BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS012B03

Length=617
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010108239.1|  Phosphoenolpyruvate carboxylase, housekeepin...    239   3e-76   
ref|XP_011098224.1|  PREDICTED: phosphoenolpyruvate carboxylase         236   1e-74   Sesamum indicum [beniseed]
ref|XP_009340037.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    234   1e-74   Pyrus x bretschneideri [bai li]
ref|XP_008386247.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    233   1e-74   Malus domestica [apple tree]
ref|XP_009783765.1|  PREDICTED: phosphoenolpyruvate carboxylase         239   3e-74   Nicotiana sylvestris
ref|XP_009604678.1|  PREDICTED: phosphoenolpyruvate carboxylase         238   4e-74   Nicotiana tomentosiformis
ref|XP_011082759.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    229   5e-74   Sesamum indicum [beniseed]
ref|XP_002316861.1|  phosphoenolpyruvate carboxylase family protein     232   9e-74   
sp|P27154.1|CAPP_TOBAC  RecName: Full=Phosphoenolpyruvate carboxy...    237   1e-73   Nicotiana tabacum [American tobacco]
ref|XP_002530381.1|  Phosphoenolpyruvate carboxylase, putative          230   2e-73   Ricinus communis
gb|ABR29876.1|  phosphoenolpyruvate carboxylase                         230   2e-73   Ricinus communis
ref|XP_006370158.1|  phosphoenolpyruvate carboxylase family protein     233   2e-73   Populus trichocarpa [western balsam poplar]
ref|XP_009334045.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    229   2e-73   Pyrus x bretschneideri [bai li]
ref|XP_010060690.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    231   3e-73   Eucalyptus grandis [rose gum]
gb|EYU45020.1|  hypothetical protein MIMGU_mgv1a000847mg                232   3e-73   Erythranthe guttata [common monkey flower]
ref|XP_008463734.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    233   3e-73   Cucumis melo [Oriental melon]
ref|XP_009762944.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    226   4e-73   Nicotiana sylvestris
ref|XP_009607156.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    225   4e-73   Nicotiana tomentosiformis
ref|XP_011029569.1|  PREDICTED: phosphoenolpyruvate carboxylase         232   6e-73   Populus euphratica
ref|XP_006360045.1|  PREDICTED: phosphoenolpyruvate carboxylase-l...    234   6e-73   Solanum tuberosum [potatoes]
gb|KDO63365.1|  hypothetical protein CISIN_1g002112mg                   227   8e-73   Citrus sinensis [apfelsine]
emb|CBI20195.3|  unnamed protein product                                233   8e-73   Vitis vinifera
ref|XP_006446789.1|  hypothetical protein CICLE_v10014164mg             227   8e-73   Citrus clementina [clementine]
gb|KDO63363.1|  hypothetical protein CISIN_1g002112mg                   227   8e-73   Citrus sinensis [apfelsine]
ref|XP_002285441.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    232   9e-73   Vitis vinifera
gb|KDO63366.1|  hypothetical protein CISIN_1g002112mg                   226   1e-72   Citrus sinensis [apfelsine]
ref|XP_006469015.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    226   1e-72   
ref|XP_011005507.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    231   1e-72   Populus euphratica
gb|AFN70425.1|  phosphoenolpyruvate carboxylase                         229   1e-72   Manihot esculenta subsp. flabellifolia
ref|XP_008367955.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    227   1e-72   
gb|AJP17168.1|  phosphoenolpyruvate carboxylase 2                       229   2e-72   Prunus sibirica [Siberian apricot]
ref|XP_008229092.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       229   2e-72   Prunus mume [ume]
ref|NP_001267517.1|  phosphoenolpyruvate carboxylase, housekeepin...    230   3e-72   Cucumis sativus [cucumbers]
ref|XP_009766373.1|  PREDICTED: phosphoenolpyruvate carboxylase         233   3e-72   Nicotiana sylvestris
ref|XP_009598007.1|  PREDICTED: phosphoenolpyruvate carboxylase         233   4e-72   Nicotiana tomentosiformis
ref|XP_007213682.1|  hypothetical protein PRUPE_ppa000910mg             226   5e-72   Prunus persica
emb|CDP00977.1|  unnamed protein product                                221   5e-72   Coffea canephora [robusta coffee]
ref|XP_008226531.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    226   5e-72   Prunus mume [ume]
ref|XP_010104390.1|  Phosphoenolpyruvate carboxylase 2                  220   5e-72   Morus notabilis
ref|NP_001237602.1|  phosphoenolpyruvate carboxylase, housekeepin...    222   6e-72   Glycine max [soybeans]
gb|ACC66283.1|  phosphoenolpyruvate carboxylase                         227   7e-72   Suaeda glauca
ref|XP_004248242.1|  PREDICTED: phosphoenolpyruvate carboxylase         233   8e-72   Solanum lycopersicum
ref|XP_007214986.1|  hypothetical protein PRUPE_ppa002020mg             228   1e-71   
sp|Q9FV65.1|CAPPC_FLATR  RecName: Full=Phosphoenolpyruvate carbox...    233   1e-71   Flaveria trinervia
emb|CDP06006.1|  unnamed protein product                                221   1e-71   Coffea canephora [robusta coffee]
ref|XP_004303182.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       234   1e-71   Fragaria vesca subsp. vesca
gb|KHG25857.1|  Phosphoenolpyruvate carboxylase 2                       221   3e-71   Gossypium arboreum [tree cotton]
gb|KJB27013.1|  hypothetical protein B456_004G272100                    221   3e-71   Gossypium raimondii
ref|XP_010675388.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       229   3e-71   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB27012.1|  hypothetical protein B456_004G272100                    221   3e-71   Gossypium raimondii
gb|AFN70424.1|  phosphoenolpyruvate carboxylase                         224   5e-71   Manihot esculenta [manioc]
ref|XP_007021728.1|  Phosphoenolpyruvate carboxylase 3 isoform 1        221   6e-71   
gb|KHG02548.1|  Phosphoenolpyruvate carboxylase, housekeeping iso...    220   7e-71   Gossypium arboreum [tree cotton]
ref|XP_002518037.1|  Phosphoenolpyruvate carboxylase, putative          223   9e-71   
gb|KJB13196.1|  hypothetical protein B456_002G061400                    219   1e-70   Gossypium raimondii
ref|XP_008368627.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    224   1e-70   
ref|XP_008342775.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    224   1e-70   
ref|XP_003527207.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    222   1e-70   Glycine max [soybeans]
ref|XP_004294066.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       224   1e-70   Fragaria vesca subsp. vesca
gb|KHN48472.1|  Phosphoenolpyruvate carboxylase, housekeeping iso...    222   1e-70   Glycine soja [wild soybean]
ref|XP_006582125.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    222   2e-70   Glycine max [soybeans]
gb|EYU26325.1|  hypothetical protein MIMGU_mgv1a000844mg                224   2e-70   Erythranthe guttata [common monkey flower]
gb|AJD81367.1|  phosphoenolpyruvate carboxylase isoform 1               218   2e-70   Egeria densa
emb|CAA62469.1|  phosphoenolpyruvate carboxylase                        228   2e-70   Solanum tuberosum [potatoes]
emb|CAC28225.1|  phosphoenolpyruvate carboxylase                        224   3e-70   Sesbania rostrata
ref|XP_006852422.1|  hypothetical protein AMTR_s00021p00059810          219   4e-70   Amborella trichopoda
sp|Q01647.1|CAPP1_FLAPR  RecName: Full=Phosphoenolpyruvate carbox...    231   4e-70   Flaveria pringlei
gb|AAM14597.1|AF494192_1  phosphoenolpyruvate carboxylase FPUB966       231   4e-70   Flaveria pubescens
emb|CAA88829.1|  phosphoenolpyruvate carboxylase                        231   4e-70   Flaveria pringlei
ref|NP_001274942.1|  phosphoenolpyruvate carboxylase                    227   5e-70   Solanum tuberosum [potatoes]
ref|XP_006358941.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    227   5e-70   
ref|XP_009354255.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       223   6e-70   Pyrus x bretschneideri [bai li]
ref|XP_010279120.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    218   1e-69   Nelumbo nucifera [Indian lotus]
gb|KDP36288.1|  hypothetical protein JCGZ_09795                         220   1e-69   Jatropha curcas
gb|EPS69468.1|  hypothetical protein M569_05291                         220   1e-69   Genlisea aurea
gb|KJB82054.1|  hypothetical protein B456_013G173500                    214   1e-69   Gossypium raimondii
gb|KJB82053.1|  hypothetical protein B456_013G173500                    214   2e-69   Gossypium raimondii
gb|AAM14596.1|AF494191_1  phosphoenolpyruvate carboxylase FB966         229   2e-69   Flaveria brownii
gb|KHG25331.1|  Phosphoenolpyruvate carboxylase 2                       226   2e-69   Gossypium arboreum [tree cotton]
gb|KJB33217.1|  hypothetical protein B456_006G001300                    226   2e-69   Gossypium raimondii
ref|XP_009357178.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    221   2e-69   Pyrus x bretschneideri [bai li]
gb|KDP32538.1|  hypothetical protein JCGZ_14741                         216   2e-69   Jatropha curcas
ref|XP_004251893.1|  PREDICTED: phosphoenolpyruvate carboxylase         224   2e-69   Solanum lycopersicum
ref|XP_004297535.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    230   3e-69   Fragaria vesca subsp. vesca
ref|XP_007133202.1|  hypothetical protein PHAVU_011G160200g             216   4e-69   Phaseolus vulgaris [French bean]
gb|AAB80714.1|  phosphoenolpyruvate carboxylase 1                       224   4e-69   Gossypium hirsutum [American cotton]
gb|ABV80356.1|  phosphoenolpyruvate carboxylase                         214   5e-69   Gossypium hirsutum [American cotton]
ref|NP_001241357.1|  phosphoenolpyruvate carboxylase                    216   5e-69   Glycine max [soybeans]
gb|ABU41519.1|  phosphoenolpyruvate carboxylase                         217   6e-69   Jatropha curcas
sp|Q9FV66.1|CAPPB_FLATR  RecName: Full=Phosphoenolpyruvate carbox...    227   6e-69   Flaveria trinervia
gb|AJD81369.1|  phosphoenolpyruvate carboxylase isoform 3               214   1e-68   Egeria densa
ref|XP_006306678.1|  hypothetical protein CARUB_v10008196mg             222   1e-68   
sp|Q9AU12.1|CAPP_PHAVU  RecName: Full=Phosphoenolpyruvate carboxy...    217   1e-68   Phaseolus vulgaris [French bean]
gb|AJD81371.1|  phosphoenolpyruvate carboxylase isoform 5               215   1e-68   Egeria densa
ref|XP_007149391.1|  hypothetical protein PHAVU_005G066400g             217   1e-68   Phaseolus vulgaris [French bean]
ref|XP_010911773.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       217   2e-68   
gb|AJD81368.1|  phosphoenolpyruvate carboxylase isoform 2               212   2e-68   Egeria densa
ref|XP_008812088.1|  PREDICTED: SCAR-like protein 2                     213   2e-68   
gb|AAU07997.1|  phosphoenolpyruvate carboxylase 2                       217   2e-68   Lupinus albus
ref|XP_010552117.1|  PREDICTED: phosphoenolpyruvate carboxylase 3       218   3e-68   Tarenaya hassleriana [spider flower]
gb|KJB48959.1|  hypothetical protein B456_008G095300                    221   3e-68   Gossypium raimondii
gb|KHG11000.1|  Phosphoenolpyruvate carboxylase, housekeeping iso...    221   4e-68   Gossypium arboreum [tree cotton]
ref|XP_007048690.1|  Phosphoenolpyruvate carboxylase 3 isoform 1        219   4e-68   
ref|XP_006407030.1|  hypothetical protein EUTSA_v10019997mg             218   4e-68   Eutrema salsugineum [saltwater cress]
ref|NP_001237394.1|  phosphoenolpyruvate carboxylase                    215   4e-68   Glycine max [soybeans]
ref|XP_004516076.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    216   4e-68   Cicer arietinum [garbanzo]
ref|XP_002280569.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    219   4e-68   Vitis vinifera
emb|CBI21984.3|  unnamed protein product                                218   4e-68   Vitis vinifera
ref|NP_001236741.1|  phosphoenolpyruvate carboxylase                    216   5e-68   
ref|XP_006593478.1|  PREDICTED: phosphoenolpyruvate carboxylase i...    215   6e-68   
ref|XP_007149740.1|  hypothetical protein PHAVU_005G095300g             212   6e-68   Phaseolus vulgaris [French bean]
ref|XP_003543306.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    214   6e-68   Glycine max [soybeans]
gb|KHN36882.1|  Phosphoenolpyruvate carboxylase                         215   6e-68   Glycine soja [wild soybean]
gb|KHN36697.1|  Phosphoenolpyruvate carboxylase 2                       214   7e-68   Glycine soja [wild soybean]
ref|XP_007132856.1|  hypothetical protein PHAVU_011G130400g             213   7e-68   Phaseolus vulgaris [French bean]
gb|AAO15570.1|AF459644_1  phosphoenolpyruvate carboxylase               215   7e-68   Lupinus albus
gb|KEH19559.1|  phosphoenolpyruvate carboxylase                         219   8e-68   Medicago truncatula
gb|KEH19560.1|  phosphoenolpyruvate carboxylase                         219   8e-68   Medicago truncatula
emb|CAB65170.1|  phosphoenolpyruvate carboxylase 1                      219   8e-68   Solanum lycopersicum var. cerasiforme [cherry tomato]
ref|XP_010920051.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoenolp...    213   8e-68   
ref|XP_011012152.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    221   9e-68   Populus euphratica
emb|CAA45504.1|  phosphoenolpyruvate carboxylase                        224   9e-68   Flaveria trinervia
gb|KFK38845.1|  phosphoenolpyruvate carboxylase                         216   1e-67   Arabis alpina [alpine rockcress]
gb|ABR29878.1|  phosphoenolpyruvate carboxylase                         213   1e-67   Ricinus communis
pdb|3ZGB|A  Chain A, Greater Efficiency Of Photosynthetic Carbon ...    223   1e-67   Flaveria pringlei
ref|XP_010542308.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    218   1e-67   Tarenaya hassleriana [spider flower]
ref|XP_002882904.1|  ATPPC3                                             216   1e-67   Arabidopsis lyrata subsp. lyrata
gb|EEC83482.1|  hypothetical protein OsI_28999                          209   1e-67   Oryza sativa Indica Group [Indian rice]
ref|XP_002894435.1|  ATPPC1                                             218   2e-67   
ref|XP_010479886.1|  PREDICTED: phosphoenolpyruvate carboxylase 1       218   2e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010500970.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    218   2e-67   Camelina sativa [gold-of-pleasure]
ref|NP_001061646.1|  Os08g0366000                                       209   2e-67   
ref|XP_006296907.1|  hypothetical protein CARUB_v10012899mg             215   2e-67   Capsella rubella
tpg|DAA61010.1|  TPA: phosphoenolpyruvate carboxylase4                  206   2e-67   
ref|XP_003597124.1|  Phosphoenolpyruvate carboxylase                    214   3e-67   Medicago truncatula
ref|XP_008813762.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    213   3e-67   Phoenix dactylifera
ref|NP_001275821.1|  phosphoenolpyruvate carboxylase                    216   3e-67   Citrus sinensis [apfelsine]
ref|XP_006306679.1|  hypothetical protein CARUB_v10008196mg             217   3e-67   Capsella rubella
ref|XP_006487452.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    216   4e-67   Citrus sinensis [apfelsine]
ref|XP_009406237.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    213   4e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006442514.1|  hypothetical protein CICLE_v10018719mg             215   4e-67   Citrus clementina [clementine]
emb|CAJ86550.1|  phosphoenolpyrovate carboxylase                        212   4e-67   Lupinus luteus
gb|AAO42888.1|  At3g14940                                               214   4e-67   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ34480.1|  unnamed protein product                                217   4e-67   Eutrema halophilum
ref|NP_188112.1|  phosphoenolpyruvate carboxylase 3                     214   4e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006392801.1|  hypothetical protein EUTSA_v10011967mg             216   5e-67   
ref|XP_009146304.1|  PREDICTED: phosphoenolpyruvate carboxylase 3       219   5e-67   Brassica rapa
ref|XP_008793018.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    216   6e-67   Phoenix dactylifera
gb|ABR17346.1|  unknown                                                 223   6e-67   Picea sitchensis
emb|CAJ84247.1|  phosphoenolpyruvate carboxylase                        213   6e-67   Lupinus luteus
dbj|BAH19953.1|  AT1G53310                                              216   6e-67   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175738.1|  phosphoenolpyruvate carboxylase 1                     216   6e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002302820.2|  hypothetical protein POPTR_0002s22720g             218   7e-67   
ref|XP_006659319.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    209   7e-67   Oryza brachyantha
ref|XP_004487157.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    208   8e-67   Cicer arietinum [garbanzo]
ref|XP_010052683.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       218   9e-67   Eucalyptus grandis [rose gum]
ref|XP_010925637.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    209   1e-66   
pdb|3ZGE|A  Chain A, Greater Efficiency Of Photosynthetic Carbon ...    220   1e-66   Flaveria trinervia
pdb|4BXH|B  Chain B, Resolving The Activation Site Of Positive Re...    220   1e-66   Flaveria trinervia
ref|XP_003527347.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    209   1e-66   Glycine max [soybeans]
dbj|BAC41248.1|  phosphoenolpyruvate carboxylase                        208   1e-66   Glycine max [soybeans]
prf||1801241A  phosphoenolpyruvate carboxylase                          220   1e-66
ref|XP_009395707.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       209   1e-66   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAA81072.1|  phosphoenolpyruvate carboxylase                        220   1e-66   Flaveria trinervia
sp|P30694.2|CAPPA_FLATR  RecName: Full=C4 phosphoenolpyruvate car...    220   1e-66   Flaveria trinervia
tpg|DAA61011.1|  TPA: phosphoenolpyruvate carboxylase4                  203   1e-66   
ref|XP_010277028.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    211   2e-66   Nelumbo nucifera [Indian lotus]
sp|P29194.1|CAPP2_SORBI  RecName: Full=Phosphoenolpyruvate carbox...    203   2e-66   Sorghum bicolor [broomcorn]
ref|XP_002462179.1|  hypothetical protein SORBIDRAFT_02g021090          203   2e-66   Sorghum bicolor [broomcorn]
ref|XP_010915515.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    210   2e-66   Elaeis guineensis
gb|AAU07999.1|  phosphoenolpyruvate carboxylase 4                       211   2e-66   Lupinus albus
gb|ACN32213.1|  phosphoenolpyruvate carboxylase                         209   2e-66   Arachis hypogaea [goober]
ref|XP_009135413.1|  PREDICTED: phosphoenolpyruvate carboxylase 3       212   2e-66   Brassica rapa
gb|ABY87944.1|  phosphoenolpyruvate carboxylase                         207   2e-66   Arachis hypogaea [goober]
sp|P51063.1|CAPP_PICAB  RecName: Full=Phosphoenolpyruvate carboxy...    221   2e-66   Picea abies
ref|XP_002444204.1|  hypothetical protein SORBIDRAFT_07g014960          207   3e-66   Sorghum bicolor [broomcorn]
gb|ACO48250.1|  phosphoenolpyruvate carboxylase                         207   4e-66   Arachis hypogaea [goober]
gb|AAO25631.1|  phosphoenolpyruvate carboxylase                         206   6e-66   Oryza sativa Indica Group [Indian rice]
gb|AAU07998.1|  phosphoenolpyruvate carboxylase 3                       209   6e-66   Lupinus albus
ref|XP_010465426.1|  PREDICTED: phosphoenolpyruvate carboxylase 3...    210   8e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010502354.1|  PREDICTED: phosphoenolpyruvate carboxylase 3       210   8e-66   
emb|CAC83481.1|  phosphoenolpyruvate carboxylase                        206   9e-66   Phalaenopsis equestris
emb|CAC83482.1|  phosphoenolpyruvate carboxylase                        206   9e-66   Phalaenopsis amabilis
ref|NP_001105438.1|  phosphoenolpyruvate carboxylase 2                  201   1e-65   Zea mays [maize]
ref|XP_004956559.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    201   1e-65   Setaria italica
gb|AAK58637.1|AF271163_1  phosphoenolpyruvate carboxylase isoform 3     204   1e-65   Hydrilla verticillata
ref|XP_003596385.1|  Phosphoenolpyruvate-carboxylase                    207   1e-65   Medicago truncatula
sp|Q02735.1|CAPP_MEDSA  RecName: Full=Phosphoenolpyruvate carboxy...    207   1e-65   Medicago sativa [alfalfa]
ref|XP_008781416.1|  PREDICTED: LOW QUALITY PROTEIN: SCAR-like pr...    205   1e-65   
ref|XP_004505496.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    208   1e-65   Cicer arietinum [garbanzo]
gb|AAK58635.2|AF271161_1  phosphoenolpyruvate carboxylase isoform 1     204   2e-65   Hydrilla verticillata
ref|XP_010924612.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       211   2e-65   
gb|AAK58636.1|AF271162_1  phosphoenolpyruvate carboxylase isoform 2     205   3e-65   Hydrilla verticillata
ref|XP_009416509.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    206   3e-65   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY45929.1|  BnaC06g09980D                                          210   3e-65   Brassica napus [oilseed rape]
ref|XP_004489030.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    204   4e-65   
ref|XP_009106983.1|  PREDICTED: phosphoenolpyruvate carboxylase 1       210   5e-65   Brassica rapa
emb|CAA11415.1|  phosphoenolpyruvate carboxylase                        210   5e-65   Brassica juncea [brown mustard]
ref|XP_003577980.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       199   6e-65   Brachypodium distachyon [annual false brome]
ref|XP_010527380.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    209   6e-65   Tarenaya hassleriana [spider flower]
ref|XP_006348868.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    211   6e-65   Solanum tuberosum [potatoes]
emb|CAA11414.1|  phosphoenolpyrovate carboxylase                        209   7e-65   Brassica juncea [brown mustard]
sp|P16097.1|CAPP2_MESCR  RecName: Full=Phosphoenolpyruvate carbox...    210   7e-65   Mesembryanthemum crystallinum
dbj|BAC20365.1|  phosphoenolpyruvate carboxylase                        210   7e-65   Lotus japonicus
ref|NP_001267665.1|  phosphoenolpyruvate carboxylase 2-like             218   7e-65   Cucumis sativus [cucumbers]
emb|CDY25721.1|  BnaC03g69540D                                          209   7e-65   Brassica napus [oilseed rape]
emb|CDP15935.1|  unnamed protein product                                212   7e-65   Coffea canephora [robusta coffee]
gb|EMT08272.1|  Phosphoenolpyruvate carboxylase 2                       198   1e-64   
dbj|BAJ85327.1|  predicted protein                                      198   1e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009795584.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    212   1e-64   Nicotiana sylvestris
ref|XP_006348299.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    205   2e-64   
gb|ACO48251.1|  phosphoenolpyruvate carboxylase                         220   2e-64   Arachis hypogaea [goober]
ref|XP_003607582.1|  Phosphoenolpyruvate carboxylase                    205   3e-64   Medicago truncatula
ref|XP_011100202.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    211   4e-64   Sesamum indicum [beniseed]
dbj|BAJ97144.1|  predicted protein                                      198   4e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAA07610.1|  phospoenolpyruvate carboxylase                         198   4e-64   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010524060.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       209   6e-64   Tarenaya hassleriana [spider flower]
ref|XP_008455304.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       216   7e-64   
ref|XP_009603289.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    210   7e-64   Nicotiana tomentosiformis
ref|XP_004243288.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    209   8e-64   Solanum lycopersicum
emb|CAA09807.1|  ppc2                                                   202   8e-64   Solanum tuberosum [potatoes]
ref|XP_008655339.1|  PREDICTED: uncharacterized protein LOC100384...    201   1e-63   
gb|AAD45696.1|AF159051_1  phosphoenolpyruvate carboxylase               212   1e-63   Picea abies
sp|P29193.1|CAPP1_SACHY  RecName: Full=Phosphoenolpyruvate carbox...    201   1e-63   Saccharum sp.
sp|P51062.1|CAPP_PEA  RecName: Full=Phosphoenolpyruvate carboxyla...    202   1e-63   Pisum sativum [garden pea]
gb|AHF21553.1|  phosphoenolpyruvate carboxylase                         196   1e-63   Hylocereus undatus [dragon fruit]
emb|CAA09588.1|  phosphoenolpyruvate-carboxylase                        202   1e-63   Vicia faba [broad bean]
ref|XP_009380945.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    204   1e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004970018.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    202   2e-63   Setaria italica
ref|XP_006293629.1|  hypothetical protein CARUB_v10022582mg             209   7e-63   Capsella rubella
ref|NP_850373.4|  phosphoenolpyruvate carboxylase 2                     208   8e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881863.1|  phosphoenolpyruvate carboxylase                    208   8e-63   Arabidopsis lyrata subsp. lyrata
gb|EYU41129.1|  hypothetical protein MIMGU_mgv1a000842mg                208   8e-63   Erythranthe guttata [common monkey flower]
gb|AAP43628.1|  phosphoenolpyruvate carboxylase                         208   9e-63   Arabidopsis thaliana [mouse-ear cress]
emb|CAD58726.1|  phosphoenolpyruvate carboxylase                        208   9e-63   Arabidopsis thaliana [mouse-ear cress]
gb|AEG78834.1|  phosphoenolpyruvate carboxylase                         204   1e-62   Dendrobium officinale
gb|AAD22994.1|  phosphoenolpyruvate carboxylase                         208   1e-62   Arabidopsis thaliana [mouse-ear cress]
emb|CAA60627.1|  phosphoenolpyruvate-carboxylase                        192   2e-62   Vanilla planifolia [cultivated vanilla]
ref|XP_006644735.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    197   2e-62   Oryza brachyantha
ref|XP_010508551.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       207   2e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010413019.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    207   3e-62   Camelina sativa [gold-of-pleasure]
ref|XP_006660531.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    192   5e-62   
gb|ABG01962.1|  phosphoenolpyruvate carboxylase                         192   6e-62   Sesuvium portulacastrum [sea-purslane]
dbj|BAD36412.1|  putative phosphoenolpyruvate carboxylase               192   1e-61   Oryza sativa Japonica Group [Japonica rice]
gb|KFK37112.1|  hypothetical protein AALP_AA4G214300                    204   1e-61   Arabis alpina [alpine rockcress]
gb|EAZ08566.1|  hypothetical protein OsI_30839                          192   1e-61   Oryza sativa Indica Group [Indian rice]
gb|EMS60171.1|  Phosphoenolpyruvate carboxylase 2                       188   1e-61   Triticum urartu
gb|EEE55407.1|  hypothetical protein OsJ_03516                          196   2e-61   Oryza sativa Japonica Group [Japonica rice]
emb|CAB65171.1|  phosphoenolpyruvate carboxylase 2                      201   2e-61   Solanum lycopersicum var. cerasiforme [cherry tomato]
emb|CAC86034.1|  phosphoenolpyruvate carboxylase 2                      201   2e-61   Solanum lycopersicum
ref|XP_010324389.1|  PREDICTED: phosphoenolpyruvate carboxylase         201   2e-61   
gb|AAD31452.1|AF135371_1  phosphoenol pyruvate carboxylase              207   7e-61   Lotus corniculatus
dbj|BAC20364.1|  phosphoenolpyruvate carboxylase                        206   9e-61   Lotus japonicus
dbj|BAJ33978.1|  unnamed protein product                                201   1e-60   Eutrema halophilum
ref|XP_009404506.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    196   1e-60   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAC19851.1|  phosphoenolpyruvate carboxylase                        198   2e-60   Eleocharis vivipara
emb|CAB59571.1|  phosphoenolpyruvate carboxylase                        195   2e-60   Vanilla planifolia [cultivated vanilla]
ref|XP_010689827.1|  PREDICTED: phosphoenolpyruvate carboxylase 1       189   6e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009142853.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       197   2e-59   Brassica rapa
emb|CDY51508.1|  BnaC04g02430D                                          197   2e-59   Brassica napus [oilseed rape]
emb|CDY55389.1|  BnaA05g34260D                                          197   2e-59   Brassica napus [oilseed rape]
ref|XP_010232351.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoenolp...    191   3e-59   
gb|AAY28730.1|  phosphoenolpyruvate carboxylase                         185   3e-59   Alternanthera ficoidea [sanguinarea]
gb|EPS65212.1|  hypothetical protein M569_09565                         195   4e-59   Genlisea aurea
ref|XP_002458521.1|  hypothetical protein SORBIDRAFT_03g035090          188   7e-59   
gb|ABR24265.1|  PhtY                                                    192   7e-59   Microbacterium sp. CQ0110Y
ref|XP_009142075.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       195   8e-59   Brassica rapa
emb|CDY14847.1|  BnaC04g48440D                                          195   8e-59   Brassica napus [oilseed rape]
sp|Q43299.1|CAPP_AMAHP  RecName: Full=Phosphoenolpyruvate carboxy...    191   8e-59   Amaranthus hypochondriacus [prince's feather]
emb|CDY47982.1|  BnaA04g24600D                                          195   9e-59   Brassica napus [oilseed rape]
gb|ADO15315.1|  C4 photosynthetic phosphoenolpyruvate                   192   1e-58   Amaranthus hypochondriacus [prince's feather]
gb|AAY28731.1|  phosphoenolpyruvate carboxylase                         184   2e-58   Alternanthera sessilis
emb|CBM56258.1|  C3 phosphoenolpyruvate carboxylase                     180   4e-58   Panicum bisulcatum [Japanese panicgrass]
gb|AIR93775.1|  phosphoenolpyruvate carboxylase                         199   5e-58   Kalanchoe fedtschenkoi [lavender-scallops]
ref|XP_006411524.1|  hypothetical protein EUTSA_v10016192mg             192   8e-58   Eutrema salsugineum [saltwater cress]
ref|XP_006411525.1|  hypothetical protein EUTSA_v10016192mg             192   9e-58   
emb|CAA62747.1|  phosphoenolpyruvate carboxylase                        184   2e-57   Welwitschia mirabilis
sp|P10490.1|CAPP1_MESCR  RecName: Full=Phosphoenolpyruvate carbox...    182   3e-57   Mesembryanthemum crystallinum
gb|ABG20459.1|  phosphoenolpyruvate carboxylase                         180   3e-57   Bienertia sinuspersici
gb|AAX98688.3|  C4 phosphoenolpyruvate carboxylase                      186   3e-57   
dbj|BAF80187.1|  phosphoenolpyruvate carboxylase                        204   4e-57   
ref|NP_001046417.1|  Os02g0244700                                       188   7e-57   
gb|AAG00180.1|AF271995_1  phosphoenolpyruvate carboxylase               188   7e-57   
gb|EEC72817.1|  hypothetical protein OsI_06526                          188   8e-57   
ref|XP_003571949.1|  PREDICTED: phosphoenolpyruvate carboxylase 1       187   8e-57   
dbj|BAJ87123.1|  predicted protein                                      189   9e-57   
gb|EMT32045.1|  Phosphoenolpyruvate carboxylase 1                       189   9e-57   
ref|XP_008676434.1|  PREDICTED: uncharacterized protein LOC100191...    188   1e-56   
dbj|BAD27731.1|  phosphoenolpyruvate carboxylase-like                   187   1e-56   
gb|AAY28729.1|  phosphoenolpyruvate carboxylase                         178   1e-56   
ref|NP_001105503.1|  phosphoenolpyruvate carboxylase                    188   1e-56   
ref|NP_001267742.1|  phosphoenolpyruvate carboxylase 1                  188   1e-56   
ref|XP_006647114.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    188   1e-56   
emb|CAA60626.1|  phosphoenolpyruvate-carboxylase                        181   2e-56   
gb|AAP06951.1|  phosphoenolpyruvate carboxylase                         186   5e-56   
sp|P29195.1|CAPP1_SORBI  RecName: Full=Phosphoenolpyruvate carbox...    186   5e-56   
ref|XP_002451855.1|  hypothetical protein SORBIDRAFT_04g008720          186   6e-56   
gb|AAG42288.1|  phosphoenolpyruvate carboxylase                         179   8e-56   
dbj|BAJ94338.1|  predicted protein                                      183   1e-55   
dbj|BAI78342.1|  phosphoenolpyruvate carboxylase                        184   1e-55   
gb|AAM95946.1|  phosphoenolpyruvate carboxylase                         199   2e-55   
ref|XP_003563811.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    182   3e-55   
ref|NP_001267758.1|  phosphoenolpyruvate carboxylase 1-like             181   1e-54   
ref|XP_010553399.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    178   8e-54   
gb|EMS57465.1|  Phosphoenolpyruvate carboxylase, housekeeping iso...    172   1e-53   
emb|CAM83969.2|  phosphoenolpyruvate carboxylase                        176   2e-53   
gb|ABA33611.1|  phosphoenolpyruvate carboxylase                         172   8e-53   
emb|CAA33663.1|  P-pyruvate carboxylase                                 171   2e-52   
gb|ADW27477.1|  phosphoenolpyruvate carboxylase                         171   2e-52   
gb|ACJ38542.1|  phosphoenolpyruvate carboxylase                         171   2e-52   
emb|CAD60555.1|  phosphoenolpyruvate carboxylase                        171   2e-52   
ref|NP_001105418.1|  phosphoenolpyruvate carboxylase 1                  171   3e-52   
ref|NP_001154820.1|  uncharacterized protein LOC100191762               171   3e-52   
dbj|BAA03094.1|  phosphoenolpyruvate carboxylase                        166   4e-50   
ref|XP_001760595.1|  predicted protein                                  167   8e-50   
ref|XP_008664266.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    162   1e-49   
ref|XP_001757859.1|  predicted protein                                  160   1e-49   
ref|XP_008664106.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    161   1e-49   
emb|CBT21623.1|  C4 phosphoenolpyruvate carboxylase                     169   2e-49   
emb|CAA96509.1|  phosphoenolpyruvate carboxylase                        166   9e-49   
gb|EMT25785.1|  Phosphoenolpyruvate carboxylase 1                       159   2e-48   
ref|XP_001766239.1|  predicted protein                                  155   7e-48   
ref|XP_001782799.1|  predicted protein                                  160   4e-47   
ref|XP_008670284.1|  PREDICTED: MLO-like protein 4                      157   6e-47   
gb|ABY56044.1|  phosphoenolpyruvate carboxylase                         140   9e-47   
emb|CAC08829.1|  putative C4 phosphoenolpyruvate carboxylase            156   2e-46   
gb|AAN15222.1|  putative C4 phosphoenolpyruvate carboxylase             155   4e-46   
gb|ADV92634.1|  phosphoenolpyruvate carboxylase                         165   5e-46   
sp|P15804.2|CAPP3_SORBI  RecName: Full=Phosphoenolpyruvate carbox...    155   6e-46   
ref|XP_002438521.1|  hypothetical protein SORBIDRAFT_10g021330          155   6e-46   
ref|XP_002990195.1|  hypothetical protein SELMODRAFT_447920             157   7e-46   
emb|CCA60995.1|  phosphoenolpyruvate carboxylase                        164   3e-45   
emb|CAC85930.1|  putative phosphoenolpyruvate carboxylase               152   5e-45   
ref|XP_002992495.1|  hypothetical protein SELMODRAFT_269944             152   1e-44   
emb|CDX82457.1|  BnaA03g33640D                                          137   6e-44   
emb|CDX75798.1|  BnaC03g38810D                                          137   6e-44   
gb|EMS68413.1|  Phosphoenolpyruvate carboxylase 1                       144   6e-44   
dbj|BAK09197.1|  phosphoenolpyruvate carboxylase                        145   1e-43   
dbj|BAK09198.1|  phosphoenolpyruvate carboxylase                        145   1e-43   
gb|EAY72974.1|  hypothetical protein OsI_00846                          144   2e-43   
ref|NP_001042358.1|  Os01g0208700                                       144   2e-43   
dbj|BAK09195.1|  phosphoenolpyruvate carboxylase                        144   2e-43   
dbj|BAK09196.1|  phosphoenolpyruvate carboxylase                        144   2e-43   
emb|CDX98516.1|  BnaC05g38590D                                          139   4e-43   
ref|XP_006643893.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    143   5e-43   
emb|CDX97618.1|  BnaA05g24610D                                          139   6e-43   
emb|CAA27270.1|  PEPCase                                                132   1e-40   
gb|EEE56642.1|  hypothetical protein OsJ_06051                          135   2e-40   
ref|XP_002513286.1|  2-alkenal reductase, putative                      120   2e-40   
ref|XP_001774499.1|  predicted protein                                  141   2e-40   
ref|XP_009342319.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    118   8e-40   
emb|CDY32330.1|  BnaC01g36490D                                          122   1e-39   
ref|XP_001773964.1|  predicted protein                                  134   2e-39   
ref|XP_004968594.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    130   3e-39   
emb|CCB84879.1|  phosphoenolpyruvate carboxylase                        122   3e-38   
ref|XP_008362419.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       117   3e-37   
emb|CAM83972.2|  phosphoenolpyruvate carboxylase                        121   9e-37   
emb|CDM82240.1|  unnamed protein product                                119   1e-33   
gb|EMS50355.1|  Phosphoenolpyruvate carboxylase 1                       107   2e-32   
dbj|BAJ96977.1|  predicted protein                                      116   3e-32   
ref|XP_003565329.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    109   2e-31   
ref|XP_002985372.1|  hypothetical protein SELMODRAFT_122213             128   3e-30   
ref|XP_002979664.1|  hypothetical protein SELMODRAFT_111216             128   3e-30   
emb|CAA30158.1|  unnamed protein product                                114   5e-29   
gb|AJD81370.1|  phosphoenolpyruvate carboxylase isoform 4             76.3    1e-26   
dbj|BAA25129.1|  phosphoenolpyruvate carboxylase                        103   3e-25   
ref|NP_001044301.1|  Os01g0758300                                       112   1e-24   
emb|CAA96504.1|  phosphoenolpyruvate carboxylase                        102   1e-24   
gb|ACJ22779.1|  phosphoenolpyruvate carboxylase                         100   4e-24   
gb|EAZ06755.1|  hypothetical protein OsI_29000                        89.7    1e-19   
gb|EMT14603.1|  Phosphoenolpyruvate carboxylase 1                     71.2    2e-19   
ref|XP_007021730.1|  Phosphoenolpyruvate carboxylase 3 isoform 3      73.2    3e-18   
emb|CAA30159.1|  unnamed protein product                              85.5    3e-18   
ref|NP_683646.1|  phosphoenolpyruvate carboxylase-related protein     85.1    4e-18   
emb|CAA45347.1|  phosphoenolpyruvate carboxylase                      84.3    8e-18   
ref|XP_008377074.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...  85.1    1e-17   
ref|XP_008813763.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...  70.1    2e-17   
gb|AAD13911.1|S60262_1  phosphoenolpyruvate carboxylase               83.2    2e-17   
gb|EAY75884.1|  hypothetical protein OsI_03803                        90.1    4e-17   
emb|CDM84220.1|  unnamed protein product                              66.6    7e-16   
dbj|BAA23422.1|  phosphoenolpyruvate carboxylase                      54.7    2e-15   
gb|KDO44636.1|  hypothetical protein CISIN_1g002089mg                 65.9    5e-14   
gb|ADZ05827.1|  phosphoenolpyruvate carboxylase                       65.9    5e-14   
emb|CAX83739.1|  PEP carboxylase                                      73.6    7e-14   
gb|EMS62961.1|  SCAR-like protein 2                                   68.2    4e-13   
dbj|BAJ85848.1|  predicted protein                                    48.9    6e-10   
dbj|BAJ90026.1|  predicted protein                                    48.9    6e-10   
gb|ABG20460.1|  phosphoenolpyruvate carboxylase                       67.8    9e-10   
gb|AAD13912.1|S60264_1  phosphoenolpyruvate carboxylase               60.1    4e-09   
emb|CCA60994.1|  phosphoenolpyruvate carboxylase                      46.6    6e-08   
emb|CAA96507.1|  phosphoenolpyruvate carboxylase                      55.1    2e-07   
emb|CAM83970.2|  phosphoenolpyruvate carboxylase                      53.5    5e-07   
emb|CCA60991.1|  phosphoenolpyruvate carboxylase                      56.6    4e-06   
gb|ABX79637.1|  phosphoenolpyruvate carboxylase                       49.7    3e-05   
gb|AFW81519.1|  putative clathrin heavy chain family protein          47.0    5e-05   
ref|WP_040851641.1|  phosphoenolpyruvate carboxylase                  53.1    6e-05   
emb|CCU61859.1|  Phosphoenolpyruvate carboxylase                      52.8    6e-05   
ref|XP_002949515.1|  hypothetical protein VOLCADRAFT_59445            52.4    8e-05   
gb|ADH01790.1|  phosphoenolpyruvate carboxylase                       47.8    1e-04   
gb|AAS88368.1|  phosphoenolpyruvate carboxylase                       47.8    1e-04   
ref|XP_005652003.1|  PEPCase 1                                        52.0    1e-04   
gb|AAS88349.1|  phosphoenolpyruvate carboxylase                       47.8    1e-04   
ref|XP_001420862.1|  predicted protein                                51.6    1e-04   
gb|ADH01796.1|  phosphoenolpyruvate carboxylase                       46.6    3e-04   
gb|AAW29040.1|  phosphoenolpyruvate carboxylase                       48.1    3e-04   
gb|AAW29059.1|  phosphoenolpyruvate carboxylase                       48.1    3e-04   
gb|AAS88361.1|  phosphoenolpyruvate carboxylase                       46.6    3e-04   
gb|AAS88356.1|  phosphoenolpyruvate carboxylase                       46.6    3e-04   
gb|AAW29057.1|  phosphoenolpyruvate carboxylase                       48.1    4e-04   
gb|AAW29046.1|  phosphoenolpyruvate carboxylase                       48.1    4e-04   
gb|AAW29043.1|  phosphoenolpyruvate carboxylase                       48.1    4e-04   
gb|AAS88348.1|  phosphoenolpyruvate carboxylase                       46.6    4e-04   
gb|AAW29056.1|  phosphoenolpyruvate carboxylase                       48.1    4e-04   
gb|AAW29049.1|  phosphoenolpyruvate carboxylase                       48.1    4e-04   
gb|AAW29038.1|  phosphoenolpyruvate carboxylase                       48.1    4e-04   
gb|AAW29051.1|  phosphoenolpyruvate carboxylase                       47.8    4e-04   
gb|EHM03224.1|  phosphoenolpyruvate carboxykinase                     50.4    4e-04   
ref|WP_040289772.1|  phosphoenolpyruvate carboxylase                  50.4    4e-04   
gb|AAW29042.1|  phosphoenolpyruvate carboxylase                       47.8    4e-04   
sp|P81831.2|CAPP1_CHLRE  RecName: Full=Phosphoenolpyruvate carbox...  50.1    6e-04   
gb|ABX79622.1|  phosphoenolpyruvate carboxylase                       46.2    6e-04   
ref|WP_041514014.1|  phosphoenolpyruvate carboxylase                  50.1    6e-04   
ref|WP_036211378.1|  phosphoenolpyruvate carboxylase                  49.7    7e-04   
ref|WP_027866050.1|  phosphoenolpyruvate carboxylase                  49.7    7e-04   
gb|AAS88364.1|  phosphoenolpyruvate carboxylase                       45.8    8e-04   
ref|WP_038311255.1|  hypothetical protein                             47.4    9e-04   
ref|XP_003082445.1|  phosphoenolpyruvate carboxylase 2; LaPEPC2 (...  49.3    0.001   



>ref|XP_010108239.1| Phosphoenolpyruvate carboxylase, housekeeping isozyme [Morus 
notabilis]
 gb|EXC18479.1| Phosphoenolpyruvate carboxylase, housekeeping isozyme [Morus 
notabilis]
Length=1376

 Score =   239 bits (610),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/124 (94%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKMASIDAQLRLLVPGKVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MANRNLEKMASIDAQLRLLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRNK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 73.6 bits (179),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETLKRLV D+KKSPQEVFDALK +
Sbjct  122  KKGDFADENSATTESDIEETLKRLVGDLKKSPQEVFDALKNQ  163



>ref|XP_011098224.1| PREDICTED: phosphoenolpyruvate carboxylase [Sesamum indicum]
Length=964

 Score =   236 bits (602),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA+RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQEC
Sbjct  1    MASRNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKL+ELGNVLTSLDPGDSIV+AK+FSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLDELGNVLTSLDPGDSIVVAKAFSHMLNLANLAEEVQIAYRRRNK  120

Query  479  LRRG  490
             ++G
Sbjct  121  RKKG  124


 Score = 70.9 bits (172),  Expect(2) = 1e-74, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGD+ DEN+A TESDIEET+KRLVVD+KKSPQEVFDALK +
Sbjct  122  KKGDYTDENNATTESDIEETIKRLVVDLKKSPQEVFDALKNQ  163



>ref|XP_009340037.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Pyrus x bretschneideri]
Length=966

 Score =   234 bits (596),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKMASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ C
Sbjct  1    MANRNLEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQAC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKL ELGNVLTSLDPGDSIVIAKSF+HML+LANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEGKHDPKKLSELGNVLTSLDPGDSIVIAKSFAHMLSLANLAEEVQIAYRRRQK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 73.6 bits (179),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETLKRLV D+KKSPQEVFDALK +
Sbjct  122  KKGDFADENSATTESDIEETLKRLVGDLKKSPQEVFDALKNQ  163



>ref|XP_008386247.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Malus domestica]
Length=965

 Score =   233 bits (595),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKMASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ C
Sbjct  1    MANRNLEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQAC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKL ELGNVLTSLDPGDSIVIAKSF+HML+LANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEGKHDPKKLSELGNVLTSLDPGDSIVIAKSFAHMLSLANLAEEVQIAYRRRQK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 73.6 bits (179),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETLKRLV D+KKSPQEVFDALK +
Sbjct  122  KKGDFADENSATTESDIEETLKRLVGDLKKSPQEVFDALKNQ  163



>ref|XP_009783765.1| PREDICTED: phosphoenolpyruvate carboxylase [Nicotiana sylvestris]
 ref|XP_009783766.1| PREDICTED: phosphoenolpyruvate carboxylase [Nicotiana sylvestris]
Length=964

 Score =   239 bits (609),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/124 (94%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEK+ASIDAQLR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MATRNLEKLASIDAQLRALVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  479  LRRG  490
            L+RG
Sbjct  121  LKRG  124


 Score = 67.0 bits (162),  Expect(2) = 3e-74, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            K+GDF DEN+A TESDIEET K+LV D+KKSPQEVFDALK +
Sbjct  122  KRGDFADENNATTESDIEETFKKLVGDLKKSPQEVFDALKNQ  163



>ref|XP_009604678.1| PREDICTED: phosphoenolpyruvate carboxylase [Nicotiana tomentosiformis]
 ref|XP_009604679.1| PREDICTED: phosphoenolpyruvate carboxylase [Nicotiana tomentosiformis]
 ref|XP_009604680.1| PREDICTED: phosphoenolpyruvate carboxylase [Nicotiana tomentosiformis]
Length=964

 Score =   238 bits (606),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/124 (93%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEK+ASIDAQLR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MATRNLEKLASIDAQLRALVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 67.8 bits (164),  Expect(2) = 4e-74, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DEN+A TESDIEET K+LV D+KKSPQEVFDALK +
Sbjct  122  KKGDFADENNATTESDIEETFKKLVGDLKKSPQEVFDALKNQ  163



>ref|XP_011082759.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Sesamum indicum]
Length=964

 Score =   229 bits (585),  Expect(2) = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MATRNLEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELGNVLTSLDPGDSIV+AK+FSHML+LANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVLAKAFSHMLSLANLAEEVQIAHRRRNK  120

Query  479  LRRG  490
             ++G
Sbjct  121  KKKG  124


 Score = 75.5 bits (184),  Expect(2) = 5e-74, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGD+ DENSA TESDIEETLKRLVVD+KKSPQEVFDALK +
Sbjct  122  KKGDYTDENSATTESDIEETLKRLVVDLKKSPQEVFDALKNQ  163



>ref|XP_002316861.1| phosphoenolpyruvate carboxylase family protein [Populus trichocarpa]
 gb|EEE97473.1| phosphoenolpyruvate carboxylase family protein [Populus trichocarpa]
Length=966

 Score =   232 bits (591),  Expect(2) = 9e-74, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +2

Query  128  RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYEL  307
            RNLEK+ASIDAQLRLLVPGKVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQECYEL
Sbjct  5    RNLEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQECYEL  64

Query  308  SAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRR  487
            SAEYEG+HDPKKLEELG+VLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR KL++
Sbjct  65   SAEYEGKHDPKKLEELGSVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRNKLKK  124

Query  488  G  490
            G
Sbjct  125  G  125


 Score = 72.4 bits (176),  Expect(2) = 9e-74, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETL+RLVVD+KKSP+EVFDALK +
Sbjct  123  KKGDFADENSATTESDIEETLRRLVVDLKKSPEEVFDALKNQ  164



>sp|P27154.1|CAPP_TOBAC RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Nicotiana tabacum]
 emb|CAA41758.1| phosphoenolpyruvate carboxylase [Nicotiana tabacum]
Length=964

 Score =   237 bits (604),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/124 (93%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA R+LEK+ASIDAQLR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MATRSLEKLASIDAQLRALVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  479  LRRG  490
            L+RG
Sbjct  121  LKRG  124


 Score = 67.0 bits (162),  Expect(2) = 1e-73, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            K+GDF DEN+A TESDIEET K+LV D+KKSPQEVFDALK +
Sbjct  122  KRGDFADENNATTESDIEETFKKLVGDLKKSPQEVFDALKNQ  163



>ref|XP_002530381.1| Phosphoenolpyruvate carboxylase, putative [Ricinus communis]
 gb|EEF32001.1| Phosphoenolpyruvate carboxylase, putative [Ricinus communis]
Length=965

 Score =   230 bits (587),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            M  RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MQPRNLEKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDP+KL+ELGN+LTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPRKLDELGNLLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRNK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 72.8 bits (177),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEET KRLV+D+KKSP+EVFDALK +
Sbjct  122  KKGDFADENSATTESDIEETFKRLVIDLKKSPEEVFDALKNQ  163



>gb|ABR29876.1| phosphoenolpyruvate carboxylase [Ricinus communis]
Length=965

 Score =   230 bits (586),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            M  RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MQPRNLEKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDP+KL+ELGN+LTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPRKLDELGNLLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRNK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 72.8 bits (177),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEET KRLV+D+KKSP+EVFDALK +
Sbjct  122  KKGDFADENSATTESDIEETFKRLVIDLKKSPEEVFDALKNQ  163



>ref|XP_006370158.1| phosphoenolpyruvate carboxylase family protein [Populus trichocarpa]
 gb|ERP66727.1| phosphoenolpyruvate carboxylase family protein [Populus trichocarpa]
Length=968

 Score =   233 bits (595),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  125  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  304
            ARNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQECYE
Sbjct  6    ARNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQECYE  65

Query  305  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLR  484
            LSAEYEG+HDPKKLEELG+VLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR KL+
Sbjct  66   LSAEYEGKHDPKKLEELGSVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRNKLK  125

Query  485  RG  490
            +G
Sbjct  126  KG  127


 Score = 69.3 bits (168),  Expect(2) = 2e-73, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DEN+A TESDIEETLKRLV +MKKSP+EVFDALK +
Sbjct  125  KKGDFADENNATTESDIEETLKRLVSEMKKSPEEVFDALKNQ  166



>ref|XP_009334045.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Pyrus x bretschneideri]
Length=965

 Score =   229 bits (584),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ C
Sbjct  1    MANRNLEKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQAC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKL ELGNVLTSLDPGDSIV+AKSF+HML+LANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLSELGNVLTSLDPGDSIVVAKSFAHMLSLANLAEEVQIAYRRRNK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 73.9 bits (180),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETLKRLV D+KKSPQEVFDALK +
Sbjct  122  KKGDFADENSATTESDIEETLKRLVGDLKKSPQEVFDALKNQ  163



>ref|XP_010060690.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Eucalyptus grandis]
 gb|KCW67501.1| hypothetical protein EUGRSUZ_F01229 [Eucalyptus grandis]
Length=965

 Score =   231 bits (590),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MANRNLEKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDP+KLEELGNVLTSLDPGDSIVIAKSFS+MLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPQKLEELGNVLTSLDPGDSIVIAKSFSNMLNLANLAEEVQIAYRRRNK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 71.2 bits (173),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DEN+A TESDIEETLKRLVV +KKSP+EVFDALK +
Sbjct  122  KKGDFADENNATTESDIEETLKRLVVQLKKSPEEVFDALKNQ  163



>gb|EYU45020.1| hypothetical protein MIMGU_mgv1a000847mg [Erythranthe guttata]
Length=963

 Score =   232 bits (591),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/124 (90%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEK+ASIDAQLRLLVPGKVS+DDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MATRNLEKLASIDAQLRLLVPGKVSDDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELGN+LTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRNK  120

Query  479  LRRG  490
             ++G
Sbjct  121  KKKG  124


 Score = 70.5 bits (171),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGD+ DENSA TESDIEET KRLV D+KKSP+EVFDALK +
Sbjct  122  KKGDYTDENSATTESDIEETFKRLVFDLKKSPEEVFDALKNQ  163



>ref|XP_008463734.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Cucumis melo]
Length=965

 Score =   233 bits (595),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKMASIDAQLRLLVP +VSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MANRNLEKMASIDAQLRLLVPARVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+H+PKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHNPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 68.9 bits (167),  Expect(2) = 3e-73, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETLK+LV ++KKSPQEVFDALK +
Sbjct  122  KKGDFADENSATTESDIEETLKKLVGELKKSPQEVFDALKNQ  163



>ref|XP_009762944.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Nicotiana sylvestris]
Length=964

 Score =   226 bits (575),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE L+ETVQEC
Sbjct  1    MATRNLEKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEGLKETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYE + D KKLEELGNVLTSLDPGDSIV+AKS SHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYESKRDKKKLEELGNVLTSLDPGDSIVVAKSISHMLNLANLAEEVQIAYRRRQK  120

Query  479  LRRGILL  499
            L++G  L
Sbjct  121  LKKGDFL  127


 Score = 76.6 bits (187),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF+DEN+A+TESDIEETLKRLVVD+KKSPQEVFDALK +
Sbjct  122  KKGDFLDENNAMTESDIEETLKRLVVDLKKSPQEVFDALKNQ  163



>ref|XP_009607156.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Nicotiana tomentosiformis]
 ref|XP_009607157.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Nicotiana tomentosiformis]
Length=964

 Score =   225 bits (574),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE L+ETVQEC
Sbjct  1    MATRNLEKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEGLKETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYE + D KKLEELGNVLTSLDPGDSIV+AKS SHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYESKRDKKKLEELGNVLTSLDPGDSIVVAKSISHMLNLANLAEEVQIAYRRRQK  120

Query  479  LRRGILL  499
            L++G  L
Sbjct  121  LKKGDFL  127


 Score = 76.6 bits (187),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF+DEN+A+TESDIEETLKRLVVD+KKSPQEVFDALK +
Sbjct  122  KKGDFLDENNAMTESDIEETLKRLVVDLKKSPQEVFDALKNQ  163



>ref|XP_011029569.1| PREDICTED: phosphoenolpyruvate carboxylase [Populus euphratica]
Length=966

 Score =   232 bits (591),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  125  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  304
             RNLEK+ASIDAQLRLLVPGKVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQECYE
Sbjct  4    TRNLEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQECYE  63

Query  305  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLR  484
            LSAEYEG+HDPKKLEELG+VLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR KL+
Sbjct  64   LSAEYEGKHDPKKLEELGSVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRNKLK  123

Query  485  RG  490
            +G
Sbjct  124  KG  125


 Score = 69.3 bits (168),  Expect(2) = 6e-73, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DEN+A TESDIEETLKRLV +MKKSP+EVFDALK +
Sbjct  123  KKGDFADENNATTESDIEETLKRLVSEMKKSPEEVFDALKNQ  164



>ref|XP_006360045.1| PREDICTED: phosphoenolpyruvate carboxylase-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006360046.1| PREDICTED: phosphoenolpyruvate carboxylase-like isoform X2 [Solanum 
tuberosum]
Length=964

 Score =   234 bits (596),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            M  RNLEK+ASIDAQLR LVPGKVSEDDKLVEYDALLLD FLDILQDLHGE+L+ETVQEC
Sbjct  1    MTTRNLEKLASIDAQLRALVPGKVSEDDKLVEYDALLLDSFLDILQDLHGEDLKETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 67.4 bits (163),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DEN+A TESDIEET K+LV ++KKSPQEVFDALK +
Sbjct  122  KKGDFADENNATTESDIEETFKKLVEELKKSPQEVFDALKNQ  163



>gb|KDO63365.1| hypothetical protein CISIN_1g002112mg [Citrus sinensis]
Length=891

 Score =   227 bits (578),  Expect(2) = 8e-73, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MAARNLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+ D +KLEELGNVLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKRDSQKLEELGNVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 74.3 bits (181),  Expect(2) = 8e-73, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDENSA TESDIEETLKRLVV +KKSP+EVFDALK +
Sbjct  122  KKGDFVDENSATTESDIEETLKRLVVQLKKSPEEVFDALKNQ  163



>emb|CBI20195.3| unnamed protein product [Vitis vinifera]
Length=930

 Score =   233 bits (593),  Expect(2) = 8e-73, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RN+EKMASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MANRNIEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELGNVLTSLD GDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDAGDSIVIAKSFSHMLNLANLAEEVQIAYRRRNK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 68.6 bits (166),  Expect(2) = 8e-73, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DEN+A TESDIEETLK+LVV +KKSP+EVFDALK +
Sbjct  122  KKGDFADENNATTESDIEETLKKLVVQLKKSPEEVFDALKNQ  163



>ref|XP_006446789.1| hypothetical protein CICLE_v10014164mg [Citrus clementina]
 gb|ESR60029.1| hypothetical protein CICLE_v10014164mg [Citrus clementina]
Length=965

 Score =   227 bits (578),  Expect(2) = 8e-73, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MAARNLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+ D +KLEELGNVLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKRDSQKLEELGNVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 74.3 bits (181),  Expect(2) = 8e-73, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDENSA TESDIEETLKRLVV +KKSP+EVFDALK +
Sbjct  122  KKGDFVDENSATTESDIEETLKRLVVQLKKSPEEVFDALKNQ  163



>gb|KDO63363.1| hypothetical protein CISIN_1g002112mg [Citrus sinensis]
 gb|KDO63364.1| hypothetical protein CISIN_1g002112mg [Citrus sinensis]
Length=965

 Score =   227 bits (578),  Expect(2) = 8e-73, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MAARNLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+ D +KLEELGNVLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKRDSQKLEELGNVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 74.3 bits (181),  Expect(2) = 8e-73, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDENSA TESDIEETLKRLVV +KKSP+EVFDALK +
Sbjct  122  KKGDFVDENSATTESDIEETLKRLVVQLKKSPEEVFDALKNQ  163



>ref|XP_002285441.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Vitis vinifera]
Length=963

 Score =   232 bits (592),  Expect(2) = 9e-73, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RN+EKMASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MANRNIEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELGNVLTSLD GDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDAGDSIVIAKSFSHMLNLANLAEEVQIAYRRRNK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 68.6 bits (166),  Expect(2) = 9e-73, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DEN+A TESDIEETLK+LVV +KKSP+EVFDALK +
Sbjct  122  KKGDFADENNATTESDIEETLKKLVVQLKKSPEEVFDALKNQ  163



>gb|KDO63366.1| hypothetical protein CISIN_1g002112mg [Citrus sinensis]
Length=753

 Score =   226 bits (577),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MAARNLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+ D +KLEELGNVLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKRDSQKLEELGNVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 74.3 bits (181),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDENSA TESDIEETLKRLVV +KKSP+EVFDALK +
Sbjct  122  KKGDFVDENSATTESDIEETLKRLVVQLKKSPEEVFDALKNQ  163



>ref|XP_006469015.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like isoform X1 
[Citrus sinensis]
 ref|XP_006469016.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like isoform X2 
[Citrus sinensis]
Length=965

 Score =   226 bits (577),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MAARNLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+ D +KLEELGNVLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKRDSQKLEELGNVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 74.3 bits (181),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDENSA TESDIEETLKRLVV +KKSP+EVFDALK +
Sbjct  122  KKGDFVDENSATTESDIEETLKRLVVQLKKSPEEVFDALKNQ  163



>ref|XP_011005507.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Populus euphratica]
 ref|XP_011005508.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Populus euphratica]
 ref|XP_011005509.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Populus euphratica]
Length=968

 Score =   231 bits (589),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  125  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  304
            ARNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQ+CYE
Sbjct  6    ARNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQDCYE  65

Query  305  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLR  484
            LSAEYEG+HDPKKLEELG VLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR KL+
Sbjct  66   LSAEYEGKHDPKKLEELGRVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRNKLK  125

Query  485  RG  490
            +G
Sbjct  126  KG  127


 Score = 69.3 bits (168),  Expect(2) = 1e-72, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DEN+A TESDIEETLKRLV +MKKSP+EVFDALK +
Sbjct  125  KKGDFADENNATTESDIEETLKRLVSEMKKSPEEVFDALKNQ  166



>gb|AFN70425.1| phosphoenolpyruvate carboxylase [Manihot esculenta subsp. flabellifolia]
Length=965

 Score =   229 bits (585),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/124 (90%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MAARNLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE +RETVQ+C
Sbjct  1    MAARNLEKMASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQDLHGEEIRETVQDC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDP+KLEELG VLTSLDPGDSIV+AKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPQKLEELGKVLTSLDPGDSIVVAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 70.9 bits (172),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIE+TLKRLVV +KKSP+EVFDALK +
Sbjct  122  KKGDFADENSATTESDIEKTLKRLVVQLKKSPEEVFDALKNQ  163



>ref|XP_008367955.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Malus domestica]
Length=965

 Score =   227 bits (578),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ C
Sbjct  1    MANRNLEKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQAC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKL ELG+VLTSLDPGDSIV+AKSF+HML+LANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLSELGDVLTSLDPGDSIVVAKSFAHMLSLANLAEEVQIAYRRRNK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 73.6 bits (179),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETLKRLV D+KKSPQEVFDALK +
Sbjct  122  KKGDFADENSATTESDIEETLKRLVGDLKKSPQEVFDALKNQ  163



>gb|AJP17168.1| phosphoenolpyruvate carboxylase 2 [Prunus sibirica]
Length=966

 Score =   229 bits (583),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/124 (90%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA+RNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQ+C
Sbjct  1    MASRNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGESLRETVQDC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYE + DPKKLEELG VLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYERKQDPKKLEELGKVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 70.9 bits (172),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE SA TESDIEETLKRLV D+KKSPQEVFDALK +
Sbjct  122  KKGDFADEASATTESDIEETLKRLVGDLKKSPQEVFDALKNQ  163



>ref|XP_008229092.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Prunus mume]
Length=966

 Score =   229 bits (583),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/124 (90%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA+RNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQ+C
Sbjct  1    MASRNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGESLRETVQDC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYE + DPKKLEELG VLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYERKQDPKKLEELGKVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 70.9 bits (172),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE SA TESDIEETLKRLV D+KKSPQEVFDALK +
Sbjct  122  KKGDFADEASATTESDIEETLKRLVGDLKKSPQEVFDALKNQ  163



>ref|NP_001267517.1| phosphoenolpyruvate carboxylase, housekeeping isozyme-like [Cucumis 
sativus]
 ref|XP_004165409.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Cucumis sativus]
 gb|AFS33790.1| phosphoenolpyruvate carboxylase protein [Cucumis sativus]
 gb|KGN55071.1| hypothetical protein Csa_4G627210 [Cucumis sativus]
Length=965

 Score =   230 bits (586),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKMASIDAQLRLLVP +VSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MANRNLEKMASIDAQLRLLVPARVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+ +PKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKFNPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 68.9 bits (167),  Expect(2) = 3e-72, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETLK+LV ++KKSPQEVFDALK +
Sbjct  122  KKGDFADENSATTESDIEETLKKLVGELKKSPQEVFDALKNQ  163



>ref|XP_009766373.1| PREDICTED: phosphoenolpyruvate carboxylase [Nicotiana sylvestris]
Length=966

 Score =   233 bits (595),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/123 (92%), Positives = 121/123 (98%), Gaps = 0/123 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEK+ASIDAQLR LVPGKVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MANRNLEKLASIDAQLRQLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  479  LRR  487
            L++
Sbjct  121  LKK  123


 Score = 65.5 bits (158),  Expect(2) = 3e-72, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            K GDFVDE++A TESDIEET K+LV D+KKSPQEVFDALK +
Sbjct  123  KTGDFVDESNATTESDIEETFKKLVGDLKKSPQEVFDALKNQ  164



>ref|XP_009598007.1| PREDICTED: phosphoenolpyruvate carboxylase [Nicotiana tomentosiformis]
Length=966

 Score =   233 bits (594),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/123 (92%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEK+ASIDAQLR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MANRNLEKLASIDAQLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELGNV TSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEGKHDPKKLEELGNVFTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  479  LRR  487
            L++
Sbjct  121  LKK  123


 Score = 65.5 bits (158),  Expect(2) = 4e-72, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            K GDFVDE++A TESDIEET K+LV D+KKSPQEVFDALK +
Sbjct  123  KTGDFVDESNATTESDIEETFKKLVGDLKKSPQEVFDALKNQ  164



>ref|XP_007213682.1| hypothetical protein PRUPE_ppa000910mg [Prunus persica]
 gb|EMJ14881.1| hypothetical protein PRUPE_ppa000910mg [Prunus persica]
Length=965

 Score =   226 bits (577),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ C
Sbjct  1    MANRNLEKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQAC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HD KKL ELGNVLTSLDPGDSIV+AKSFSHML+LANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDAKKLSELGNVLTSLDPGDSIVVAKSFSHMLSLANLAEEVQIAYRRRNK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 72.0 bits (175),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETLKRLV D+KKSPQEVF+ALK +
Sbjct  122  KKGDFADENSATTESDIEETLKRLVGDLKKSPQEVFEALKNQ  163



>emb|CDP00977.1| unnamed protein product [Coffea canephora]
Length=344

 Score =   221 bits (564),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +2

Query  128  RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYEL  307
            RNLEK+ASIDAQLRLLVP KVS+DDKLVEYDALLLDRFLDILQ LHGE+L+ETVQECYEL
Sbjct  5    RNLEKLASIDAQLRLLVPAKVSDDDKLVEYDALLLDRFLDILQYLHGEDLKETVQECYEL  64

Query  308  SAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRR  487
            SAEYEGR DPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR KL++
Sbjct  65   SAEYEGRKDPKKLEELGHVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRNKLKK  124

Query  488  G  490
            G
Sbjct  125  G  125


 Score = 77.0 bits (188),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSAITESDIEETLKRLV+D+KKSPQEVFDALK +
Sbjct  123  KKGDFADENSAITESDIEETLKRLVLDLKKSPQEVFDALKNQ  164



>ref|XP_008226531.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Prunus mume]
Length=965

 Score =   226 bits (577),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ C
Sbjct  1    MANRNLEKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQAC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HD KKL ELGNVLTSLDPGDSIV+AKSFSHML+LANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDAKKLSELGNVLTSLDPGDSIVVAKSFSHMLSLANLAEEVQIAYRRRNK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 72.0 bits (175),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETLKRLV D+KKSPQEVF+ALK +
Sbjct  122  KKGDFADENSATTESDIEETLKRLVGDLKKSPQEVFEALKNQ  163



>ref|XP_010104390.1| Phosphoenolpyruvate carboxylase 2 [Morus notabilis]
 gb|EXC00235.1| Phosphoenolpyruvate carboxylase 2 [Morus notabilis]
Length=967

 Score =   220 bits (561),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            M++RNLEKMASIDAQLRLL P KVSEDDKL+EYDALL DRFLDILQDLHGE+LRETVQ+C
Sbjct  1    MSSRNLEKMASIDAQLRLLAPAKVSEDDKLIEYDALLCDRFLDILQDLHGEDLRETVQDC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYE   DPKKLEELGNVLTSLDPGDSIV+AKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYERNLDPKKLEELGNVLTSLDPGDSIVVAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRR  487
            L++
Sbjct  121  LKK  123


 Score = 78.2 bits (191),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDENSA TESDIEETLKRLVVD+KKSPQEVFDALK +
Sbjct  123  KKGDFVDENSATTESDIEETLKRLVVDLKKSPQEVFDALKNQ  164



>ref|NP_001237602.1| phosphoenolpyruvate carboxylase, housekeeping isozyme [Glycine 
max]
 sp|Q02909.1|CAPP1_SOYBN RecName: Full=Phosphoenolpyruvate carboxylase, housekeeping isozyme; 
Short=PEPCase; AltName: Full=PEPC 1 [Glycine max]
 dbj|BAA01560.1| phosphoenolpyruvate carboxylase [Glycine max]
Length=967

 Score =   222 bits (566),  Expect(2) = 6e-72, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKMASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+ RR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHSRRNK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 76.3 bits (186),  Expect(2) = 6e-72, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  463  SSETETKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            S   + KKGDF DEN+A TESDIEETLK+LVVDMKKSPQEVFDALK +
Sbjct  116  SRRNKLKKGDFADENNATTESDIEETLKKLVVDMKKSPQEVFDALKNQ  163



>gb|ACC66283.1| phosphoenolpyruvate carboxylase [Suaeda glauca]
Length=966

 Score =   227 bits (578),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 120/123 (98%), Gaps = 1/123 (1%)
 Frame = +2

Query  125  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  304
            ARN+EKMASIDAQLRLLVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQECYE
Sbjct  2    ARNIEKMASIDAQLRLLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQECYE  61

Query  305  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-QKL  481
            LSAEYEG+ DPKKLEELGNVLTSLDPGDSIV+AKSFSHMLNLANLAEEVQIAYRRR +KL
Sbjct  62   LSAEYEGKRDPKKLEELGNVLTSLDPGDSIVLAKSFSHMLNLANLAEEVQIAYRRRIKKL  121

Query  482  RRG  490
            ++G
Sbjct  122  KKG  124


 Score = 71.2 bits (173),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF+DENSA TESDIEET KRLV D+ KSPQEVFDALK +
Sbjct  122  KKGDFIDENSATTESDIEETFKRLVGDLGKSPQEVFDALKNQ  163



>ref|XP_004248242.1| PREDICTED: phosphoenolpyruvate carboxylase [Solanum lycopersicum]
Length=964

 Score =   233 bits (593),  Expect(2) = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            M  RNLEK+ASIDAQLR LVPGKVSEDDKLVEYDALLLD FLDILQDLHG +L+ETVQEC
Sbjct  1    MTTRNLEKLASIDAQLRALVPGKVSEDDKLVEYDALLLDSFLDILQDLHGVDLKETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  479  LRRG  490
            LR+G
Sbjct  121  LRKG  124


 Score = 65.1 bits (157),  Expect(2) = 8e-72, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            +KGDF DEN+A TESDIEET K+LV ++KKSPQEVF+ALK +
Sbjct  122  RKGDFADENNATTESDIEETFKKLVEELKKSPQEVFEALKNQ  163



>ref|XP_007214986.1| hypothetical protein PRUPE_ppa002020mg [Prunus persica]
 gb|EMJ16185.1| hypothetical protein PRUPE_ppa002020mg [Prunus persica]
Length=728

 Score =   228 bits (582),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/124 (90%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA+RNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQ+C
Sbjct  1    MASRNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGESLRETVQDC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYE + DPKKLEELG VLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYERKQDPKKLEELGKVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 68.9 bits (167),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE SA TESDIEETLKRLV D+KKSP+EVFDALK +
Sbjct  122  KKGDFADEASATTESDIEETLKRLVGDLKKSPEEVFDALKNQ  163



>sp|Q9FV65.1|CAPPC_FLATR RecName: Full=Phosphoenolpyruvate carboxylase 2; Short=PEPC 2; 
Short=PEPCase 2; Short=ppcC [Flaveria trinervia]
 gb|AAG17619.1|AF248080_1 phosphoenolpyruvate carboxylase [Flaveria trinervia]
Length=967

 Score =   233 bits (595),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEK+ASIDAQLRLLVPGKVSEDDKL+EYDALLLD+FLDILQDLHGE L+ETVQEC
Sbjct  1    MANRNLEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDKFLDILQDLHGEGLKETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 63.5 bits (153),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE SA TESDIEET K+LV  +KKSP+EVFDALK +
Sbjct  122  KKGDFADEASATTESDIEETFKKLVHKLKKSPEEVFDALKNQ  163



>emb|CDP06006.1| unnamed protein product [Coffea canephora]
Length=965

 Score =   221 bits (564),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +2

Query  128  RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYEL  307
            RNLEK+ASIDAQLRLLVP KVS+DDKLVEYDALLLDRFLDILQ LHGE+L+ETVQECYEL
Sbjct  5    RNLEKLASIDAQLRLLVPAKVSDDDKLVEYDALLLDRFLDILQYLHGEDLKETVQECYEL  64

Query  308  SAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRR  487
            SAEYEGR DPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR KL++
Sbjct  65   SAEYEGRKDPKKLEELGHVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRNKLKK  124

Query  488  G  490
            G
Sbjct  125  G  125


 Score = 75.5 bits (184),  Expect(2) = 1e-71, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSAITESDIEETLKRLV+D+KKSPQEVFDALK +
Sbjct  123  KKGDFADENSAITESDIEETLKRLVLDLKKSPQEVFDALKNQ  164



>ref|XP_004303182.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011466957.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Fragaria vesca 
subsp. vesca]
Length=961

 Score =   234 bits (596),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/124 (90%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA+RNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQ+C
Sbjct  1    MASRNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQDC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+ DPKKLEELGNV TSLDPGDSIV+AKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKQDPKKLEELGNVFTSLDPGDSIVVAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 63.2 bits (152),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDE +A TESDIEET K+LV  +KKSPQEVFD LK +
Sbjct  122  KKGDFVDEANATTESDIEETFKKLVGQLKKSPQEVFDELKNQ  163



>gb|KHG25857.1| Phosphoenolpyruvate carboxylase 2 [Gossypium arboreum]
Length=969

 Score =   221 bits (563),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +2

Query  125  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  304
            +  L+K+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQECYE
Sbjct  7    SNKLQKLASIDAQLRLLVPSKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQECYE  66

Query  305  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLR  484
            LSAEYEG++DPKKLEELGNVLTSLDPGDSIV+AK+FSHMLNLANLAEEVQIAYRRR KL+
Sbjct  67   LSAEYEGKNDPKKLEELGNVLTSLDPGDSIVVAKAFSHMLNLANLAEEVQIAYRRRIKLK  126

Query  485  RG  490
            +G
Sbjct  127  KG  128


 Score = 74.7 bits (182),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDENSA TESDIEETLKRLVVD+ KSP+EVFDALK +
Sbjct  126  KKGDFVDENSATTESDIEETLKRLVVDLNKSPEEVFDALKNQ  167



>gb|KJB27013.1| hypothetical protein B456_004G272100 [Gossypium raimondii]
Length=751

 Score =   221 bits (562),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 122/131 (93%), Gaps = 5/131 (4%)
 Frame = +2

Query  98   SGADSEKMAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENL  277
            S ++S KM     +K+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L
Sbjct  3    STSNSNKM-----QKLASIDAQLRLLVPSKVSEDDKLVEYDALLLDRFLDILQDLHGEDL  57

Query  278  RETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQI  457
            +ETVQECYELSAEYEG++DPKKLEELGNVLTSLDPGDSIV+AK+FSHMLNLANLAEEVQI
Sbjct  58   KETVQECYELSAEYEGKNDPKKLEELGNVLTSLDPGDSIVVAKAFSHMLNLANLAEEVQI  117

Query  458  AYRRRQKLRRG  490
            AYRRR KL++G
Sbjct  118  AYRRRIKLKKG  128


 Score = 74.7 bits (182),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDENSA TESDIEETLKRLVVD+ KSP+EVFDALK +
Sbjct  126  KKGDFVDENSATTESDIEETLKRLVVDLNKSPEEVFDALKNQ  167



>ref|XP_010675388.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Beta vulgaris subsp. 
vulgaris]
Length=967

 Score =   229 bits (585),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 121/125 (97%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            M ARN+EKMASIDAQLRLLVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQEC
Sbjct  1    MMARNIEKMASIDAQLRLLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YELSAEYEG+ DPKKLEELGNVLTSLDPGDSIV+AKSFSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YELSAEYEGKRDPKKLEELGNVLTSLDPGDSIVVAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 65.9 bits (159),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDENSA TESDIEET KRLV  + K+P+E+FDALK +
Sbjct  123  KKGDFVDENSATTESDIEETFKRLVGQLGKTPEEIFDALKNQ  164



>gb|KJB27012.1| hypothetical protein B456_004G272100 [Gossypium raimondii]
Length=969

 Score =   221 bits (562),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 122/131 (93%), Gaps = 5/131 (4%)
 Frame = +2

Query  98   SGADSEKMAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENL  277
            S ++S KM     +K+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L
Sbjct  3    STSNSNKM-----QKLASIDAQLRLLVPSKVSEDDKLVEYDALLLDRFLDILQDLHGEDL  57

Query  278  RETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQI  457
            +ETVQECYELSAEYEG++DPKKLEELGNVLTSLDPGDSIV+AK+FSHMLNLANLAEEVQI
Sbjct  58   KETVQECYELSAEYEGKNDPKKLEELGNVLTSLDPGDSIVVAKAFSHMLNLANLAEEVQI  117

Query  458  AYRRRQKLRRG  490
            AYRRR KL++G
Sbjct  118  AYRRRIKLKKG  128


 Score = 74.7 bits (182),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDENSA TESDIEETLKRLVVD+ KSP+EVFDALK +
Sbjct  126  KKGDFVDENSATTESDIEETLKRLVVDLNKSPEEVFDALKNQ  167



>gb|AFN70424.1| phosphoenolpyruvate carboxylase [Manihot esculenta]
Length=965

 Score =   224 bits (571),  Expect(2) = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MAARNLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDI QDLHGE +RETVQ+C
Sbjct  1    MAARNLEKMASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDISQDLHGEEIRETVQDC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDP+KLEELG VLTSLDPGDSIV+AKSFSHMLNLANLAEEVQIAY RR K
Sbjct  61   YELSAEYEGKHDPQKLEELGKVLTSLDPGDSIVVAKSFSHMLNLANLAEEVQIAYGRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 70.9 bits (172),  Expect(2) = 5e-71, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETLKRLVV +KKSP+EVFDALK +
Sbjct  122  KKGDFADENSATTESDIEETLKRLVVQLKKSPEEVFDALKNQ  163



>ref|XP_007021728.1| Phosphoenolpyruvate carboxylase 3 isoform 1 [Theobroma cacao]
 ref|XP_007021729.1| Phosphoenolpyruvate carboxylase 3 isoform 1 [Theobroma cacao]
 gb|EOY13253.1| Phosphoenolpyruvate carboxylase 3 isoform 1 [Theobroma cacao]
 gb|EOY13254.1| Phosphoenolpyruvate carboxylase 3 isoform 1 [Theobroma cacao]
Length=972

 Score =   221 bits (562),  Expect(2) = 6e-71, Method: Compositional matrix adjust.
 Identities = 107/119 (90%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +2

Query  134  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  313
            LEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQECYELSA
Sbjct  13   LEKLASIDAQLRLLVPSKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQECYELSA  72

Query  314  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRRG  490
            EYEG+++PKKLEELGNVLTSLDPGDSIV+AK+FSHMLNLANLAEEVQIAYRRR KL++G
Sbjct  73   EYEGKNNPKKLEELGNVLTSLDPGDSIVVAKAFSHMLNLANLAEEVQIAYRRRIKLKKG  131


 Score = 74.3 bits (181),  Expect(2) = 6e-71, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF+DENSA TESDIEETLKRLV D+KKSP+EVFDALK +
Sbjct  129  KKGDFIDENSATTESDIEETLKRLVFDLKKSPEEVFDALKNQ  170



>gb|KHG02548.1| Phosphoenolpyruvate carboxylase, housekeeping isozyme [Gossypium 
arboreum]
Length=969

 Score =   220 bits (560),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 118/128 (92%), Gaps = 4/128 (3%)
 Frame = +2

Query  119  MAARN----LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRET  286
            MA  N    LEK+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRET
Sbjct  1    MATNNNNSKLEKLASIDAQLRALVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRET  60

Query  287  VQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYR  466
            VQECYELSAEYEG+ +PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYR
Sbjct  61   VQECYELSAEYEGKSNPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYR  120

Query  467  RRQKLRRG  490
            RR KL++G
Sbjct  121  RRIKLKKG  128


 Score = 74.7 bits (182),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETLKRLVVD+KKSP+EVFDALK +
Sbjct  126  KKGDFADENSATTESDIEETLKRLVVDLKKSPEEVFDALKNQ  167



>ref|XP_002518037.1| Phosphoenolpyruvate carboxylase, putative [Ricinus communis]
 gb|EEF44555.1| Phosphoenolpyruvate carboxylase, putative [Ricinus communis]
Length=965

 Score =   223 bits (569),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQ+C
Sbjct  1    MAGRNLEKMASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQDC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+H+P+KL ELG VLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHNPQKLAELGKVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 70.9 bits (172),  Expect(2) = 9e-71, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETLKRLVV +KKSP+EVFDALK +
Sbjct  122  KKGDFADENSATTESDIEETLKRLVVQLKKSPEEVFDALKNQ  163



>gb|KJB13196.1| hypothetical protein B456_002G061400 [Gossypium raimondii]
Length=969

 Score =   219 bits (558),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 117/128 (91%), Gaps = 4/128 (3%)
 Frame = +2

Query  119  MAARN----LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRET  286
            MA  N    LEK+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRET
Sbjct  1    MATNNNNSKLEKLASIDAQLRALVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRET  60

Query  287  VQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYR  466
            VQECYELSAEYEG+  PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYR
Sbjct  61   VQECYELSAEYEGKSTPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYR  120

Query  467  RRQKLRRG  490
            RR KL++G
Sbjct  121  RRIKLKKG  128


 Score = 74.7 bits (182),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETLKRLVVD+KKSP+EVFDALK +
Sbjct  126  KKGDFADENSATTESDIEETLKRLVVDLKKSPEEVFDALKNQ  167



>ref|XP_008368627.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Malus domestica]
Length=875

 Score =   224 bits (572),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MAA+NLEKMASID QLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGENLRETVQ+C
Sbjct  1    MAAKNLEKMASIDVQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGENLRETVQDC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYE + DP+KL ELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYERKQDPQKLAELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRR  487
            +++
Sbjct  121  MKK  123


 Score = 68.9 bits (167),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE SA TESDIEETLKRLV D+KKSP+EVFDALK +
Sbjct  123  KKGDFADEASATTESDIEETLKRLVGDLKKSPEEVFDALKNQ  164



>ref|XP_008342775.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Malus domestica]
 ref|XP_008368623.1| PREDICTED: phosphoenolpyruvate carboxylase [Malus domestica]
Length=967

 Score =   224 bits (572),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MAARNLEKMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ+C
Sbjct  1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGESLRETVQDC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYE + DP+KLEELG +LTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYERKQDPQKLEELGKMLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRR  487
            L++
Sbjct  121  LKK  123


 Score = 68.9 bits (167),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE SA TESDIEETLKRLV D+KKSP+EVFDALK +
Sbjct  123  KKGDFADEASATTESDIEETLKRLVGDLKKSPEEVFDALKNQ  164



>ref|XP_003527207.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
isoform X1 [Glycine max]
Length=967

 Score =   222 bits (565),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKMASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+ RR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHSRRNK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 71.6 bits (174),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  463  SSETETKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            S   + KKGDF DEN+A TESDIEETLK+LV DMKKSPQEVF+ALK +
Sbjct  116  SRRNKLKKGDFADENNATTESDIEETLKKLVGDMKKSPQEVFNALKNQ  163



>ref|XP_004294066.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011460783.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Fragaria vesca 
subsp. vesca]
Length=965

 Score =   224 bits (571),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA R+LEK+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ C
Sbjct  1    MAYRSLEKLASIDAQLRALVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQSC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDP+KL ELGNVLTSLDPGDSIVIAKSF+HML+LANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPQKLAELGNVLTSLDPGDSIVIAKSFAHMLSLANLAEEVQIAYRRRNK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 69.3 bits (168),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETLKRLV + KKSP+EVFDALK +
Sbjct  122  KKGDFADENSATTESDIEETLKRLVGEFKKSPEEVFDALKNQ  163



>gb|KHN48472.1| Phosphoenolpyruvate carboxylase, housekeeping isozyme [Glycine 
soja]
Length=967

 Score =   222 bits (565),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKMASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+ RR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHSRRNK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 71.6 bits (174),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  463  SSETETKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            S   + KKGDF DEN+A TESDIEETLK+LV DMKKSPQEVF+ALK +
Sbjct  116  SRRNKLKKGDFADENNATTESDIEETLKKLVGDMKKSPQEVFNALKNQ  163



>ref|XP_006582125.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
isoform X2 [Glycine max]
Length=760

 Score =   222 bits (565),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKMASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+ RR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHSRRNK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 71.6 bits (174),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  463  SSETETKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            S   + KKGDF DEN+A TESDIEETLK+LV DMKKSPQEVF+ALK +
Sbjct  116  SRRNKLKKGDFADENNATTESDIEETLKKLVGDMKKSPQEVFNALKNQ  163



>gb|EYU26325.1| hypothetical protein MIMGU_mgv1a000844mg [Erythranthe guttata]
Length=964

 Score =   224 bits (571),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKMASIDAQLRLLVPGKVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQEC
Sbjct  1    MATRNLEKMASIDAQLRLLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYE + D KKLEELGNVLTSLDPGDSIV+AK+FSHMLNLANLAEEVQIA RRR K
Sbjct  61   YELSAEYESKRDAKKLEELGNVLTSLDPGDSIVVAKAFSHMLNLANLAEEVQIATRRRNK  120

Query  479  LRRG  490
             ++G
Sbjct  121  KKKG  124


 Score = 69.3 bits (168),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGD  DE++A TESDIEETLKRLVVD+KKSPQEVFDAL+ +
Sbjct  122  KKGDITDESNATTESDIEETLKRLVVDLKKSPQEVFDALRNQ  163



>gb|AJD81367.1| phosphoenolpyruvate carboxylase isoform 1 [Egeria densa]
Length=968

 Score =   218 bits (556),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 116/124 (94%), Gaps = 2/124 (2%)
 Frame = +2

Query  125  ARN--LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            ARN  +EKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ C
Sbjct  4    ARNPSIEKMASIDAQLRLLAPSKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQRC  63

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEGR DP+KLEELGNVLTSLDPGDSIV+A SFSHMLNLANLAEEVQIA+RRR K
Sbjct  64   YELSAEYEGRLDPQKLEELGNVLTSLDPGDSIVVASSFSHMLNLANLAEEVQIAFRRRAK  123

Query  479  LRRG  490
            L++G
Sbjct  124  LKKG  127


 Score = 74.7 bits (182),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETLKRLVV +KKSPQEVFDALK++
Sbjct  125  KKGDFADENSATTESDIEETLKRLVVQLKKSPQEVFDALKSQ  166



>emb|CAA62469.1| phosphoenolpyruvate carboxylase [Solanum tuberosum]
Length=965

 Score =   228 bits (582),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            M  RNLEK+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MTTRNLEKLASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYE +HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEAKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  479  LRR  487
            L++
Sbjct  121  LKK  123


 Score = 64.7 bits (156),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE++A TESDIEET K+LV D+KKSPQEVFDA+K +
Sbjct  123  KKGDFGDESNATTESDIEETFKKLVGDLKKSPQEVFDAIKNQ  164



>emb|CAC28225.1| phosphoenolpyruvate carboxylase [Sesbania rostrata]
Length=961

 Score =   224 bits (572),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKMASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 68.2 bits (165),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE++A TESDIEETLK+LV +MKKSPQEVFDALK +
Sbjct  122  KKGDFADESNATTESDIEETLKKLVGEMKKSPQEVFDALKNQ  163



>ref|XP_006852422.1| hypothetical protein AMTR_s00021p00059810 [Amborella trichopoda]
 gb|ERN13889.1| hypothetical protein AMTR_s00021p00059810 [Amborella trichopoda]
Length=965

 Score =   219 bits (558),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            M+  +L K+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLD+LQDLHGE+LRETVQEC
Sbjct  1    MSKNSLVKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDVLQDLHGEDLRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YE SAEYEG+HDP+KLEELG+VLTSLDPGDSIV+A SFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YEHSAEYEGKHDPRKLEELGSVLTSLDPGDSIVVASSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 72.8 bits (177),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETLKRLVV +KKSP+EVFDALK +
Sbjct  122  KKGDFADENSATTESDIEETLKRLVVQLKKSPEEVFDALKNQ  163



>sp|Q01647.1|CAPP1_FLAPR RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Flaveria pringlei]
 emb|CAA45505.1| phosphoenolpyruvate carboxylase [Flaveria pringlei]
Length=967

 Score =   231 bits (588),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/124 (90%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEK+ASIDAQLRLLVPGKVSEDDKL+EYDALLLD+FLDILQDLHGE+L+E VQEC
Sbjct  1    MANRNLEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDKFLDILQDLHGEDLKEAVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L+RG
Sbjct  121  LKRG  124


 Score = 61.2 bits (147),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            K+GDF DE +A TESDIEET K+LV+ + KSP+EVFDALK +
Sbjct  122  KRGDFADEANATTESDIEETFKKLVLKLNKSPEEVFDALKNQ  163



>gb|AAM14597.1|AF494192_1 phosphoenolpyruvate carboxylase FPUB966 [Flaveria pubescens]
Length=966

 Score =   231 bits (588),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/124 (90%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEK+ASIDAQLRLLVPGKVSEDDKL+EYDALLLD+FLDILQDLHGE+L+E VQEC
Sbjct  1    MANRNLEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDKFLDILQDLHGEDLKEAVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L+RG
Sbjct  121  LKRG  124


 Score = 61.2 bits (147),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            K+GDF DE +A TESDIEET KRLV  + KSP+EVFDALK +
Sbjct  122  KRGDFADEANATTESDIEETFKRLVHKLNKSPEEVFDALKNQ  163



>emb|CAA88829.1| phosphoenolpyruvate carboxylase [Flaveria pringlei]
Length=966

 Score =   231 bits (588),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/124 (90%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEK+ASIDAQLRLLVPGKVSEDDKL+EYDALLLD+FLDILQDLHGE+L+E VQEC
Sbjct  1    MANRNLEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDKFLDILQDLHGEDLKEAVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L+RG
Sbjct  121  LKRG  124


 Score = 61.2 bits (147),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            K+GDF DE +A TESDIEET K+LV+ + KSP+EVFDALK +
Sbjct  122  KRGDFADEANATTESDIEETFKKLVLKLNKSPEEVFDALKNQ  163



>ref|NP_001274942.1| phosphoenolpyruvate carboxylase [Solanum tuberosum]
 sp|P29196.2|CAPP_SOLTU RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Solanum tuberosum]
 emb|CAA47437.1| phosphoenolpyruvate carboxylase [Solanum tuberosum]
Length=965

 Score =   227 bits (578),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            M  RNL+K+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MTTRNLDKLASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYE +HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEAKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  479  LRR  487
            L++
Sbjct  121  LKK  123


 Score = 64.7 bits (156),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE++A TESDIEET K+LV D+KKSPQEVFDA+K +
Sbjct  123  KKGDFGDESNATTESDIEETFKKLVGDLKKSPQEVFDAIKNQ  164



>ref|XP_006358941.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Solanum tuberosum]
Length=965

 Score =   227 bits (578),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            M  RNLEK+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQ+C
Sbjct  1    MTTRNLEKLASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQDC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYE +HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEAKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  479  LRR  487
            L++
Sbjct  121  LKK  123


 Score = 64.7 bits (156),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE++A TESDIEET K+LV D+KKSPQEVFDA+K +
Sbjct  123  KKGDFGDESNATTESDIEETFKKLVGDLKKSPQEVFDAIKNQ  164



>ref|XP_009354255.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Pyrus x bretschneideri]
 ref|XP_009348400.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Pyrus x bretschneideri]
Length=967

 Score =   223 bits (567),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MAA+NLEKMASID QLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQ+C
Sbjct  1    MAAKNLEKMASIDVQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGESLRETVQDC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYE + DP+KL ELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYERKQDPQKLAELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRR  487
            +++
Sbjct  121  MKK  123


 Score = 68.9 bits (167),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE SA TESDIEETLKRLV D+KKSP+EVFDALK +
Sbjct  123  KKGDFADEASATTESDIEETLKRLVGDLKKSPEEVFDALKNQ  164



>ref|XP_010279120.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Nelumbo nucifera]
 ref|XP_010279121.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Nelumbo nucifera]
Length=964

 Score =   218 bits (554),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = +2

Query  125  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  304
            ARNLEK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE L+ETVQE YE
Sbjct  2    ARNLEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEELKETVQEVYE  61

Query  305  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLR  484
            L+A+YEG+HD +KLEELGNVLTSLDPGDSIV+AKSFSHMLNLANLAEEVQIA+ RR KL+
Sbjct  62   LAAKYEGKHDFQKLEELGNVLTSLDPGDSIVVAKSFSHMLNLANLAEEVQIAHHRRTKLK  121

Query  485  RG  490
            +G
Sbjct  122  KG  123


 Score = 73.2 bits (178),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +1

Query  472  TETKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            T+ KKGDF DENSA TESDIEETLKRLVV +KKSP+EVFDALK +
Sbjct  118  TKLKKGDFHDENSATTESDIEETLKRLVVQLKKSPEEVFDALKNQ  162



>gb|KDP36288.1| hypothetical protein JCGZ_09795 [Jatropha curcas]
Length=965

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA +NLEKM SIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAGKNLEKMVSIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YE+SAEYE +HDP+KLEELG VLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YEISAEYERKHDPQKLEELGKVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRTK  120

Query  479  LRRG  490
             ++G
Sbjct  121  SKKG  124


 Score = 70.9 bits (172),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +1

Query  472  TETKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            T++KKGDF DENSA TESD+EET K+LVV +KKSP+EVFDALK +
Sbjct  119  TKSKKGDFADENSATTESDMEETFKKLVVQLKKSPEEVFDALKNQ  163



>gb|EPS69468.1| hypothetical protein M569_05291 [Genlisea aurea]
Length=965

 Score =   220 bits (560),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA+R LE M SIDAQLRLLVPGKVSEDD L+EYDALLLDRFLDILQDLHGE+LRETVQEC
Sbjct  1    MASRCLETMQSIDAQLRLLVPGKVSEDDHLIEYDALLLDRFLDILQDLHGEDLRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDP+KLEELGNVLTSLDPGDSIV+AK+FSHML+LAN+AEEVQ AYRRR K
Sbjct  61   YELSAEYEGKHDPRKLEELGNVLTSLDPGDSIVVAKAFSHMLSLANMAEEVQNAYRRRIK  120

Query  479  LRRG  490
             ++G
Sbjct  121  KKKG  124


 Score = 70.9 bits (172),  Expect(2) = 1e-69, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +1

Query  475  ETKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            + KKGD+ DEN+A TESDIEETLKRLVVD+KKSP+EVFDALK +
Sbjct  120  KKKKGDYTDENNATTESDIEETLKRLVVDLKKSPEEVFDALKNQ  163



>gb|KJB82054.1| hypothetical protein B456_013G173500 [Gossypium raimondii]
Length=750

 Score =   214 bits (545),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = +2

Query  134  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  313
             EK+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQECYELSA
Sbjct  12   FEKLASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQECYELSA  71

Query  314  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRRG  490
            EYEG+++PKKLEELGNVLTSLDPGDSIV+AK+FSHMLNLANLAEEVQIA+RRR KL++G
Sbjct  72   EYEGKNNPKKLEELGNVLTSLDPGDSIVVAKAFSHMLNLANLAEEVQIAHRRRIKLKKG  130


 Score = 75.9 bits (185),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDEN+A TESD+EETLKRLVVD+KKSPQEVFDALK +
Sbjct  128  KKGDFVDENNATTESDLEETLKRLVVDLKKSPQEVFDALKNQ  169



>gb|KJB82053.1| hypothetical protein B456_013G173500 [Gossypium raimondii]
Length=964

 Score =   214 bits (545),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = +2

Query  134  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  313
             EK+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQECYELSA
Sbjct  12   FEKLASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQECYELSA  71

Query  314  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRRG  490
            EYEG+++PKKLEELGNVLTSLDPGDSIV+AK+FSHMLNLANLAEEVQIA+RRR KL++G
Sbjct  72   EYEGKNNPKKLEELGNVLTSLDPGDSIVVAKAFSHMLNLANLAEEVQIAHRRRIKLKKG  130


 Score = 75.9 bits (185),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDEN+A TESD+EETLKRLVVD+KKSPQEVFDALK +
Sbjct  128  KKGDFVDENNATTESDLEETLKRLVVDLKKSPQEVFDALKNQ  169



>gb|AAM14596.1|AF494191_1 phosphoenolpyruvate carboxylase FB966 [Flaveria brownii]
Length=966

 Score =   229 bits (583),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA +N+EK+ASIDAQLRLLVPGKVSEDDKL+EYDALLLD+FLDILQDLHGE+L+E VQEC
Sbjct  1    MANKNVEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDKFLDILQDLHGEDLKEAVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L+RG
Sbjct  121  LKRG  124


 Score = 61.2 bits (147),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            K+GDF DE +A TESDIEET KRLV  + KSP+EVFDALK +
Sbjct  122  KRGDFADEANATTESDIEETFKRLVHKLNKSPEEVFDALKNQ  163



>gb|KHG25331.1| Phosphoenolpyruvate carboxylase 2 [Gossypium arboreum]
Length=965

 Score =   226 bits (575),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA R +EKMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAGRKVEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPK LEELG VLTSLDPGDSIV+ KSFSHMLNL NLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKILEELGKVLTSLDPGDSIVVTKSFSHMLNLGNLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 64.3 bits (155),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE+SA TESDIEET KRLV  + KSP+EVFDALK +
Sbjct  122  KKGDFADESSATTESDIEETFKRLVGQLNKSPEEVFDALKNQ  163



>gb|KJB33217.1| hypothetical protein B456_006G001300 [Gossypium raimondii]
Length=965

 Score =   226 bits (575),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA R +EKMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAGRKVEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPK LEELG VLTSLDPGDSIV+ KSFSHMLNL NLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKILEELGKVLTSLDPGDSIVVTKSFSHMLNLGNLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 64.3 bits (155),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE+SA TESDIEET KRLV  + KSP+EVFDALK +
Sbjct  122  KKGDFADESSATTESDIEETFKRLVGQLNKSPEEVFDALKNQ  163



>ref|XP_009357178.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Pyrus x bretschneideri]
Length=967

 Score =   221 bits (563),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MAARNLEKMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ+C
Sbjct  1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGESLRETVQDC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYE +  P+KLEELG +LTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYERKQVPQKLEELGKMLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRR  487
            L++
Sbjct  121  LKK  123


 Score = 68.6 bits (166),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE SA TESDIEETLKRLV D+KKSP+E+FDALK +
Sbjct  123  KKGDFADEASATTESDIEETLKRLVGDLKKSPEEIFDALKNQ  164



>gb|KDP32538.1| hypothetical protein JCGZ_14741 [Jatropha curcas]
Length=957

 Score =   216 bits (550),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/116 (91%), Positives = 112/116 (97%), Gaps = 0/116 (0%)
 Frame = +2

Query  143  MASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAEYE  322
            MASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQECYELS EYE
Sbjct  1    MASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQECYELSGEYE  60

Query  323  GRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRRG  490
            G+HD KKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIA+RRR KL++G
Sbjct  61   GKHDGKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAHRRRNKLKKG  116


 Score = 73.9 bits (180),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DEN+A TESDIEET+KRLVVDMKKSP+EVFDALK +
Sbjct  114  KKGDFADENNATTESDIEETIKRLVVDMKKSPEEVFDALKNQ  155



>ref|XP_004251893.1| PREDICTED: phosphoenolpyruvate carboxylase [Solanum lycopersicum]
 ref|XP_010313917.1| PREDICTED: phosphoenolpyruvate carboxylase [Solanum lycopersicum]
Length=965

 Score =   224 bits (572),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA +NLEK+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ TVQ+C
Sbjct  1    MATKNLEKLASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKGTVQDC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYE +HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEAKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  479  LRR  487
            L++
Sbjct  121  LKK  123


 Score = 64.7 bits (156),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE++A TESDIEET K+LV D+KKSPQEVFDA+K +
Sbjct  123  KKGDFGDESNATTESDIEETFKKLVGDLKKSPQEVFDAIKNQ  164



>ref|XP_004297535.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Fragaria vesca 
subsp. vesca]
Length=962

 Score =   230 bits (587),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            M ARNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RETVQ+C
Sbjct  1    MTARNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDIRETVQDC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+ DPKKLEELGNVLTSLDPGDSIV+AK+FSHMLNLANLAEEVQ+AYRRR K
Sbjct  61   YELSAEYEGKRDPKKLEELGNVLTSLDPGDSIVVAKAFSHMLNLANLAEEVQMAYRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 58.9 bits (141),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALK  600
            KKG FVDE +A TESDIEET K+LV  + KSPQEVFD LK
Sbjct  122  KKGGFVDEANATTESDIEETFKKLVGQLNKSPQEVFDELK  161



>ref|XP_007133202.1| hypothetical protein PHAVU_011G160200g [Phaseolus vulgaris]
 gb|ESW05196.1| hypothetical protein PHAVU_011G160200g [Phaseolus vulgaris]
Length=967

 Score =   216 bits (550),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKMASIDA LRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAHLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG HD KKL+ELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGNHDSKKLDELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 72.8 bits (177),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETLK+LVVD+KKSPQEVFD LK +
Sbjct  122  KKGDFADENSATTESDIEETLKKLVVDLKKSPQEVFDELKNQ  163



>gb|AAB80714.1| phosphoenolpyruvate carboxylase 1 [Gossypium hirsutum]
Length=965

 Score =   224 bits (572),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA R +EKMASIDAQLRLL PGKVSEDDKLVEYDA+LLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAGRKVEKMASIDAQLRLLAPGKVSEDDKLVEYDAVLLDRFLDILQDLHGEDIRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPK LEELG VLTSLDPGDSIV+ KSFSHMLNL NLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKILEELGKVLTSLDPGDSIVVTKSFSHMLNLGNLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 64.3 bits (155),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE+SA TESDIEET KRLV  + KSP+EVFDALK +
Sbjct  122  KKGDFADESSATTESDIEETFKRLVGQLNKSPEEVFDALKNQ  163



>gb|ABV80356.1| phosphoenolpyruvate carboxylase [Gossypium hirsutum]
Length=971

 Score =   214 bits (544),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/119 (88%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  134  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  313
             EK+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQECYELSA
Sbjct  12   FEKLASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQECYELSA  71

Query  314  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRRG  490
            EYEG+  PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLA+LAEEVQIAYRRR KL++G
Sbjct  72   EYEGKSTPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLADLAEEVQIAYRRRIKLKKG  130


 Score = 74.7 bits (182),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETLKRLVVD+KKSP+EVFDALK +
Sbjct  128  KKGDFADENSATTESDIEETLKRLVVDLKKSPEEVFDALKNQ  169



>ref|NP_001241357.1| phosphoenolpyruvate carboxylase [Glycine max]
 ref|XP_006591889.1| PREDICTED: phosphoenolpyruvate carboxylase isoform X1 [Glycine 
max]
 ref|XP_006591890.1| PREDICTED: phosphoenolpyruvate carboxylase isoform X2 [Glycine 
max]
 sp|P51061.1|CAPP2_SOYBN RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Glycine max]
 dbj|BAA03100.1| phosphoenolpyruvate carboxylase [Glycine max]
Length=967

 Score =   216 bits (551),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MATRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELGN++TSLD GDSI++AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSILVAKSFSHMLNLANLAEEVQISRRRRNK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 71.6 bits (174),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DEN+A TESDIEETLK+LV D+KKSPQEVFDALK +
Sbjct  122  KKGDFADENNATTESDIEETLKKLVFDLKKSPQEVFDALKNQ  163



>gb|ABU41519.1| phosphoenolpyruvate carboxylase [Jatropha curcas]
Length=965

 Score =   217 bits (553),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA +NLEKM SIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAGKNLEKMVSIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YE+SA YE +HDP+KLEELG VLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YEISAGYERKHDPQKLEELGKVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRTK  120

Query  479  LRRG  490
             ++G
Sbjct  121  SKKG  124


 Score = 70.9 bits (172),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +1

Query  472  TETKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            T++KKGDF DENSA TESD+EET K+LVV +KKSP+EVFDALK +
Sbjct  119  TKSKKGDFADENSATTESDMEETFKKLVVQLKKSPEEVFDALKNQ  163



>sp|Q9FV66.1|CAPPB_FLATR RecName: Full=Phosphoenolpyruvate carboxylase 1; Short=PEPC 1; 
Short=PEPCase 1; Short=ppcB [Flaveria trinervia]
 gb|AAG17618.1|AF248079_1 phosphoenolpyruvate carboxylase [Flaveria trinervia]
Length=965

 Score =   227 bits (578),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEK+ASIDA LRLLVPGKVSEDDKL+EYDALLLD+FLDILQDLHGE+L+ETVQEC
Sbjct  1    MANRNLEKLASIDAHLRLLVPGKVSEDDKLIEYDALLLDKFLDILQDLHGEDLKETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+ DPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKRDPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 61.2 bits (147),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE  A TESD+EETLK+LV  + KSP+EVFDALK +
Sbjct  122  KKGDFADEAHATTESDMEETLKKLVYKLNKSPEEVFDALKNQ  163



>gb|AJD81369.1| phosphoenolpyruvate carboxylase isoform 3 [Egeria densa]
Length=978

 Score =   214 bits (546),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +2

Query  131  NLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELS  310
            N+EKMASIDAQLR+L P KVSEDDKLVEYDALL+DRFLDILQDLHGE LRETVQ CYELS
Sbjct  18   NVEKMASIDAQLRILAPSKVSEDDKLVEYDALLVDRFLDILQDLHGEELRETVQRCYELS  77

Query  311  AEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRRG  490
            AEYEG+ DP+KLEELGNVLTSLDPGDSIV++ SFSHMLNLANLAEEVQIA+RRR KL++G
Sbjct  78   AEYEGKLDPQKLEELGNVLTSLDPGDSIVVSSSFSHMLNLANLAEEVQIAFRRRAKLKKG  137


 Score = 72.8 bits (177),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE+SA TESDIEETLKRLVV +KKSPQEVFDALK++
Sbjct  135  KKGDFADESSATTESDIEETLKRLVVQLKKSPQEVFDALKSQ  176



>ref|XP_006306678.1| hypothetical protein CARUB_v10008196mg, partial [Capsella rubella]
 gb|EOA39576.1| hypothetical protein CARUB_v10008196mg, partial [Capsella rubella]
Length=996

 Score =   222 bits (565),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 122/134 (91%), Gaps = 1/134 (1%)
 Frame = +2

Query  92   LWSGADSEKMAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE  271
            +WS    ++MA R LEKMASID  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE
Sbjct  21   IWSEVGEKEMANRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE  80

Query  272  NLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEV  451
            +LRETVQE YE SAEYEG+H+PKKLEELGNVLTSLDPGDSIVI+K+FSHMLNLANLAEEV
Sbjct  81   DLRETVQELYEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVISKAFSHMLNLANLAEEV  140

Query  452  QIAYRRR-QKLRRG  490
            QIAYRRR +KL++G
Sbjct  141  QIAYRRRVKKLKKG  154


 Score = 65.5 bits (158),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDE+SA TESD+EET K+LV D+ KSP+E+FDALK +
Sbjct  152  KKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDALKNQ  193



>sp|Q9AU12.1|CAPP_PHAVU RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Phaseolus vulgaris]
 gb|AAK28444.1|AF288382_1 phosphoenolpyruvate carboxylase [Phaseolus vulgaris]
Length=968

 Score =   217 bits (552),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQ+LHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLAPSKVSEDDKLIEYDALLLDRFLDILQNLHGEDLKETVQEV  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELGNV+TSLD GDSIV+AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNVITSLDAGDSIVVAKSFSHMLNLANLAEEVQISRRRRNK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 70.1 bits (170),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DEN+A TESDIEETLK+LV ++KKSPQEVFDALK +
Sbjct  122  KKGDFADENNATTESDIEETLKKLVFELKKSPQEVFDALKNQ  163



>gb|AJD81371.1| phosphoenolpyruvate carboxylase isoform 5, partial [Egeria densa]
Length=967

 Score =   215 bits (547),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 114/121 (94%), Gaps = 1/121 (1%)
 Frame = +2

Query  131  NLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETV-QECYEL  307
            N+EKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETV Q CYEL
Sbjct  6    NVEKMASIDAQLRLLAPSKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVVQRCYEL  65

Query  308  SAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRR  487
            SAEYEGR DP+KLEELGNVLTSLDPGDSIV+A SFSHMLNLANLAEEVQIA+RRR KL++
Sbjct  66   SAEYEGRLDPQKLEELGNVLTSLDPGDSIVVASSFSHMLNLANLAEEVQIAFRRRAKLKK  125

Query  488  G  490
            G
Sbjct  126  G  126


 Score = 72.4 bits (176),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETLKRLV+ +KKSPQEVFDALK++
Sbjct  124  KKGDFGDENSATTESDIEETLKRLVMQLKKSPQEVFDALKSQ  165



>ref|XP_007149391.1| hypothetical protein PHAVU_005G066400g [Phaseolus vulgaris]
 gb|ESW21385.1| hypothetical protein PHAVU_005G066400g [Phaseolus vulgaris]
Length=968

 Score =   217 bits (552),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQ+LHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLAPSKVSEDDKLIEYDALLLDRFLDILQNLHGEDLKETVQEV  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELGNV+TSLD GDSIV+AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNVITSLDAGDSIVVAKSFSHMLNLANLAEEVQISRRRRNK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 70.1 bits (170),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DEN+A TESDIEETLK+LV ++KKSPQEVFDALK +
Sbjct  122  KKGDFADENNATTESDIEETLKKLVFELKKSPQEVFDALKNQ  163



>ref|XP_010911773.1| PREDICTED: phosphoenolpyruvate carboxylase 2, partial [Elaeis 
guineensis]
Length=127

 Score =   217 bits (553),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            M+   +EK+ASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MSRNAVEKLASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDP+KL+ELG+VLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPRKLDELGDVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124



>gb|AJD81368.1| phosphoenolpyruvate carboxylase isoform 2 [Egeria densa]
Length=968

 Score =   212 bits (539),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  125  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  304
            + N+EKM SIDAQLR+L P KVSEDDKLVEYDALL+DRFLDILQDLHGE LRETVQ CYE
Sbjct  6    SSNVEKMVSIDAQLRILAPSKVSEDDKLVEYDALLVDRFLDILQDLHGEELRETVQRCYE  65

Query  305  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLR  484
            LSAEYEG+ DP+KLE+LGNVLTSLDPGDSIV++ SFSHMLNLANLAEEVQIA+RRR KL+
Sbjct  66   LSAEYEGKLDPQKLEKLGNVLTSLDPGDSIVVSSSFSHMLNLANLAEEVQIAFRRRAKLK  125

Query  485  RG  490
            +G
Sbjct  126  KG  127


 Score = 75.1 bits (183),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETLKRLVV +KKSPQEVFDALK++
Sbjct  125  KKGDFADENSATTESDIEETLKRLVVQLKKSPQEVFDALKSQ  166



>ref|XP_008812088.1| PREDICTED: SCAR-like protein 2 [Phoenix dactylifera]
Length=2243

 Score =   213 bits (543),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 126/145 (87%), Gaps = 2/145 (1%)
 Frame = +2

Query  59    TICRFR*LKSGLWSGADSEK-MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLD  235
             +ICR + L+ G   G + E+ M+  +LE+ AS+DA+LRLL PGKVSEDDKLVEYDALLLD
Sbjct  1259  SICR-KLLQRGSERGGEREREMSKNSLERHASMDAKLRLLAPGKVSEDDKLVEYDALLLD  1317

Query  236   RFLDILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFS  415
             RFLDILQDLHGE +RETVQECYELSAEYE + DPKKL+ELGNVLTSLDPGDSIV++ SFS
Sbjct  1318  RFLDILQDLHGEEIRETVQECYELSAEYERKQDPKKLDELGNVLTSLDPGDSIVVSSSFS  1377

Query  416   HMLNLANLAEEVQIAYRRRQKLRRG  490
             HMLNLANLAEEVQIA+RRR K ++G
Sbjct  1378  HMLNLANLAEEVQIAHRRRIKRKKG  1402


 Score = 73.2 bits (178),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481   KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
             KKGDF DENSA TESDIEET KRLVV +KKSPQEVFDALK +
Sbjct  1400  KKGDFADENSATTESDIEETFKRLVVQLKKSPQEVFDALKNQ  1441



>gb|AAU07997.1| phosphoenolpyruvate carboxylase 2 [Lupinus albus]
Length=967

 Score =   217 bits (553),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKMASIDAQLR L P KVSEDDKLVEYDALLLDRFLDILQDLHGE+++ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDMKETVQEI  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELGN++TSLD GDSIV AK+FSHMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSIVFAKAFSHMLNLANLAEEVQIAHRRRNK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 69.3 bits (168),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DEN+A TESDIEET KRLV ++KKSPQEVFDALK +
Sbjct  122  KKGDFADENNATTESDIEETFKRLVRELKKSPQEVFDALKNQ  163



>ref|XP_010552117.1| PREDICTED: phosphoenolpyruvate carboxylase 3 [Tarenaya hassleriana]
 ref|XP_010552118.1| PREDICTED: phosphoenolpyruvate carboxylase 3 [Tarenaya hassleriana]
Length=967

 Score =   218 bits (554),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MAARN+EKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ+ 
Sbjct  1    MAARNIEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQDL  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+H+P KLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHEPGKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120


 Score = 68.2 bits (165),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  484  KGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            K DF DENSA TESDIEET KRLVVD+KKSP+EVFDALK +
Sbjct  124  KRDFADENSATTESDIEETFKRLVVDLKKSPEEVFDALKNQ  164



>gb|KJB48959.1| hypothetical protein B456_008G095300 [Gossypium raimondii]
Length=965

 Score =   221 bits (562),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA+R +EK+ SIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MASRKVEKLTSIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPK LEELG V+TSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKILEELGKVITSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            +++G
Sbjct  121  MKKG  124


 Score = 64.7 bits (156),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE+SA TESDIEETLKRLV  + KSP EVFDALK +
Sbjct  122  KKGDFADESSATTESDIEETLKRLVGQLNKSPDEVFDALKNQ  163



>gb|KHG11000.1| Phosphoenolpyruvate carboxylase, housekeeping isozyme [Gossypium 
arboreum]
Length=965

 Score =   221 bits (562),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA+R +EK+ SIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MASRKVEKLTSIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPK LEELG V+TSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKILEELGKVITSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            +++G
Sbjct  121  MKKG  124


 Score = 64.7 bits (156),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE+SA TESDIEETLKRLV  + KSP EVFDALK +
Sbjct  122  KKGDFADESSATTESDIEETLKRLVGQLNKSPDEVFDALKNQ  163



>ref|XP_007048690.1| Phosphoenolpyruvate carboxylase 3 isoform 1 [Theobroma cacao]
 gb|EOX92847.1| Phosphoenolpyruvate carboxylase 3 isoform 1 [Theobroma cacao]
Length=965

 Score =   219 bits (558),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA +++EKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHG ++RETVQEC
Sbjct  1    MAGKSIEKMASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQDLHGGDIRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDP KLEELG V+TSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPLKLEELGKVITSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 66.2 bits (160),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE+SA TESDIEET+KRLV  +KKSP+EVFDALK +
Sbjct  122  KKGDFADESSATTESDIEETIKRLVGQLKKSPEEVFDALKNQ  163



>ref|XP_006407030.1| hypothetical protein EUTSA_v10019997mg [Eutrema salsugineum]
 dbj|BAJ34436.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48483.1| hypothetical protein EUTSA_v10019997mg [Eutrema salsugineum]
Length=968

 Score =   218 bits (554),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAGRNLEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YELSAEYEG  +PKKLEELG+VLTSLDPGDSIVI+K+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YELSAEYEGNREPKKLEELGSVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 67.8 bits (164),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDE+SA TESDIEET KRLV D+ KSP+E+FDALK +
Sbjct  123  KKGDFVDESSATTESDIEETFKRLVSDLGKSPEEIFDALKNQ  164



>ref|NP_001237394.1| phosphoenolpyruvate carboxylase [Glycine max]
 gb|AAS67006.1| Phosphoenolpyruvate carboxylase [Glycine max]
 gb|KHN27941.1| Phosphoenolpyruvate carboxylase 2 [Glycine soja]
Length=966

 Score =   215 bits (548),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MAARN+EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHGE++R+TVQ+C
Sbjct  1    MAARNIEKMASIDAQLRLLAPRKVSDDDKLVEYDALLLDRFLDILQDLHGEDIRQTVQDC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG H P+KLEELGN+LT LD GDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGEHKPEKLEELGNMLTGLDAGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  L  481
            L
Sbjct  121  L  121


 Score = 70.1 bits (170),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSAITESDIEET K+LV  +KK+PQE+FDALK +
Sbjct  123  KKGDFADENSAITESDIEETFKKLVAQLKKTPQEIFDALKNQ  164



>ref|XP_004516076.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Cicer arietinum]
Length=967

 Score =   216 bits (551),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKMASIDA LR LVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAHLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDP+KLEELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGKHDPEKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 68.9 bits (167),  Expect(2) = 4e-68, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DEN+A TESDIEETLKRLV D+ KSPQEVFDALK +
Sbjct  122  KKGDFADENNATTESDIEETLKRLVGDLNKSPQEVFDALKNQ  163



>ref|XP_002280569.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Vitis vinifera]
 ref|XP_010657037.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Vitis vinifera]
 emb|CAN77927.1| hypothetical protein VITISV_018739 [Vitis vinifera]
Length=965

 Score =   219 bits (557),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MAARNLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQ++HGE+L+ETVQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQEIHGEDLKETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDP+KLEELG V+TSLD GDSIV+AKSFS+ML LANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGKHDPQKLEELGRVITSLDAGDSIVVAKSFSNMLTLANLAEEVQIAFRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 66.6 bits (161),  Expect(2) = 4e-68, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE+SA TESDIEET+KRLVV +KKSP+EVFDALK +
Sbjct  122  KKGDFHDESSATTESDIEETIKRLVVQLKKSPEEVFDALKNQ  163



>emb|CBI21984.3| unnamed protein product [Vitis vinifera]
Length=944

 Score =   218 bits (556),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MAARNLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQ++HGE+L+ETVQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQEIHGEDLKETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDP+KLEELG V+TSLD GDSIV+AKSFS+ML LANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGKHDPQKLEELGRVITSLDAGDSIVVAKSFSNMLTLANLAEEVQIAFRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 67.0 bits (162),  Expect(2) = 4e-68, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE+SA TESDIEET+KRLVV +KKSP+EVFDALK +
Sbjct  122  KKGDFHDESSATTESDIEETIKRLVVQLKKSPEEVFDALKNQ  163



>ref|NP_001236741.1| phosphoenolpyruvate carboxylase [Glycine max]
 dbj|BAA23419.1| phosphoenolpyruvate carboxylase [Glycine max]
Length=967

 Score =   216 bits (549),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELGN++TSLD GDSI++AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSILVAKSFSHMLNLANLAEEVQISRRRRNK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 69.3 bits (168),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DEN+A TESDIEETLK+LV  +KKSPQEVFDALK +
Sbjct  122  KKGDFADENNATTESDIEETLKKLVFGLKKSPQEVFDALKNQ  163



>ref|XP_006593478.1| PREDICTED: phosphoenolpyruvate carboxylase isoform X1 [Glycine 
max]
 dbj|BAC41249.1| phosphoenolpyruvate carboxylase [Glycine max]
Length=967

 Score =   215 bits (548),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELGN++TSLD GDSI++AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSILVAKSFSHMLNLANLAEEVQISRRRRNK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 69.3 bits (168),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DEN+A TESDIEETLK+LV  +KKSPQEVFDALK +
Sbjct  122  KKGDFADENNATTESDIEETLKKLVFGLKKSPQEVFDALKNQ  163



>ref|XP_007149740.1| hypothetical protein PHAVU_005G095300g [Phaseolus vulgaris]
 gb|ESW21734.1| hypothetical protein PHAVU_005G095300g [Phaseolus vulgaris]
Length=966

 Score =   212 bits (540),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RN+EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHGE++R+TVQ+C
Sbjct  1    MATRNIEKMASIDAQLRLLAPRKVSDDDKLVEYDALLLDRFLDILQDLHGEDIRQTVQDC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG H P+KLEELGN+LT LD GDSIVI+KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGEHRPEKLEELGNMLTGLDAGDSIVISKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  L  481
            L
Sbjct  121  L  121


 Score = 72.4 bits (176),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA+TESDIEETLKRLV  +KK+PQEVFDALK +
Sbjct  123  KKGDFADENSAMTESDIEETLKRLVTQLKKTPQEVFDALKNQ  164



>ref|XP_003543306.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Glycine max]
Length=972

 Score =   214 bits (546),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MAARN+EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHGE++R+TVQ+C
Sbjct  1    MAARNIEKMASIDAQLRLLAPRKVSDDDKLVEYDALLLDRFLDILQDLHGEDIRQTVQDC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG H P KLEELGN+LT LD GDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGEHKPDKLEELGNMLTGLDAGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  L  481
            L
Sbjct  121  L  121


 Score = 70.1 bits (170),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSAITESDIEET K+LV  +KK+PQE+FDALK +
Sbjct  123  KKGDFADENSAITESDIEETFKKLVAQLKKTPQEIFDALKNQ  164



>gb|KHN36882.1| Phosphoenolpyruvate carboxylase [Glycine soja]
Length=967

 Score =   215 bits (548),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELGN++TSLD GDSI++AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSILVAKSFSHMLNLANLAEEVQISRRRRNK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 69.3 bits (168),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DEN+A TESDIEETLK+LV  +KKSPQEVFDALK +
Sbjct  122  KKGDFADENNATTESDIEETLKKLVFGLKKSPQEVFDALKNQ  163



>gb|KHN36697.1| Phosphoenolpyruvate carboxylase 2 [Glycine soja]
Length=966

 Score =   214 bits (546),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MAARN+EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHGE++R+TVQ+C
Sbjct  1    MAARNIEKMASIDAQLRLLAPRKVSDDDKLVEYDALLLDRFLDILQDLHGEDIRQTVQDC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG H P KLEELGN+LT LD GDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGEHKPDKLEELGNMLTGLDAGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  L  481
            L
Sbjct  121  L  121


 Score = 70.1 bits (170),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSAITESDIEET K+LV  +KK+PQE+FDALK +
Sbjct  123  KKGDFADENSAITESDIEETFKKLVAQLKKTPQEIFDALKNQ  164



>ref|XP_007132856.1| hypothetical protein PHAVU_011G130400g [Phaseolus vulgaris]
 gb|ESW04850.1| hypothetical protein PHAVU_011G130400g [Phaseolus vulgaris]
Length=966

 Score =   213 bits (541),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKMASIDAQLRLLVP KVS+DDKLVEYDALLLDRFLDILQDLHG ++RETVQ+C
Sbjct  1    MATRNLEKMASIDAQLRLLVPSKVSDDDKLVEYDALLLDRFLDILQDLHGGDIRETVQDC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+++P+KLEELGN+LT LD GDSIVI+KSF+HMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGQNNPQKLEELGNMLTGLDAGDSIVISKSFAHMLNLANLAEEVQIAYRRRIK  120

Query  479  L  481
            L
Sbjct  121  L  121


 Score = 72.0 bits (175),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF+DENSAITESDIEET KRLV  +KK+PQE+FDALK++
Sbjct  123  KKGDFIDENSAITESDIEETFKRLVNQLKKTPQEIFDALKSQ  164



>gb|AAO15570.1|AF459644_1 phosphoenolpyruvate carboxylase [Lupinus albus]
Length=967

 Score =   215 bits (548),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKMASIDAQLR L P KVSEDDKLVEYDALLLDRFLDILQDLHGE+++ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDMKETVQEI  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELGN++TSLD GDSIV AK+FSHMLNLANLAEEVQIA+RRR  
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSIVFAKAFSHMLNLANLAEEVQIAHRRRNN  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 69.3 bits (168),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DEN+A TESDIEET KRLV ++KKSPQEVFDALK +
Sbjct  122  KKGDFADENNATTESDIEETFKRLVRELKKSPQEVFDALKNQ  163



>gb|KEH19559.1| phosphoenolpyruvate carboxylase [Medicago truncatula]
Length=967

 Score =   219 bits (559),  Expect(2) = 8e-68, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDP+KLEELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGKHDPQKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 65.1 bits (157),  Expect(2) = 8e-68, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DEN+A TESDIEET+KRLV ++ K+PQEVFDALK +
Sbjct  122  KKGDFADENNATTESDIEETIKRLVGELNKTPQEVFDALKNQ  163



>gb|KEH19560.1| phosphoenolpyruvate carboxylase [Medicago truncatula]
Length=873

 Score =   219 bits (559),  Expect(2) = 8e-68, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDP+KLEELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGKHDPQKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 65.1 bits (157),  Expect(2) = 8e-68, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DEN+A TESDIEET+KRLV ++ K+PQEVFDALK +
Sbjct  122  KKGDFADENNATTESDIEETIKRLVGELNKTPQEVFDALKNQ  163



>emb|CAB65170.1| phosphoenolpyruvate carboxylase 1 [Solanum lycopersicum var. 
cerasiforme]
Length=964

 Score =   219 bits (559),  Expect(2) = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            M  RNL+K+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ TVQ+C
Sbjct  1    MTTRNLDKLASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKGTVQDC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYE +HDPKKLEELGNVLTSL PGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEAKHDPKKLEELGNVLTSLVPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  479  LRR  487
            L++
Sbjct  121  LKK  123


 Score = 64.7 bits (156),  Expect(2) = 8e-68, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE++A TESDIEET K+LV D+KKSPQEVFDA+K +
Sbjct  123  KKGDFGDESNATTESDIEETFKKLVGDLKKSPQEVFDAIKNQ  164



>ref|XP_010920051.1| PREDICTED: LOW QUALITY PROTEIN: phosphoenolpyruvate carboxylase, 
housekeeping isozyme-like [Elaeis guineensis]
Length=966

 Score =   213 bits (541),  Expect(2) = 8e-68, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            M+   +EK+ASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MSRNAVEKLASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEL  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDP+KL+ELGNVLTSLDPGDSIVI KSFS+MLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPRKLDELGNVLTSLDPGDSIVITKSFSNMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 71.6 bits (174),  Expect(2) = 8e-68, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETLKRLVV +KKSP EVFDALK +
Sbjct  122  KKGDFADENSAATESDIEETLKRLVVQLKKSPAEVFDALKNQ  163



>ref|XP_011012152.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Populus euphratica]
Length=965

 Score =   221 bits (562),  Expect(2) = 9e-68, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNL+KMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHG+++RETV +C
Sbjct  1    MADRNLQKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGQDIRETVHDC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYE  HDP+KLEELG V+TSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEAMHDPQKLEELGKVITSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 63.2 bits (152),  Expect(2) = 9e-68, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETL RLV  + KSP+EVF+ALK +
Sbjct  122  KKGDFADENSATTESDIEETLNRLVGQLNKSPEEVFEALKNQ  163



>emb|CAA45504.1| phosphoenolpyruvate carboxylase [Flaveria trinervia]
Length=967

 Score =   224 bits (570),  Expect(2) = 9e-68, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RN+EK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLD+FLDILQDLHGE+L+E VQ+C
Sbjct  1    MANRNVEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDKFLDILQDLHGEDLKEAVQQC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKL+ELG++LTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLDELGSLLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L+ G
Sbjct  121  LKSG  124


 Score = 60.5 bits (145),  Expect(2) = 9e-68, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            K GDF DE +A TESDIEET KRLV  + KSP+EVFDALK +
Sbjct  122  KSGDFADEANATTESDIEETFKRLVHKLNKSPEEVFDALKNQ  163



>gb|KFK38845.1| phosphoenolpyruvate carboxylase [Arabis alpina]
Length=968

 Score =   216 bits (551),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 119/125 (95%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RN+EKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAGRNVEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YELSAEYEG+ +P+KLEELG+VLTSLDPGDSIVI+K+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YELSAEYEGKREPEKLEELGSVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 67.8 bits (164),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDE+SA TESDIEET KRLV D+ KSP+E+FDALK +
Sbjct  123  KKGDFVDESSATTESDIEETFKRLVSDLGKSPEEIFDALKNQ  164



>gb|ABR29878.1| phosphoenolpyruvate carboxylase [Ricinus communis]
Length=965

 Score =   213 bits (541),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNL  MASIDAQLRLL   KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQ+C
Sbjct  1    MAGRNLVIMASIDAQLRLLALRKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQDC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+H+P+KL ELG VLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHNPQKLAELGKVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 71.2 bits (173),  Expect(2) = 1e-67, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETLKRLVV +KKSP+EVFDALK +
Sbjct  122  KKGDFADENSATTESDIEETLKRLVVQLKKSPEEVFDALKNQ  163



>pdb|3ZGB|A Chain A, Greater Efficiency Of Photosynthetic Carbon Fixation 
Due To Single Amino Acid Substitution
 pdb|3ZGB|B Chain B, Greater Efficiency Of Photosynthetic Carbon Fixation 
Due To Single Amino Acid Substitution
Length=972

 Score =   223 bits (567),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/119 (91%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +2

Query  134  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  313
            LEK+ASIDAQLRLLVPGKVSEDDKL+EYDALLLD+FLDILQDLHGE+L+E VQECYELSA
Sbjct  12   LEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDKFLDILQDLHGEDLKEAVQECYELSA  71

Query  314  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRRG  490
            EYEG+HDPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR KL+RG
Sbjct  72   EYEGKHDPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIKLKRG  130


 Score = 61.2 bits (147),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            K+GDF DE +A TESDIEET K+LV+ + KSP+EVFDALK +
Sbjct  128  KRGDFADEANATTESDIEETFKKLVLKLNKSPEEVFDALKNQ  169



>ref|XP_010542308.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like [Tarenaya hassleriana]
Length=967

 Score =   218 bits (555),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKM SIDAQLR LVP KV EDD+LVEYDALLLDRFLDILQDLHGE LRETVQE 
Sbjct  1    MATRNLEKMVSIDAQLRQLVPAKVGEDDRLVEYDALLLDRFLDILQDLHGEGLRETVQEL  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120


 Score = 65.5 bits (158),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  490  DFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            DF DENSA TESDIEET KRLVVD+KKSP+EVF+ALK +
Sbjct  126  DFADENSATTESDIEETFKRLVVDLKKSPEEVFEALKNQ  164



>ref|XP_002882904.1| ATPPC3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59163.1| ATPPC3 [Arabidopsis lyrata subsp. lyrata]
Length=968

 Score =   216 bits (550),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 119/125 (95%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RN+EKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAGRNIEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YELSAEYEG+ +PKKLEELG+VLTSLDPGDSIVI+K+FSHMLNLANLAEEVQIA+RRR +
Sbjct  61   YELSAEYEGKREPKKLEELGSVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAHRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 67.8 bits (164),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDE+SA TESDIEET KRLV D+ KSP+E+FDALK +
Sbjct  123  KKGDFVDESSATTESDIEETFKRLVSDLGKSPEEIFDALKNQ  164



>gb|EEC83482.1| hypothetical protein OsI_28999 [Oryza sativa Indica Group]
Length=684

 Score =   209 bits (532),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = +2

Query  125  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  304
            A  +EKMASIDAQLR+L P K+SEDDKLVEYDALLLDRFLDILQDLHG++LRE VQECYE
Sbjct  2    AGKVEKMASIDAQLRMLAPAKLSEDDKLVEYDALLLDRFLDILQDLHGDDLREMVQECYE  61

Query  305  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLR  484
            ++AEYEG+HD +KL+ELGN+LTSLDPGDSIV+AK+FSHMLNLANLAEEVQIAYRRR KL+
Sbjct  62   IAAEYEGKHDSQKLDELGNMLTSLDPGDSIVMAKAFSHMLNLANLAEEVQIAYRRRIKLK  121

Query  485  RG  490
            +G
Sbjct  122  KG  123


 Score = 74.3 bits (181),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA+TESDIEET KRLVVD+KKSP EVFDALK++
Sbjct  121  KKGDFADENSALTESDIEETFKRLVVDLKKSPAEVFDALKSQ  162



>ref|XP_002894435.1| ATPPC1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70694.1| ATPPC1 [Arabidopsis lyrata subsp. lyrata]
Length=967

 Score =   218 bits (556),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA R LEKMASID  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAYRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YE SAEYEG+H+PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 65.1 bits (157),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDE+SA TESD+EET K+LV D+ KSP+E+FDALK +
Sbjct  123  KKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDALKNQ  164



>ref|XP_010479886.1| PREDICTED: phosphoenolpyruvate carboxylase 1 [Camelina sativa]
Length=967

 Score =   218 bits (555),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA R LEKMASID  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MANRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YE SAEYEG+H+PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRVK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 65.1 bits (157),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDE+SA TESD+EET K+LV D+ KSP+E+FDALK +
Sbjct  123  KKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDALKNQ  164



>ref|XP_010500970.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like isoform X1 
[Camelina sativa]
 ref|XP_010500971.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like isoform X2 
[Camelina sativa]
 ref|XP_010500972.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like isoform X3 
[Camelina sativa]
 ref|XP_010462211.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like isoform X1 
[Camelina sativa]
 ref|XP_010462212.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like isoform X2 
[Camelina sativa]
 ref|XP_010462213.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like isoform X3 
[Camelina sativa]
Length=967

 Score =   218 bits (555),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA R LEKMASID  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MANRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YE SAEYEG+H+PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRVK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 65.1 bits (157),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDE+SA TESD+EET K+LV D+ KSP+E+FDALK +
Sbjct  123  KKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDALKNQ  164



>ref|NP_001061646.1| Os08g0366000 [Oryza sativa Japonica Group]
 dbj|BAC24913.1| phosphoenolpyruvate carboxylase [Oryza sativa Japonica Group]
 dbj|BAF23560.1| Os08g0366000 [Oryza sativa Japonica Group]
 gb|EAZ06753.1| hypothetical protein OsI_28997 [Oryza sativa Indica Group]
 gb|EAZ42509.1| hypothetical protein OsJ_27076 [Oryza sativa Japonica Group]
 dbj|BAG93600.1| unnamed protein product [Oryza sativa Japonica Group]
Length=964

 Score =   209 bits (531),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = +2

Query  125  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  304
            A  +EKMASIDAQLR+L P K+SEDDKLVEYDALLLDRFLDILQDLHG++LRE VQECYE
Sbjct  2    AGKVEKMASIDAQLRMLAPAKLSEDDKLVEYDALLLDRFLDILQDLHGDDLRELVQECYE  61

Query  305  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLR  484
            ++AEYEG+HD +KL+ELGN+LTSLDPGDSIV+AK+FSHMLNLANLAEEVQIAYRRR KL+
Sbjct  62   IAAEYEGKHDSQKLDELGNMLTSLDPGDSIVMAKAFSHMLNLANLAEEVQIAYRRRIKLK  121

Query  485  RG  490
            +G
Sbjct  122  KG  123


 Score = 74.3 bits (181),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA+TESDIEET KRLVVD+KKSP EVFDALK++
Sbjct  121  KKGDFADENSALTESDIEETFKRLVVDLKKSPAEVFDALKSQ  162



>ref|XP_006296907.1| hypothetical protein CARUB_v10012899mg [Capsella rubella]
 gb|EOA29805.1| hypothetical protein CARUB_v10012899mg [Capsella rubella]
Length=968

 Score =   215 bits (547),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 119/125 (95%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RN+EKMASIDAQLR LVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAGRNVEKMASIDAQLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YELSAEYEG+ +PKKLEELG+VLTSLDPGDSIVI+K+FSHMLNLANLAEEVQIA+RRR +
Sbjct  61   YELSAEYEGKREPKKLEELGSVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAHRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 67.8 bits (164),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDE+SA TESDIEET KRLV D+ KSP+E+FDALK +
Sbjct  123  KKGDFVDESSATTESDIEETFKRLVSDLGKSPEEIFDALKNQ  164



>tpg|DAA61010.1| TPA: phosphoenolpyruvate carboxylase4 [Zea mays]
Length=222

 Score =   206 bits (523),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 117/126 (93%), Gaps = 2/126 (2%)
 Frame = +2

Query  119  MAA--RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQ  292
            MAA    +E+++SIDAQLR+LVPGKVSEDDKL+EYDALLLDRFLDILQDLHG++L+E VQ
Sbjct  1    MAALGAKMERLSSIDAQLRMLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGDDLKEMVQ  60

Query  293  ECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR  472
            ECYE++AEYE +HD +KL+ELG ++TSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR
Sbjct  61   ECYEVAAEYETKHDLQKLDELGKMITSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR  120

Query  473  QKLRRG  490
             KL++G
Sbjct  121  IKLKKG  126


 Score = 77.0 bits (188),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSAITESDIEETLKRLVVD+KKSP EVFDALK++
Sbjct  124  KKGDFADENSAITESDIEETLKRLVVDLKKSPAEVFDALKSQ  165



>ref|XP_003597124.1| Phosphoenolpyruvate carboxylase [Medicago truncatula]
 gb|AES67375.1| phosphoenolpyruvate carboxylase [Medicago truncatula]
Length=966

 Score =   214 bits (544),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RN+EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHGE++R+TVQ+C
Sbjct  1    MATRNIEKMASIDAQLRLLAPKKVSDDDKLVEYDALLLDRFLDILQDLHGEDIRQTVQDC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG H P+KLEELGN+LT LD GDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGEHRPEKLEELGNMLTGLDAGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  L  481
            L
Sbjct  121  L  121


 Score = 68.6 bits (166),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSAITESDIEET K+LV ++KK+P EVFDALK++
Sbjct  123  KKGDFADENSAITESDIEETFKKLVTELKKTPLEVFDALKSQ  164



>ref|XP_008813762.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like isoform X1 
[Phoenix dactylifera]
Length=966

 Score =   213 bits (542),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            M+   +EK+ASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQ LHGE+LRETVQE 
Sbjct  1    MSRNVVEKLASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQYLHGEDLRETVQEL  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+ DP KL+ELGNVLTSLDPGDSIV+AKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKPDPSKLDELGNVLTSLDPGDSIVVAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 69.7 bits (169),  Expect(2) = 3e-67, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETLKRLVV +KKSP E+FDALK +
Sbjct  122  KKGDFADENSAATESDIEETLKRLVVQLKKSPAEIFDALKNQ  163



>ref|NP_001275821.1| phosphoenolpyruvate carboxylase [Citrus sinensis]
 gb|ABK54024.2| phosphoenolpyruvate carboxylase [Citrus sinensis]
Length=967

 Score =   216 bits (549),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 119/124 (96%), Gaps = 1/124 (1%)
 Frame = +2

Query  122  AARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECY  301
            A RNLEKMASIDAQLRLLVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQECY
Sbjct  3    ANRNLEKMASIDAQLRLLVPRKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQECY  62

Query  302  ELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-QK  478
            EL+AEYEG++DP K +ELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEE+QIA+RRR +K
Sbjct  63   ELAAEYEGKNDPSKFKELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEELQIAHRRRIKK  122

Query  479  LRRG  490
            L++G
Sbjct  123  LKKG  126


 Score = 66.6 bits (161),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEET KRLV ++ KSP+E+FDALK +
Sbjct  124  KKGDFADENSATTESDIEETFKRLVGELNKSPEEIFDALKNQ  165



>ref|XP_006306679.1| hypothetical protein CARUB_v10008196mg [Capsella rubella]
 gb|EOA39577.1| hypothetical protein CARUB_v10008196mg [Capsella rubella]
Length=967

 Score =   217 bits (553),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA R LEKMASID  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MANRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YE SAEYEG+H+PKKLEELGNVLTSLDPGDSIVI+K+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAYRRRVK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 65.1 bits (157),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDE+SA TESD+EET K+LV D+ KSP+E+FDALK +
Sbjct  123  KKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDALKNQ  164



>ref|XP_006487452.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
isoform X1 [Citrus sinensis]
 ref|XP_006487453.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
isoform X2 [Citrus sinensis]
 ref|XP_006487454.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
isoform X3 [Citrus sinensis]
 gb|KDO44634.1| hypothetical protein CISIN_1g002089mg [Citrus sinensis]
 gb|KDO44635.1| hypothetical protein CISIN_1g002089mg [Citrus sinensis]
Length=969

 Score =   216 bits (549),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 119/124 (96%), Gaps = 1/124 (1%)
 Frame = +2

Query  122  AARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECY  301
            A RNLEKMASIDAQLRLLVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQECY
Sbjct  3    ANRNLEKMASIDAQLRLLVPRKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQECY  62

Query  302  ELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-QK  478
            EL+AEYEG++DP K +ELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEE+QIA+RRR +K
Sbjct  63   ELAAEYEGKNDPSKFKELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEELQIAHRRRIKK  122

Query  479  LRRG  490
            L++G
Sbjct  123  LKKG  126


 Score = 66.6 bits (161),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEET KRLV ++ KSP+E+FDALK +
Sbjct  124  KKGDFADENSATTESDIEETFKRLVGELNKSPEEIFDALKNQ  165



>ref|XP_009406237.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Musa acuminata 
subsp. malaccensis]
Length=963

 Score =   213 bits (543),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  134  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  313
            LEKMASIDA +RLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE +RETVQE YELSA
Sbjct  4    LEKMASIDAHMRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEEIRETVQELYELSA  63

Query  314  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRRG  490
            EYEG H+P+KLEELGNVLTSLDPGD+IV++KSFSHMLNLANLAEEVQIAYRRR KL++G
Sbjct  64   EYEGNHEPEKLEELGNVLTSLDPGDTIVVSKSFSHMLNLANLAEEVQIAYRRRIKLKKG  122


 Score = 68.9 bits (167),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSAITESDIEETLKRLV  +KKS +EVFDALK +
Sbjct  120  KKGDFADENSAITESDIEETLKRLVTQLKKSKEEVFDALKNQ  161



>ref|XP_006442514.1| hypothetical protein CICLE_v10018719mg [Citrus clementina]
 gb|ESR55754.1| hypothetical protein CICLE_v10018719mg [Citrus clementina]
Length=969

 Score =   215 bits (548),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 119/124 (96%), Gaps = 1/124 (1%)
 Frame = +2

Query  122  AARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECY  301
            A RNLEKMASIDAQLRLLVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQECY
Sbjct  3    ANRNLEKMASIDAQLRLLVPRKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQECY  62

Query  302  ELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-QK  478
            EL+AEYEG++DP K +ELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEE+QIA+RRR +K
Sbjct  63   ELAAEYEGKNDPSKFKELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEELQIAHRRRIKK  122

Query  479  LRRG  490
            L++G
Sbjct  123  LKKG  126


 Score = 66.6 bits (161),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEET KRLV ++ KSP+E+FDALK +
Sbjct  124  KKGDFADENSATTESDIEETFKRLVGELNKSPEEIFDALKNQ  165



>emb|CAJ86550.1| phosphoenolpyrovate carboxylase [Lupinus luteus]
Length=968

 Score =   212 bits (540),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +2

Query  128  RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYEL  307
            RN+EKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE L++TVQE YEL
Sbjct  5    RNMEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEGLKDTVQEVYEL  64

Query  308  SAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRR  487
            S+EYEG+HDPKKLEE+GNV+TSLD GDSIV+AKSFSHMLNLANLAEEVQI++RRR KL++
Sbjct  65   SSEYEGKHDPKKLEEIGNVITSLDAGDSIVVAKSFSHMLNLANLAEEVQISHRRRNKLKK  124

Query  488  G  490
            G
Sbjct  125  G  125


 Score = 69.7 bits (169),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKG+F DE +A TESDIEETLKRLV D+KKSPQEVFDALK++
Sbjct  123  KKGNFADETNATTESDIEETLKRLVFDLKKSPQEVFDALKSQ  164



>gb|AAO42888.1| At3g14940 [Arabidopsis thaliana]
 dbj|BAE99551.1| phosphoenolpyruvate carboxylase [Arabidopsis thaliana]
Length=968

 Score =   214 bits (545),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RN+EKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAGRNIEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YELSAEYEG+ +P KLEELG+VLTSLDPGDSIVI+K+FSHMLNLANLAEEVQIA+RRR +
Sbjct  61   YELSAEYEGKREPSKLEELGSVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAHRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 67.8 bits (164),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDE+SA TESDIEET KRLV D+ KSP+E+FDALK +
Sbjct  123  KKGDFVDESSATTESDIEETFKRLVSDLGKSPEEIFDALKNQ  164



>dbj|BAJ34480.1| unnamed protein product [Thellungiella halophila]
Length=967

 Score =   217 bits (552),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA R LEKMASID  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MANRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YE SAEYEG+HDPKKLE+LG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHDPKKLEDLGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 65.1 bits (157),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDE+SA TESD+EET K+LV D+ KSP+E+FDALK +
Sbjct  123  KKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDALKNQ  164



>ref|NP_188112.1| phosphoenolpyruvate carboxylase 3 [Arabidopsis thaliana]
 sp|Q84VW9.2|CAPP3_ARATH RecName: Full=Phosphoenolpyruvate carboxylase 3; Short=AtPPC3; 
Short=PEPC 3; Short=PEPCase 3 [Arabidopsis thaliana]
 gb|AAC24594.1| phosphoenolpyruvate carboxylase [Arabidopsis thaliana]
 emb|CAA10486.1| phospho enole pyruvate carboxylase [Arabidopsis thaliana]
 dbj|BAA97057.1| phosphoenolpyruvate carboxylase [Arabidopsis thaliana]
 gb|AEE75592.1| phosphoenolpyruvate carboxylase 3 [Arabidopsis thaliana]
Length=968

 Score =   214 bits (545),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RN+EKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAGRNIEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YELSAEYEG+ +P KLEELG+VLTSLDPGDSIVI+K+FSHMLNLANLAEEVQIA+RRR +
Sbjct  61   YELSAEYEGKREPSKLEELGSVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAHRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 67.8 bits (164),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDE+SA TESDIEET KRLV D+ KSP+E+FDALK +
Sbjct  123  KKGDFVDESSATTESDIEETFKRLVSDLGKSPEEIFDALKNQ  164



>ref|XP_006392801.1| hypothetical protein EUTSA_v10011967mg, partial [Eutrema salsugineum]
 gb|ESQ30087.1| hypothetical protein EUTSA_v10011967mg, partial [Eutrema salsugineum]
Length=935

 Score =   216 bits (551),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA R LEKMASID  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MANRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YE SAEYEG+HDPKKLE+LG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHDPKKLEDLGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 65.1 bits (157),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDE+SA TESD+EET K+LV D+ KSP+E+FDALK +
Sbjct  123  KKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDALKNQ  164



>ref|XP_009146304.1| PREDICTED: phosphoenolpyruvate carboxylase 3 [Brassica rapa]
 ref|XP_009146305.1| PREDICTED: phosphoenolpyruvate carboxylase 3 [Brassica rapa]
Length=967

 Score =   219 bits (559),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 119/125 (95%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RN+EKMASIDAQLR LVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAGRNIEKMASIDAQLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YELSAEYEG+ DPKKLEELG+VLTSLDPGDSIVI+K+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YELSAEYEGKRDPKKLEELGSVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 62.0 bits (149),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE+SA TESDIEET KRLV  + KSP+E+FDALK +
Sbjct  123  KKGDFADESSATTESDIEETFKRLVGVLGKSPEEIFDALKNQ  164



>ref|XP_008793018.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Phoenix dactylifera]
Length=966

 Score =   216 bits (550),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            M+   +EK+AS+DAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MSRNGVEKLASVDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+ DP KL+ELGNVLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKRDPSKLDELGNVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRGIL  496
            L++G  
Sbjct  121  LKKGYF  126


 Score = 65.5 bits (158),  Expect(2) = 6e-67, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKG F DENSA TESDIEETLKRL+V +KKSP EVFDALK++
Sbjct  122  KKGYFADENSAATESDIEETLKRLMVQLKKSPAEVFDALKSQ  163



>gb|ABR17346.1| unknown [Picea sitchensis]
Length=963

 Score =   223 bits (568),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA  NLEKMASIDAQ+RLLVPGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct  1    MARNNLEKMASIDAQMRLLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDIREMVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YE S EYEG++DP KLEELGNVLTSLDPGDSIV+A SFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YERSGEYEGKNDPHKLEELGNVLTSLDPGDSIVVASSFSHMLNLANLAEEVQIAYRRRNK  120

Query  479  LRRG  490
            ++RG
Sbjct  121  IKRG  124


 Score = 58.2 bits (139),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            K+G F DE++A TESDIEET KRLV  + KSP EVFDALK +
Sbjct  122  KRGGFADESNATTESDIEETFKRLVNQLGKSPAEVFDALKNQ  163



>emb|CAJ84247.1| phosphoenolpyruvate carboxylase [Lupinus luteus]
Length=967

 Score =   213 bits (543),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEV  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYE +H+P+KLE+LGN++TSLD GDSIV AK+FSHMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEEKHEPEKLEKLGNIITSLDAGDSIVFAKAFSHMLNLANLAEEVQIAHRRRNK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 68.2 bits (165),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DEN+A TESDIEET KRLV ++KKSPQ+VFDALK +
Sbjct  122  KKGDFADENNATTESDIEETFKRLVGELKKSPQQVFDALKNQ  163



>dbj|BAH19953.1| AT1G53310 [Arabidopsis thaliana]
Length=967

 Score =   216 bits (550),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA R LEKMASID  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MANRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YE SAEYEG+H+PKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 65.1 bits (157),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDE+SA TESD+EET K+LV D+ KSP+E+FDALK +
Sbjct  123  KKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDALKNQ  164



>ref|NP_175738.1| phosphoenolpyruvate carboxylase 1 [Arabidopsis thaliana]
 ref|NP_001031178.1| phosphoenolpyruvate carboxylase 1 [Arabidopsis thaliana]
 ref|NP_001031179.1| phosphoenolpyruvate carboxylase 1 [Arabidopsis thaliana]
 sp|Q9MAH0.1|CAPP1_ARATH RecName: Full=Phosphoenolpyruvate carboxylase 1; Short=AtPPC1; 
Short=PEPC 1; Short=PEPCase 1; AltName: Full=107-kDa PEPC 
polypeptide [Arabidopsis thaliana]
 gb|AAF69546.1|AC008007_21 F12M16.21 [Arabidopsis thaliana]
 gb|AAL09748.1| At1g53310/F12M16_21 [Arabidopsis thaliana]
 gb|AAN18213.1| At1g53310/F12M16_21 [Arabidopsis thaliana]
 emb|CAD58725.1| phosphoenolpyruvate carboxylase [Arabidopsis thaliana]
 gb|AEE32921.1| phosphoenolpyruvate carboxylase 1 [Arabidopsis thaliana]
 gb|AEE32922.1| phosphoenolpyruvate carboxylase 1 [Arabidopsis thaliana]
 gb|AEE32923.1| phosphoenolpyruvate carboxylase 1 [Arabidopsis thaliana]
Length=967

 Score =   216 bits (550),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA R LEKMASID  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MANRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YE SAEYEG+H+PKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 65.1 bits (157),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDE+SA TESD+EET K+LV D+ KSP+E+FDALK +
Sbjct  123  KKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDALKNQ  164



>ref|XP_002302820.2| hypothetical protein POPTR_0002s22720g [Populus trichocarpa]
 gb|EEE82093.2| hypothetical protein POPTR_0002s22720g [Populus trichocarpa]
Length=995

 Score =   218 bits (556),  Expect(2) = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNL+KMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHG+++RETV +C
Sbjct  31   MADRNLQKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGKDIRETVHDC  90

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYE +HDP+KLEELG V+TSLDPGDSIV+ KSFSHMLNLANLAEEVQIA RRR K
Sbjct  91   YELSAEYEAKHDPQKLEELGRVITSLDPGDSIVVTKSFSHMLNLANLAEEVQIASRRRIK  150

Query  479  LRRG  490
            L++G
Sbjct  151  LKKG  154


 Score = 63.2 bits (152),  Expect(2) = 7e-67, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETL RLV  + KSP+EVF+ALK +
Sbjct  152  KKGDFADENSATTESDIEETLNRLVGQLNKSPEEVFEALKNQ  193



>ref|XP_006659319.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Oryza brachyantha]
Length=964

 Score =   209 bits (531),  Expect(2) = 7e-67, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  125  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  304
            A  +EKMASIDAQLR+L P K+SEDDKLVEYDALLLDRFLDILQDLHG++LRE VQECYE
Sbjct  2    AGKVEKMASIDAQLRMLAPAKLSEDDKLVEYDALLLDRFLDILQDLHGDDLREMVQECYE  61

Query  305  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLR  484
            ++AEYEG+HD +KL ELGN+LTSLDPGDSIV+AK+FSHMLNLANLAEEVQIAYRRR KL+
Sbjct  62   IAAEYEGKHDSQKLSELGNMLTSLDPGDSIVMAKAFSHMLNLANLAEEVQIAYRRRIKLK  121

Query  485  RG  490
            +G
Sbjct  122  KG  123


 Score = 72.4 bits (176),  Expect(2) = 7e-67, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA+TESDIEET KRLVVD+KKSP EVFDALK++
Sbjct  121  KKGDFADENSALTESDIEETFKRLVVDLKKSPAEVFDALKSQ  162



>ref|XP_004487157.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Cicer arietinum]
Length=965

 Score =   208 bits (530),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RN+EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHG+++R+TVQ+C
Sbjct  1    MATRNIEKMASIDAQLRLLAPRKVSDDDKLVEYDALLLDRFLDILQDLHGQDIRQTVQDC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG H+ +KLEELGN+LT LD GDSIVI+KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGNHESEKLEELGNMLTGLDAGDSIVISKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  L  481
            L
Sbjct  121  L  121


 Score = 72.4 bits (176),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSAITESDIEETLKRLV ++KK+P+EVFDALK +
Sbjct  123  KKGDFADENSAITESDIEETLKRLVTELKKTPEEVFDALKNQ  164



>ref|XP_010052683.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Eucalyptus grandis]
 gb|KCW89639.1| hypothetical protein EUGRSUZ_A01915 [Eucalyptus grandis]
 gb|KCW89640.1| hypothetical protein EUGRSUZ_A01915 [Eucalyptus grandis]
Length=966

 Score =   218 bits (555),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MAARNLEK+ SIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAARNLEKLTSIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGESIRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+ +P+KLEELG +LT LDPGDSIVI KSF+HMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGKQEPQKLEELGKMLTGLDPGDSIVITKSFAHMLNLANLAEEVQIAHRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 63.2 bits (152),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE SA TESDIEET KRLV  +KKSP+EVF ALK +
Sbjct  122  KKGDFADEASATTESDIEETFKRLVGQLKKSPEEVFSALKNQ  163



>ref|XP_010925637.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Elaeis guineensis]
Length=965

 Score =   209 bits (531),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            M+  +LE+ AS+DAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC
Sbjct  1    MSKNSLERHASVDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEY  + D KKL ELGNVLTSLDPGDSIV+A SFSHMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYGRKQDLKKLGELGNVLTSLDPGDSIVVASSFSHMLNLANLAEEVQIAHRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 72.0 bits (175),  Expect(2) = 1e-66, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETLKRLVV +KKSPQEVFDALK +
Sbjct  122  KKGDFADENSAPTESDIEETLKRLVVQLKKSPQEVFDALKNQ  163



>pdb|3ZGE|A Chain A, Greater Efficiency Of Photosynthetic Carbon Fixation 
Due To Single Amino Acid Substitution
 pdb|3ZGE|B Chain B, Greater Efficiency Of Photosynthetic Carbon Fixation 
Due To Single Amino Acid Substitution
 pdb|4BXC|A Chain A, Resolving The Activation Site Of Positive Regulators 
In Plant Phosphoenolpyruvate Carboxylase
 pdb|4BXC|B Chain B, Resolving The Activation Site Of Positive Regulators 
In Plant Phosphoenolpyruvate Carboxylase
 pdb|4BXH|A Chain A, Resolving The Activation Site Of Positive Regulators 
In Plant Phosphoenolpyruvate Carboxylase
Length=990

 Score =   220 bits (561),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RN+EK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLD+FLDILQDLHGE+L+E VQ+C
Sbjct  25   MANRNVEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDKFLDILQDLHGEDLKEAVQQC  84

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELG++LTSLD GDSIVIAK+FSHMLNLANLAEE+QIAYRRR K
Sbjct  85   YELSAEYEGKHDPKKLEELGSLLTSLDTGDSIVIAKAFSHMLNLANLAEELQIAYRRRIK  144

Query  479  LRRG  490
            L+ G
Sbjct  145  LKSG  148


 Score = 60.5 bits (145),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            K GDF DE +A TESDIEET KRLV  + KSP+EVFDALK +
Sbjct  146  KSGDFADEANATTESDIEETFKRLVHKLNKSPEEVFDALKNQ  187



>pdb|4BXH|B Chain B, Resolving The Activation Site Of Positive Regulators 
In Plant Phosphoenolpyruvate Carboxylase
Length=990

 Score =   220 bits (561),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RN+EK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLD+FLDILQDLHGE+L+E VQ+C
Sbjct  25   MANRNVEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDKFLDILQDLHGEDLKEAVQQC  84

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELG++LTSLD GDSIVIAK+FSHMLNLANLAEE+QIAYRRR K
Sbjct  85   YELSAEYEGKHDPKKLEELGSLLTSLDTGDSIVIAKAFSHMLNLANLAEELQIAYRRRIK  144

Query  479  LRRG  490
            L+ G
Sbjct  145  LKSG  148


 Score = 60.5 bits (145),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            K GDF DE +A TESDIEET KRLV  + KSP+EVFDALK +
Sbjct  146  KSGDFADEANATTESDIEETFKRLVHKLNKSPEEVFDALKNQ  187



>ref|XP_003527347.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Glycine max]
 gb|KHN33958.1| Phosphoenolpyruvate carboxylase 2 [Glycine soja]
Length=966

 Score =   209 bits (533),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            M  RN EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHG+++RETVQ+C
Sbjct  1    MGTRNFEKMASIDAQLRLLAPSKVSDDDKLVEYDALLLDRFLDILQDLHGDDIRETVQDC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+++P+KLEELGN+LT LD GDSIVI+KSF+HMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGQNNPQKLEELGNMLTGLDAGDSIVISKSFAHMLNLANLAEEVQIAYRRRIK  120

Query  479  L  481
            L
Sbjct  121  L  121


 Score = 70.9 bits (172),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSAITESDIEET KRLV  +KK+PQE+FDALK++
Sbjct  123  KKGDFADENSAITESDIEETFKRLVNQLKKTPQEIFDALKSQ  164



>dbj|BAC41248.1| phosphoenolpyruvate carboxylase [Glycine max]
Length=967

 Score =   208 bits (530),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQ    ENL+ETVQE 
Sbjct  1    MATRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQGFTWENLKETVQEV  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELGN++TSLD GDSI++AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSILVAKSFSHMLNLANLAEEVQISRRRRNK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 72.0 bits (175),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DEN+A TESDIEETLK+LV D+KKSPQEVFDALK +
Sbjct  122  KKGDFADENNATTESDIEETLKKLVFDLKKSPQEVFDALKNQ  163



>prf||1801241A phosphoenolpyruvate carboxylase
Length=966

 Score =   220 bits (560),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RN+EK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLD+FLDILQDLHGE+L+E VQ+C
Sbjct  1    MANRNVEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDKFLDILQDLHGEDLKEAVQQC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELG++LTSLD GDSIVIAK+FSHMLNLANLAEE+QIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGSLLTSLDTGDSIVIAKAFSHMLNLANLAEELQIAYRRRIK  120

Query  479  LRRG  490
            L+ G
Sbjct  121  LKSG  124


 Score = 60.5 bits (145),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            K GDF DE +A TESDIEET KRLV  + KSP+EVFDALK +
Sbjct  122  KSGDFADEANATTESDIEETFKRLVHKLNKSPEEVFDALKNQ  163



>ref|XP_009395707.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Musa acuminata 
subsp. malaccensis]
Length=963

 Score =   209 bits (533),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +2

Query  134  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  313
            LEK ASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRE VQECYE SA
Sbjct  4    LEKTASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLREMVQECYEHSA  63

Query  314  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRRG  490
            EYE +HDP+KLEELGN LTSLDPGD IV+ KSFSHMLNLANLAEEVQIAYRRR KL++G
Sbjct  64   EYERKHDPRKLEELGNELTSLDPGDLIVVTKSFSHMLNLANLAEEVQIAYRRRIKLKKG  122


 Score = 70.9 bits (172),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETLKRLV  +KKSP+EVFDALK +
Sbjct  120  KKGDFADENSATTESDIEETLKRLVAQLKKSPEEVFDALKNQ  161



>emb|CAA81072.1| phosphoenolpyruvate carboxylase [Flaveria trinervia]
Length=966

 Score =   220 bits (560),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RN+EK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLD+FLDILQDLHGE+L+E VQ+C
Sbjct  1    MANRNVEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDKFLDILQDLHGEDLKEAVQQC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELG++LTSLD GDSIVIAK+FSHMLNLANLAEE+QIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGSLLTSLDTGDSIVIAKAFSHMLNLANLAEELQIAYRRRIK  120

Query  479  LRRG  490
            L+ G
Sbjct  121  LKSG  124


 Score = 60.5 bits (145),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            K GDF DE +A TESDIEET KRLV  + KSP+EVFDALK +
Sbjct  122  KSGDFADEANATTESDIEETFKRLVHKLNKSPEEVFDALKNQ  163



>sp|P30694.2|CAPPA_FLATR RecName: Full=C4 phosphoenolpyruvate carboxylase; Short=C4 PEPC; 
Short=C4 PEPCase; Short=ppcA; AltName: Full=Photosynthetic 
PEPCase [Flaveria trinervia]
 emb|CAA43601.1| phosphoenolpyruvate carboxylase [Flaveria trinervia]
Length=966

 Score =   220 bits (560),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RN+EK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLD+FLDILQDLHGE+L+E VQ+C
Sbjct  1    MANRNVEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDKFLDILQDLHGEDLKEAVQQC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELG++LTSLD GDSIVIAK+FSHMLNLANLAEE+QIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGSLLTSLDTGDSIVIAKAFSHMLNLANLAEELQIAYRRRIK  120

Query  479  LRRG  490
            L+ G
Sbjct  121  LKSG  124


 Score = 60.5 bits (145),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            K GDF DE +A TESDIEET KRLV  + KSP+EVFDALK +
Sbjct  122  KSGDFADEANATTESDIEETFKRLVHKLNKSPEEVFDALKNQ  163



>tpg|DAA61011.1| TPA: phosphoenolpyruvate carboxylase4 [Zea mays]
Length=967

 Score =   203 bits (517),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = +2

Query  134  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  313
            +E+++SIDAQLR+LVPGKVSEDDKL+EYDALLLDRFLDILQDLHG++L+E VQECYE++A
Sbjct  8    MERLSSIDAQLRMLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGDDLKEMVQECYEVAA  67

Query  314  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRRG  490
            EYE +HD +KL+ELG ++TSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR KL++G
Sbjct  68   EYETKHDLQKLDELGKMITSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIKLKKG  126


 Score = 77.0 bits (188),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSAITESDIEETLKRLVVD+KKSP EVFDALK++
Sbjct  124  KKGDFADENSAITESDIEETLKRLVVDLKKSPAEVFDALKSQ  165



>ref|XP_010277028.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Nelumbo nucifera]
Length=964

 Score =   211 bits (536),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  125  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  304
            ARNLEK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE YE
Sbjct  2    ARNLEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEVYE  61

Query  305  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLR  484
            LSAEYE  HDP+KL+ELG VLTSLD GDSIV+ K+FSHMLNLANLAEEVQIAYRRR + +
Sbjct  62   LSAEYERNHDPQKLDELGKVLTSLDAGDSIVLTKAFSHMLNLANLAEEVQIAYRRRTRQK  121

Query  485  RG  490
            +G
Sbjct  122  KG  123


 Score = 69.3 bits (168),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  472  TETKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            T  KKGDF DE++A TESDIEETLKRLVV +KKSP+EVFDALK +
Sbjct  118  TRQKKGDFHDESNATTESDIEETLKRLVVQLKKSPEEVFDALKNQ  162



>sp|P29194.1|CAPP2_SORBI RecName: Full=Phosphoenolpyruvate carboxylase 2; Short=PEPC 2; 
Short=PEPCase 2; AltName: Full=CP28 [Sorghum bicolor]
 emb|CAA42549.1| phosphoenolpyruvate carboxylase [Sorghum bicolor]
Length=960

 Score =   203 bits (517),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = +2

Query  134  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  313
            +E+++SIDAQLR+LVPGKVSEDDKL+EYDALLLDRFLDILQDLHG++L+E VQECYE++A
Sbjct  1    MERLSSIDAQLRMLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGDDLKEMVQECYEVAA  60

Query  314  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRRG  490
            EYE +HD +KL+ELG ++TSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR KL++G
Sbjct  61   EYETKHDLQKLDELGKMITSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIKLKKG  119


 Score = 76.6 bits (187),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSAITESDIEETLKRLVVD+KKSP EVFDALK++
Sbjct  117  KKGDFADENSAITESDIEETLKRLVVDLKKSPAEVFDALKSQ  158



>ref|XP_002462179.1| hypothetical protein SORBIDRAFT_02g021090 [Sorghum bicolor]
 gb|EER98700.1| hypothetical protein SORBIDRAFT_02g021090 [Sorghum bicolor]
Length=967

 Score =   203 bits (517),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +2

Query  131  NLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELS  310
             +E+++SIDAQLR+LVPGKVSEDDKL+EYDALLLDRFLDILQDLHG++L+E VQECYE++
Sbjct  7    KMERLSSIDAQLRMLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGDDLKEMVQECYEVA  66

Query  311  AEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRRG  490
            AEYE +HD +KL+ELG ++TSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR KL++G
Sbjct  67   AEYETKHDLQKLDELGKMITSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIKLKKG  126


 Score = 76.6 bits (187),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSAITESDIEETLKRLVVD+KKSP EVFDALK++
Sbjct  124  KKGDFADENSAITESDIEETLKRLVVDLKKSPAEVFDALKSQ  165



>ref|XP_010915515.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Elaeis guineensis]
Length=965

 Score =   210 bits (534),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            M+  +LE+ AS+DAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGE +RETVQEC
Sbjct  1    MSKNSLERHASVDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGEEIRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYE + DPKKL+ELGNV TSLDPGDSIV++ SFSHMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEQKQDPKKLDELGNVFTSLDPGDSIVVSSSFSHMLNLANLAEEVQIAHRRRIK  120

Query  479  LRRG  490
             ++G
Sbjct  121  RKKG  124


 Score = 70.1 bits (170),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEET KRLV  +KKSPQEVFDALK +
Sbjct  122  KKGDFADENSATTESDIEETFKRLVGQLKKSPQEVFDALKNQ  163



>gb|AAU07999.1| phosphoenolpyruvate carboxylase 4 [Lupinus albus]
Length=968

 Score =   211 bits (538),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = +2

Query  128  RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYEL  307
            RN+EKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L++TVQE YEL
Sbjct  5    RNMEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKDTVQEVYEL  64

Query  308  SAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRR  487
            S++YEG+HDPKKLEE+GNV+TSLD GDSIV+AKSFSHMLNLANLAEEVQI++RRR KL++
Sbjct  65   SSQYEGKHDPKKLEEIGNVITSLDAGDSIVVAKSFSHMLNLANLAEEVQISHRRRNKLKK  124

Query  488  G  490
            G
Sbjct  125  G  125


 Score = 68.2 bits (165),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKG+F DE +A TESDIEETLKRLV D+KKSP EVFDALK++
Sbjct  123  KKGNFADETNATTESDIEETLKRLVFDLKKSPHEVFDALKSQ  164



>gb|ACN32213.1| phosphoenolpyruvate carboxylase [Arachis hypogaea]
Length=966

 Score =   209 bits (533),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = +2

Query  125  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  304
            A+ LEKMASIDAQLR LVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE YE
Sbjct  2    AKKLEKMASIDAQLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEVYE  61

Query  305  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLR  484
            LSAEYEG+HD KKL+ELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR KL+
Sbjct  62   LSAEYEGKHDSKKLDELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRIKLK  121

Query  485  RG  490
            +G
Sbjct  122  KG  123


 Score = 70.5 bits (171),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DEN+A TESDIEETLK+LVV++KKSPQEVF+ALK +
Sbjct  121  KKGDFADENNATTESDIEETLKKLVVELKKSPQEVFEALKNQ  162



>ref|XP_009135413.1| PREDICTED: phosphoenolpyruvate carboxylase 3 [Brassica rapa]
Length=967

 Score =   212 bits (539),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RN+EKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAGRNIEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YELSAEYEG+ +PKKLEELG VLTSLD GDSIVI+K+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YELSAEYEGKREPKKLEELGKVLTSLDAGDSIVISKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 67.8 bits (164),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDE+SA TESDIEET KRLV D+ KSP+E+FDALK +
Sbjct  123  KKGDFVDESSAATESDIEETFKRLVSDLGKSPEEIFDALKNQ  164



>gb|ABY87944.1| phosphoenolpyruvate carboxylase [Arachis hypogaea]
Length=968

 Score =   207 bits (528),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  122  AARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECY  301
             +RN+EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHGE++R+TVQ+CY
Sbjct  4    TSRNIEKMASIDAQLRLLAPRKVSDDDKLVEYDALLLDRFLDILQDLHGEDIRQTVQDCY  63

Query  302  ELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKL  481
            ELSAEYEG+H  +KLEELGN+LT LD GDSIVIAKSFSHMLNLANLAEEVQIAYRRR KL
Sbjct  64   ELSAEYEGKHKTEKLEELGNMLTGLDAGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIKL  123


 Score = 72.0 bits (175),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DEN AITESDIEET KRLV ++KKSPQEVFDALK +
Sbjct  125  KKGDFADENPAITESDIEETFKRLVTELKKSPQEVFDALKNQ  166



>sp|P51063.1|CAPP_PICAB RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Picea abies]
 emb|CAA55700.1| phosphoenolpyruvate carboxylase [Picea abies]
Length=963

 Score =   221 bits (563),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA  NLEKMASIDAQ+RLLVPGKVSEDDKL+EYDALLLDRFLDILQDLHGE++R  VQEC
Sbjct  1    MARNNLEKMASIDAQMRLLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDIRAMVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YE S EYEG++DP KLEELGNVLTSLDPGDSIV+A SFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YERSGEYEGKNDPHKLEELGNVLTSLDPGDSIVVASSFSHMLNLANLAEEVQIAYRRRNK  120

Query  479  LRRG  490
            ++RG
Sbjct  121  IKRG  124


 Score = 58.2 bits (139),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            K+G F DE++A TESDIEET KRLV  + KSP EVFDALK +
Sbjct  122  KRGGFADESNATTESDIEETFKRLVNQLGKSPAEVFDALKNQ  163



>ref|XP_002444204.1| hypothetical protein SORBIDRAFT_07g014960 [Sorghum bicolor]
 gb|EES13699.1| hypothetical protein SORBIDRAFT_07g014960 [Sorghum bicolor]
Length=964

 Score =   207 bits (526),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  125  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  304
            A  LEKMASIDAQLR+L P K+SEDDKLVEYDALLLDRFLDILQDLHGE+LRE VQECYE
Sbjct  2    AGKLEKMASIDAQLRMLAPAKLSEDDKLVEYDALLLDRFLDILQDLHGEDLRELVQECYE  61

Query  305  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLR  484
            ++AEYE +HD +KL+ELGN+LTSLDPGDSIV AK+FSHMLNLANLAEEVQIAYRRR KL+
Sbjct  62   IAAEYERKHDSEKLDELGNMLTSLDPGDSIVTAKAFSHMLNLANLAEEVQIAYRRRIKLK  121

Query  485  RG  490
            +G
Sbjct  122  KG  123


 Score = 72.4 bits (176),  Expect(2) = 3e-66, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA+TESDIEET KRLVVD+KKSP EVFDALK++
Sbjct  121  KKGDFADENSALTESDIEETFKRLVVDLKKSPAEVFDALKSQ  162



>gb|ACO48250.1| phosphoenolpyruvate carboxylase [Arachis hypogaea]
Length=966

 Score =   207 bits (527),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA + +EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHG ++RETVQ+C
Sbjct  1    MATKKVEKMASIDAQLRLLAPSKVSDDDKLVEYDALLLDRFLDILQDLHGLDIRETVQDC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG +DP KLEELGN+LT LD GDSIV+AKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGENDPHKLEELGNMLTGLDAGDSIVVAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  L  481
            L
Sbjct  121  L  121


 Score = 71.2 bits (173),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDENSAITESD+EET KRLV  M K+PQEVFDALK +
Sbjct  123  KKGDFVDENSAITESDLEETFKRLVNQMNKTPQEVFDALKNQ  164



>gb|AAO25631.1| phosphoenolpyruvate carboxylase [Oryza sativa Indica Group]
Length=964

 Score =   206 bits (523),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  125  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  304
            A  +EKMASIDAQLR+L P   SEDDKLVEYDALLLDRFLDILQDLHG++LRE VQECYE
Sbjct  2    AGKVEKMASIDAQLRMLAPAHRSEDDKLVEYDALLLDRFLDILQDLHGDDLREMVQECYE  61

Query  305  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLR  484
            ++AEYEG+HD +KL+ELGN+LTSLDPGDSIV+AK+FSHMLNLANLAEEVQIAYRRR KL+
Sbjct  62   IAAEYEGKHDSQKLDELGNMLTSLDPGDSIVMAKAFSHMLNLANLAEEVQIAYRRRIKLK  121

Query  485  RG  490
            +G
Sbjct  122  KG  123


 Score = 72.4 bits (176),  Expect(2) = 6e-66, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA+TESDIEET KRLVVD+KKSP EVFDALK++
Sbjct  121  KKGDFADENSALTESDIEETFKRLVVDLKKSPAEVFDALKSQ  162



>gb|AAU07998.1| phosphoenolpyruvate carboxylase 3 [Lupinus albus]
Length=968

 Score =   209 bits (531),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +2

Query  128  RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYEL  307
            RN+EKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ TVQ+ YEL
Sbjct  5    RNMEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKNTVQDVYEL  64

Query  308  SAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRR  487
            S+EYEG+HDPKKLEE+GN +TSLD GDSIV+AKSFSHMLNLANLAEEVQI++RRR KL++
Sbjct  65   SSEYEGKHDPKKLEEIGNAITSLDAGDSIVVAKSFSHMLNLANLAEEVQISHRRRNKLKK  124

Query  488  G  490
            G
Sbjct  125  G  125


 Score = 69.3 bits (168),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKG+F DE +A TESDIEETLKRLV D+KKSPQEVFDALK +
Sbjct  123  KKGNFADETNATTESDIEETLKRLVFDLKKSPQEVFDALKNQ  164



>ref|XP_010465426.1| PREDICTED: phosphoenolpyruvate carboxylase 3-like [Camelina sativa]
Length=968

 Score =   210 bits (534),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RN+EKMASIDAQLR LVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAGRNVEKMASIDAQLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YELSAEYEG+ +PKKLEELG++LTSLD GDSIVI+K+FSHMLNLANLAEEVQIA+RRR +
Sbjct  61   YELSAEYEGKREPKKLEELGSLLTSLDAGDSIVISKAFSHMLNLANLAEEVQIAHRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 67.8 bits (164),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDE+SA TESDIEET KRLV D+ KSP+E+FDALK +
Sbjct  123  KKGDFVDESSATTESDIEETFKRLVSDLGKSPEEIFDALKNQ  164



>ref|XP_010502354.1| PREDICTED: phosphoenolpyruvate carboxylase 3 [Camelina sativa]
Length=968

 Score =   210 bits (534),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RN+EKMASIDAQLR LVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAGRNVEKMASIDAQLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YELSAEYEG+ +PKKLEELG++LTSLD GDSIVI+K+FSHMLNLANLAEEVQIA+RRR +
Sbjct  61   YELSAEYEGKREPKKLEELGSLLTSLDAGDSIVISKAFSHMLNLANLAEEVQIAHRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 67.8 bits (164),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDE+SA TESDIEET KRLV D+ KSP+E+FDALK +
Sbjct  123  KKGDFVDESSATTESDIEETFKRLVSDLGKSPEEIFDALKNQ  164



>emb|CAC83481.1| phosphoenolpyruvate carboxylase [Phalaenopsis equestris]
Length=965

 Score =   206 bits (525),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            M+   +E+ ASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQ++HGE++RETVQEC
Sbjct  1    MSRSTVERHASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQEIHGEDIRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYE  HD KKLEELG+VLTSLDPGDSIV+AKSFS+MLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEATHDSKKLEELGHVLTSLDPGDSIVVAKSFSNMLNLANLAEEVQIAFRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 71.2 bits (173),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDENSA TESDIEETL+RLV ++KKSP+EVFDALK +
Sbjct  122  KKGDFVDENSAATESDIEETLRRLVHELKKSPEEVFDALKNQ  163



>emb|CAC83482.1| phosphoenolpyruvate carboxylase [Phalaenopsis amabilis]
Length=965

 Score =   206 bits (525),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            M+   +E+ ASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQ++HGE++RETVQEC
Sbjct  1    MSRSTVERHASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQEIHGEDIRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYE  HD KKLEELG+VLTSLDPGDSIV+AKSFS+MLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEATHDSKKLEELGHVLTSLDPGDSIVVAKSFSNMLNLANLAEEVQIAFRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 71.2 bits (173),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDENSA TESDIEETL+RLV ++KKSP+EVFDALK +
Sbjct  122  KKGDFVDENSAATESDIEETLRRLVHELKKSPEEVFDALKNQ  163



>ref|NP_001105438.1| phosphoenolpyruvate carboxylase 2 [Zea mays]
 sp|P51059.1|CAPP2_MAIZE RecName: Full=Phosphoenolpyruvate carboxylase 2; Short=PEPC 2; 
Short=PEPCase 2 [Zea mays]
 emb|CAA43709.1| phosphoenolpyruvate carboxylase [Zea mays]
Length=967

 Score =   201 bits (510),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  134  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  313
            +E+++SIDAQLR+LVPGKVSEDDKL+EYDALLLDRFLDILQDLHG++L+E VQECYE++A
Sbjct  8    MERLSSIDAQLRMLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGDDLKEMVQECYEVAA  67

Query  314  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRRG  490
            EYE +HD +KL+ELG ++TSLDPGDSIVIAKS SHMLNLANLAEEVQIAYRRR KL++G
Sbjct  68   EYETKHDLQKLDELGKMITSLDPGDSIVIAKSLSHMLNLANLAEEVQIAYRRRIKLKKG  126


 Score = 76.6 bits (187),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSAITESDIEETLKRLVVD+KKSP EVFDALK++
Sbjct  124  KKGDFADENSAITESDIEETLKRLVVDLKKSPAEVFDALKSQ  165



>ref|XP_004956559.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Setaria italica]
Length=967

 Score =   201 bits (510),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +2

Query  131  NLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELS  310
             +E+++SIDAQLR+LVPGKVSEDDKL+EYDALLLDRFLDILQDLHG++L+E VQECYE++
Sbjct  7    KVERLSSIDAQLRMLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGDDLKEMVQECYEVA  66

Query  311  AEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRRG  490
            AEYE +HD +KL+ELG ++TSLDPGDSIV+AK+FSHMLNLANLAEEVQIAYRRR KL++G
Sbjct  67   AEYETKHDLQKLDELGKMITSLDPGDSIVMAKAFSHMLNLANLAEEVQIAYRRRIKLKKG  126


 Score = 76.6 bits (187),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSAITESDIEETLKRLVVD+KKSP EVFDALK++
Sbjct  124  KKGDFADENSAITESDIEETLKRLVVDLKKSPAEVFDALKSQ  165



>gb|AAK58637.1|AF271163_1 phosphoenolpyruvate carboxylase isoform 3 [Hydrilla verticillata]
Length=970

 Score =   204 bits (520),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 112/126 (89%), Gaps = 3/126 (2%)
 Frame = +2

Query  122  AARN---LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQ  292
             ARN   LE+MAS+DAQLR+L P KVSEDD LVEYDALLLDRFL+ILQDLHGE+LRETVQ
Sbjct  4    TARNPNHLERMASVDAQLRMLAPSKVSEDDNLVEYDALLLDRFLEILQDLHGEDLRETVQ  63

Query  293  ECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR  472
             CYELSAEYE   DP+KLEELGN+LTSLDPGDSIV+A SFSHMLNL NLAEEVQIA+RRR
Sbjct  64   SCYELSAEYESTLDPQKLEELGNMLTSLDPGDSIVVASSFSHMLNLGNLAEEVQIAFRRR  123

Query  473  QKLRRG  490
             KL++G
Sbjct  124  IKLKKG  129


 Score = 72.8 bits (177),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETLK+LVV +KKSPQEVFDALK +
Sbjct  127  KKGDFADENSAATESDIEETLKKLVVQLKKSPQEVFDALKNQ  168



>ref|XP_003596385.1| Phosphoenolpyruvate-carboxylase [Medicago truncatula]
 gb|AES66636.1| phosphoenolpyruvate carboxylase [Medicago truncatula]
Length=966

 Score =   207 bits (527),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  125  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  304
            A  +EKMASIDAQLR LVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+++VQE YE
Sbjct  2    ANKMEKMASIDAQLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKDSVQEVYE  61

Query  305  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLR  484
            LSAEYE +HDPKKLEELGN++TS D GDSIV+AKSFSHMLNLANLAEEVQIA+RRR KL+
Sbjct  62   LSAEYERKHDPKKLEELGNLITSFDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNKLK  121

Query  485  RG  490
            +G
Sbjct  122  KG  123


 Score = 69.7 bits (169),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE++A TESDIEETLK+LV DMKKSPQEVFDALK +
Sbjct  121  KKGDFRDESNATTESDIEETLKKLVFDMKKSPQEVFDALKNQ  162



>sp|Q02735.1|CAPP_MEDSA RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Medicago sativa]
 gb|AAB46618.1| phosphoenolpyruvate carboxylase [Medicago sativa]
 gb|AAB41903.1| phosphoenolpyruvate carboxylase [Medicago sativa]
Length=966

 Score =   207 bits (527),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  125  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  304
            A  +EKMASIDAQLR LVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+++VQE YE
Sbjct  2    ANKMEKMASIDAQLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKDSVQEVYE  61

Query  305  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLR  484
            LSAEYE +HDPKKLEELGN++TS D GDSIV+AKSFSHMLNLANLAEEVQIA+RRR KL+
Sbjct  62   LSAEYERKHDPKKLEELGNLITSFDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNKLK  121

Query  485  RG  490
            +G
Sbjct  122  KG  123


 Score = 69.7 bits (169),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE++A TESDIEETLK+LV DMKKSPQEVFDALK +
Sbjct  121  KKGDFRDESNATTESDIEETLKKLVFDMKKSPQEVFDALKNQ  162



>ref|XP_008781416.1| PREDICTED: LOW QUALITY PROTEIN: SCAR-like protein 2 [Phoenix 
dactylifera]
Length=2296

 Score =   205 bits (522),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  119   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
             M+  +LE+ AS+DAQLRLL PGKVSEDD LVEYDALLLDRFLDILQDLHGEN+RETVQEC
Sbjct  1332  MSKNSLERHASVDAQLRLLAPGKVSEDDMLVEYDALLLDRFLDILQDLHGENIRETVQEC  1391

Query  299   YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
             YELSAEY  + D KKL+ELGN LTSLDPGDSIV+A SFSHMLNLANLAEEVQIA+RRR K
Sbjct  1392  YELSAEYGRKQDLKKLDELGNELTSLDPGDSIVVASSFSHMLNLANLAEEVQIAHRRRIK  1451

Query  479   LRRG  490
             L++G
Sbjct  1452  LKKG  1455


 Score = 71.6 bits (174),  Expect(2) = 1e-65, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481   KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
             KKGDF DENSA TESDIEETLKRLVV +KKSPQEVFDALK +
Sbjct  1453  KKGDFADENSAPTESDIEETLKRLVVQLKKSPQEVFDALKKQ  1494



>ref|XP_004505496.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Cicer arietinum]
Length=966

 Score =   208 bits (529),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            M +R +EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHG+++RETVQ+C
Sbjct  1    MTSRKIEKMASIDAQLRLLAPSKVSDDDKLVEYDALLLDRFLDILQDLHGDDIRETVQDC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG ++P+KLEELGN+LT LD GDSIVIAKSF+HMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGENNPQKLEELGNMLTGLDAGDSIVIAKSFAHMLNLANLAEEVQIAYRRRIK  120

Query  479  L  481
            L
Sbjct  121  L  121


 Score = 68.9 bits (167),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSAITESDIEETLKRLV  +KK+P EVF ALK++
Sbjct  123  KKGDFADENSAITESDIEETLKRLVNQLKKTPHEVFGALKSQ  164



>gb|AAK58635.2|AF271161_1 phosphoenolpyruvate carboxylase isoform 1 [Hydrilla verticillata]
Length=970

 Score =   204 bits (519),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 112/126 (89%), Gaps = 3/126 (2%)
 Frame = +2

Query  122  AARN---LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQ  292
             ARN   LE+MAS+DAQLR+L P KVSEDD LVEYDALLLDRFL+ILQDLHGE+LRETVQ
Sbjct  4    TARNPNHLERMASVDAQLRMLAPSKVSEDDNLVEYDALLLDRFLEILQDLHGEDLRETVQ  63

Query  293  ECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR  472
             CYELSAEYE   DP+KLEELGN+LTSLDPGDSIV+A SFSHMLNL NLAEEVQIA+RRR
Sbjct  64   SCYELSAEYESTLDPQKLEELGNMLTSLDPGDSIVVASSFSHMLNLGNLAEEVQIAFRRR  123

Query  473  QKLRRG  490
             KL++G
Sbjct  124  IKLKKG  129


 Score = 72.8 bits (177),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETLK+LVV +KKSPQEVFDALK +
Sbjct  127  KKGDFADENSAATESDIEETLKKLVVQLKKSPQEVFDALKNQ  168



>ref|XP_010924612.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Elaeis guineensis]
Length=966

 Score =   211 bits (537),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            M+  +LE+ AS+DAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC
Sbjct  1    MSKNSLERHASVDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEY  + D KKL ELGNVLTSLDPGDSIV+A SFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYGRKQDLKKLGELGNVLTSLDPGDSIVVASSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  LRRGIL  496
            L++G  
Sbjct  121  LKKGYF  126


 Score = 65.1 bits (157),  Expect(2) = 2e-65, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKG F DEN A TESDIEETLKRLVV +KKSP EVFDALK +
Sbjct  122  KKGYFADENCATTESDIEETLKRLVVQLKKSPAEVFDALKNQ  163



>gb|AAK58636.1|AF271162_1 phosphoenolpyruvate carboxylase isoform 2 [Hydrilla verticillata]
Length=968

 Score =   205 bits (521),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 113/127 (89%), Gaps = 3/127 (2%)
 Frame = +2

Query  119  MAARN---LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETV  289
            MAARN   +E+MAS+DAQLR+L P KVSEDD LVEYDALLLDRFLDILQDLHGE+LRETV
Sbjct  1    MAARNSNHVERMASVDAQLRMLAPSKVSEDDNLVEYDALLLDRFLDILQDLHGEDLRETV  60

Query  290  QECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRR  469
            Q CYELSAEYE   +P+KLEELG +LTSLDPGDSIV+A SFSHMLNL NLAEEVQIA+RR
Sbjct  61   QSCYELSAEYESTLNPEKLEELGKMLTSLDPGDSIVVASSFSHMLNLGNLAEEVQIAFRR  120

Query  470  RQKLRRG  490
            R KL++G
Sbjct  121  RIKLKKG  127


 Score = 71.2 bits (173),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TESDIEETL+++VV +KKSPQEVFDALK +
Sbjct  125  KKGDFADENSATTESDIEETLRKMVVQLKKSPQEVFDALKNQ  166



>ref|XP_009416509.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Musa acuminata 
subsp. malaccensis]
Length=963

 Score =   206 bits (525),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +2

Query  134  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  313
            +EKMASIDA +RLL PGKVSEDDKLVEYDALLLDRFLDILQDLHG+++RETVQ+ YELSA
Sbjct  4    VEKMASIDAHMRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGDDIRETVQDLYELSA  63

Query  314  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRRG  490
            EYEG+HDP+KL ELGNVLTSLD GD+IV+ KSFSHMLNLANLAEEVQIAYRRR KL++G
Sbjct  64   EYEGKHDPEKLVELGNVLTSLDAGDTIVVTKSFSHMLNLANLAEEVQIAYRRRIKLKKG  122


 Score = 69.3 bits (168),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSAITESDIEETLKRLV+ +KKS +EVFDALK +
Sbjct  120  KKGDFADENSAITESDIEETLKRLVMQLKKSKEEVFDALKNQ  161



>emb|CDY45929.1| BnaC06g09980D [Brassica napus]
Length=838

 Score =   210 bits (534),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            M    LEKMAS+D  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MPHGKLEKMASMDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YE SAEYEG+H+PKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 65.9 bits (159),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDE+SA TESD+EET K+LV D+ KSP+E+FDALK++
Sbjct  123  KKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDALKSQ  164



>ref|XP_004489030.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Cicer arietinum]
Length=966

 Score =   204 bits (519),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +2

Query  134  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  313
            +EKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE YELSA
Sbjct  5    MEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEVYELSA  64

Query  314  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRRG  490
            EYE  +DPKKLEELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR KL++G
Sbjct  65   EYERNYDPKKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNKLKKG  123


 Score = 71.2 bits (173),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDEN+A TESDIEETLK+LV  MKK+PQEVFDALK +
Sbjct  121  KKGDFVDENNATTESDIEETLKKLVFKMKKTPQEVFDALKNQ  162



>ref|XP_009106983.1| PREDICTED: phosphoenolpyruvate carboxylase 1 [Brassica rapa]
 emb|CDY02513.1| BnaA08g01200D [Brassica napus]
Length=964

 Score =   210 bits (534),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            M    LEKMAS+D  LR LVPGKVSEDDKLVEYDALLLDRFLDILQ+LHGE+LRETVQE 
Sbjct  1    MPHGKLEKMASMDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQELHGEDLRETVQEL  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YE SAEYEG+H+PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 65.1 bits (157),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDE+SA TESD+EET K+LV D+ KSP+E+FDALK +
Sbjct  123  KKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDALKNQ  164



>emb|CAA11415.1| phosphoenolpyruvate carboxylase [Brassica juncea]
Length=964

 Score =   210 bits (534),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            M    LEKMAS+D  LR LVPGKVSEDDKLVEYDALLLDRFLDILQ+LHGE+LRETVQE 
Sbjct  1    MPHGKLEKMASMDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQELHGEDLRETVQEL  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YE SAEYEG+H+PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 65.1 bits (157),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDE+SA TESD+EET K+LV D+ KSP+E+FDALK +
Sbjct  123  KKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDALKNQ  164



>ref|XP_003577980.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Brachypodium distachyon]
Length=968

 Score =   199 bits (505),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +2

Query  122  AARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECY  301
            A   +E+++SIDAQLR+LVP KVSEDDKL+EYDALLLDRFLD+LQ LHG++LRE VQECY
Sbjct  5    APGKIERLSSIDAQLRMLVPAKVSEDDKLIEYDALLLDRFLDVLQGLHGDDLREMVQECY  64

Query  302  ELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKL  481
            E++AEYE +HD +KL+ELG ++TSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR KL
Sbjct  65   EVAAEYETKHDLQKLDELGEMITSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIKL  124

Query  482  RRG  490
            ++G
Sbjct  125  KKG  127


 Score = 75.9 bits (185),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF +ENSAITESDIEETLKRLVVDMKKSP EVFDALK +
Sbjct  125  KKGDFAEENSAITESDIEETLKRLVVDMKKSPAEVFDALKNQ  166



>ref|XP_010527380.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like [Tarenaya hassleriana]
Length=967

 Score =   209 bits (531),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 116/127 (91%), Gaps = 2/127 (2%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MAAR LEKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAARKLEKMASIDAQLRQLVPVKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYE +HDPKKLEELGNVLT+LDPGD+IVI+K+FSHMLNLANLAE+VQIAY R+ K
Sbjct  61   YELSAEYERKHDPKKLEELGNVLTNLDPGDAIVISKAFSHMLNLANLAEKVQIAYLRKIK  120

Query  479  --LRRGI  493
               +RG 
Sbjct  121  KLTKRGF  127


 Score = 65.9 bits (159),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +1

Query  478  TKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            TK+G F DENSA TESDIEET KRLVVD+KKSP+EVF+ALK +
Sbjct  123  TKRG-FADENSATTESDIEETFKRLVVDLKKSPEEVFEALKNQ  164



>ref|XP_006348868.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Solanum tuberosum]
Length=964

 Score =   211 bits (537),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = +2

Query  125  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  304
            +R +EKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQECYE
Sbjct  2    SRKIEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQECYE  61

Query  305  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLR  484
            LSAEYEGRHDP KLEELG +LTSLD GDSIV+ K+FS+MLNL NLAEEVQIAYRRR KL+
Sbjct  62   LSAEYEGRHDPHKLEELGRMLTSLDAGDSIVVTKAFSNMLNLGNLAEEVQIAYRRRSKLK  121

Query  485  R  487
            +
Sbjct  122  K  122


 Score = 63.5 bits (153),  Expect(2) = 6e-65, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +1

Query  472  TETKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            ++ KK DF DE SA+TESDIEETLK+LV  + KSPQEVFDALK +
Sbjct  118  SKLKKRDFSDEASALTESDIEETLKKLVGQLNKSPQEVFDALKNQ  162



>emb|CAA11414.1| phosphoenolpyrovate carboxylase [Brassica juncea]
Length=964

 Score =   209 bits (533),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            M    LEKMAS+D  LR LVPGKVSEDDKLVEYDALLLDRFLDILQ+LHGE+LRETVQE 
Sbjct  1    MPHGKLEKMASMDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQELHGEDLRETVQEL  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YE SAEYEG+H+PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 65.1 bits (157),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDE+SA TESD+EET K+LV D+ KSP+E+FDALK +
Sbjct  123  KKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDALKNQ  164



>sp|P16097.1|CAPP2_MESCR RecName: Full=Phosphoenolpyruvate carboxylase 2; Short=PEPC 2; 
Short=PEPCase 2 [Mesembryanthemum crystallinum]
 emb|CAA32728.2| phosphoenolpyruvate carboxylase [Mesembryanthemum crystallinum]
Length=960

 Score =   210 bits (535),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 105/119 (88%), Positives = 114/119 (96%), Gaps = 1/119 (1%)
 Frame = +2

Query  143  MASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAEYE  322
            MASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQECYE SAEYE
Sbjct  1    MASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQECYERSAEYE  60

Query  323  GRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-QKLRRGIL  496
            G+HDPKKL+ELG+VLTSLD GDSIV+AKSFSHMLNLANLAEEVQIAYRRR +KL++G L
Sbjct  61   GKHDPKKLDELGSVLTSLDAGDSIVVAKSFSHMLNLANLAEEVQIAYRRRIKKLKKGDL  119


 Score = 64.3 bits (155),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGD  DENSA TESDIEET KRLV ++ KSP+E+FDALK +
Sbjct  115  KKGDLSDENSATTESDIEETFKRLVAELGKSPEEIFDALKNQ  156



>dbj|BAC20365.1| phosphoenolpyruvate carboxylase [Lotus japonicus]
Length=967

 Score =   210 bits (535),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEV  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYE +H+P++LE LGN++TSLD GDSIV+AKSF+HMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYERKHEPQRLEVLGNLITSLDAGDSIVVAKSFAHMLNLANLAEEVQIAHRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 64.3 bits (155),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE +A TESDIEET K+LV +MKKSPQEVFD LK +
Sbjct  122  KKGDFADEGNATTESDIEETFKKLVGEMKKSPQEVFDELKNQ  163



>ref|NP_001267665.1| phosphoenolpyruvate carboxylase 2-like [Cucumis sativus]
 ref|XP_004155470.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Cucumis sativus]
 gb|AFS33791.1| phosphoenolpyruvate carboxylase protein [Cucumis sativus]
 gb|KGN43627.1| Phosphoenolpyruvate carboxylase 1 [Cucumis sativus]
Length=965

 Score =   218 bits (554),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  122  AARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECY  301
            A +NLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQECY
Sbjct  3    AVKNLEKMASIDAQLRLLAPSKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQECY  62

Query  302  ELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKL  481
            E +AEYE + DP+KLEELGN LTSLDPGDSIV+AKSFSHML+LANLAEEVQIAYRRR KL
Sbjct  63   EFAAEYERKRDPEKLEELGNALTSLDPGDSIVVAKSFSHMLSLANLAEEVQIAYRRRIKL  122

Query  482  RRG  490
            ++G
Sbjct  123  KKG  125


 Score = 57.0 bits (136),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKG F DE +A TESDIEET KRL + + KSPQEVFDALK +
Sbjct  123  KKGGFADEANATTESDIEETFKRL-LQLNKSPQEVFDALKNQ  163



>emb|CDY25721.1| BnaC03g69540D [Brassica napus]
Length=891

 Score =   209 bits (533),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            M    LEKMAS+D  LR LVPGKVSEDDKLVEYDALLLDRFLDILQ+LHGE+LRETVQE 
Sbjct  1    MPHGKLEKMASMDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQELHGEDLRETVQEL  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YE SAEYEG+H+PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 65.1 bits (157),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDE+SA TESD+EET K+LV D+ KSP+E+FDALK +
Sbjct  123  KKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDALKNQ  164



>emb|CDP15935.1| unnamed protein product [Coffea canephora]
Length=968

 Score =   212 bits (539),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RN+EKMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDI QDLHGE +RETVQ+C
Sbjct  1    MATRNIEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDIFQDLHGEEIRETVQDC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYE + DP+KL+ELG +LTSLD GDSIV+AKSFS+MLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYERKRDPQKLDELGRMLTSLDAGDSIVVAKSFSNMLNLANLAEEVQIAYRRRSK  120

Query  479  LRR  487
            L++
Sbjct  121  LKK  123


 Score = 62.8 bits (151),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +1

Query  472  TETKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            ++ KK DF DE SA TESDIEETLKRLV  +KKSP+EVFDALK +
Sbjct  119  SKLKKRDFSDEASATTESDIEETLKRLVGQLKKSPEEVFDALKNQ  163



>gb|EMT08272.1| Phosphoenolpyruvate carboxylase 2 [Aegilops tauschii]
Length=972

 Score =   198 bits (503),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +2

Query  134  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  313
            +E+++SIDAQLRLLVP KVSEDDKL+EYDALLLDRFLD+LQ LHG++LRE VQECYE++A
Sbjct  13   IERLSSIDAQLRLLVPAKVSEDDKLIEYDALLLDRFLDVLQGLHGDDLREMVQECYEVAA  72

Query  314  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRRG  490
            EYE +HD +KL+ELG ++TSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR KL++G
Sbjct  73   EYETKHDLEKLDELGEMITSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRVKLKKG  131


 Score = 75.9 bits (185),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSAITESDIEETLKRLV DMKKSP EVFDALK +
Sbjct  129  KKGDFADENSAITESDIEETLKRLVFDMKKSPAEVFDALKNQ  170



>dbj|BAJ85327.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK06909.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=972

 Score =   198 bits (503),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +2

Query  134  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  313
            +E+++SIDAQLRLLVP KVSEDDKL+EYDALLLDRFLD+LQ LHG++LRE VQECYE++A
Sbjct  13   IERLSSIDAQLRLLVPAKVSEDDKLIEYDALLLDRFLDVLQGLHGDDLREMVQECYEVAA  72

Query  314  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRRG  490
            EYE +HD +KL+ELG ++TSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR KL++G
Sbjct  73   EYETKHDLEKLDELGEMITSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRVKLKKG  131


 Score = 75.9 bits (185),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSAITESDIEETLKRLV DMKKSP EVFDALK +
Sbjct  129  KKGDFADENSAITESDIEETLKRLVFDMKKSPAEVFDALKNQ  170



>ref|XP_009795584.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Nicotiana sylvestris]
Length=964

 Score =   212 bits (540),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +2

Query  125  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  304
            +R +EKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQECYE
Sbjct  2    SRKIEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQECYE  61

Query  305  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLR  484
            LSAEYEG+HDP+KLEELG +LTSLD GDSIV+ K+FS+MLNLANLAEEVQIAYRRR KL+
Sbjct  62   LSAEYEGKHDPQKLEELGRMLTSLDAGDSIVVTKAFSNMLNLANLAEEVQIAYRRRSKLK  121

Query  485  R  487
            +
Sbjct  122  K  122


 Score = 61.2 bits (147),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +1

Query  472  TETKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            ++ KK DF DE SA+TESDIEETL++LV  + KSPQEVFDALK +
Sbjct  118  SKLKKRDFSDEASALTESDIEETLRKLVGQLNKSPQEVFDALKNQ  162



>ref|XP_006348299.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Solanum tuberosum]
Length=964

 Score =   205 bits (521),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDIL+DLHGE ++ETVQEC
Sbjct  1    MATRNLEKLASIDAQLRLLVPTKVSEDDKLVEYDALLLDRFLDILEDLHGEGIKETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYE   D KKLEELG+VLTSLDPGDSIV+AKS SHMLN+ANLAEEVQIA   R+K
Sbjct  61   YELSAEYENTRDKKKLEELGSVLTSLDPGDSIVVAKSISHMLNMANLAEEVQIANSGREK  120

Query  479  LRRG  490
             ++G
Sbjct  121  SKKG  124


 Score = 68.6 bits (166),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  463  SSETETKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            S   ++KKGDF DE++ +TESDIEETLKRLVVD+KKSP+EVF+ALK +
Sbjct  116  SGREKSKKGDFSDESNLMTESDIEETLKRLVVDLKKSPREVFEALKNQ  163



>gb|ACO48251.1| phosphoenolpyruvate carboxylase [Arachis hypogaea]
Length=969

 Score =   220 bits (560),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQEV  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG+HDPKKLEELG V+TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGKVITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 53.1 bits (126),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVD N+A TESDIEETLK+LV+++KKSPQEVFDALK +
Sbjct  122  KKGDFVDVNNATTESDIEETLKKLVLNLKKSPQEVFDALKNQ  163



>ref|XP_003607582.1| Phosphoenolpyruvate carboxylase [Medicago truncatula]
 gb|AES89779.1| phosphoenolpyruvate carboxylase [Medicago truncatula]
Length=966

 Score =   205 bits (522),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            M +R LEK  SIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHG ++RETVQ C
Sbjct  1    MTSRKLEKTTSIDAQLRLLAPSKVSDDDKLVEYDALLLDRFLDILQDLHGHDIRETVQNC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYEG ++P+KLEELGN+LT LD GDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGNNNPQKLEELGNMLTGLDAGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  479  L  481
            L
Sbjct  121  L  121


 Score = 67.4 bits (163),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSAITESDIEET KRLV  +KK+P EVFDALK++
Sbjct  123  KKGDFGDENSAITESDIEETFKRLVNQLKKTPLEVFDALKSQ  164



>ref|XP_011100202.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like [Sesamum indicum]
Length=966

 Score =   211 bits (537),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +2

Query  125  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  304
            +R +EKMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGE +RETVQ+CYE
Sbjct  2    SRKIEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGEEIRETVQDCYE  61

Query  305  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLR  484
            +SAEYEG+ DP+KLEELG VLTSLD GDSIV+AKSFS+MLNLANLAEEVQIAYRRR KL+
Sbjct  62   ISAEYEGKRDPQKLEELGRVLTSLDAGDSIVVAKSFSNMLNLANLAEEVQIAYRRRIKLK  121

Query  485  R  487
            +
Sbjct  122  K  122


 Score = 61.2 bits (147),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KK DF DE SA TESDIEETLKRLV  + K+PQEVFDALK +
Sbjct  121  KKRDFSDEASATTESDIEETLKRLVGQLNKTPQEVFDALKNQ  162



>dbj|BAJ97144.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=972

 Score =   198 bits (503),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +2

Query  134  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  313
            +E+++SIDAQLRLLVP KVSEDDKL+EYDALLLDRFLD+LQ LHG++LRE VQECYE++A
Sbjct  13   IERLSSIDAQLRLLVPAKVSEDDKLIEYDALLLDRFLDVLQGLHGDDLREMVQECYEVAA  72

Query  314  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRRG  490
            EYE +HD +KL+ELG ++TSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR KL++G
Sbjct  73   EYETKHDLEKLDELGEMITSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRVKLKKG  131


 Score = 73.9 bits (180),  Expect(2) = 4e-64, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSAITESDIEETLKRLV DMKKSP EVFDALK +
Sbjct  129  KKGDFADENSAITESDIEETLKRLVFDMKKSPAEVFDALKNQ  170



>emb|CAA07610.1| phospoenolpyruvate carboxylase [Triticum aestivum]
Length=972

 Score =   198 bits (503),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +2

Query  134  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  313
            +E+++SIDAQLRLLVP KVSEDDKL+EYDALLLDRFLD+LQ LHG++LRE VQECYE++A
Sbjct  13   IERLSSIDAQLRLLVPAKVSEDDKLIEYDALLLDRFLDVLQGLHGDDLREMVQECYEVAA  72

Query  314  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRRG  490
            EYE +HD +KL+ELG ++TSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR KL++G
Sbjct  73   EYETKHDLEKLDELGEMITSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRVKLKKG  131


 Score = 73.9 bits (180),  Expect(2) = 4e-64, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSAITESDIEETLKRLV DMKKSP EVFDALK +
Sbjct  129  KKGDFADENSAITESDIEETLKRLVFDMKKSPAEVFDALKNQ  170



>ref|XP_010524060.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Tarenaya hassleriana]
Length=965

 Score =   209 bits (532),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MAARNLEKMASID QLRLL PGKVSEDDKLVE+DALLLDRFLDILQDLHGE +RE VQEC
Sbjct  1    MAARNLEKMASIDVQLRLLAPGKVSEDDKLVEFDALLLDRFLDILQDLHGEEIREFVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YE++AEY+G+ D +KLEELGN+LTSLDPGDSIV+ KSFS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAAEYDGKRDTEKLEELGNMLTSLDPGDSIVVTKSFSNMLSLANLAEEVQIAYRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 62.0 bits (149),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE SA TESDIEETLKRL + +KKSP+EVFDALK +
Sbjct  123  KKGDFADEASATTESDIEETLKRL-LQLKKSPEEVFDALKNQ  163



>ref|XP_008455304.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Cucumis melo]
Length=965

 Score =   216 bits (551),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  122  AARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECY  301
            A +NLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQECY
Sbjct  3    AVKNLEKMASIDAQLRLLAPSKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQECY  62

Query  302  ELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKL  481
            E +AEYE + DP+KLEELG+ LTSLDPGDSIV+AKSFSHML+LANLAEEVQIAYRRR KL
Sbjct  63   EFAAEYERKRDPRKLEELGSALTSLDPGDSIVVAKSFSHMLSLANLAEEVQIAYRRRIKL  122

Query  482  RRG  490
            ++G
Sbjct  123  KKG  125


 Score = 55.1 bits (131),  Expect(2) = 7e-64, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKG F DE +A TESDIEET KRL + + KSPQEVFDALK +
Sbjct  123  KKGGFADEANATTESDIEETFKRL-LQLNKSPQEVFDALKNQ  163



>ref|XP_009603289.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Nicotiana tomentosiformis]
Length=964

 Score =   210 bits (534),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +2

Query  125  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  304
            +R +EKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQ CYE
Sbjct  2    SRKIEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQACYE  61

Query  305  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLR  484
            LSAEYEG+HDP+KLEELG +LTSLD GDSIV+ K+FS+MLNLANLAEEVQIAYRRR KL+
Sbjct  62   LSAEYEGKHDPQKLEELGRMLTSLDAGDSIVVTKAFSNMLNLANLAEEVQIAYRRRSKLK  121

Query  485  R  487
            +
Sbjct  122  K  122


 Score = 61.2 bits (147),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +1

Query  472  TETKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            ++ KK DF DE SA+TESDIEETL++LV  + KSPQEVFDALK +
Sbjct  118  SKLKKRDFSDEASALTESDIEETLRKLVGQLNKSPQEVFDALKNQ  162



>ref|XP_004243288.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Solanum lycopersicum]
Length=964

 Score =   209 bits (532),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +2

Query  125  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  304
            +R +EKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQ+CYE
Sbjct  2    SRKIEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQDCYE  61

Query  305  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLR  484
            LSAEYEG+HDP KLEELG++LTSLD GDSIV+ K+FS+MLNL NLAEEVQIAYRRR KL+
Sbjct  62   LSAEYEGKHDPHKLEELGSMLTSLDAGDSIVVTKAFSNMLNLGNLAEEVQIAYRRRSKLK  121

Query  485  R  487
            +
Sbjct  122  K  122


 Score = 62.0 bits (149),  Expect(2) = 8e-64, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  472  TETKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            ++ KK DF DE SA+TESDIEET K+LV  + KSPQEVFDALK +
Sbjct  118  SKLKKRDFSDEASALTESDIEETFKKLVGQLNKSPQEVFDALKNQ  162



>emb|CAA09807.1| ppc2 [Solanum tuberosum]
Length=964

 Score =   202 bits (514),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDIL+ LHGE ++ETVQEC
Sbjct  1    MATRNLEKLASIDAQLRLLVPTKVSEDDKLVEYDALLLDRFLDILEGLHGEGIKETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYE   D KKLEELG+VLTSLDPGDSIV+AKS SHMLN+ANLAEEVQIA   R+K
Sbjct  61   YELSAEYENTRDKKKLEELGSVLTSLDPGDSIVVAKSISHMLNMANLAEEVQIANSGREK  120

Query  479  LRRG  490
             ++G
Sbjct  121  SKKG  124


 Score = 68.6 bits (166),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  463  SSETETKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            S   ++KKGDF DE++ +TESDIEETLKRLVVD+KKSP+EVF+ALK +
Sbjct  116  SGREKSKKGDFSDESNLMTESDIEETLKRLVVDLKKSPREVFEALKNQ  163



>ref|XP_008655339.1| PREDICTED: uncharacterized protein LOC100384708 isoform X1 [Zea 
mays]
 ref|XP_008655340.1| PREDICTED: uncharacterized protein LOC100384708 isoform X1 [Zea 
mays]
 ref|XP_008655341.1| PREDICTED: uncharacterized protein LOC100384708 isoform X1 [Zea 
mays]
 gb|AFW85037.1| hypothetical protein ZEAMMB73_388983 [Zea mays]
 gb|AFW85038.1| hypothetical protein ZEAMMB73_388983 [Zea mays]
Length=966

 Score =   201 bits (512),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA   ++K  SIDAQLRLL P K+S+DDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MARNAVDKATSIDAQLRLLAPQKLSDDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YEL+AEYE + DPK L+E+GNVLTSLDPGDSIVI KSFSHML LANLAEEVQIAYRRR K
Sbjct  61   YELAAEYENKLDPKMLDEIGNVLTSLDPGDSIVITKSFSHMLILANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 68.9 bits (167),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDENSA TESDIEETLKRL+  +KKSP EVFDALK +
Sbjct  122  KKGDFVDENSATTESDIEETLKRLMHQLKKSPLEVFDALKNQ  163



>gb|AAD45696.1|AF159051_1 phosphoenolpyruvate carboxylase [Picea abies]
Length=955

 Score =   212 bits (540),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = +2

Query  143  MASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAEYE  322
            MASIDAQ+RLLVPGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RE VQECYE S EYE
Sbjct  1    MASIDAQMRLLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDIREMVQECYERSGEYE  60

Query  323  GRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRRG  490
            G++DP KLEELGNVLTSLDPGDSIV+A SFSHMLNLANLAEEVQIAYRRR K++RG
Sbjct  61   GKNDPHKLEELGNVLTSLDPGDSIVVASSFSHMLNLANLAEEVQIAYRRRNKIKRG  116


 Score = 58.5 bits (140),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            K+G F DE++A TESDIEET KRLV  + KSP EVFDALK +
Sbjct  114  KRGGFADESNATTESDIEETFKRLVNQLGKSPAEVFDALKNQ  155



>sp|P29193.1|CAPP1_SACHY RecName: Full=Phosphoenolpyruvate carboxylase, housekeeping isozyme; 
Short=PEPC; Short=PEPCase [Saccharum sp.]
 pir||S28614 phosphoenolpyruvate carboxylase (EC 4.1.1.31) - sugarcane hybrid 
H32-8560
 gb|AAC33164.1| phosphoenolpyruvate carboxylase [Saccharum hybrid cultivar H32-8560]
Length=966

 Score =   201 bits (511),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA   ++K  SIDAQLRLL P K+S+DDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MARNAVDKATSIDAQLRLLAPQKLSDDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YEL+AEYE + DPK L+E+GNVLTSLDPGDSIVI KSFSHML LANLAEEVQIAYRRR K
Sbjct  61   YELAAEYENKLDPKMLDEIGNVLTSLDPGDSIVITKSFSHMLILANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 68.9 bits (167),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDENSA TESDIEETLKRL+  +KKSP EVFDALK +
Sbjct  122  KKGDFVDENSATTESDIEETLKRLMHQLKKSPLEVFDALKNQ  163



>sp|P51062.1|CAPP_PEA RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Pisum sativum]
 dbj|BAA10902.1| phosphoenolpyruvate carboxylase [Pisum sativum]
Length=967

 Score =   202 bits (514),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +2

Query  125  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  304
            A  +EKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+++VQE YE
Sbjct  2    ANKMEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKDSVQEVYE  61

Query  305  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLR  484
            LSAEYE +HDPKKLEELG ++T LD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR KL+
Sbjct  62   LSAEYERKHDPKKLEELGKLITGLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNKLK  121

Query  485  RG  490
            +G
Sbjct  122  KG  123


 Score = 68.2 bits (165),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE++A TESDIEETLK+LV +MKKSPQEVFDALK +
Sbjct  121  KKGDFRDESNATTESDIEETLKKLVFNMKKSPQEVFDALKNQ  162



>gb|AHF21553.1| phosphoenolpyruvate carboxylase [Hylocereus undatus]
Length=958

 Score =   196 bits (497),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA   LEK+ASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQ LHGE++RETVQE 
Sbjct  1    MATAKLEKLASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQSLHGEDIRETVQEL  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YE +AEYE   DPKKLEELGN++TSLD GDSIV+ KSF+HMLNLANLAEEVQIA+RRR +
Sbjct  61   YEHAAEYERTRDPKKLEELGNMITSLDAGDSIVVTKSFTHMLNLANLAEEVQIAHRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 74.7 bits (182),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDE+SAITESDIEETL+RLVVD KKSPQEVFD LK +
Sbjct  123  KKGDFVDESSAITESDIEETLRRLVVDFKKSPQEVFDTLKNQ  164



>emb|CAA09588.1| phosphoenolpyruvate-carboxylase [Vicia faba]
Length=966

 Score =   202 bits (513),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +2

Query  125  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  304
            A  +EKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+++VQE YE
Sbjct  2    ANKMEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKDSVQEVYE  61

Query  305  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLR  484
            LSAEYE +HDPKKLEELG ++T LD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR KL+
Sbjct  62   LSAEYERKHDPKKLEELGKLITGLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNKLK  121

Query  485  RG  490
            +G
Sbjct  122  KG  123


 Score = 68.2 bits (165),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE++A TES+IEETLKRLV +MKKSPQEVFDALK +
Sbjct  121  KKGDFRDESNATTESNIEETLKRLVFNMKKSPQEVFDALKNQ  162



>ref|XP_009380945.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009380946.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Musa acuminata 
subsp. malaccensis]
Length=961

 Score =   204 bits (520),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            M+  +LE+ ASIDAQLRLL PGKVSEDDKLVEYDALL+DRFLDILQ LHGE+LRETVQEC
Sbjct  1    MSRDSLERHASIDAQLRLLAPGKVSEDDKLVEYDALLVDRFLDILQCLHGEDLRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YE+SA+YEG  DP KL+ELGNVL SLDPGDSI++A SFSHMLNL NLAEEVQIAYRRR +
Sbjct  61   YEISAKYEGTGDPSKLDELGNVLMSLDPGDSILVASSFSHMLNLGNLAEEVQIAYRRRNR  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 65.5 bits (158),  Expect(2) = 1e-63, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDEN+A TESDIEETLKRLV  + KSP EVFDALK +
Sbjct  122  KKGDFVDENNATTESDIEETLKRLVEQLHKSPLEVFDALKNQ  163



>ref|XP_004970018.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
isoform X1 [Setaria italica]
 ref|XP_004970019.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
isoform X2 [Setaria italica]
Length=969

 Score =   202 bits (515),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA   ++K  SIDAQLRLL P K+SEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  4    MARNAVDKATSIDAQLRLLAPQKLSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  63

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YEL+AEYE + DPK L+E+GNVLTSLDPGDSIVI KSFSHML LANLAEEVQIAYRRR K
Sbjct  64   YELAAEYESKLDPKMLDEIGNVLTSLDPGDSIVITKSFSHMLILANLAEEVQIAYRRRIK  123

Query  479  LRRG  490
            L++G
Sbjct  124  LKKG  127


 Score = 67.0 bits (162),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDENSA TESDIEETL RLV  + KSP EVFDALK +
Sbjct  125  KKGDFVDENSATTESDIEETLNRLVHQLNKSPLEVFDALKNQ  166



>ref|XP_006293629.1| hypothetical protein CARUB_v10022582mg [Capsella rubella]
 gb|EOA26527.1| hypothetical protein CARUB_v10022582mg [Capsella rubella]
Length=963

 Score =   209 bits (531),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MAARNLEKMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDVREFVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YE++A+Y+G  + +KLEELGN+LTSLDPGDSIV+ KSFS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAADYDGNRNTEKLEELGNMLTSLDPGDSIVVTKSFSNMLSLANLAEEVQIAYRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 59.3 bits (142),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE SA TESDIEETLKRL + + K+P+EVFDALK +
Sbjct  123  KKGDFADEASATTESDIEETLKRL-LQLNKTPEEVFDALKNQ  163



>ref|NP_850373.4| phosphoenolpyruvate carboxylase 2 [Arabidopsis thaliana]
 ref|NP_850372.4| phosphoenolpyruvate carboxylase 2 [Arabidopsis thaliana]
 sp|Q5GM68.2|CAPP2_ARATH RecName: Full=Phosphoenolpyruvate carboxylase 2; Short=AtPPC2; 
Short=PEPC 2; Short=PEPCase 2 [Arabidopsis thaliana]
 gb|AEC10145.1| phosphoenolpyruvate carboxylase 2 [Arabidopsis thaliana]
 gb|AEC10146.1| phosphoenolpyruvate carboxylase 2 [Arabidopsis thaliana]
Length=963

 Score =   208 bits (530),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MAARNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDVREFVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YE++A+Y+G  + +KLEELGN+LTSLDPGDSIV+ KSFS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAADYDGNRNTEKLEELGNMLTSLDPGDSIVVTKSFSNMLSLANLAEEVQIAYRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 59.3 bits (142),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE SA TESDIEETLKRL + + K+P+EVFDALK +
Sbjct  123  KKGDFADEASATTESDIEETLKRL-LQLNKTPEEVFDALKNQ  163



>ref|XP_002881863.1| phosphoenolpyruvate carboxylase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58122.1| phosphoenolpyruvate carboxylase [Arabidopsis lyrata subsp. lyrata]
Length=963

 Score =   208 bits (530),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MAARNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDVREFVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YE++A+Y+G  + +KLEELGN+LTSLDPGDSIV+ KSFS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAADYDGNRNTEKLEELGNMLTSLDPGDSIVVTKSFSNMLSLANLAEEVQIAYRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 59.3 bits (142),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE SA TESDIEETLKRL + + K+P+EVFDALK +
Sbjct  123  KKGDFADEASATTESDIEETLKRL-LQLNKTPEEVFDALKNQ  163



>gb|EYU41129.1| hypothetical protein MIMGU_mgv1a000842mg [Erythranthe guttata]
Length=966

 Score =   208 bits (529),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +2

Query  125  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  304
            +R LEKMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHG+ +RETVQ+CYE
Sbjct  2    SRKLEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGDEIRETVQDCYE  61

Query  305  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLR  484
            +SAEYEG+ DP+KLEELG VLTSLD GDSIV+AKSFS+ML LANLAEEVQIAYRRR KL+
Sbjct  62   ISAEYEGKRDPQKLEELGRVLTSLDAGDSIVVAKSFSNMLTLANLAEEVQIAYRRRIKLK  121

Query  485  R  487
            +
Sbjct  122  K  122


 Score = 59.7 bits (143),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KK DF DE SA TES+IEETLKRLV ++ K+P+EVFDALK +
Sbjct  121  KKNDFSDEASATTESNIEETLKRLVGELNKTPEEVFDALKNQ  162



>gb|AAP43628.1| phosphoenolpyruvate carboxylase [Arabidopsis thaliana]
Length=963

 Score =   208 bits (530),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MAARNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDVREFVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YE++A+Y+G  + +KLEELGN+LTSLDPGDSIV+ KSFS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAADYDGNRNTEKLEELGNMLTSLDPGDSIVVTKSFSNMLSLANLAEEVQIAYRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 59.3 bits (142),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE SA TESDIEETLKRL + + K+P+EVFDALK +
Sbjct  123  KKGDFADEASATTESDIEETLKRL-LQLNKTPEEVFDALKNQ  163



>emb|CAD58726.1| phosphoenolpyruvate carboxylase [Arabidopsis thaliana]
Length=963

 Score =   208 bits (530),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MAARNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDVREFVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YE++A+Y+G  + +KLEELGN+LTSLDPGDSIV+ KSFS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAADYDGNRNTEKLEELGNMLTSLDPGDSIVVTKSFSNMLSLANLAEEVQIAYRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 59.3 bits (142),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE SA TESDIEETLKRL + + K+P+EVFDALK +
Sbjct  123  KKGDFADEASATTESDIEETLKRL-LQLNKTPEEVFDALKNQ  163



>gb|AEG78834.1| phosphoenolpyruvate carboxylase [Dendrobium catenatum]
Length=964

 Score =   204 bits (519),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +2

Query  125  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  304
            ++ +EKMAS+DA LRLL PGKVSEDDKLVEYDALLLDRFL+I+QDLHGEN+RETVQECYE
Sbjct  2    SKGVEKMASMDAHLRLLAPGKVSEDDKLVEYDALLLDRFLEIVQDLHGENIRETVQECYE  61

Query  305  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLR  484
            LSAEYE +HD KKL+ELG+VLT LDPGDSIV+A SFSHMLNL+NLAEEVQIA RRR K +
Sbjct  62   LSAEYERKHDSKKLDELGSVLTGLDPGDSIVVASSFSHMLNLSNLAEEVQIATRRRIKPK  121

Query  485  RG  490
            +G
Sbjct  122  KG  123


 Score = 63.5 bits (153),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE SA TESD EET KRLV   KKSPQEVFDALK +
Sbjct  121  KKGDFADEASATTESDAEETFKRLVGRFKKSPQEVFDALKNQ  162



>gb|AAD22994.1| phosphoenolpyruvate carboxylase [Arabidopsis thaliana]
Length=941

 Score =   208 bits (529),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MAARNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDVREFVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YE++A+Y+G  + +KLEELGN+LTSLDPGDSIV+ KSFS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAADYDGNRNTEKLEELGNMLTSLDPGDSIVVTKSFSNMLSLANLAEEVQIAYRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 59.3 bits (142),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE SA TESDIEETLKRL + + K+P+EVFDALK +
Sbjct  123  KKGDFADEASATTESDIEETLKRL-LQLNKTPEEVFDALKNQ  163



>emb|CAA60627.1| phosphoenolpyruvate-carboxylase [Vanilla planifolia]
Length=956

 Score =   192 bits (489),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +2

Query  146  ASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAEYEG  325
            +SIDAQLRLL P KVSEDDKLVEY  LLLDRFLDILQDLHGE +RETVQE YELSAEYE 
Sbjct  3    SSIDAQLRLLAPAKVSEDDKLVEYVRLLLDRFLDILQDLHGEVVRETVQELYELSAEYES  62

Query  326  RHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRRG  490
            +HDPKKL+ELGN+L SLDPG+SIVIA SFSHMLNLANLAEEVQIA+RRR KL++G
Sbjct  63   KHDPKKLDELGNLLISLDPGNSIVIASSFSHMLNLANLAEEVQIAHRRRIKLKKG  117


 Score = 73.9 bits (180),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDFVDENSA TESDIEETLKRLV D+KKSP+EVFDALK +
Sbjct  115  KKGDFVDENSATTESDIEETLKRLVHDLKKSPEEVFDALKNQ  156



>ref|XP_006644735.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Oryza brachyantha]
Length=966

 Score =   197 bits (501),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA    +K  SIDAQLR+L P K+SEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MARNAADKATSIDAQLRILAPKKLSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YE +AEYE + DPK+L+ +GNVLT LDPGDSIVI KSFSHML LANLAEEVQIAYRRR K
Sbjct  61   YEFAAEYESKIDPKQLDAIGNVLTRLDPGDSIVITKSFSHMLILANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 69.3 bits (168),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TES+ EETLKRLV ++KKSPQEVFDALK++
Sbjct  122  KKGDFADENSATTESNFEETLKRLVGELKKSPQEVFDALKSQ  163



>ref|XP_010508551.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Camelina sativa]
Length=963

 Score =   207 bits (526),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MAARNLEKMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDVREFVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YE++A+Y+G  +  KLEELGN+LTSLDPGDSIV+ K+FS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAADYDGNRNTDKLEELGNMLTSLDPGDSIVVTKAFSNMLSLANLAEEVQIAYRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 59.3 bits (142),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE SA TESDIEETLKRL + + K+P+EVFDALK +
Sbjct  123  KKGDFADEASATTESDIEETLKRL-LQLNKTPEEVFDALKNQ  163



>ref|XP_010413019.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Camelina sativa]
Length=894

 Score =   207 bits (526),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MAARNLEKMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDVREFVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YE++A+Y+G  +  KLEELGN+LTSLDPGDSIV+ K+FS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAADYDGNRNTDKLEELGNMLTSLDPGDSIVVTKAFSNMLSLANLAEEVQIAYRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 58.5 bits (140),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE SA TESDIEETLKR ++ + K+P+EVFDALK +
Sbjct  123  KKGDFADEASATTESDIEETLKR-ILQLNKTPEEVFDALKNQ  163



>ref|XP_006660531.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Oryza brachyantha]
Length=970

 Score =   192 bits (488),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  131  NLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELS  310
             +E+++SIDAQLRLLVP K+SEDDKL+EYDALLLDRFLD+L  LHG++L+E VQECYE++
Sbjct  10   KVERLSSIDAQLRLLVPAKLSEDDKLIEYDALLLDRFLDVLHGLHGDDLKEMVQECYEVA  69

Query  311  AEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRRG  490
            AEYE +HD +KL+ELGN++TSLD GDSIVIAK+FSHMLNLANLAEEVQIAYRRR KL++G
Sbjct  70   AEYETKHDLQKLDELGNMITSLDAGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIKLKKG  129


 Score = 73.2 bits (178),  Expect(2) = 5e-62, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSAITESDIEETLKRLV D+KKSP EVFDALK++
Sbjct  127  KKGDFADENSAITESDIEETLKRLVFDLKKSPAEVFDALKSQ  168



>gb|ABG01962.1| phosphoenolpyruvate carboxylase [Sesuvium portulacastrum]
Length=966

 Score =   192 bits (488),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA   LEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQ LHGE +RETVQE 
Sbjct  1    MATGKLEKMASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQSLHGEEIRETVQEL  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YE +AEYE   DPKK+EELGN++TSLD GDSIV+ KSF+HMLNLANLAEEVQIA+RRR +
Sbjct  61   YEHAAEYERTRDPKKMEELGNMVTSLDAGDSIVVTKSFAHMLNLANLAEEVQIAHRRRIK  120

Query  476  KLRRG  490
            K ++G
Sbjct  121  KSKKG  125


 Score = 72.4 bits (176),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  TKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            +KKGDF DE+SAITESDIEETL+RLVVD+KKSPQEVF+ LK +
Sbjct  122  SKKGDFADESSAITESDIEETLRRLVVDLKKSPQEVFETLKNQ  164



>dbj|BAD36412.1| putative phosphoenolpyruvate carboxylase [Oryza sativa Japonica 
Group]
 gb|EAZ44215.1| hypothetical protein OsJ_28834 [Oryza sativa Japonica Group]
Length=972

 Score =   192 bits (488),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +2

Query  134  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  313
            +E+++SIDAQLR LVP K+SEDDKL+EYDALLLDRFLD+L  LHG++L++ VQECYE++A
Sbjct  13   VERLSSIDAQLRQLVPAKLSEDDKLIEYDALLLDRFLDVLHGLHGDDLKDLVQECYEVAA  72

Query  314  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRRG  490
            EYE +HD +KL+ELGN++TSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR KL++G
Sbjct  73   EYETKHDVQKLDELGNMITSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIKLKKG  131


 Score = 71.6 bits (174),  Expect(2) = 1e-61, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA+TESDIEETLKRLV D+KKSP EVFDALK++
Sbjct  129  KKGDFADENSAMTESDIEETLKRLVFDLKKSPAEVFDALKSQ  170



>gb|KFK37112.1| hypothetical protein AALP_AA4G214300 [Arabis alpina]
Length=963

 Score =   204 bits (520),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA R+LEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct  1    MAGRSLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDVREFVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  475
            YE++A+Y+G  + +KLEELGN+LTSLDPGDSIV+ KSFS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAADYDGNRNTEKLEELGNMLTSLDPGDSIVVTKSFSNMLSLANLAEEVQIAYRRRIK  120

Query  476  KLRRG  490
            KL++G
Sbjct  121  KLKKG  125


 Score = 59.3 bits (142),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DE SA TESDIEETLKRL + + K+P+EVFDALK +
Sbjct  123  KKGDFADEASATTESDIEETLKRL-LQLNKTPEEVFDALKNQ  163



>gb|EAZ08566.1| hypothetical protein OsI_30839 [Oryza sativa Indica Group]
Length=971

 Score =   192 bits (488),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +2

Query  134  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  313
            +E+++SIDAQLR LVP K+SEDDKL+EYDALLLDRFLD+L  LHG++L++ VQECYE++A
Sbjct  12   VERLSSIDAQLRQLVPAKLSEDDKLIEYDALLLDRFLDVLHGLHGDDLKDLVQECYEVAA  71

Query  314  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLRRG  490
            EYE +HD +KL+ELGN++TSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR KL++G
Sbjct  72   EYETKHDVQKLDELGNMITSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIKLKKG  130


 Score = 71.6 bits (174),  Expect(2) = 1e-61, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA+TESDIEETLKRLV D+KKSP EVFDALK++
Sbjct  128  KKGDFADENSAMTESDIEETLKRLVFDLKKSPAEVFDALKSQ  169



>gb|EMS60171.1| Phosphoenolpyruvate carboxylase 2 [Triticum urartu]
Length=956

 Score =   188 bits (477),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = +2

Query  101  GADSEKMAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLR  280
            G  S       L     ++ +LRLLVP KVSEDDKL+EYDALLLDRFLD+LQ LHG++LR
Sbjct  16   GCKSTSYYLTQLTMSMKLNVKLRLLVPAKVSEDDKLIEYDALLLDRFLDVLQGLHGDDLR  75

Query  281  ETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIA  460
            E VQECYE++AEYE +HD +KL+ELG ++TSLDPGDSIVIAK+FSHMLNLANLAEEVQIA
Sbjct  76   EMVQECYEVAAEYETKHDLEKLDELGEMITSLDPGDSIVIAKAFSHMLNLANLAEEVQIA  135

Query  461  YRRRQKLRRG  490
            YRRR KL++G
Sbjct  136  YRRRVKLKKG  145


 Score = 75.9 bits (185),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSAITESDIEETLKRLV DMKKSP EVFDALK +
Sbjct  143  KKGDFADENSAITESDIEETLKRLVFDMKKSPAEVFDALKNQ  184



>gb|EEE55407.1| hypothetical protein OsJ_03516 [Oryza sativa Japonica Group]
 dbj|BAP76084.1| phosphoenolpyruvate carboxylase [Oryza sativa Japonica Group]
Length=966

 Score =   196 bits (498),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA    +K  SIDAQLR+L P K+SEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MARNAADKGTSIDAQLRILAPKKLSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YEL+AEYE + DPK+L+ +GNVLT LDPGDSIV+ KSFSHML LANLAEEVQIAYRRR K
Sbjct  61   YELAAEYESKVDPKQLDAIGNVLTRLDPGDSIVMTKSFSHMLILANLAEEVQIAYRRRIK  120

Query  479  LRRG  490
            L++G
Sbjct  121  LKKG  124


 Score = 67.0 bits (162),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  481  KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            KKGDF DENSA TES+ EETLKRLV ++KKSP EVFDALK +
Sbjct  122  KKGDFADENSATTESNFEETLKRLVGELKKSPHEVFDALKNQ  163



>emb|CAB65171.1| phosphoenolpyruvate carboxylase 2 [Solanum lycopersicum var. 
cerasiforme]
Length=964

 Score =   201 bits (511),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEK ASIDAQ+RLLVP KVSEDD LVEYDALLLDRFLDIL+DLHGE ++ TVQEC
Sbjct  1    MATRNLEKFASIDAQMRLLVPTKVSEDDMLVEYDALLLDRFLDILEDLHGEGIKTTVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYE  HD KKLEELG+VLT+LDPGDSIV+AKS SHMLN+ANLAEEVQIA   R K
Sbjct  61   YELSAEYENTHDKKKLEELGSVLTTLDPGDSIVVAKSISHMLNMANLAEEVQIANSGRAK  120

Query  479  LRRG  490
             ++G
Sbjct  121  SKKG  124


 Score = 62.0 bits (149),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  463  SSETETKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            S   ++KKG+  DE++ +TESDIEETLKRLVV++ KSP+EVF+ALK +
Sbjct  116  SGRAKSKKGELSDESNLMTESDIEETLKRLVVNLNKSPREVFNALKNQ  163



>emb|CAC86034.1| phosphoenolpyruvate carboxylase 2 [Solanum lycopersicum]
Length=964

 Score =   201 bits (511),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  298
            MA RNLEK ASIDAQ+RLLVP KVSEDD LVEYDALLLDRFLDIL+DLHGE ++ TVQEC
Sbjct  1    MATRNLEKFASIDAQMRLLVPTKVSEDDMLVEYDALLLDRFLDILEDLHGEGIKTTVQEC  60

Query  299  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  478
            YELSAEYE  HD KKLEELG+VLT+LDPGDSIV+AKS SHMLN+ANLAEEVQIA   R K
Sbjct  61   YELSAEYENTHDKKKLEELGSVLTTLDPGDSIVVAKSISHMLNMANLAEEVQIANSGRAK  120

Query  479  LRRG  490
             ++G
Sbjct  121  SKKG  124


 Score = 62.0 bits (149),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  463  SSETETKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKTR  606
            S   ++KKG+  DE++ +TESDIEETLKRLVV++ KSP+EVF+ALK +
Sbjct  116  SGRAKSKKGELSDESNLMTESDIEETLKRLVVNLNKSPREVFNALKNQ  163



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090