Gaps = 2/148 (1%)
 Frame = +3

Query  150  SLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFL  329
            +  +PLL+KR  T  +S +A+VG+ V  IESLDYEI EN+LFK DWRSR + Q+ QY+ L
Sbjct  40   TFREPLLVKRVNT--TSQIAIVGSNVCPIESLDYEIVENELFKQDWRSRKKIQIFQYILL  97

Query  330  KWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFV  509
            KW  A ++GL TG++    N+AVENIAGYKLL   D + K RY   FA FAG N VL   
Sbjct  98   KWAFALIIGLGTGLVGFFNNIAVENIAGYKLLLATDLMSKDRYFAAFAAFAGCNVVLAIA  157

Query  510  ASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            A  LC F AP AAG GIPE+KAYLNG+D
Sbjct  158  AGALCAFIAPAAAGSGIPEVKAYLNGID  185



>ref|XP_006359489.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
[Solanum tuberosum]
Length=767

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 106/160 (66%), Gaps = 2/160 (1%)
 Frame = +3

Query  135  DPESNSLHQPLL--LKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQ  308
            + +  SL  PLL  L R+ + ++S +A+VG+ VS IESLDYEI END FK DWR   + Q
Sbjct  2    EEDEESLTHPLLNSLSRSTSNNTSQVAIVGSSVSPIESLDYEIMENDYFKQDWRRGEKIQ  61

Query  309  VLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGA  488
            +LQYV +KW + F +GLL G++    NLAVENIAG K +   D +  +RY   F  FA +
Sbjct  62   ILQYVSMKWMMCFFIGLLVGLVGFCNNLAVENIAGMKFVVTSDLMRARRYTTAFLVFASS  121

Query  489  NFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            NF LT  A ++  F AP AAG GIPE+KAYLNGVD P +F
Sbjct  122  NFGLTLFAGLITAFIAPEAAGSGIPEVKAYLNGVDAPAIF  161



>ref|XP_006395982.1| hypothetical protein EUTSA_v10003685mg [Eutrema salsugineum]
 gb|ESQ33268.1| hypothetical protein EUTSA_v10003685mg [Eutrema salsugineum]
Length=765

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 105/154 (68%), Gaps = 1/154 (1%)
 Frame = +3

Query  150  SLHQPLLLK-RNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVF  326
            S+  PLL   R+ T SSS +A+VG+ V  IESLDYEI END FK DWR+RS+TQ+ QYVF
Sbjct  9    SVTVPLLPSLRHATNSSSQVAIVGSNVCPIESLDYEIAENDFFKQDWRARSKTQIFQYVF  68

Query  327  LKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTF  506
            +KW L F +G++  +I    NLAVEN+AG K +   + +   R+ MGF  F   N VLT 
Sbjct  69   MKWLLCFFIGIIVSLIGFANNLAVENLAGVKFVITSNMMLVGRFSMGFFVFTVTNLVLTL  128

Query  507  VASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
             ASV+  F AP AAG GIPE+KAYLNGVD P +F
Sbjct  129  FASVITAFVAPAAAGSGIPEVKAYLNGVDAPEIF  162



>ref|XP_006389435.1| chloride channel-like family protein [Populus trichocarpa]
 gb|ERP48349.1| chloride channel-like family protein [Populus trichocarpa]
Length=775

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 108/161 (67%), Gaps = 5/161 (3%)
 Frame = +3

Query  141  ESNSLHQ----PLLL-KRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRT  305
            E+N  H+    PLL  +R+   S+S +A+VGA V  IESLDYEI ENDLFK DWRS  + 
Sbjct  9    EANDDHESVTIPLLTSERSNVNSTSQVAIVGANVCPIESLDYEIAENDLFKQDWRSGGKI  68

Query  306  QVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAG  485
            Q+ QYVF+KW L FL+GL+  +I    NLAVENIAG K +   + +  KR+ M F  F+ 
Sbjct  69   QIFQYVFMKWLLCFLIGLIVSLIGFFNNLAVENIAGLKFVVTSNMMLAKRFGMAFLVFSV  128

Query  486  ANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            +N  LT  AS++  F AP AAG GIPE+KAYLNGVD P +F
Sbjct  129  SNLTLTLFASIITAFIAPAAAGSGIPEVKAYLNGVDAPGIF  169



>ref|XP_002974253.1| hypothetical protein SELMODRAFT_100906 [Selaginella moellendorffii]
 gb|EFJ24475.1| hypothetical protein SELMODRAFT_100906 [Selaginella moellendorffii]
Length=786

 Score =   166 bits (420),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 107/157 (68%), Gaps = 3/157 (2%)
 Frame = +3

Query  138  PESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQ  317
            P   S H P+    N ++S +   ++ + VS +ESLDYEI END+FK DWR+R+  +VLQ
Sbjct  27   PRKKS-HFPVFATGNESVSFT--GIIKSNVSSLESLDYEIVENDVFKQDWRARTNYEVLQ  83

Query  318  YVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFV  497
            YV +KWT A L+G+LTG++A LINLAVENIAG KLL  +  +   RY++      G N V
Sbjct  84   YVIMKWTFACLIGVLTGLVALLINLAVENIAGAKLLITLKLLQSNRYVLAGLLLTGINLV  143

Query  498  LTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            L   +SVLCV+F P AAG GIPE+KAYLNG+D P + 
Sbjct  144  LVLFSSVLCVYFGPAAAGSGIPEVKAYLNGIDAPEIL  180



>ref|XP_003573678.1| PREDICTED: putative chloride channel-like protein CLC-g [Brachypodium 
distachyon]
Length=806

 Score =   166 bits (420),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 105/164 (64%), Gaps = 5/164 (3%)
 Frame = +3

Query  132  RDP--ESNSLHQPL---LLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSR  296
             DP  E +    PL   LL R+ T + S +AMVG+    IESLDYEI ENDLF  +WRSR
Sbjct  8    EDPLMEDDEQRPPLTRALLHRSATNNISQVAMVGSNPCPIESLDYEIIENDLFDQNWRSR  67

Query  297  SRTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAY  476
             +   ++YV LKWT  F +G+LTGI+  LINLAVEN+AG+K  AV   ++   Y   F  
Sbjct  68   GKADQVRYVVLKWTFCFAIGILTGIVGFLINLAVENVAGFKHTAVSSLMESSSYWTAFLV  127

Query  477  FAGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            FAGAN  L   AS +  F AP A G GIPE+KAYLNGVD PN+F
Sbjct  128  FAGANLALLLFASSITAFIAPAAGGSGIPEVKAYLNGVDAPNIF  171



>gb|EMS50378.1| Chloride channel protein CLC-c [Triticum urartu]
Length=783

 Score =   166 bits (420),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 96/134 (72%), Gaps = 0/134 (0%)
 Frame = +3

Query  192  SSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGI  371
            ++S +A+VGA V  IESLDYEI ENDLFK DWRSR + Q+ QYV LKW L  L+GLLTG+
Sbjct  3    TTSQIAIVGANVFAIESLDYEIVENDLFKQDWRSRKKNQIFQYVVLKWALVLLIGLLTGL  62

Query  372  IATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAG  551
            +    NLAVENIAG+KL+   D + +KRY   F  + G N VL   A+ LC + AP AAG
Sbjct  63   VGFFNNLAVENIAGFKLVLTGDLMLQKRYFTAFLAYGGCNLVLGATAAALCAYIAPAAAG  122

Query  552  PGIPEIKAYLNGVD  593
             GIPE+KAYLNGVD
Sbjct  123  SGIPEVKAYLNGVD  136



>ref|XP_004242745.2| PREDICTED: putative chloride channel-like protein CLC-g [Solanum 
lycopersicum]
Length=788

 Score =   166 bits (420),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 106/160 (66%), Gaps = 2/160 (1%)
 Frame = +3

Query  135  DPESNSLHQPLL--LKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQ  308
            + +  SL  PLL  L R+ + ++S +A+VG+ VS IESLDYEI END FK DWR   + Q
Sbjct  23   EEDEESLTHPLLNRLSRSASNNTSQVAIVGSSVSPIESLDYEIMENDYFKQDWRRGEKIQ  82

Query  309  VLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGA  488
            +LQYV +KW + F +GLL G++    NLAVENIAG K +   D +  +RY   F  FA +
Sbjct  83   ILQYVSMKWMMCFFIGLLVGLVGFCNNLAVENIAGMKFVVTSDLMRARRYTTAFLVFASS  142

Query  489  NFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            NF LT  A ++  F AP AAG GIPE+KAYLNGVD P +F
Sbjct  143  NFGLTLFAGLITAFIAPEAAGSGIPEVKAYLNGVDAPAIF  182



>ref|XP_011084085.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Sesamum indicum]
Length=787

 Score =   166 bits (420),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 108/158 (68%), Gaps = 2/158 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            D ++  LHQPLL   ++T++   +A+VG+ V  IESLDYE+ END FK DWRSR + Q  
Sbjct  14   DDDTALLHQPLLPSESITVAE--VAIVGSSVCPIESLDYEVIENDFFKADWRSRGKIQKY  71

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+F+KW L FL+GL+ G++   INLAVENIAG K +     +   ++++ F  F  +N 
Sbjct  72   QYIFMKWILCFLIGLIVGLLGFFINLAVENIAGMKFVVTSKMMLTGKFMVAFLVFTSSNL  131

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
             LT +AS++  F AP AAG GIPE+KAYLNGVD P +F
Sbjct  132  GLTLLASLITAFVAPEAAGSGIPEVKAYLNGVDVPAIF  169



>ref|XP_010030223.1| PREDICTED: chloride channel protein CLC-c-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW57159.1| hypothetical protein EUGRSUZ_I02790 [Eucalyptus grandis]
Length=778

 Score =   166 bits (419),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 108/158 (68%), Gaps = 4/158 (3%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLS----SSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRS  299
            ++     + QPLL +++ + S    +S +A+VGA +  IESLDYEI ENDLFK DWRSR+
Sbjct  25   KESSPKGMRQPLLSRKHDSGSRINRTSQIAIVGANLCPIESLDYEIVENDLFKQDWRSRT  84

Query  300  RTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYF  479
            ++++ QYV LKWTLA L+GL TG++    N+AVENIAG+K L   + + K+RY   F  +
Sbjct  85   KSEIYQYVVLKWTLALLIGLGTGLVGFFNNIAVENIAGFKFLLANNLMLKERYYQAFVAY  144

Query  480  AGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            A  N VL   A  LC + AP AAG GIPE+KAYLNG+D
Sbjct  145  ASCNIVLAVAAGALCAYIAPAAAGSGIPEVKAYLNGID  182



>ref|XP_011020210.1| PREDICTED: putative chloride channel-like protein CLC-g [Populus 
euphratica]
Length=806

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 109/162 (67%), Gaps = 5/162 (3%)
 Frame = +3

Query  135  DPESNSLHQPLLL-----KRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRS  299
            D E+N+  + L++     +R+   S+S +A+VGA V  IESLDYEI EN+ FK DWRSR 
Sbjct  38   DGEANTDQESLIIPLLSPRRSFINSTSQVAIVGANVCPIESLDYEIAENEFFKQDWRSRG  97

Query  300  RTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYF  479
            + Q+ QYVF+KW+L FL+GL+  ++    NLAVENIAG K +   + +   R+ M F  F
Sbjct  98   KMQIFQYVFMKWSLCFLIGLIVSLVGFFNNLAVENIAGLKFVVTSNMMMANRFWMAFLVF  157

Query  480  AGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNM  605
            + +N +LT  AS++  F AP AAG G+PE+KAYLNGVD P +
Sbjct  158  SVSNLILTLFASIITAFIAPAAAGSGVPEVKAYLNGVDAPGI  199



>ref|XP_003592890.1| Chloride channel protein CLC-c [Medicago truncatula]
 gb|ABE91957.1| CBS; Cl- channel, voltage gated; Twin-arginine translocation 
pathway signal [Medicago truncatula]
 gb|AES63141.1| chloride channel ClC1 protein [Medicago truncatula]
Length=761

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 105/145 (72%), Gaps = 1/145 (1%)
 Frame = +3

Query  159  QPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWT  338
            QPLL++  +  +SS LA+VGA +  I+SLDYE+ ENDL K DWRSR++ ++ QYV LKWT
Sbjct  17   QPLLIRSRIN-NSSQLAIVGANICPIQSLDYELIENDLLKQDWRSRTKVEIYQYVVLKWT  75

Query  339  LAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASV  518
            LA L+GL+TG++    NL VENIAG+KLL   + + K++Y   FA + G N +L   A+ 
Sbjct  76   LALLIGLITGLVGFFNNLGVENIAGFKLLLTNNLMLKQKYHEAFAVYVGCNMILGVGAAA  135

Query  519  LCVFFAPTAAGPGIPEIKAYLNGVD  593
            LC + AP AAG GIPE+KAYLNG+D
Sbjct  136  LCAYIAPAAAGSGIPEVKAYLNGID  160



>emb|CDY12393.1| BnaC08g08120D [Brassica napus]
Length=764

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 100/144 (69%), Gaps = 0/144 (0%)
 Frame = +3

Query  177  RNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVG  356
            R+ T SSS +A+VG+ +  +ESLDYEI END FK DWR+RS+TQ+ QYVF+KW L F VG
Sbjct  19   RHATNSSSQVAIVGSNLCPVESLDYEIAENDFFKQDWRARSKTQIFQYVFMKWLLCFFVG  78

Query  357  LLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFA  536
            ++  +I    NLAVEN+AG K +   + +   RY MGF  F   N +LT  ASV+  F A
Sbjct  79   IIVSLIGFTNNLAVENLAGVKFVVTSNMMLAGRYSMGFFVFTVTNLLLTLFASVITAFVA  138

Query  537  PTAAGPGIPEIKAYLNGVDTPNMF  608
            P AAG GIPE+KAYLNGVD P +F
Sbjct  139  PAAAGSGIPEVKAYLNGVDAPEIF  162



>ref|XP_009777968.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Nicotiana sylvestris]
Length=788

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 108/161 (67%), Gaps = 3/161 (2%)
 Frame = +3

Query  135  DPESNSLHQPLLL---KRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRT  305
            + +  SL +PLLL   +R+ + ++S +A+VG+ V  IESLDYEI+END FK DWR   + 
Sbjct  22   EADEESLTRPLLLNGLRRSASNTTSQVAIVGSNVCPIESLDYEISENDYFKQDWRRGEKI  81

Query  306  QVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAG  485
            Q LQY+F+KW + F +GLL G++    NLAVENIAG K +   + +  +RY   F  FA 
Sbjct  82   QTLQYIFMKWMMCFFIGLLVGLVGFCNNLAVENIAGTKFVVTSNMMLARRYTTAFLVFAS  141

Query  486  ANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            +NF LT  A ++  F AP AAG GIPE+KAYLNGVD P +F
Sbjct  142  SNFGLTLFAGLITAFIAPEAAGSGIPEVKAYLNGVDAPAIF  182



>ref|XP_002870407.1| hypothetical protein ARALYDRAFT_493576 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46666.1| hypothetical protein ARALYDRAFT_493576 [Arabidopsis lyrata subsp. 
lyrata]
Length=763

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 104/155 (67%), Gaps = 1/155 (1%)
 Frame = +3

Query  147  NSLHQPLLLK-RNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYV  323
            +S+  PLL   R  T S+S +A+VGA V  IESLDYEI END FK DWR RS+ ++ QYV
Sbjct  8    DSVAVPLLPSLRRATNSTSQVAIVGANVCPIESLDYEIAENDFFKQDWRGRSKVEIFQYV  67

Query  324  FLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLT  503
            F+KW L F +G++  +I    NLAVEN+AG K +   + +   R+ MGF  F+  N VLT
Sbjct  68   FMKWLLCFCIGIIVSLIGFANNLAVENLAGVKFVVTSNMMIAGRFGMGFVVFSVTNLVLT  127

Query  504  FVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
              ASV+  F AP AAG GIPE+KAYLNGVD P +F
Sbjct  128  LFASVITAFVAPAAAGSGIPEVKAYLNGVDAPEIF  162



>ref|NP_198313.2| putative chloride channel-like protein CLC-g [Arabidopsis thaliana]
 sp|P60300.2|CLCG_ARATH RecName: Full=Putative chloride channel-like protein CLC-g; AltName: 
Full=CBS domain-containing protein CBSCLC6 [Arabidopsis 
thaliana]
 gb|AED93891.1| putative chloride channel-like protein CLC-g [Arabidopsis thaliana]
Length=765

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 104/155 (67%), Gaps = 1/155 (1%)
 Frame = +3

Query  147  NSLHQPLLLK-RNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYV  323
            +S+  PLL   R  T S+S +A+VGA V  IESLDYEI END FK DWR RS+ ++ QYV
Sbjct  8    DSVAVPLLPSLRRATNSTSQVAIVGANVCPIESLDYEIAENDFFKQDWRGRSKVEIFQYV  67

Query  324  FLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLT  503
            F+KW L F +G++  +I    NLAVEN+AG K +   + +   R+ MGF  F+  N +LT
Sbjct  68   FMKWLLCFCIGIIVSLIGFANNLAVENLAGVKFVVTSNMMIAGRFAMGFVVFSVTNLILT  127

Query  504  FVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
              ASV+  F AP AAG GIPE+KAYLNGVD P +F
Sbjct  128  LFASVITAFVAPAAAGSGIPEVKAYLNGVDAPEIF  162



>gb|KDP30234.1| hypothetical protein JCGZ_17016 [Jatropha curcas]
Length=773

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 106/156 (68%), Gaps = 1/156 (1%)
 Frame = +3

Query  141  ESNSLHQPLLLK-RNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQ  317
            +  SL  PLL   R++T S+S +A+VGA V  IESLDYE+ END FK DWR+R + Q+ Q
Sbjct  11   DQESLTVPLLTSSRSITNSTSQVAIVGANVCPIESLDYEVAENDFFKQDWRTRGKIQIFQ  70

Query  318  YVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFV  497
            Y+F+KW+L FL+G++  +I    NLAVENIAG K +   + +   RY M F  F+ +NF 
Sbjct  71   YLFMKWSLCFLIGIVVSLIGFFNNLAVENIAGVKFVVTSNMMLHNRYWMAFLVFSLSNFA  130

Query  498  LTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNM  605
            LT  + ++  F AP AAG GIPE+KAYLNGVD P +
Sbjct  131  LTLFSCIITDFIAPAAAGSGIPEVKAYLNGVDAPGI  166



>ref|XP_002985623.1| hypothetical protein SELMODRAFT_181899 [Selaginella moellendorffii]
 gb|EFJ13201.1| hypothetical protein SELMODRAFT_181899 [Selaginella moellendorffii]
Length=786

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 97/134 (72%), Gaps = 0/134 (0%)
 Frame = +3

Query  207  AMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGIIATLI  386
             ++ + VS +ESLDYEI END+FK DWR+R+  +VLQYV +KWT A L+G+LTG++A LI
Sbjct  47   GIIKSDVSSLESLDYEIVENDVFKQDWRARTNYEVLQYVIMKWTFACLIGVLTGLVALLI  106

Query  387  NLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAGPGIPE  566
            NLAVENIAG KLL  +  +   RY++      G N VL   +SVLCV+F P AAG GIPE
Sbjct  107  NLAVENIAGAKLLITLKLLQSNRYVLAGLLLTGINLVLVLFSSVLCVYFGPAAAGSGIPE  166

Query  567  IKAYLNGVDTPNMF  608
            +KAYLNG+D P + 
Sbjct  167  VKAYLNGIDAPEIL  180



>ref|XP_008452224.1| PREDICTED: LOW QUALITY PROTEIN: chloride channel protein CLC-c 
[Cucumis melo]
Length=789

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 107/155 (69%), Gaps = 1/155 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSS-SPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQ  308
            RD  S +L +PLL      +S+ S LA+VG+ +  IESLDYEI EN+LFK DWRSR + +
Sbjct  39   RDSVSLTLGEPLLRTSTARISTTSQLAIVGSNICPIESLDYEIIENELFKQDWRSRRKIE  98

Query  309  VLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGA  488
            + QY+ LKW L   +GL+TG++    N+AVENIAG+KLL   + + K++Y   F  + G+
Sbjct  99   IFQYIILKWALCLCIGLITGLVGFFNNIAVENIAGHKLLLTNNLMLKEKYFQAFVVYVGS  158

Query  489  NFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            N VL   A++LC + AP AAG GIPE+KAYLNG+D
Sbjct  159  NSVLAVAAAILCAYIAPAAAGSGIPEVKAYLNGID  193



>ref|XP_011017858.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Populus euphratica]
Length=751

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 106/159 (67%), Gaps = 1/159 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLL-KRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            + +  S+  PLL  +R+   S+S +A+VGA V  IESLDYEI ENDLFK DWRS  R Q+
Sbjct  11   NDDQESVTIPLLTSERSNVNSTSQVAIVGANVCPIESLDYEIAENDLFKQDWRSGGRIQI  70

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
             QYV +KW L F +GL+  +I    NLAVENIAG K +   + +  KR+ M F  F+ +N
Sbjct  71   FQYVLVKWLLCFFIGLIVSLIGFFNNLAVENIAGLKFVVTSNMMLAKRFEMAFFVFSVSN  130

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
             +LT  AS++  F AP AAG GIPE+KAYLNGVD P +F
Sbjct  131  LILTLFASIITAFIAPAAAGSGIPEVKAYLNGVDAPGIF  169



>ref|XP_007013578.1| Voltage-gated chloride channel family protein isoform 2 [Theobroma 
cacao]
 gb|EOY31197.1| Voltage-gated chloride channel family protein isoform 2 [Theobroma 
cacao]
Length=788

 Score =   164 bits (414),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 105/161 (65%), Gaps = 4/161 (2%)
 Frame = +3

Query  138  PESNSLHQ----PLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRT  305
            P+ N  H+    PLL       S+S +A+VGA V  IES DYEI END FK DWR+R++ 
Sbjct  7    PDQNQDHESLTIPLLSHERSLNSTSQVAIVGANVCPIESFDYEIAENDFFKQDWRTRAKI  66

Query  306  QVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAG  485
            Q+ QY+F+KW L FL+G +  ++    NLAVENIAG K +   + +  +RY M F  F+ 
Sbjct  67   QIFQYIFMKWLLCFLIGAIVSLVGFCNNLAVENIAGIKFVVTSNMMLARRYGMAFLVFSL  126

Query  486  ANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            +N VLT  A+++  F +P AAG GIPE+KAYLNGVD P +F
Sbjct  127  SNLVLTLFAAIITAFISPAAAGSGIPEVKAYLNGVDAPGIF  167



>ref|XP_011017857.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Populus euphratica]
 ref|XP_011017859.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X3 [Populus euphratica]
Length=775

 Score =   163 bits (413),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 106/159 (67%), Gaps = 1/159 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLL-KRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            + +  S+  PLL  +R+   S+S +A+VGA V  IESLDYEI ENDLFK DWRS  R Q+
Sbjct  11   NDDQESVTIPLLTSERSNVNSTSQVAIVGANVCPIESLDYEIAENDLFKQDWRSGGRIQI  70

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
             QYV +KW L F +GL+  +I    NLAVENIAG K +   + +  KR+ M F  F+ +N
Sbjct  71   FQYVLVKWLLCFFIGLIVSLIGFFNNLAVENIAGLKFVVTSNMMLAKRFEMAFFVFSVSN  130

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
             +LT  AS++  F AP AAG GIPE+KAYLNGVD P +F
Sbjct  131  LILTLFASIITAFIAPAAAGSGIPEVKAYLNGVDAPGIF  169



>ref|XP_007013577.1| Voltage-gated chloride channel family protein isoform 1 [Theobroma 
cacao]
 gb|EOY31196.1| Voltage-gated chloride channel family protein isoform 1 [Theobroma 
cacao]
Length=773

 Score =   163 bits (413),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 105/161 (65%), Gaps = 4/161 (2%)
 Frame = +3

Query  138  PESNSLHQ----PLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRT  305
            P+ N  H+    PLL       S+S +A+VGA V  IES DYEI END FK DWR+R++ 
Sbjct  7    PDQNQDHESLTIPLLSHERSLNSTSQVAIVGANVCPIESFDYEIAENDFFKQDWRTRAKI  66

Query  306  QVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAG  485
            Q+ QY+F+KW L FL+G +  ++    NLAVENIAG K +   + +  +RY M F  F+ 
Sbjct  67   QIFQYIFMKWLLCFLIGAIVSLVGFCNNLAVENIAGIKFVVTSNMMLARRYGMAFLVFSL  126

Query  486  ANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            +N VLT  A+++  F +P AAG GIPE+KAYLNGVD P +F
Sbjct  127  SNLVLTLFAAIITAFISPAAAGSGIPEVKAYLNGVDAPGIF  167



>gb|AFW70590.1| hypothetical protein ZEAMMB73_498282 [Zea mays]
Length=220

 Score =   155 bits (391),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 102/154 (66%), Gaps = 3/154 (2%)
 Frame = +3

Query  156  HQPL---LLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVF  326
             +PL   LL R+ T ++S +AMVG+    IESLDYE+ EN+LF  +WR+R +   ++YV 
Sbjct  17   QRPLNRALLHRSATTNASQVAMVGSNPCPIESLDYEMIENELFDQNWRTRRKADQVRYVV  76

Query  327  LKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTF  506
            LKWT  F +G+LTGI+   INLAVEN+AG+K  AV   +D   Y   F  FAG N  L  
Sbjct  77   LKWTFCFAIGILTGIVGFFINLAVENVAGFKHQAVSALMDSASYWTAFWVFAGCNLALLL  136

Query  507  VASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            +AS +  F +P A G GIPE+KAYLNGVD PN+F
Sbjct  137  LASSITAFLSPAAGGSGIPEVKAYLNGVDAPNIF  170



>ref|XP_008793993.1| PREDICTED: putative chloride channel-like protein CLC-g [Phoenix 
dactylifera]
Length=774

 Score =   163 bits (413),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 104/151 (69%), Gaps = 1/151 (1%)
 Frame = +3

Query  156  HQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKW  335
            H  + L+R+ +  +S +A+VG+ V  IESLDYE+ ENDLFK DWR R R  ++ YV LKW
Sbjct  15   HHRINLRRSASNVTSQVAIVGSHVCPIESLDYELVENDLFK-DWRHRGRAHIICYVTLKW  73

Query  336  TLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVAS  515
            +L FL+G L G +    NLAVENIAG+K +   + +  K+Y   F  FAG+NFVL   AS
Sbjct  74   SLCFLIGALAGAVGFFNNLAVENIAGFKFVVTSNLMLAKKYAWAFGVFAGSNFVLAMFAS  133

Query  516  VLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            VL  + AP AAG GIPE+KAYLNG+D P++F
Sbjct  134  VLTAYIAPAAAGSGIPEVKAYLNGIDAPDLF  164



>ref|XP_008365471.1| PREDICTED: chloride channel protein CLC-a-like [Malus domestica]
Length=117

 Score =   151 bits (382),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 78/88 (89%), Gaps = 1/88 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            RDPES SL QPLL KRN TLSS+PLAMVGAKVSHIESLDYEINEN LFKHDWRSRS+ QV
Sbjct  25   RDPESISLQQPLL-KRNRTLSSTPLAMVGAKVSHIESLDYEINENXLFKHDWRSRSKVQV  83

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLA  395
            LQYVFLKW LA LVGLLTGIIAT IN A
Sbjct  84   LQYVFLKWILACLVGLLTGIIATXINXA  111



>gb|ADF30876.1| chloride channel protein [Citrus trifoliata]
Length=789

 Score =   163 bits (412),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 108/151 (72%), Gaps = 1/151 (1%)
 Frame = +3

Query  141  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  320
            E ++L +PLLLK   T ++S +A+VGA +S IESLDYEI EN+LFK DWR+R + ++ QY
Sbjct  42   EDHNLREPLLLKCR-TNTTSQIAIVGANISPIESLDYEIVENELFKQDWRARRKVEIFQY  100

Query  321  VFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVL  500
            V LKWTLA L+G+LTG+ A   N  VENIAG+KLL + + +   R+ MGF      N  L
Sbjct  101  VVLKWTLALLIGVLTGLAAVFCNFFVENIAGFKLLLINNLMLNDRHFMGFVANTSINLGL  160

Query  501  TFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
              +A++LC + AP AAG GIPE+KAYLNG+D
Sbjct  161  AILAAILCAYIAPAAAGSGIPEVKAYLNGID  191



>ref|XP_010274995.1| PREDICTED: chloride channel protein CLC-c [Nelumbo nucifera]
Length=773

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 104/147 (71%), Gaps = 2/147 (1%)
 Frame = +3

Query  153  LHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  332
            + +PLL KR  T ++S +A+VGA V  IESLDYEI ENDLFK DWRSR + Q+ QYV LK
Sbjct  33   IREPLLKKR--TNTTSQIAIVGANVCPIESLDYEIVENDLFKQDWRSRKKIQIFQYVVLK  90

Query  333  WTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVA  512
            WTLA L+GL TG++    NL VENIAG+KLL   D + K RY   F  FAG N  L   A
Sbjct  91   WTLALLIGLATGLVGFFNNLGVENIAGFKLLLTNDLMLKDRYFKAFLAFAGCNLGLAVAA  150

Query  513  SVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            +VLC + AP AAG GIPE+KAYLNGVD
Sbjct  151  AVLCAYIAPAAAGSGIPEVKAYLNGVD  177



>gb|EMT06377.1| Putative chloride channel-like protein CLC-g [Aegilops tauschii]
Length=816

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 103/159 (65%), Gaps = 3/159 (2%)
 Frame = +3

Query  141  ESNSLHQPL---LLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            E      PL   LL R+ T + S +AMVG+K   IESLDYEI ENDLF  +WR+R++   
Sbjct  14   EDEEQRPPLTRPLLHRSATNNISQVAMVGSKACPIESLDYEIIENDLFDQNWRTRAKADQ  73

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
            ++YV LKWT  F +G++TG++  LINLAVEN+AG+K  AV   +D   Y   F  FAGAN
Sbjct  74   VRYVVLKWTFCFAIGIITGVVGFLINLAVENVAGFKHAAVSSLMDSSSYWTAFWVFAGAN  133

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
              L   AS +    +P A G GIPE+KAYLNGVD PN+F
Sbjct  134  LALLLFASAITASVSPAAGGSGIPEVKAYLNGVDAPNIF  172



>ref|XP_009392135.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=757

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 99/151 (66%), Gaps = 0/151 (0%)
 Frame = +3

Query  156  HQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKW  335
            H P+ L+R+   ++S LA+VG+ +  IESLDYE+ ENDLF  DWRSR R  +L+YVFLKW
Sbjct  44   HHPINLRRHAPNNTSQLAIVGSNLCPIESLDYELIENDLFNQDWRSRGRAAILRYVFLKW  103

Query  336  TLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVAS  515
            T    +G++ G +    NLAVENIAGYK   V D +   +Y   F  FAG N  L   A+
Sbjct  104  TFCLFIGIVAGAVGFFNNLAVENIAGYKFFTVSDLMLANKYWTAFWVFAGTNLALLLFAT  163

Query  516  VLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            V+  F +  A G GIPE+KAYLNGVD P++F
Sbjct  164  VITAFVSTAAGGSGIPEVKAYLNGVDAPDIF  194



>ref|XP_006283171.1| hypothetical protein CARUB_v10004204mg [Capsella rubella]
 ref|XP_006283172.1| hypothetical protein CARUB_v10004204mg [Capsella rubella]
 gb|EOA16069.1| hypothetical protein CARUB_v10004204mg [Capsella rubella]
 gb|EOA16070.1| hypothetical protein CARUB_v10004204mg [Capsella rubella]
Length=766

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 98/144 (68%), Gaps = 0/144 (0%)
 Frame = +3

Query  177  RNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVG  356
            R  T S+S +A+VG+ V  IESLDYEI END FK DWR RS+ ++ QYVF+KW L F +G
Sbjct  20   RRATNSTSQVAIVGSNVCPIESLDYEIAENDFFKQDWRGRSKVEIFQYVFMKWLLCFCIG  79

Query  357  LLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFA  536
            ++  +I    NLAVEN+AG K +   + +  +R+ MGF  F   N VLT  ASV+  F A
Sbjct  80   IIVSLIGFANNLAVENLAGVKFVFTSNMMIARRFGMGFVVFTVINLVLTLFASVITAFVA  139

Query  537  PTAAGPGIPEIKAYLNGVDTPNMF  608
            P AAG GIPE+KAYLNGVD P +F
Sbjct  140  PAAAGSGIPEVKAYLNGVDAPEIF  163



>ref|XP_009392134.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=784

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 99/151 (66%), Gaps = 0/151 (0%)
 Frame = +3

Query  156  HQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKW  335
            H P+ L+R+   ++S LA+VG+ +  IESLDYE+ ENDLF  DWRSR R  +L+YVFLKW
Sbjct  44   HHPINLRRHAPNNTSQLAIVGSNLCPIESLDYELIENDLFNQDWRSRGRAAILRYVFLKW  103

Query  336  TLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVAS  515
            T    +G++ G +    NLAVENIAGYK   V D +   +Y   F  FAG N  L   A+
Sbjct  104  TFCLFIGIVAGAVGFFNNLAVENIAGYKFFTVSDLMLANKYWTAFWVFAGTNLALLLFAT  163

Query  516  VLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            V+  F +  A G GIPE+KAYLNGVD P++F
Sbjct  164  VITAFVSTAAGGSGIPEVKAYLNGVDAPDIF  194



>ref|XP_009392132.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=806

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 99/151 (66%), Gaps = 0/151 (0%)
 Frame = +3

Query  156  HQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKW  335
            H P+ L+R+   ++S LA+VG+ +  IESLDYE+ ENDLF  DWRSR R  +L+YVFLKW
Sbjct  44   HHPINLRRHAPNNTSQLAIVGSNLCPIESLDYELIENDLFNQDWRSRGRAAILRYVFLKW  103

Query  336  TLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVAS  515
            T    +G++ G +    NLAVENIAGYK   V D +   +Y   F  FAG N  L   A+
Sbjct  104  TFCLFIGIVAGAVGFFNNLAVENIAGYKFFTVSDLMLANKYWTAFWVFAGTNLALLLFAT  163

Query  516  VLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            V+  F +  A G GIPE+KAYLNGVD P++F
Sbjct  164  VITAFVSTAAGGSGIPEVKAYLNGVDAPDIF  194



>ref|XP_010905336.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Elaeis guineensis]
 ref|XP_010905338.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Elaeis guineensis]
 ref|XP_010905339.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Elaeis guineensis]
Length=779

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 98/139 (71%), Gaps = 0/139 (0%)
 Frame = +3

Query  192  SSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGI  371
            ++S +A+VGA V  IESLDYE+ EN+ FK DWRSR R  + +YV LKW+L FL+G L G 
Sbjct  31   TTSQVAIVGAHVCPIESLDYELIENEFFKQDWRSRGRAYIFRYVTLKWSLCFLIGALAGA  90

Query  372  IATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAG  551
            +    NLAVENIAG K +   + +  ++Y   FA FAG+NFVLT  ASV+  + AP AAG
Sbjct  91   VGFFNNLAVENIAGVKFVVTSNMMLSRKYGWAFAVFAGSNFVLTMFASVITAYMAPAAAG  150

Query  552  PGIPEIKAYLNGVDTPNMF  608
             GIPE+KAYLNGVD P +F
Sbjct  151  SGIPEVKAYLNGVDAPGIF  169



>gb|KDP42489.1| hypothetical protein JCGZ_00286 [Jatropha curcas]
Length=768

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 113/162 (70%), Gaps = 2/162 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
             D E NS+ +PLL  RN   ++S +A+VGA V  IESLDYEI EN+L K DWRSR + ++
Sbjct  21   EDKEFNSMREPLL--RNRKNTTSQIAIVGANVCPIESLDYEIFENELIKQDWRSRKKIEI  78

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
             QY+FLKWTLA L+GL T ++    NLAVENIAG+KLL     + + +Y  GFA +AG+N
Sbjct  79   FQYIFLKWTLALLIGLGTALVGLFNNLAVENIAGFKLLWTNSLMLQDKYYQGFAAYAGSN  138

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMFGAT  617
             +L   A+ LC + AP AAG GIPE+KAYLNGVD P++   +
Sbjct  139  LILAIAAAALCAYVAPAAAGSGIPEVKAYLNGVDAPSILAPS  180



>gb|EEC69203.1| hypothetical protein OsI_38196 [Oryza sativa Indica Group]
Length=140

 Score =   150 bits (379),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 88/102 (86%), Gaps = 1/102 (1%)
 Frame = +3

Query  147  NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVF  326
            +SL QPLL KR+ TL++S LAMVGAKVSHIESLDYEI ENDLFKHDWR RS  +VLQY+F
Sbjct  39   SSLEQPLL-KRSNTLTASHLAMVGAKVSHIESLDYEIIENDLFKHDWRRRSNVEVLQYIF  97

Query  327  LKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKK  452
            LKW +AFLVGLLTG+IA+LINLA+ENI+G K+L +V  + +K
Sbjct  98   LKWAMAFLVGLLTGVIASLINLAIENISGLKMLHMVQLVREK  139



>ref|XP_006470992.1| PREDICTED: chloride channel protein CLC-c-like isoform X1 [Citrus 
sinensis]
Length=789

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 107/151 (71%), Gaps = 1/151 (1%)
 Frame = +3

Query  141  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  320
            E ++L +PLLLK   T ++S +A+VGA +  IESLDYEI EN+LFK DWR+R + ++ QY
Sbjct  42   EDHNLREPLLLKCR-TNTTSQIAIVGANICPIESLDYEIVENELFKQDWRARRKVEIFQY  100

Query  321  VFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVL  500
            V LKWTLA L+G+LTG+ A   N  VENIAG+KLL + + +   R+ MGF      N  L
Sbjct  101  VVLKWTLALLIGVLTGLAAVFCNFFVENIAGFKLLLINNLMLNDRHFMGFVANTSINLGL  160

Query  501  TFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
              +A++LC + AP AAG GIPE+KAYLNG+D
Sbjct  161  AILAAILCAYIAPAAAGSGIPEVKAYLNGID  191



>ref|XP_004508447.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
[Cicer arietinum]
Length=777

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 107/158 (68%), Gaps = 0/158 (0%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            D E++  H  L  +R++  S+S +A+VGA V  IESLDYEI EN+ FK DWRSR   Q+ 
Sbjct  10   DFETHLRHPLLSSQRSIINSTSQVAIVGANVCPIESLDYEIFENEFFKQDWRSRGVVQIF  69

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+ +KW L F++G++ G++    NLAVEN+AG K +   + + ++R+L+ F  F  +N 
Sbjct  70   QYICMKWLLCFMIGMIVGLVGFCNNLAVENLAGIKFVITSNMMLERRFLLAFVIFFASNL  129

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
             LT  AS++  F APTAAG GI E+KAYLNGVD P +F
Sbjct  130  SLTLFASIITAFIAPTAAGSGISEVKAYLNGVDAPGIF  167



>ref|XP_010435388.1| PREDICTED: putative chloride channel-like protein CLC-g [Camelina 
sativa]
Length=767

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 103/155 (66%), Gaps = 1/155 (1%)
 Frame = +3

Query  147  NSLHQPLLLK-RNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYV  323
            +S+  PLL   R  T S+S +A+VG+ V  IESLDYEI END FK DWR RS+ ++ QYV
Sbjct  8    DSVAVPLLSSLRRATNSTSQVAIVGSDVCPIESLDYEIAENDFFKQDWRGRSKVEIFQYV  67

Query  324  FLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLT  503
             +KW L F +G++  +I    NLAVEN+AG K +   + +   R+ MGF  F   N VLT
Sbjct  68   VMKWLLCFCIGIIVSLIGFANNLAVENLAGIKFVFTSNMMIAGRFGMGFVVFTATNLVLT  127

Query  504  FVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
              ASV+  F AP AAG GIPE+KAYLNGVD P++F
Sbjct  128  LFASVITAFVAPAAAGSGIPEVKAYLNGVDAPDIF  162



>ref|XP_009405902.1| PREDICTED: chloride channel protein CLC-c-like [Musa acuminata 
subsp. malaccensis]
Length=780

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 107/151 (71%), Gaps = 1/151 (1%)
 Frame = +3

Query  141  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  320
            ++ S+ QPLL KR +  ++S +A+VGA V  IESLDYEI ENDLFK DWRSR + Q+ QY
Sbjct  34   DAGSVRQPLLRKRTMN-TTSQIAIVGANVCPIESLDYEIVENDLFKQDWRSRKKVQIFQY  92

Query  321  VFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVL  500
            V LKWTLA L+GL TGII  L NLAVENIAG KLL   + + + RY   F  + G N +L
Sbjct  93   VLLKWTLALLIGLATGIIGFLNNLAVENIAGLKLLLTSNLMLENRYFTAFLAYGGINLIL  152

Query  501  TFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
               A+ LC + AP AAG GIPE+KAYLNGVD
Sbjct  153  AAAAAALCAYVAPAAAGSGIPEVKAYLNGVD  183



>gb|KFK30515.1| hypothetical protein AALP_AA7G272300 [Arabis alpina]
Length=765

 Score =   160 bits (405),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 105/155 (68%), Gaps = 3/155 (2%)
 Frame = +3

Query  150  SLHQPLL--LKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYV  323
            S+  PLL  L+R +  S+S +A+VG+ +  IESLDYEI END FK DWR+RS+ Q+ QYV
Sbjct  9    SVAVPLLPSLRRTIN-STSQVAIVGSNLCPIESLDYEIEENDFFKQDWRARSKVQIFQYV  67

Query  324  FLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLT  503
            F+KW L F +G++  +I    NLAVEN+AG K +   + +   R+ MGF  F+  N VLT
Sbjct  68   FMKWLLCFFIGIIVSLIGFTNNLAVENLAGVKFVITSNMMLAGRFSMGFLVFSLTNLVLT  127

Query  504  FVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
              AS +  F AP AAG GIPE+KAYLNGVD P +F
Sbjct  128  LFASAVTSFVAPAAAGSGIPEVKAYLNGVDAPEIF  162



>ref|XP_010450335.1| PREDICTED: putative chloride channel-like protein CLC-g [Camelina 
sativa]
Length=765

 Score =   160 bits (404),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 102/155 (66%), Gaps = 1/155 (1%)
 Frame = +3

Query  147  NSLHQPLLLK-RNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYV  323
            +S+  PLL   R  T S+S +A+VG+ V  IESLDYEI END FK DWR RS+ ++ QYV
Sbjct  8    DSVAVPLLASLRRATNSTSQVAIVGSDVCPIESLDYEIAENDFFKQDWRGRSKVEIFQYV  67

Query  324  FLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLT  503
            F+KW L F +G+   +I    NLAVEN+AG K +   + +   R+ MG   F   N VLT
Sbjct  68   FMKWLLCFCIGITVSLIGFANNLAVENLAGIKFVFTSNMMIAGRFGMGIVVFTTTNLVLT  127

Query  504  FVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
              ASV+  F AP AAG GIPE+KAYLNGVD P++F
Sbjct  128  LFASVITAFVAPAAAGSGIPEVKAYLNGVDAPDIF  162



>ref|XP_006431490.1| hypothetical protein CICLE_v10000336mg [Citrus clementina]
 gb|ESR44730.1| hypothetical protein CICLE_v10000336mg [Citrus clementina]
Length=789

 Score =   160 bits (405),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 106/151 (70%), Gaps = 1/151 (1%)
 Frame = +3

Query  141  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  320
            E ++L +PLLLK   T ++S +A+VGA +  IESLDYEI EN+LFK DWR+R + ++ QY
Sbjct  42   EDHNLREPLLLKCR-TNTTSQIAIVGANICPIESLDYEIVENELFKQDWRARRKVEIFQY  100

Query  321  VFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVL  500
            V  KWTLA L+G+LTG+ A   N  VENIAG+KLL + + +   R+ MGF      N  L
Sbjct  101  VVFKWTLALLIGVLTGLAAVFCNFFVENIAGFKLLLINNLMLNDRHFMGFVANTSINLGL  160

Query  501  TFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
              +A++LC + AP AAG GIPE+KAYLNG+D
Sbjct  161  AILAAILCAYIAPAAAGSGIPEVKAYLNGID  191



>gb|KDO42564.1| hypothetical protein CISIN_1g003885mg [Citrus sinensis]
Length=789

 Score =   160 bits (405),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 106/151 (70%), Gaps = 1/151 (1%)
 Frame = +3

Query  141  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  320
            E ++L +PLLLK   T ++S +A+VGA +  IESLDYEI EN+LFK DWR+R + ++ QY
Sbjct  42   EDHNLREPLLLKCR-TNTTSQIAIVGANICPIESLDYEIVENELFKQDWRARRKVEIFQY  100

Query  321  VFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVL  500
            V  KWTLA L+G+LTG+ A   N  VENIAG+KLL + + +   R+ MGF      N  L
Sbjct  101  VVFKWTLALLIGVLTGLAAVFCNFFVENIAGFKLLLINNLMLNDRHFMGFVANTSINLGL  160

Query  501  TFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
              +A++LC + AP AAG GIPE+KAYLNG+D
Sbjct  161  AILAAILCAYIAPAAAGSGIPEVKAYLNGID  191



>ref|XP_008336976.1| PREDICTED: putative chloride channel-like protein CLC-g [Malus 
domestica]
Length=778

 Score =   160 bits (404),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 108/160 (68%), Gaps = 3/160 (2%)
 Frame = +3

Query  132  RDPESNSLHQPLLLK-RNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQ  308
             DPES  +  PL+ + R    S+S +A+VGA V  IESLDYEI E++ FK DWRS  +  
Sbjct  15   EDPES--ITAPLISRQRYAPNSTSQVALVGANVRPIESLDYEILEBEFFKQDWRSCGKAH  72

Query  309  VLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGA  488
            VLQY+F+KW   FLVG++ G+IA   NLAVENIAG K +   + + ++R+ + FA F  +
Sbjct  73   VLQYIFMKWVSCFLVGIVVGLIAFCNNLAVENIAGIKFVVTSNMMLQRRFWLAFAVFFFS  132

Query  489  NFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            N  LTF A V+  F AP AAG GIPE+KAYLNGVD P ++
Sbjct  133  NLGLTFFAVVVTAFVAPAAAGSGIPEVKAYLNGVDAPGIY  172



>ref|XP_008385147.1| PREDICTED: LOW QUALITY PROTEIN: putative chloride channel-like 
protein CLC-g, partial [Malus domestica]
Length=719

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 106/160 (66%), Gaps = 3/160 (2%)
 Frame = +3

Query  132  RDPESNSLHQPLLLK-RNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQ  308
             DPES  +  PL+ + R+   S+S +A+VGA V  IESLDYEI EN+ FK DWRSR +  
Sbjct  10   EDPES--ITAPLISRQRSAPNSTSQVALVGANVCPIESLDYEILENEFFKQDWRSRGKVH  67

Query  309  VLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGA  488
              QY+F+KW   FL+G++ G+I    NLAVENIAG K +   + + ++R+ + FA F  +
Sbjct  68   AFQYLFMKWVSCFLIGIVVGLIGFCNNLAVENIAGIKFVVTSNMMLQRRFWLAFAVFFLS  127

Query  489  NFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            NF LT  A V+    AP AAG GIPE+KAYLNGVD P +F
Sbjct  128  NFGLTLFAVVITALVAPAAAGSGIPEVKAYLNGVDAPRIF  167



>gb|KJB46914.1| hypothetical protein B456_008G001200 [Gossypium raimondii]
Length=761

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 100/145 (69%), Gaps = 2/145 (1%)
 Frame = +3

Query  159  QPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWT  338
            +PLL+KR  T  +S +A+VGA V  +ESLDYE+ EN+L   DWRSR   Q++QY+ LKW 
Sbjct  23   KPLLIKRVNT--TSQIAIVGANVCPVESLDYEVPENELVNEDWRSRRTVQIVQYILLKWA  80

Query  339  LAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASV  518
             A ++GL TG++    N+AVENIAG+KLL   + + K +Y   FA +AG N  L   A+ 
Sbjct  81   FALIIGLSTGLVGIFNNIAVENIAGFKLLLTTELMLKHKYYKAFAAYAGCNLGLATSAAA  140

Query  519  LCVFFAPTAAGPGIPEIKAYLNGVD  593
            LC F AP AAG GIPE+KAYLNGVD
Sbjct  141  LCAFIAPAAAGSGIPEVKAYLNGVD  165



>ref|XP_009403721.1| PREDICTED: chloride channel protein CLC-c-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403722.1| PREDICTED: chloride channel protein CLC-c-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403723.1| PREDICTED: chloride channel protein CLC-c-like [Musa acuminata 
subsp. malaccensis]
Length=778

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 107/154 (69%), Gaps = 1/154 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
             + E+ S+ +PLL KR +  ++S +A+VGA V  IESLDYEI ENDLF+ DWRSR + Q+
Sbjct  29   ENEEAGSMREPLLRKRTMN-TTSQIAIVGANVCTIESLDYEIVENDLFEQDWRSRKKVQI  87

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
             QY+ LKWTLA L+GL TG++    NLAVENIAG+KLL   + + + RY   F  +   N
Sbjct  88   FQYIVLKWTLALLIGLATGLVGFFNNLAVENIAGFKLLLTSNLMLEHRYFAAFLAYCSTN  147

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
             +L   A+ LC + AP AAG GIPE+KAYLNGVD
Sbjct  148  AILAASAAALCAYVAPAAAGSGIPEVKAYLNGVD  181



>gb|KDO73468.1| hypothetical protein CISIN_1g003801mg [Citrus sinensis]
Length=794

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 107/163 (66%), Gaps = 6/163 (4%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSS----PLAMVGAKVSHIESLDYEINENDLFKHDWRSRS  299
            +DPES  L  PLL  +    S S     +A+VGA V  IESLDYEI END FK DWR+R 
Sbjct  28   QDPES--LTVPLLSHQRSRSSISNSTSQVALVGADVCPIESLDYEIAENDFFKEDWRTRG  85

Query  300  RTQVLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYF  479
            R Q++QY+F+KW+L FL+GL+ G+I  L NLAVENIAG K +   + +   ++ M F  F
Sbjct  86   RNQMIQYIFMKWSLCFLIGLIVGLIGFLNNLAVENIAGTKFVVTSNMMLANKFGMAFLSF  145

Query  480  AGANFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            +  N VLT  AS++    AP AAG GIPE+KAYLNGVD P + 
Sbjct  146  SIPNLVLTLFASIVTATVAPVAAGSGIPEVKAYLNGVDAPGIL  188



>ref|XP_008354360.1| PREDICTED: putative chloride channel-like protein CLC-g [Malus 
domestica]
Length=773

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 106/160 (66%), Gaps = 3/160 (2%)
 Frame = +3

Query  132  RDPESNSLHQPLLLK-RNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQ  308
             DPES  +  PL+ + R+   S+S +A+VGA V  IESLDYEI EN+ FK DWRSR +  
Sbjct  10   EDPES--ITAPLISRQRSAPNSTSQVALVGANVCPIESLDYEILENEFFKQDWRSRGKVH  67

Query  309  VLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGA  488
              QY+F+KW   FL+G++ G+I    NLAVENIAG K +   + + ++R+ + FA F  +
Sbjct  68   AFQYLFMKWVSCFLIGIVVGLIGFCNNLAVENIAGIKFVVTSNMMLQRRFXLAFAVFFLS  127

Query  489  NFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            NF LT  A V+    AP AAG GIPE+KAYLNGVD P +F
Sbjct  128  NFGLTLFAVVITALVAPAAAGSGIPEVKAYLNGVDAPRIF  167



>ref|XP_010930514.1| PREDICTED: chloride channel protein CLC-c-like [Elaeis guineensis]
Length=778

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 107/154 (69%), Gaps = 0/154 (0%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
             D +   + QPLLL++    ++S +A+VGA V  IESLDYEI ENDLFK DWRSR + Q+
Sbjct  28   EDEKEAGMRQPLLLRKRTMNTTSQIAIVGANVCPIESLDYEIVENDLFKQDWRSRKKVQI  87

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
             QY+ LKWTLA L+GL TG++    NLAVENIAG+KLL   D + K R+   F  ++G N
Sbjct  88   FQYIVLKWTLALLIGLATGLVGFFNNLAVENIAGFKLLLTSDLMLKDRFFAAFLAYSGCN  147

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
             VL   A+ +C + AP AAG GIPE+KAYLNG+D
Sbjct  148  LVLAAAAAAICAYIAPAAAGSGIPEVKAYLNGID  181



>ref|XP_004979167.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
[Setaria italica]
Length=793

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 104/159 (65%), Gaps = 3/159 (2%)
 Frame = +3

Query  141  ESNSLHQPL---LLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            E      PL   LL R+ T ++S +AMVG+    IESLDYE+ ENDLF  +WR+RS+   
Sbjct  11   EGEEQRPPLTRALLHRSATNNTSQVAMVGSNPCPIESLDYEMIENDLFDENWRTRSKADQ  70

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
            ++YV LKWT  F +G+LTGI+  ++NLAVEN+AG+K  AV   ++   Y   F  FAG+N
Sbjct  71   VRYVVLKWTFCFAIGILTGIVGFVVNLAVENVAGFKHNAVSALMESSSYWTAFWVFAGSN  130

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
              L   AS +  F +P A G GIPE+KAYLNGVD PN+F
Sbjct  131  LALLLFASSITAFVSPAAGGSGIPEVKAYLNGVDAPNIF  169



>ref|XP_009363967.1| PREDICTED: putative chloride channel-like protein CLC-g [Pyrus 
x bretschneideri]
Length=778

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 106/160 (66%), Gaps = 3/160 (2%)
 Frame = +3

Query  132  RDPESNSLHQPLLLK-RNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQ  308
             DPES  +  PL+ + R+   S+S +A+VGA V  IESLDYEI EN+ FK DWRSR +  
Sbjct  15   EDPES--ITAPLISRQRSAPNSTSQVALVGANVCPIESLDYEILENECFKQDWRSRGKVH  72

Query  309  VLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGA  488
              QY+F+KW   FL+G++ G+I    NLAVENIAG K +   + + ++R+ + FA F  +
Sbjct  73   AFQYLFMKWVSCFLIGIVVGLIGFCNNLAVENIAGIKFVVTSNMMLQRRFWLAFAVFFFS  132

Query  489  NFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            NF LT  A V+    AP AAG GIPE+KAYLNGVD P +F
Sbjct  133  NFGLTLFAVVITALVAPAAAGSGIPEVKAYLNGVDAPRIF  172



>ref|XP_004486231.1| PREDICTED: chloride channel protein CLC-c-like [Cicer arietinum]
Length=766

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 97/134 (72%), Gaps = 0/134 (0%)
 Frame = +3

Query  192  SSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFLVGLLTGI  371
            +SS LA+VG+ +  I+SLDYEI ENDL K DWRSR + ++ QYV LKWTLA L+GL+TGI
Sbjct  40   TSSQLAIVGSNICPIQSLDYEIIENDLLKQDWRSRRKVEIYQYVVLKWTLALLIGLITGI  99

Query  372  IATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASVLCVFFAPTAAG  551
            +  L N+ VENI+G K+L   + + +++Y   FA + G N +L   A+ LC + AP AAG
Sbjct  100  VGFLNNIGVENISGLKVLLTNNLMQQQKYEEAFAMYVGCNMILAVGAAALCAYIAPAAAG  159

Query  552  PGIPEIKAYLNGVD  593
             GIPE+KAYLNG+D
Sbjct  160  SGIPEVKAYLNGID  173



>gb|KHN47107.1| Putative chloride channel-like protein CLC-g [Glycine soja]
Length=765

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 105/153 (69%), Gaps = 1/153 (1%)
 Frame = +3

Query  153  LHQPLLL-KRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFL  329
            L +PLL  +R++  S+S +A+VG+ VS IESLDYEI EN+ FKHDWRSR + Q+ Q++ +
Sbjct  15   LRRPLLSSQRSIVNSTSQVAIVGSNVSPIESLDYEIFENEFFKHDWRSRGKAQIFQFMIM  74

Query  330  KWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFV  509
            KW L  L+G++  ++    NLAVEN+AG K +   + + ++R+LM F  F  +N VLT  
Sbjct  75   KWLLCLLIGMIVCLVGFCNNLAVENLAGIKFVVTSNMMLERRFLMAFLVFFVSNLVLTVF  134

Query  510  ASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            A  +    APTA G GIPE+KAYLNGVD P +F
Sbjct  135  ACTITALIAPTATGSGIPEVKAYLNGVDAPGIF  167



>ref|XP_003542650.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
[Glycine max]
Length=765

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 105/153 (69%), Gaps = 1/153 (1%)
 Frame = +3

Query  153  LHQPLLL-KRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFL  329
            L +PLL  +R++  S+S +A+VG+ VS IESLDYEI EN+ FKHDWRSR + Q+ Q++ +
Sbjct  15   LRRPLLSSQRSIVNSTSQVAIVGSNVSPIESLDYEIFENEFFKHDWRSRGKAQIFQFMIM  74

Query  330  KWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFV  509
            KW L  L+G++  ++    NLAVEN+AG K +   + + ++R+LM F  F  +N VLT  
Sbjct  75   KWLLCLLIGMIVCLVGFCNNLAVENLAGIKFVVTSNMMLERRFLMAFLVFFVSNLVLTVF  134

Query  510  ASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            A  +    APTA G GIPE+KAYLNGVD P +F
Sbjct  135  ACTITALIAPTATGSGIPEVKAYLNGVDAPGIF  167



>ref|XP_010927804.1| PREDICTED: chloride channel protein CLC-c-like [Elaeis guineensis]
Length=761

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 109/154 (71%), Gaps = 1/154 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
             + +   + +PLL +R +  ++S LA+VGAKV  IESLDYEI ENDL+K DWRSR + Q+
Sbjct  12   EEDKEMGMREPLLRRRTMN-TTSQLAIVGAKVCPIESLDYEIVENDLYKQDWRSRKKVQI  70

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
             QY+ LKWTLA L+GL TG++A   NLAVENIAG+KLL   + + K RY   F  +AG N
Sbjct  71   FQYIVLKWTLALLIGLGTGLVAFFNNLAVENIAGFKLLLTNNLMLKDRYHEAFLTYAGCN  130

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
             VL   A+ LC + AP AAG GIPE+KAYLNGVD
Sbjct  131  LVLAAAAAALCAYVAPAAAGSGIPEVKAYLNGVD  164



>ref|XP_009358559.1| PREDICTED: putative chloride channel-like protein CLC-g [Pyrus 
x bretschneideri]
Length=778

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 107/160 (67%), Gaps = 3/160 (2%)
 Frame = +3

Query  132  RDPESNSLHQPLLL-KRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQ  308
             DPES  +  PL+  +R    S+S +A+VGA V  IESLDYEI EN+ FK DWRS  +  
Sbjct  15   EDPES--ITAPLISHQRYAPNSTSQVALVGANVRPIESLDYEILENEFFKQDWRSCGKAH  72

Query  309  VLQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGA  488
            VLQY+F+KW   FLVG++ G+IA   NLAVENIAG K +   + + ++R+ + FA F  +
Sbjct  73   VLQYIFMKWVSCFLVGIVVGLIAFCNNLAVENIAGVKFVVTSNMMLQRRFWLAFAVFFFS  132

Query  489  NFVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            N  LT  A V+  F AP AAG GIPE+KAYLNGVD P ++
Sbjct  133  NLGLTLFAVVVTAFVAPAAAGSGIPEVKAYLNGVDAPGIY  172



>ref|XP_010999722.1| PREDICTED: chloride channel protein CLC-c-like [Populus euphratica]
 ref|XP_010999723.1| PREDICTED: chloride channel protein CLC-c-like [Populus euphratica]
Length=784

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 102/145 (70%), Gaps = 2/145 (1%)
 Frame = +3

Query  159  QPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWT  338
            +PLL+KR  T S +  A+VGA +S IESLDYEI EN+LFK DWRSR + Q+ QY+ LKW 
Sbjct  46   EPLLVKRRNTTSQT--AIVGANISPIESLDYEIAENELFKQDWRSRKKVQIFQYILLKWA  103

Query  339  LAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASV  518
             A L+GL TG++    N+AVENI+G+KLL     + K+ Y   FA FAG N VL   A+ 
Sbjct  104  FALLIGLFTGLVGFFNNIAVENISGFKLLLTNKLMRKQHYYKAFAAFAGCNMVLAAAAAA  163

Query  519  LCVFFAPTAAGPGIPEIKAYLNGVD  593
            LC F AP AAG GIPE+KAYLNG+D
Sbjct  164  LCAFIAPAAAGSGIPEVKAYLNGID  188



>ref|XP_008786445.1| PREDICTED: chloride channel protein CLC-c-like [Phoenix dactylifera]
Length=778

 Score =   157 bits (398),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 107/154 (69%), Gaps = 0/154 (0%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
             D +   + QPLLL++    ++S +A+VGA V  IESLDYEI ENDLFK DWRSR + Q+
Sbjct  28   EDEKEAGMRQPLLLRKRTMNTTSQIAIVGANVCSIESLDYEIVENDLFKQDWRSRKKVQI  87

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
             QY+ LKWTLA L+GL TG++    NLAVENIAG+KLL   D + + R+   F  ++G N
Sbjct  88   FQYIVLKWTLALLIGLGTGLVGFFNNLAVENIAGFKLLLTSDLMLEHRFFAAFLAYSGCN  147

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
             VL   A+ +C + AP AAG GIPE+KAYLNG+D
Sbjct  148  LVLAAAAAAICAYIAPAAAGSGIPEVKAYLNGID  181



>emb|CBI27719.3| unnamed protein product [Vitis vinifera]
Length=742

 Score =   157 bits (397),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 105/149 (70%), Gaps = 2/149 (1%)
 Frame = +3

Query  159  QPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWT  338
            +PLL KR  T  +S +A+VGA V  IESLDYEI EN+LFK DWRSR + Q+ QYV LKW 
Sbjct  6    EPLLTKRMNT--TSQIAIVGANVCSIESLDYEIVENELFKQDWRSRKKAQIFQYVVLKWA  63

Query  339  LAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASV  518
            LA L+GL TG++    N+AVENIAG+KLL   D++ +K+Y   FA +A  N  L   A+ 
Sbjct  64   LALLIGLGTGLVGFFNNIAVENIAGFKLLLTSDFMSQKKYFKAFAAYASCNIGLAAAAAA  123

Query  519  LCVFFAPTAAGPGIPEIKAYLNGVDTPNM  605
            LC F AP AAG GIPE+KAYLNG+D  ++
Sbjct  124  LCAFIAPAAAGSGIPEVKAYLNGIDAHSI  152



>ref|XP_008806106.1| PREDICTED: chloride channel protein CLC-c-like [Phoenix dactylifera]
 ref|XP_008806107.1| PREDICTED: chloride channel protein CLC-c-like [Phoenix dactylifera]
Length=765

 Score =   157 bits (397),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 107/148 (72%), Gaps = 1/148 (1%)
 Frame = +3

Query  150  SLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFL  329
             + +PLL +R +  ++S LA+VGA VS IESLDYEI ENDL+K DWRSR + Q+ QYV L
Sbjct  23   GMREPLLRRRTMN-TTSQLAIVGANVSPIESLDYEIVENDLYKQDWRSRRKVQIFQYVVL  81

Query  330  KWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFV  509
            KWTLA L+GL TG++    NLAVENIAG+KLL   + + K+RY   F  +AG N VL   
Sbjct  82   KWTLALLIGLGTGLVGFFNNLAVENIAGFKLLLTNNLMLKERYREAFLAYAGCNLVLAAA  141

Query  510  ASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            A+ LC + AP AAG GIPE+KAYLNGVD
Sbjct  142  AAALCAYVAPAAAGSGIPEVKAYLNGVD  169



>ref|NP_001268085.1| uncharacterized protein LOC100259734 [Vitis vinifera]
 ref|XP_010653021.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653022.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653023.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653024.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653025.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653026.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653027.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 gb|ADK66981.1| chloride channel ClC3 [Vitis vinifera]
Length=780

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 105/150 (70%), Gaps = 2/150 (1%)
 Frame = +3

Query  159  QPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWT  338
            +PLL KR  T  +S +A+VGA V  IESLDYEI EN+LFK DWRSR + Q+ QYV LKW 
Sbjct  44   EPLLTKRMNT--TSQIAIVGANVCSIESLDYEIVENELFKQDWRSRKKAQIFQYVVLKWA  101

Query  339  LAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASV  518
            LA L+GL TG++    N+AVENIAG+KLL   D++ +K+Y   FA +A  N  L   A+ 
Sbjct  102  LALLIGLGTGLVGFFNNIAVENIAGFKLLLTSDFMSQKKYFKAFAAYASCNIGLAAAAAA  161

Query  519  LCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            LC F AP AAG GIPE+KAYLNG+D  ++ 
Sbjct  162  LCAFIAPAAAGSGIPEVKAYLNGIDAHSIL  191



>ref|XP_009393492.1| PREDICTED: chloride channel protein CLC-c [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393493.1| PREDICTED: chloride channel protein CLC-c [Musa acuminata subsp. 
malaccensis]
Length=780

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 107/153 (70%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            D +   + +PLL +R +  ++S LA+VGA V  IESLDYEI ENDL+K DWRSR + Q+ 
Sbjct  32   DDKEAGMREPLLRRRTMN-TTSQLAVVGANVCPIESLDYEIVENDLYKEDWRSRKKAQIF  90

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QYV LKWTLA L+GL+TG++    NLAVENIAG+KLL   + + K  Y   F  +AG N 
Sbjct  91   QYVVLKWTLALLIGLVTGLVGFFNNLAVENIAGFKLLLTSNLMLKHSYHKAFVVYAGCNL  150

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
            VL   A+ LC + AP AAG GIPE+KAYLNGVD
Sbjct  151  VLAAAAAALCAYVAPAAAGSGIPEVKAYLNGVD  183



>emb|CDM85188.1| unnamed protein product [Triticum aestivum]
Length=771

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 99/150 (66%), Gaps = 1/150 (1%)
 Frame = +3

Query  144  SNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYV  323
            +  L +PLL +R  + ++S +A+VG  V  IESLDYEI ENDL+K DWRSR R QV QY 
Sbjct  51   AGGLERPLLRQRG-SNTTSQMAVVGTNVCPIESLDYEIVENDLYKQDWRSRGRIQVFQYQ  109

Query  324  FLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLT  503
             LKW +A LVG   G++    N+AVENIAGYKLL   + + + R L  F  +   N VL 
Sbjct  110  VLKWLMALLVGSFVGLVGFFNNIAVENIAGYKLLLTSNLMRQNRNLEAFLLYMACNAVLA  169

Query  504  FVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
              A+ +C + AP AAG GIPE+KAYLNGVD
Sbjct  170  GSAAAICAYLAPAAAGSGIPEVKAYLNGVD  199



>gb|AAQ56538.1| putative chloride channel [Oryza sativa Japonica Group]
 gb|AAQ56565.1| putative chloride channel protein [Oryza sativa Japonica Group]
 dbj|BAC92420.1| putative chloride channel protein [Oryza sativa Japonica Group]
 gb|EAZ06475.1| hypothetical protein OsI_28712 [Oryza sativa Indica Group]
 gb|EAZ42255.1| hypothetical protein OsJ_26819 [Oryza sativa Japonica Group]
 dbj|BAG89940.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAI39689.1| putative chloride channel [Oryza sativa Indica Group]
Length=796

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 100/155 (65%), Gaps = 4/155 (3%)
 Frame = +3

Query  156  HQP----LLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYV  323
            H+P     LL R+ T ++S +AMVG+    IESLDYEI ENDLF  +WRSR +   ++YV
Sbjct  18   HRPPLNRALLHRSATNNTSQVAMVGSNPCPIESLDYEIIENDLFDQNWRSRGKADQVRYV  77

Query  324  FLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLT  503
             LKWT  F +G++TGI   +INLAVEN+AG K  AV   ++   Y   F  FAG N  L 
Sbjct  78   VLKWTFCFAIGIITGIAGFVINLAVENVAGLKHTAVSALMESSSYWTAFWLFAGTNLALL  137

Query  504  FVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
              AS +  F +P A G GIPE+KAYLNGVD PN+F
Sbjct  138  LFASSITAFVSPAAGGSGIPEVKAYLNGVDAPNIF  172



>ref|XP_004952777.1| PREDICTED: chloride channel protein CLC-c-like [Setaria italica]
Length=950

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 107/151 (71%), Gaps = 1/151 (1%)
 Frame = +3

Query  141  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  320
            +  S H+PLL KR +  ++S +A+VGA V  IESLDYE+ ENDLFK DWRSR + Q+ QY
Sbjct  196  DRGSTHEPLLRKRTMN-TTSQIAIVGANVCPIESLDYEVVENDLFKQDWRSRKKKQIFQY  254

Query  321  VFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVL  500
            + LKW+L  L+GLLTG++    NLAVENIAG+KLL   D +  +RY+  F  + G N VL
Sbjct  255  IVLKWSLVLLIGLLTGVVGFFNNLAVENIAGFKLLLTSDLMLNERYIKAFFVYGGCNLVL  314

Query  501  TFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
               A+ +C + AP AAG GIPE+KAYLNGVD
Sbjct  315  AASAAAICAYIAPAAAGSGIPEVKAYLNGVD  345



>gb|KJB64678.1| hypothetical protein B456_010G060300 [Gossypium raimondii]
Length=774

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 103/156 (66%), Gaps = 1/156 (1%)
 Frame = +3

Query  141  ESNSLHQPLLLKRNLTL-SSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQ  317
            + +SL  PLL  +  ++ S+S +A+VGA V  IESLDYEI END FK DWR+R + Q+ Q
Sbjct  12   DHDSLTIPLLSHQQRSINSTSQVAIVGANVCPIESLDYEIVENDFFKQDWRARGKVQIFQ  71

Query  318  YVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFV  497
            Y+F+KW L FL+G    +     NLAVENIAG K +   + +  +RY M F  F+ +N  
Sbjct  72   YIFMKWLLCFLIGGFVSLAGFFNNLAVENIAGVKFVITSNMMLAQRYWMAFLVFSLSNLA  131

Query  498  LTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNM  605
            LT  A+++  F +P AAG GIPE+KAYLNGVD P +
Sbjct  132  LTLFAAIITAFISPAAAGSGIPEVKAYLNGVDAPGI  167



>ref|XP_008457165.1| PREDICTED: putative chloride channel-like protein CLC-g [Cucumis 
melo]
Length=773

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 102/155 (66%), Gaps = 0/155 (0%)
 Frame = +3

Query  141  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  320
            +  S+  PLL +++L  SSS +A+VGA V  IESLDYEI +N+ F  DWRSR   Q+ QY
Sbjct  10   DEESIITPLLAQKSLANSSSQVAIVGANVCPIESLDYEIFDNECFMQDWRSRGDFQIFQY  69

Query  321  VFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVL  500
            + +KW   FL+GL+ G++    NLAVENIAG K +   + + + RY M F  F+ +N VL
Sbjct  70   LVMKWLSCFLIGLIMGLVGFFNNLAVENIAGKKFVVTSNMMLEGRYGMAFLVFSVSNLVL  129

Query  501  TFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNM  605
            T  ASV+     P AAG GIPE+KAYLNGVD P +
Sbjct  130  TLFASVITALICPQAAGSGIPEVKAYLNGVDAPGI  164



>gb|EYU34964.1| hypothetical protein MIMGU_mgv1a001646mg [Erythranthe guttata]
Length=779

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 104/159 (65%), Gaps = 0/159 (0%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            R+P       P LL+R+ + S+S +A+VG+ +  +ESLDYEI END FK DWR R +T++
Sbjct  19   REPLLQQDQPPPLLQRSRSNSTSQVAVVGSNLCPVESLDYEIIENDFFKQDWRGRGKTEI  78

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
             QY+ +KW    L+GL+  +I    NLA+ENI+G K +     +  +R+ + F  FA +N
Sbjct  79   FQYISMKWIFCLLIGLIVSLIGFFNNLAIENISGMKFVITSYMMLHRRFGVAFTVFAASN  138

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            F L  +AS++  F AP AAG GIPE+KAYLNG+D P +F
Sbjct  139  FSLALLASLITAFIAPEAAGSGIPEVKAYLNGIDAPAIF  177



>ref|XP_011078419.1| PREDICTED: putative chloride channel-like protein CLC-g [Sesamum 
indicum]
Length=834

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 109/158 (69%), Gaps = 3/158 (2%)
 Frame = +3

Query  144  SNSLHQPLLL---KRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  314
            S  L +PLLL   +R+ + ++S +A+VG+ +  IESLDYEI END FK DWR+     + 
Sbjct  77   SEVLREPLLLLQDQRSRSNTTSQVAIVGSDLCPIESLDYEIIENDFFKQDWRTMGTVDIF  136

Query  315  QYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANF  494
            QY+F+KWTL FL+G++  ++  L NLA+ENIAG K +   + +  +++++ F  FA +N 
Sbjct  137  QYIFIKWTLCFLIGVIVSLLGFLNNLAIENIAGVKFVITSNMMLARKFVVAFIVFASSNL  196

Query  495  VLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
             LTF++S++    AP AAG GIPE+KAYLNGVD P +F
Sbjct  197  GLTFLSSLVTALIAPEAAGSGIPEVKAYLNGVDAPAIF  234



>ref|NP_001267618.1| putative chloride channel-like protein CLC-g-like [Cucumis sativus]
 gb|AFJ15540.1| chloride channel g [Cucumis sativus]
 gb|KGN60713.1| hypothetical protein Csa_2G008050 [Cucumis sativus]
Length=775

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 102/155 (66%), Gaps = 0/155 (0%)
 Frame = +3

Query  141  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  320
            +  S+  PLL +++L  SSS +A+VGA V  IESLDYEI +N+ F  DWRSR   Q+ QY
Sbjct  12   DEESIITPLLAQKSLANSSSQVAIVGANVCPIESLDYEIFDNECFMQDWRSRGDFQIFQY  71

Query  321  VFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVL  500
            + +KW   FL+GL+ G++    NLAVENIAG K +   + + + RY M F  F+ +N VL
Sbjct  72   LVMKWLSCFLIGLIMGLVGFFNNLAVENIAGKKFVITSNMMLEGRYGMAFLVFSVSNLVL  131

Query  501  TFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNM  605
            T  ASV+     P AAG GIPE+KAYLNGVD P +
Sbjct  132  TLFASVITALICPQAAGSGIPEVKAYLNGVDAPGI  166



>ref|XP_011047852.1| PREDICTED: chloride channel protein CLC-c-like [Populus euphratica]
Length=768

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 108/152 (71%), Gaps = 1/152 (1%)
 Frame = +3

Query  153  LHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  332
            L +P L+ RN+  ++S +A+VGA    IESLDYEI +N+LFK DWRSR + ++ QYV LK
Sbjct  27   LREPFLV-RNIKNNTSQIAIVGANTCPIESLDYEITDNELFKQDWRSRKKVEIYQYVVLK  85

Query  333  WTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVA  512
            WTLA L+GL TG++    NLAVENIAG+KLL   + + + +Y   FA +AG N VL   A
Sbjct  86   WTLALLIGLGTGLVGFFNNLAVENIAGFKLLLTNNLMLENKYYQAFATYAGCNVVLAIAA  145

Query  513  SVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
            + LC + AP AAG GIPE+KAYLNGVD P++ 
Sbjct  146  AALCAYVAPAAAGSGIPEVKAYLNGVDAPSIL  177



>ref|XP_004165980.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
[Cucumis sativus]
Length=790

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 102/155 (66%), Gaps = 0/155 (0%)
 Frame = +3

Query  141  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  320
            +  S+  PLL +++L  SSS +A+VGA V  IESLDYEI +N+ F  DWRSR   Q+ QY
Sbjct  12   DEESIITPLLAQKSLANSSSQVAIVGANVCPIESLDYEIFDNECFMQDWRSRGDFQIFQY  71

Query  321  VFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVL  500
            + +KW   FL+GL+ G++    NLAVENIAG K +   + + + RY M F  F+ +N VL
Sbjct  72   LVMKWLSCFLIGLIMGLVGFFNNLAVENIAGKKFVITSNMMLEGRYGMAFLVFSVSNLVL  131

Query  501  TFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNM  605
            T  ASV+     P AAG GIPE+KAYLNGVD P +
Sbjct  132  TLFASVITALICPQAAGSGIPEVKAYLNGVDAPGI  166



>ref|NP_001105216.1| LOC542114 [Zea mays]
 gb|AAP04392.2| chloride channel [Zea mays]
Length=786

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 105/151 (70%), Gaps = 1/151 (1%)
 Frame = +3

Query  141  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  320
            +  S  QPLL KR +  ++S +A+VGA V  IESLDYE+ ENDLFK DWRSR + Q+ QY
Sbjct  32   DHGSTQQPLLRKRTVN-TTSQIAIVGANVCPIESLDYEVVENDLFKQDWRSRKKKQIFQY  90

Query  321  VFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVL  500
            + LKW+L  L+GLLTG +    NLAVENIAG+KLL   D + K RY+  F  + G N VL
Sbjct  91   IVLKWSLVLLIGLLTGFVGFFNNLAVENIAGFKLLLTSDLMLKGRYIRAFFVYGGCNLVL  150

Query  501  TFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
               A+ +C + AP AAG GIPE+KAYLNGVD
Sbjct  151  AAAAAAICAYIAPAAAGSGIPEVKAYLNGVD  181



>dbj|BAJ97961.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=739

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 108/154 (70%), Gaps = 1/154 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            R  +  S+H+PL+ KR +  ++S +A+VGA +  IESLDYE+ EN+LFK DWRSR + Q+
Sbjct  48   RYDDRQSVHEPLMRKRTIN-TASQIAIVGANICPIESLDYEVVENNLFKQDWRSRKKKQI  106

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
             QY+ +KWTL  L+GLLTG++    NLAVENIAG KLL   D +  +RY   F  + G+N
Sbjct  107  FQYIVMKWTLVLLIGLLTGLVGFFNNLAVENIAGLKLLITSDLMLNQRYFTAFLAYGGSN  166

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
             VL   A+ +C + AP AAG GIPE+KAYLNGVD
Sbjct  167  LVLAAAAAAICAYIAPAAAGSGIPEVKAYLNGVD  200



>ref|XP_010928311.1| PREDICTED: putative chloride channel-like protein CLC-g [Elaeis 
guineensis]
Length=790

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 104/159 (65%), Gaps = 1/159 (1%)
 Frame = +3

Query  132  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  311
            R+P    LH  + L+R+   S+S +A++G+ +  IESLDYE+ ENDLF  DWRSR R  +
Sbjct  21   REPLLEHLHS-INLRRHAPNSTSQVAIIGSNLCPIESLDYEMIENDLFNQDWRSRGRAAI  79

Query  312  LQYVFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGAN  491
            LQY+ LKWTL FLVG+L G +    NLA+EN+AG K +A    +   +Y + F  FA +N
Sbjct  80   LQYISLKWTLCFLVGILAGAVGFFNNLAIENLAGIKFVAFSKLMLANKYWLAFGMFAASN  139

Query  492  FVLTFVASVLCVFFAPTAAGPGIPEIKAYLNGVDTPNMF  608
              L   AS +  + +  AAG GIPE+KAYLNGVD P++F
Sbjct  140  LALLLSASTITSYISTAAAGSGIPEVKAYLNGVDAPDIF  178



>ref|XP_008644266.1| PREDICTED: LOC542114 isoform X1 [Zea mays]
 gb|AFW71856.1| chloride channel [Zea mays]
Length=813

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 105/151 (70%), Gaps = 1/151 (1%)
 Frame = +3

Query  141  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  320
            +  S  QPLL KR +  ++S +A+VGA V  IESLDYE+ ENDLFK DWRSR + Q+ QY
Sbjct  59   DRGSTQQPLLRKRTVN-TTSQIAIVGANVCPIESLDYEVVENDLFKQDWRSRKKKQIFQY  117

Query  321  VFLKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVL  500
            + LKW+L  L+GLLTG +    NLAVENIAG+KLL   D + K RY+  F  + G N VL
Sbjct  118  IVLKWSLVLLIGLLTGFVGFFNNLAVENIAGFKLLLTSDLMLKGRYIRAFFVYGGCNLVL  177

Query  501  TFVASVLCVFFAPTAAGPGIPEIKAYLNGVD  593
               A+ +C + AP AAG GIPE+KAYLNGVD
Sbjct  178  AAAAAAICAYIAPAAAGSGIPEVKAYLNGVD  208



>gb|EEC73409.1| hypothetical protein OsI_07665 [Oryza sativa Indica Group]
Length=708

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 105/145 (72%), Gaps = 1/145 (1%)
 Frame = +3

Query  159  QPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWT  338
            +PLL KR +  ++S +A+VGA V  IESLDYE+ ENDLFK DWRSR + Q+ QY+ LKWT
Sbjct  56   EPLLRKRTMN-TTSQIAIVGANVCPIESLDYEVVENDLFKQDWRSRKKKQIFQYIVLKWT  114

Query  339  LAFLVGLLTGIIATLINLAVENIAGYKLLAVVDYIDKKRYLMGFAYFAGANFVLTFVASV  518
            L  L+GLLTG++    NLAVENIAG+KLL   + + K+RYL  F  + G N VL   A+ 
Sbjct  115  LVLLIGLLTGLVGFFNNLAVENIAGFKLLLTGNLMLKERYLTAFFAYGGCNLVLAAAAAA  174

Query  519  LCVFFAPTAAGPGIPEIKAYLNGVD  593
            +C + AP AAG GIPE+KAYLNGVD
Sbjct  175  ICAYIAPAAAGSGIPEVKAYLNGVD  199



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520