BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS011F01

Length=624
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004237268.1|  PREDICTED: uncharacterized protein LOC101265533    168   6e-45   Solanum lycopersicum
ref|XP_006363752.1|  PREDICTED: uncharacterized protein LOC102588763    166   2e-44   Solanum tuberosum [potatoes]
ref|XP_004163890.1|  PREDICTED: uncharacterized protein LOC101226676    158   3e-43   
ref|XP_009786299.1|  PREDICTED: uncharacterized protein LOC104234435    163   4e-43   Nicotiana sylvestris
ref|XP_009608458.1|  PREDICTED: membralin                               163   4e-43   Nicotiana tomentosiformis
gb|AAQ09996.1|  S3 self-incompatibility locus-linked pollen 3.15 ...    160   2e-42   Petunia integrifolia subsp. inflata
emb|CBI23782.3|  unnamed protein product                                159   5e-42   Vitis vinifera
emb|CAN83928.1|  hypothetical protein VITISV_036910                     159   1e-41   Vitis vinifera
ref|XP_004146263.1|  PREDICTED: uncharacterized protein LOC101205453    158   2e-41   Cucumis sativus [cucumbers]
ref|XP_008456073.1|  PREDICTED: uncharacterized protein LOC103496115    157   3e-41   Cucumis melo [Oriental melon]
ref|XP_008361707.1|  PREDICTED: uncharacterized protein LOC103425410    151   6e-41   
ref|XP_011083231.1|  PREDICTED: uncharacterized protein LOC105165794    155   2e-40   Sesamum indicum [beniseed]
gb|EYU31215.1|  hypothetical protein MIMGU_mgv1a002444mg                155   2e-40   Erythranthe guttata [common monkey flower]
emb|CDP12573.1|  unnamed protein product                                155   3e-40   Coffea canephora [robusta coffee]
ref|XP_003593019.1|  Membralin                                          154   4e-40   Medicago truncatula
ref|XP_007227344.1|  hypothetical protein PRUPE_ppa002726mg             152   3e-39   Prunus persica
ref|XP_008347906.1|  PREDICTED: uncharacterized protein LOC103411037    145   6e-39   
ref|XP_003531591.1|  PREDICTED: uncharacterized protein LOC100810...    150   1e-38   Glycine max [soybeans]
ref|XP_006585484.1|  PREDICTED: uncharacterized protein LOC100810...    150   1e-38   Glycine max [soybeans]
ref|XP_007148516.1|  hypothetical protein PHAVU_006G215300g             150   1e-38   Phaseolus vulgaris [French bean]
ref|XP_003547536.1|  PREDICTED: uncharacterized protein LOC100812436    150   2e-38   Glycine max [soybeans]
gb|KHN33454.1|  Membralin                                               150   2e-38   Glycine soja [wild soybean]
ref|XP_004485491.1|  PREDICTED: uncharacterized protein LOC101514383    150   2e-38   Cicer arietinum [garbanzo]
ref|XP_008224597.1|  PREDICTED: uncharacterized protein LOC103324328    149   2e-38   Prunus mume [ume]
ref|XP_011016110.1|  PREDICTED: uncharacterized protein LOC105119643    146   3e-38   Populus euphratica
gb|KDP38854.1|  hypothetical protein JCGZ_05011                         147   1e-37   Jatropha curcas
gb|KDO53495.1|  hypothetical protein CISIN_1g005878mg                   146   1e-37   Citrus sinensis [apfelsine]
ref|XP_010101164.1|  hypothetical protein L484_016729                   147   1e-37   
gb|KDO53494.1|  hypothetical protein CISIN_1g005878mg                   145   2e-37   Citrus sinensis [apfelsine]
ref|XP_006431848.1|  hypothetical protein CICLE_v10000505mg             146   2e-37   
ref|XP_002529547.1|  Membralin, putative                                147   2e-37   Ricinus communis
ref|XP_006392070.1|  hypothetical protein EUTSA_v10023347mg             146   4e-37   Eutrema salsugineum [saltwater cress]
gb|KHG02113.1|  Membralin                                               146   4e-37   Gossypium arboreum [tree cotton]
gb|KDO53491.1|  hypothetical protein CISIN_1g005878mg                   146   4e-37   Citrus sinensis [apfelsine]
gb|KHG02112.1|  Membralin                                               146   4e-37   Gossypium arboreum [tree cotton]
ref|XP_008378986.1|  PREDICTED: uncharacterized protein LOC103442021    143   4e-37   
gb|KDO53490.1|  hypothetical protein CISIN_1g005878mg                   146   5e-37   Citrus sinensis [apfelsine]
ref|XP_006431850.1|  hypothetical protein CICLE_v10000505mg             146   5e-37   Citrus clementina [clementine]
gb|KDO53489.1|  hypothetical protein CISIN_1g005878mg                   146   5e-37   Citrus sinensis [apfelsine]
ref|XP_006431851.1|  hypothetical protein CICLE_v10000505mg             146   5e-37   Citrus clementina [clementine]
ref|XP_006369359.1|  hypothetical protein POPTR_0001s21920g             144   6e-37   
gb|KFK40737.1|  hypothetical protein AALP_AA2G034600                    144   1e-36   Arabis alpina [alpine rockcress]
ref|XP_002298169.2|  Nuf2 family protein                                145   1e-36   
ref|XP_009355233.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    144   2e-36   Pyrus x bretschneideri [bai li]
ref|XP_011005215.1|  PREDICTED: uncharacterized protein LOC105111532    145   2e-36   Populus euphratica
ref|XP_010533962.1|  PREDICTED: membralin                               144   2e-36   Tarenaya hassleriana [spider flower]
gb|KHG12184.1|  Membralin                                               144   2e-36   Gossypium arboreum [tree cotton]
ref|XP_010030118.1|  PREDICTED: uncharacterized protein LOC104419970    144   2e-36   Eucalyptus grandis [rose gum]
ref|XP_006471107.1|  PREDICTED: uncharacterized protein LOC102618...    144   2e-36   
ref|XP_006471106.1|  PREDICTED: uncharacterized protein LOC102618...    144   2e-36   Citrus sinensis [apfelsine]
ref|XP_006471105.1|  PREDICTED: uncharacterized protein LOC102618...    144   2e-36   Citrus sinensis [apfelsine]
gb|KJB77702.1|  hypothetical protein B456_012G151900                    144   2e-36   Gossypium raimondii
gb|KJB12208.1|  hypothetical protein B456_002G006000                    144   3e-36   Gossypium raimondii
gb|KJB12206.1|  hypothetical protein B456_002G006000                    144   3e-36   Gossypium raimondii
gb|KJB12209.1|  hypothetical protein B456_002G006000                    144   3e-36   Gossypium raimondii
gb|KJB77701.1|  hypothetical protein B456_012G151900                    144   4e-36   Gossypium raimondii
ref|XP_007042242.1|  S3 self-incompatibility locus-linked pollen ...    143   4e-36   
ref|XP_007042243.1|  S3 self-incompatibility locus-linked pollen ...    143   5e-36   
ref|XP_010274109.1|  PREDICTED: uncharacterized protein LOC104609475    143   5e-36   Nelumbo nucifera [Indian lotus]
ref|XP_004299931.1|  PREDICTED: uncharacterized protein LOC101308680    142   8e-36   Fragaria vesca subsp. vesca
ref|XP_010674302.1|  PREDICTED: uncharacterized protein LOC104890...    142   1e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010674303.1|  PREDICTED: uncharacterized protein LOC104890...    142   1e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001077749.1|  uncharacterized protein                            141   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010418050.1|  PREDICTED: membralin-like                          141   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_002886570.1|  hypothetical protein ARALYDRAFT_475227             141   2e-35   
ref|XP_010430092.1|  PREDICTED: membralin-like                          141   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_006301185.1|  hypothetical protein CARUB_v10021584mg             140   6e-35   Capsella rubella
ref|XP_010473303.1|  PREDICTED: uncharacterized protein LOC104752769    139   9e-35   Camelina sativa [gold-of-pleasure]
emb|CDY52486.1|  BnaA01g36030D                                          138   1e-34   Brassica napus [oilseed rape]
emb|CDY61338.1|  BnaCnng37740D                                          138   2e-34   Brassica napus [oilseed rape]
ref|XP_009104283.1|  PREDICTED: membralin                               138   2e-34   Brassica rapa
emb|CDY03777.1|  BnaC01g28940D                                          138   2e-34   
gb|EPS72367.1|  hypothetical protein M569_02391                         137   6e-34   Genlisea aurea
gb|KDO53488.1|  hypothetical protein CISIN_1g005878mg                   135   3e-33   Citrus sinensis [apfelsine]
ref|XP_006471108.1|  PREDICTED: uncharacterized protein LOC102618...    128   1e-30   Citrus sinensis [apfelsine]
gb|KDO53492.1|  hypothetical protein CISIN_1g005878mg                   128   1e-30   Citrus sinensis [apfelsine]
gb|KDO53493.1|  hypothetical protein CISIN_1g005878mg                   127   2e-30   Citrus sinensis [apfelsine]
ref|XP_006471109.1|  PREDICTED: uncharacterized protein LOC102618...    127   2e-30   Citrus sinensis [apfelsine]
ref|XP_010923767.1|  PREDICTED: uncharacterized protein LOC105046...    120   8e-29   
ref|XP_010923766.1|  PREDICTED: uncharacterized protein LOC105046...    119   1e-28   
ref|XP_010923765.1|  PREDICTED: uncharacterized protein LOC105046...    119   2e-28   
gb|AFW68066.1|  hypothetical protein ZEAMMB73_082522                    115   2e-28   
ref|XP_010923763.1|  PREDICTED: uncharacterized protein LOC105046...    119   4e-28   
ref|XP_010923762.1|  PREDICTED: uncharacterized protein LOC105046...    119   4e-28   
ref|XP_010923758.1|  PREDICTED: uncharacterized protein LOC105046...    119   4e-28   Elaeis guineensis
ref|XP_010923759.1|  PREDICTED: uncharacterized protein LOC105046...    119   5e-28   
ref|XP_010923760.1|  PREDICTED: uncharacterized protein LOC105046...    119   5e-28   Elaeis guineensis
gb|KJB12207.1|  hypothetical protein B456_002G006000                    120   6e-28   Gossypium raimondii
ref|XP_010923761.1|  PREDICTED: uncharacterized protein LOC105046...    119   6e-28   
ref|XP_010923757.1|  PREDICTED: uncharacterized protein LOC105046...    119   7e-28   Elaeis guineensis
ref|XP_010923756.1|  PREDICTED: uncharacterized protein LOC105046...    119   7e-28   
ref|XP_010923755.1|  PREDICTED: uncharacterized protein LOC105046...    119   7e-28   
ref|XP_010923754.1|  PREDICTED: uncharacterized protein LOC105046...    119   1e-27   
gb|AAG51636.1|AC018908_2  unknown protein; 69131-60853                  121   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008787340.1|  PREDICTED: uncharacterized protein LOC103705...    118   5e-27   Phoenix dactylifera
dbj|BAK02995.1|  predicted protein                                      115   6e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008787339.1|  PREDICTED: uncharacterized protein LOC103705...    118   7e-27   Phoenix dactylifera
ref|XP_004982244.1|  PREDICTED: uncharacterized protein LOC101752...    115   6e-26   Setaria italica
ref|NP_001050822.1|  Os03g0659900                                       115   7e-26   
ref|XP_006650375.1|  PREDICTED: uncharacterized protein LOC102702737    115   8e-26   Oryza brachyantha
ref|XP_010231807.1|  PREDICTED: uncharacterized protein LOC100825...    114   8e-26   Brachypodium distachyon [annual false brome]
ref|XP_003561560.1|  PREDICTED: uncharacterized protein LOC100825...    115   8e-26   Brachypodium distachyon [annual false brome]
gb|EEC75863.1|  hypothetical protein OsI_12877                          115   9e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_004982243.1|  PREDICTED: uncharacterized protein LOC101752...    114   9e-26   Setaria italica
ref|XP_002464124.1|  hypothetical protein SORBIDRAFT_01g012790          114   1e-25   Sorghum bicolor [broomcorn]
gb|EMS54971.1|  hypothetical protein TRIUR3_11843                       114   2e-25   Triticum urartu
ref|XP_010942375.1|  PREDICTED: uncharacterized protein LOC105060393    114   2e-25   Elaeis guineensis
gb|EEE59630.1|  hypothetical protein OsJ_11978                          114   2e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008782691.1|  PREDICTED: uncharacterized protein LOC103702156    113   4e-25   Phoenix dactylifera
ref|XP_010231815.1|  PREDICTED: uncharacterized protein LOC100825...    112   6e-25   Brachypodium distachyon [annual false brome]
gb|EMT20955.1|  hypothetical protein F775_05632                         112   1e-24   
ref|XP_009387979.1|  PREDICTED: uncharacterized protein LOC103974813    109   5e-24   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW68067.1|  hypothetical protein ZEAMMB73_082522                    101   8e-24   
gb|ACN39930.1|  unknown                                                 106   1e-22   Picea sitchensis
ref|XP_006853401.1|  hypothetical protein AMTR_s00032p00148750        95.9    3e-19   
gb|AAQ09998.1|  S2 self-incompatibility locus-linked pollen 3.15 ...  89.0    7e-17   Petunia integrifolia subsp. inflata
gb|AAQ09997.1|  S1 self-incompatibility locus-linked pollen 3.15 ...  85.1    1e-15   Petunia integrifolia subsp. inflata
ref|XP_002970045.1|  hypothetical protein SELMODRAFT_440969           78.2    3e-13   
ref|XP_002985235.1|  hypothetical protein SELMODRAFT_446163           78.2    3e-13   
gb|KEH36424.1|  S3 self-incompatibility locus-linked pollen 3.15 ...  61.2    1e-07   Medicago truncatula
gb|ABK24891.1|  unknown                                               58.2    6e-07   Picea sitchensis
gb|ABK23338.1|  unknown                                               57.8    7e-07   Picea sitchensis
gb|ACN41062.1|  unknown                                               57.8    8e-07   Picea sitchensis



>ref|XP_004237268.1| PREDICTED: uncharacterized protein LOC101265533 [Solanum lycopersicum]
Length=658

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERF+QML+PRIRATLEY  LF+AVTLFCILVVMHANYVQQPGCSSELS+
Sbjct  1    MDPEQTFIRVQERFAQMLTPRIRATLEYLYLFMAVTLFCILVVMHANYVQQPGCSSELSR  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILK  610
            V+ISD Q+IQIKITSAGLW QN+T Y+ V+V++ E   E LK
Sbjct  61   VNISDAQLIQIKITSAGLWSQNQTNYDVVNVANEEPIDENLK  102



>ref|XP_006363752.1| PREDICTED: uncharacterized protein LOC102588763 [Solanum tuberosum]
Length=658

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERF+QML+PRIRATLEY  LF+AVTLFCILVVMHANYVQQPGCSSELS+
Sbjct  1    MDPEQTFIRVQERFAQMLTPRIRATLEYLYLFMAVTLFCILVVMHANYVQQPGCSSELSR  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKVIH  619
            V+ISD Q+IQIKITSAGLW QN+T Y+ V+V + E   E LK ++
Sbjct  61   VNISDAQLIQIKITSAGLWSQNQTNYDVVNVVNEEPIDENLKHVN  105



>ref|XP_004163890.1| PREDICTED: uncharacterized protein LOC101226676 [Cucumis sativus]
Length=327

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQML+P++RATLEY  L +A+TLFCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQMLTPKVRATLEYMNLCIAITLFCILVVMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKV  613
            V+ ++ Q+IQIKIT+AGLW QNE+E N  DV  GE+  E L+V
Sbjct  61   VETTEAQLIQIKITTAGLWSQNESELNIQDVPGGETVRESLEV  103



>ref|XP_009786299.1| PREDICTED: uncharacterized protein LOC104234435 [Nicotiana sylvestris]
Length=661

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERF+QML PR+RATLEY  LF+AVTLF ILVVMHANYVQQPGCSSELS+
Sbjct  1    MDPEQTFIRVQERFAQMLRPRVRATLEYLYLFIAVTLFSILVVMHANYVQQPGCSSELSR  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILK  610
            V+IS+ Q+IQIKITSAGLW QN+T Y+ V+V++ E  SE LK
Sbjct  61   VNISEAQLIQIKITSAGLWSQNQTNYDVVNVANEEQISENLK  102



>ref|XP_009608458.1| PREDICTED: membralin [Nicotiana tomentosiformis]
Length=661

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERF+QML PR+RATLEY  LF+AVTLF ILVVMHANYVQQPGCSSELS+
Sbjct  1    MDPEQTFIRVQERFAQMLRPRVRATLEYLYLFIAVTLFSILVVMHANYVQQPGCSSELSR  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILK  610
            V+IS+ Q+IQIKITSAGLW QN+T Y+ V+V++ E  SE LK
Sbjct  61   VNISEAQLIQIKITSAGLWSQNQTNYDVVNVANEEPISENLK  102



>gb|AAQ09996.1| S3 self-incompatibility locus-linked pollen 3.15 protein [Petunia 
integrifolia subsp. inflata]
Length=660

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERF+QML+PRIR TLEY  LF+AVTLF ILVVMHANYVQQPGCSSELS+
Sbjct  1    MDPEQTFIRVQERFAQMLTPRIRVTLEYLYLFIAVTLFSILVVMHANYVQQPGCSSELSR  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILK  610
            V+I + Q+IQIKITSAGLW QN+  Y+ VDV++ E  SE LK
Sbjct  61   VNIMEAQLIQIKITSAGLWSQNQPNYDVVDVANKEPFSENLK  102



>emb|CBI23782.3| unnamed protein product [Vitis vinifera]
Length=516

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQML+PR+RA+LEY  LFVA+TLFCILVVMHANYVQQPGCSSE S 
Sbjct  1    MDPEQTFIRVQERFSQMLTPRVRASLEYIYLFVAITLFCILVVMHANYVQQPGCSSEFSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKV  613
            V+ ++ Q+IQIKITSAGLW +NE+EY  ++V   E+ ++ L V
Sbjct  61   VETTEAQLIQIKITSAGLWSRNESEYKAINVPDKETVTDNLNV  103



>emb|CAN83928.1| hypothetical protein VITISV_036910 [Vitis vinifera]
Length=673

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQML+PR+RA+LEY  LFVA+TLFCILVVMHANYVQQPGCSSE S 
Sbjct  1    MDPEQTFIRVQERFSQMLTPRVRASLEYIYLFVAITLFCILVVMHANYVQQPGCSSEFSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKV  613
            V+ ++ Q+IQIKITSAGLW +NE+EY  ++V   E+ ++ L V
Sbjct  61   VETTEAQLIQIKITSAGLWSRNESEYKAINVPDKETVTDNLNV  103



>ref|XP_004146263.1| PREDICTED: uncharacterized protein LOC101205453 [Cucumis sativus]
 gb|KGN57586.1| hypothetical protein Csa_3G219210 [Cucumis sativus]
Length=669

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQML+P++RATLEY  L +A+TLFCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQMLTPKVRATLEYMNLCIAITLFCILVVMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKV  613
            V+ ++ Q+IQIKIT+AGLW QNE+E N  DV  GE+  E L+V
Sbjct  61   VETTEAQLIQIKITTAGLWSQNESELNIQDVPGGETVRESLEV  103



>ref|XP_008456073.1| PREDICTED: uncharacterized protein LOC103496115 [Cucumis melo]
Length=668

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQML+P++RATLEY  L +A+TLFCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQMLTPKVRATLEYMNLCIAITLFCILVVMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKV  613
            V+ ++ Q+IQIKIT+AGLW QNE+E N  DV  GE+  E L+V
Sbjct  61   VETTEAQLIQIKITTAGLWSQNESELNIQDVPGGETVRESLEV  103



>ref|XP_008361707.1| PREDICTED: uncharacterized protein LOC103425410 [Malus domestica]
Length=267

 Score =   151 bits (381),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MD EQTFIRVQERFSQ+L+P++RA LEY  LF+A+TLFCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDAEQTFIRVQERFSQILTPKVRAALEYIYLFIAITLFCILVVMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNS  598
            V+ ++ QIIQIKITSAGLW QNE+E+  V     ++ S
Sbjct  61   VETTZAQIIQIKITSAGLWSQNESEFTNVXYDGTDTKS  98



>ref|XP_011083231.1| PREDICTED: uncharacterized protein LOC105165794 [Sesamum indicum]
Length=671

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFS+ML+PRIRA LEYF LF+A+TLFCILVVMHANYVQQPGCSSE S 
Sbjct  1    MDPEQTFIRVQERFSEMLTPRIRAKLEYFFLFLAITLFCILVVMHANYVQQPGCSSEFSS  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKVIHV  622
            V  SD Q+IQI ITSAGLW  NE   + +DV   E+  EI K  +V
Sbjct  61   VQTSDAQLIQITITSAGLWSHNEAVNDVIDVHDTETEIEIGKPTNV  106



>gb|EYU31215.1| hypothetical protein MIMGU_mgv1a002444mg [Erythranthe guttata]
Length=674

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFS+ML+ +IRA LEYF LF+A+TLFCILVVMHANYVQQPGCSSE S 
Sbjct  1    MDPEQTFIRVQERFSEMLTQKIRAKLEYFFLFLAITLFCILVVMHANYVQQPGCSSEFSS  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKVIHV  622
              +SD Q+IQIKITSAGLW QNE+  + VD     +++EI K I+V
Sbjct  61   GQMSDAQLIQIKITSAGLWSQNESVVDAVDAHDTGTDTEIEKYINV  106



>emb|CDP12573.1| unnamed protein product [Coffea canephora]
Length=671

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFS+ML+P+IR  LEY  LF+AVTLFCILVVMHANYVQQPGCSSEL K
Sbjct  1    MDPEQTFIRVQERFSEMLTPKIRDFLEYLYLFIAVTLFCILVVMHANYVQQPGCSSELPK  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGE  589
            V++S+ Q+IQIKITS GLW  NE+EYNE++   G 
Sbjct  61   VNVSEAQLIQIKITSDGLWTWNESEYNEINGLEGR  95



>ref|XP_003593019.1| Membralin [Medicago truncatula]
 gb|AES63270.1| S3 self-incompatibility locus-linked pollen 3.15 protein [Medicago 
truncatula]
Length=675

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQML+P++R TLEY  LFVA+T FCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQMLTPKVRVTLEYLYLFVAITFFCILVVMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGES  592
            V  SD Q+IQIKITSAGLW+ N++E N +D    E+
Sbjct  61   VLTSDAQLIQIKITSAGLWYHNDSEPNIIDPPDTEA  96



>ref|XP_007227344.1| hypothetical protein PRUPE_ppa002726mg [Prunus persica]
 gb|EMJ28543.1| hypothetical protein PRUPE_ppa002726mg [Prunus persica]
Length=639

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQ+L+P++RA LEY  LF+A+TLFCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQILTPKVRAALEYIYLFIAITLFCILVVMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEV  571
            V+ ++ QIIQIKITSAGLW QNE+E+  V
Sbjct  61   VETTEAQIIQIKITSAGLWSQNESEFTNV  89



>ref|XP_008347906.1| PREDICTED: uncharacterized protein LOC103411037 [Malus domestica]
Length=267

 Score =   145 bits (367),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MD EQTFIRVQERFSQ+L+P++RA LEY  LF+A+TLF ILVVMHANYVQQPGCSSELS 
Sbjct  1    MDAEQTFIRVQERFSQILTPKVRAALEYMYLFIAITLFFILVVMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEV  571
            V+ ++ QIIQIKITSAGLW QNE+E+  V
Sbjct  61   VETTEAQIIQIKITSAGLWSQNESEFTNV  89



>ref|XP_003531591.1| PREDICTED: uncharacterized protein LOC100810658 isoform X1 [Glycine 
max]
Length=616

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQML+P++R  LEY  LF+A+TLFCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQMLTPKVRVALEYLYLFIAITLFCILVVMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVD  574
            V  S+ Q+IQIKITSAGLW  N++E N +D
Sbjct  61   VVTSEAQLIQIKITSAGLWSHNDSESNRID  90



>ref|XP_006585484.1| PREDICTED: uncharacterized protein LOC100810658 isoform X2 [Glycine 
max]
 gb|KHN11233.1| Membralin [Glycine soja]
Length=677

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQML+P++R  LEY  LF+A+TLFCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQMLTPKVRVALEYLYLFIAITLFCILVVMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVD  574
            V  S+ Q+IQIKITSAGLW  N++E N +D
Sbjct  61   VVTSEAQLIQIKITSAGLWSHNDSESNRID  90



>ref|XP_007148516.1| hypothetical protein PHAVU_006G215300g [Phaseolus vulgaris]
 gb|ESW20510.1| hypothetical protein PHAVU_006G215300g [Phaseolus vulgaris]
Length=676

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQML+P++R  LEY  LF+A+TLFCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQMLTPKVRVALEYLYLFIAITLFCILVVMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGE  589
            V  S+ Q+IQIKITSAGLW  N++E N +D    E
Sbjct  61   VVTSEAQLIQIKITSAGLWSHNDSESNRIDPPETE  95



>ref|XP_003547536.1| PREDICTED: uncharacterized protein LOC100812436 [Glycine max]
Length=680

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQML+P++R  LEY  LF+A+TLFCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQMLTPKVRVALEYLYLFIAITLFCILVVMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGE  589
            V  S+ Q+IQIKITSAGLW  N++E N +D    E
Sbjct  61   VVTSEAQLIQIKITSAGLWSHNDSESNRIDPPETE  95



>gb|KHN33454.1| Membralin [Glycine soja]
Length=678

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQML+P++R  LEY  LF+A+TLFCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQMLTPKVRVALEYLYLFIAITLFCILVVMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGE  589
            V  S+ Q+IQIKITSAGLW  N++E N +D    E
Sbjct  61   VVTSEAQLIQIKITSAGLWSHNDSESNRIDPPETE  95



>ref|XP_004485491.1| PREDICTED: uncharacterized protein LOC101514383 [Cicer arietinum]
Length=675

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQML+P++R TLEY  LF+A+T FCILVVMHANYVQQPGCS ELS 
Sbjct  1    MDPEQTFIRVQERFSQMLTPKVRVTLEYLYLFMAITFFCILVVMHANYVQQPGCSGELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKV  613
            V  S+ Q+IQIKITSAGLW  N+ E N +D S  E+  + ++V
Sbjct  61   VLTSEAQLIQIKITSAGLWSHNDPESNIIDSSEAEAVKDKMEV  103



>ref|XP_008224597.1| PREDICTED: uncharacterized protein LOC103324328 [Prunus mume]
Length=639

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQER SQ+L+P++RA LEY  LF+A+TLFCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERLSQILTPKVRAALEYIYLFIAITLFCILVVMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEV  571
            V+ ++ QIIQIKITSAGLW QNE+E+  V
Sbjct  61   VETTEAQIIQIKITSAGLWSQNESEFTNV  89



>ref|XP_011016110.1| PREDICTED: uncharacterized protein LOC105119643 [Populus euphratica]
Length=341

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MD EQTFIRVQERFSQML+P++RA  EY  LF+A+TLFCILVVMHANYVQQPGCSS+LS 
Sbjct  1    MDTEQTFIRVQERFSQMLTPKVRAAFEYMYLFIAITLFCILVVMHANYVQQPGCSSQLSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYN  565
            V+  + Q+IQIKITSAGLW QNE+E N
Sbjct  61   VETREAQLIQIKITSAGLWSQNESESN  87



>gb|KDP38854.1| hypothetical protein JCGZ_05011 [Jatropha curcas]
Length=673

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQML+P++RA LEY  LFVAVTLFCILVVMHANYVQQPGCSSE S 
Sbjct  1    MDPEQTFIRVQERFSQMLTPKVRAALEYMYLFVAVTLFCILVVMHANYVQQPGCSSEFSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKVIHV  622
            V+    Q+IQIKITSAGLW  N +E   VDV   ES  + L++ +V
Sbjct  61   VETMGAQLIQIKITSAGLWSHNGSESIIVDVPCVESLPDELELSNV  106



>gb|KDO53495.1| hypothetical protein CISIN_1g005878mg [Citrus sinensis]
Length=447

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQPGCSSEFAG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  583
            + +++ Q+IQIKI+SAGLW QN+++ N VDV+S
Sbjct  61   IRMTEAQLIQIKISSAGLWSQNDSDSNVVDVTS  93



>ref|XP_010101164.1| hypothetical protein L484_016729 [Morus notabilis]
 gb|EXB87382.1| hypothetical protein L484_016729 [Morus notabilis]
Length=570

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQER SQML+P++RA LEY  LF+A+TLFCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERVSQMLTPKVRAALEYLCLFIAITLFCILVVMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKVIHV  622
            V  ++ Q+IQIKITSAGLW ++  E    D+   +  S+ L+V+ V
Sbjct  61   VRTTEAQLIQIKITSAGLWSRDAAEPTGTDIPDIKPVSDKLEVVSV  106



>gb|KDO53494.1| hypothetical protein CISIN_1g005878mg [Citrus sinensis]
Length=454

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQPGCSSEFAG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  583
            + +++ Q+IQIKI+SAGLW QN+++ N VDV+S
Sbjct  61   IRMTEAQLIQIKISSAGLWSQNDSDSNVVDVTS  93



>ref|XP_006431848.1| hypothetical protein CICLE_v10000505mg [Citrus clementina]
 ref|XP_006431849.1| hypothetical protein CICLE_v10000505mg [Citrus clementina]
 ref|XP_006431852.1| hypothetical protein CICLE_v10000505mg [Citrus clementina]
 gb|ESR45088.1| hypothetical protein CICLE_v10000505mg [Citrus clementina]
 gb|ESR45089.1| hypothetical protein CICLE_v10000505mg [Citrus clementina]
 gb|ESR45092.1| hypothetical protein CICLE_v10000505mg [Citrus clementina]
Length=472

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQPGCSSEFAG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  583
            + +++ Q+IQIKI+SAGLW QN+++ N VDV+S
Sbjct  61   IRMTEAQLIQIKISSAGLWSQNDSDSNVVDVTS  93



>ref|XP_002529547.1| Membralin, putative [Ricinus communis]
 gb|EEF32850.1| Membralin, putative [Ricinus communis]
Length=672

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQML+P++RA LEY  LF+A+TLFCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQMLTPKVRAALEYVYLFIAITLFCILVVMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKVIHV  622
            V+  + Q+IQIKITSAGLW  +E E +   V S E+ S  L++ +V
Sbjct  61   VETKEAQLIQIKITSAGLWSNSEVESSVAYVPSVETVSNNLELENV  106



>ref|XP_006392070.1| hypothetical protein EUTSA_v10023347mg [Eutrema salsugineum]
 gb|ESQ29356.1| hypothetical protein EUTSA_v10023347mg [Eutrema salsugineum]
Length=629

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 87/103 (84%), Gaps = 1/103 (1%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQ+L+PRIRA LEY  LFVA+TLFCILVVMHANYVQQPGCSSEL+ 
Sbjct  1    MDPEQTFIRVQERFSQILTPRIRAFLEYTYLFVAITLFCILVVMHANYVQQPGCSSELTG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKV  613
            V++++ +++QIKITSAGLW +N+ E    DV   E+ ++ L+V
Sbjct  61   VELAEAELLQIKITSAGLWSRND-ESTAADVPKVEAAADNLEV  102



>gb|KHG02113.1| Membralin [Gossypium arboreum]
Length=628

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 84/107 (79%), Gaps = 3/107 (3%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTF+RVQ RFSQ+L+PR+R  LEY  LF+A+T FCILV MHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFMRVQGRFSQILTPRVRVALEYIYLFIAITFFCILVTMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEY---NEVDVSSGESNSEILKVI  616
            +D ++VQ+IQIKITSAGLW +NE+E    +  D+ +   N E+  V+
Sbjct  61   IDSNEVQLIQIKITSAGLWSRNESETVTVDNTDLKTATENVEVASVV  107



>gb|KDO53491.1| hypothetical protein CISIN_1g005878mg [Citrus sinensis]
Length=647

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQPGCSSEFAG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  583
            + +++ Q+IQIKI+SAGLW QN+++ N VDV+S
Sbjct  61   IRMTEAQLIQIKISSAGLWSQNDSDSNVVDVTS  93



>gb|KHG02112.1| Membralin [Gossypium arboreum]
Length=640

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 84/107 (79%), Gaps = 3/107 (3%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTF+RVQ RFSQ+L+PR+R  LEY  LF+A+T FCILV MHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFMRVQGRFSQILTPRVRVALEYIYLFIAITFFCILVTMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETE---YNEVDVSSGESNSEILKVI  616
            +D ++VQ+IQIKITSAGLW +NE+E    +  D+ +   N E+  V+
Sbjct  61   IDSNEVQLIQIKITSAGLWSRNESETVTVDNTDLKTATENVEVASVV  107



>ref|XP_008378986.1| PREDICTED: uncharacterized protein LOC103442021 [Malus domestica]
Length=372

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MD EQTFIRVQERFSQ+L+P++RA LEY  LF+A+TLF ILVVMHANYVQQPGCSSELS 
Sbjct  1    MDAEQTFIRVQERFSQILTPKVRAALEYMYLFIAITLFFILVVMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEV  571
            V+ ++ QIIQIKITSAGLW QN +E+  V
Sbjct  61   VETTEAQIIQIKITSAGLWSQNXSEFTNV  89



>gb|KDO53490.1| hypothetical protein CISIN_1g005878mg [Citrus sinensis]
Length=649

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQPGCSSEFAG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  583
            + +++ Q+IQIKI+SAGLW QN+++ N VDV+S
Sbjct  61   IRMTEAQLIQIKISSAGLWSQNDSDSNVVDVTS  93



>ref|XP_006431850.1| hypothetical protein CICLE_v10000505mg [Citrus clementina]
 gb|ESR45090.1| hypothetical protein CICLE_v10000505mg [Citrus clementina]
Length=672

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQPGCSSEFAG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  583
            + +++ Q+IQIKI+SAGLW QN+++ N VDV+S
Sbjct  61   IRMTEAQLIQIKISSAGLWSQNDSDSNVVDVTS  93



>gb|KDO53489.1| hypothetical protein CISIN_1g005878mg [Citrus sinensis]
Length=672

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQPGCSSEFAG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  583
            + +++ Q+IQIKI+SAGLW QN+++ N VDV+S
Sbjct  61   IRMTEAQLIQIKISSAGLWSQNDSDSNVVDVTS  93



>ref|XP_006431851.1| hypothetical protein CICLE_v10000505mg [Citrus clementina]
 gb|ESR45091.1| hypothetical protein CICLE_v10000505mg [Citrus clementina]
Length=674

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQPGCSSEFAG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  583
            + +++ Q+IQIKI+SAGLW QN+++ N VDV+S
Sbjct  61   IRMTEAQLIQIKISSAGLWSQNDSDSNVVDVTS  93



>ref|XP_006369359.1| hypothetical protein POPTR_0001s21920g [Populus trichocarpa]
 gb|ERP65928.1| hypothetical protein POPTR_0001s21920g [Populus trichocarpa]
Length=496

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MD EQTFIRVQERFSQML+P++RA  EY  LF+A+TLFCILVVMHANYVQQPGCSS+LS 
Sbjct  1    MDTEQTFIRVQERFSQMLTPKVRAAFEYMYLFIAITLFCILVVMHANYVQQPGCSSQLSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYN  565
            V+  + Q+IQIKITSAGLW QNE+E N
Sbjct  61   VETREAQLIQIKITSAGLWSQNESESN  87



>gb|KFK40737.1| hypothetical protein AALP_AA2G034600 [Arabis alpina]
Length=621

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 85/105 (81%), Gaps = 2/105 (2%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQ+L+PRIR  LEY  LFVA+TLFCILVVMHANYVQQPGCSSEL+ 
Sbjct  1    MDPEQTFIRVQERFSQILTPRIRGFLEYTYLFVAITLFCILVVMHANYVQQPGCSSELTG  60

Query  485  VDISDVQIIQIKITSAGLWFQNE--TEYNEVDVSSGESNSEILKV  613
            V++++ +++QIKITSAGLW +N+  T  +   V +   NSE+ K 
Sbjct  61   VELAEAELLQIKITSAGLWSRNDESTAADVPQVEAATDNSEVSKT  105



>ref|XP_002298169.2| Nuf2 family protein [Populus trichocarpa]
 gb|EEE82974.2| Nuf2 family protein [Populus trichocarpa]
Length=670

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MD EQTFIRVQERFSQML+P++RA  EY  LF+A+TLFCILVVMHANYVQQPGCSS+LS 
Sbjct  1    MDTEQTFIRVQERFSQMLTPKVRAAFEYMYLFIAITLFCILVVMHANYVQQPGCSSQLSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYN  565
            V+  + Q+IQIKITSAGLW QNE+E N
Sbjct  61   VETREAQLIQIKITSAGLWSQNESESN  87



>ref|XP_009355233.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103946303 
[Pyrus x bretschneideri]
Length=640

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MD EQTFIRVQERFSQ+L+P++RA LEY  LF+A+TLF ILVVMHANYVQQPGCSSELS 
Sbjct  1    MDAEQTFIRVQERFSQILTPKVRAALEYIYLFIAITLFFILVVMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNS  598
            V+ ++ QIIQIKITSAGLW QNE+E+  V   + ++ S
Sbjct  61   VETTEAQIIQIKITSAGLWSQNESEFTNVMDDAPDTKS  98



>ref|XP_011005215.1| PREDICTED: uncharacterized protein LOC105111532 [Populus euphratica]
Length=690

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MD EQTFIRVQERFSQML+P++RA  EY  LF+A+TLFCILVVMHANYVQQPGCSS+LS 
Sbjct  1    MDTEQTFIRVQERFSQMLTPKVRAAFEYMYLFIAITLFCILVVMHANYVQQPGCSSQLSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYN  565
            V+  + Q+IQIKITSAGLW QNE+E N
Sbjct  61   VETREAQLIQIKITSAGLWSQNESESN  87



>ref|XP_010533962.1| PREDICTED: membralin [Tarenaya hassleriana]
Length=601

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 88/106 (83%), Gaps = 1/106 (1%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQ+L+P+IRA LEY  LFVA+TLFCIL+VMHANYVQQPGCSSE+S 
Sbjct  1    MDPEQTFIRVQERFSQILTPKIRAFLEYTYLFVAITLFCILLVMHANYVQQPGCSSEVSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKVIHV  622
            V++ +VQ+IQIKITS GLW +++ E    D+S  +  +E+L+V  V
Sbjct  61   VELVEVQLIQIKITSTGLWSRDD-ESTAADISGIKVGAEMLEVPKV  105



>gb|KHG12184.1| Membralin [Gossypium arboreum]
Length=673

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 85/103 (83%), Gaps = 3/103 (3%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQ+L+PR+R  LEY  LF+A+T FCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQILTPRVRVALEYIYLFIAITSFCILVVMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETE---YNEVDVSSGESNSEI  604
            V+ ++VQ++QIKITSAGLW Q+E+E    N +D+ +   N E+
Sbjct  61   VESNEVQLVQIKITSAGLWSQDESEPPVVNNLDMETVTENIEV  103



>ref|XP_010030118.1| PREDICTED: uncharacterized protein LOC104419970 [Eucalyptus grandis]
 gb|KCW57085.1| hypothetical protein EUGRSUZ_I02737 [Eucalyptus grandis]
Length=666

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 79/101 (78%), Gaps = 1/101 (1%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQ+L+PR+RA LEY  LF+AVTLFCILVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEQTFIRVQERFSQILTPRLRAALEYVYLFIAVTLFCILVVMHANYVQQPGCSSEFTG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDV-SSGESNSEI  604
            V  +D Q+  IKITS GLW QNE   +  D+  SG +  ++
Sbjct  61   VKTADAQLFHIKITSVGLWSQNEIALDRRDLPDSGHAEGKV  101



>ref|XP_006471107.1| PREDICTED: uncharacterized protein LOC102618114 isoform X3 [Citrus 
sinensis]
Length=649

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQPGCSSEFAG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKV  613
            + +++ Q+IQIKI+SAGLW Q++++ N VDV+S +++   L+V
Sbjct  61   IRMTEAQLIQIKISSAGLWSQHDSDSNVVDVTSVDNSINELEV  103



>ref|XP_006471106.1| PREDICTED: uncharacterized protein LOC102618114 isoform X2 [Citrus 
sinensis]
Length=672

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQPGCSSEFAG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKV  613
            + +++ Q+IQIKI+SAGLW Q++++ N VDV+S +++   L+V
Sbjct  61   IRMTEAQLIQIKISSAGLWSQHDSDSNVVDVTSVDNSINELEV  103



>ref|XP_006471105.1| PREDICTED: uncharacterized protein LOC102618114 isoform X1 [Citrus 
sinensis]
Length=674

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQPGCSSEFAG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKV  613
            + +++ Q+IQIKI+SAGLW Q++++ N VDV+S +++   L+V
Sbjct  61   IRMTEAQLIQIKISSAGLWSQHDSDSNVVDVTSVDNSINELEV  103



>gb|KJB77702.1| hypothetical protein B456_012G151900 [Gossypium raimondii]
Length=673

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 85/103 (83%), Gaps = 3/103 (3%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQ+L+PR+R  LEY  LF+A+T FCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQILTPRVRVALEYIYLFIAITSFCILVVMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETE---YNEVDVSSGESNSEI  604
            V+ ++VQ++QIKITSAGLW Q+E+E    N +D+ +   N E+
Sbjct  61   VESNEVQLVQIKITSAGLWSQSESEPPVVNNLDMETVTENIEV  103



>gb|KJB12208.1| hypothetical protein B456_002G006000 [Gossypium raimondii]
Length=649

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 84/107 (79%), Gaps = 3/107 (3%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTF+RVQ RFSQ+L+PR+R  LEY  LF+A+T FCILV MHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFMRVQGRFSQILTPRVRVALEYIYLFIAITSFCILVTMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEY---NEVDVSSGESNSEILKVI  616
            +D ++VQ+IQIKITSAGLW +NE+E    +  D+ +   N E+  V+
Sbjct  61   IDSNEVQLIQIKITSAGLWSRNESETVTIDNPDLKTATENVEVASVV  107



>gb|KJB12206.1| hypothetical protein B456_002G006000 [Gossypium raimondii]
Length=676

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 84/107 (79%), Gaps = 3/107 (3%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTF+RVQ RFSQ+L+PR+R  LEY  LF+A+T FCILV MHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFMRVQGRFSQILTPRVRVALEYIYLFIAITSFCILVTMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEY---NEVDVSSGESNSEILKVI  616
            +D ++VQ+IQIKITSAGLW +NE+E    +  D+ +   N E+  V+
Sbjct  61   IDSNEVQLIQIKITSAGLWSRNESETVTIDNPDLKTATENVEVASVV  107



>gb|KJB12209.1| hypothetical protein B456_002G006000 [Gossypium raimondii]
Length=683

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 84/107 (79%), Gaps = 3/107 (3%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTF+RVQ RFSQ+L+PR+R  LEY  LF+A+T FCILV MHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFMRVQGRFSQILTPRVRVALEYIYLFIAITSFCILVTMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEY---NEVDVSSGESNSEILKVI  616
            +D ++VQ+IQIKITSAGLW +NE+E    +  D+ +   N E+  V+
Sbjct  61   IDSNEVQLIQIKITSAGLWSRNESETVTIDNPDLKTATENVEVASVV  107



>gb|KJB77701.1| hypothetical protein B456_012G151900 [Gossypium raimondii]
Length=700

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 85/103 (83%), Gaps = 3/103 (3%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQ+L+PR+R  LEY  LF+A+T FCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQILTPRVRVALEYIYLFIAITSFCILVVMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETE---YNEVDVSSGESNSEI  604
            V+ ++VQ++QIKITSAGLW Q+E+E    N +D+ +   N E+
Sbjct  61   VESNEVQLVQIKITSAGLWSQSESEPPVVNNLDMETVTENIEV  103



>ref|XP_007042242.1| S3 self-incompatibility locus-linked pollen 3.15 protein isoform 
1 [Theobroma cacao]
 gb|EOX98073.1| S3 self-incompatibility locus-linked pollen 3.15 protein isoform 
1 [Theobroma cacao]
Length=674

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQ+L+PR+R  LEY  L +A+T FC+LVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQILTPRVRVALEYIYLVIAITSFCMLVVMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKVIHV  622
            V+  +VQ+IQIKITSAGLW +NE+E+  V+    E+ +E ++V +V
Sbjct  61   VESKEVQLIQIKITSAGLWSRNESEHAVVNNPDLETVTENVEVANV  106



>ref|XP_007042243.1| S3 self-incompatibility locus-linked pollen 3.15 protein isoform 
2 [Theobroma cacao]
 gb|EOX98074.1| S3 self-incompatibility locus-linked pollen 3.15 protein isoform 
2 [Theobroma cacao]
Length=677

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQ+L+PR+R  LEY  L +A+T FC+LVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQILTPRVRVALEYIYLVIAITSFCMLVVMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKVIHV  622
            V+  +VQ+IQIKITSAGLW +NE+E+  V+    E+ +E ++V +V
Sbjct  61   VESKEVQLIQIKITSAGLWSRNESEHAVVNNPDLETVTENVEVANV  106



>ref|XP_010274109.1| PREDICTED: uncharacterized protein LOC104609475 [Nelumbo nucifera]
Length=672

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQML+PRIRA LEY  L VA+ LFC+LVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQMLTPRIRAALEYVYLVVAIALFCLLVVMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKV  613
            ++ S+ Q++QIKITS GLW    +E N +D S+   +S+ L+V
Sbjct  61   IESSEAQLVQIKITSIGLWSGKASESNAMDNSNKGISSDNLEV  103



>ref|XP_004299931.1| PREDICTED: uncharacterized protein LOC101308680 [Fragaria vesca 
subsp. vesca]
Length=631

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQ+L+P++RA LEY  LF+A+TLF ILVVMHANYVQQPGCSSEL  
Sbjct  1    MDPEQTFIRVQERFSQILTPKVRAGLEYIYLFIAITLFSILVVMHANYVQQPGCSSELPG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEY  562
            V+ +D QII +KI+SAGLW QNE+++
Sbjct  61   VETADAQIIHVKISSAGLWSQNESDF  86



>ref|XP_010674302.1| PREDICTED: uncharacterized protein LOC104890491 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=677

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQM++PR+RATLEYF LF A+TLF ILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQMVTPRVRATLEYFYLFTAITLFAILVVMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  583
            V  S+ Q+I IKIT  GL  QN +E N  D+SS
Sbjct  61   VQTSNAQLIYIKITGIGLLRQNASEPNFEDISS  93



>ref|XP_010674303.1| PREDICTED: uncharacterized protein LOC104890491 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=674

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQM++PR+RATLEYF LF A+TLF ILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQMVTPRVRATLEYFYLFTAITLFAILVVMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  583
            V  S+ Q+I IKIT  GL  QN +E N  D+SS
Sbjct  61   VQTSNAQLIYIKITGIGLLRQNASEPNFEDISS  93



>ref|NP_001077749.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAC43446.1| unknown protein [Arabidopsis thaliana]
 gb|AEE33764.1| uncharacterized protein AT1G60995 [Arabidopsis thaliana]
Length=623

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 85/103 (83%), Gaps = 1/103 (1%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQ+L+PRIR  LEY  LFVA+TLFCILVVMHANYVQQPGCSSEL+ 
Sbjct  1    MDPEQTFIRVQERFSQILTPRIRGFLEYTYLFVAITLFCILVVMHANYVQQPGCSSELTG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKV  613
            V++++ +++QIKITSAGLW +N+ E    DV    + ++ L+V
Sbjct  61   VELAEAELMQIKITSAGLWSRND-ESTAADVPRVVAATDSLEV  102



>ref|XP_010418050.1| PREDICTED: membralin-like [Camelina sativa]
Length=626

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 85/103 (83%), Gaps = 1/103 (1%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQ+L+PRIR  LEY  LFVA+TLFC+LVVMHANYVQQPGCSSEL+ 
Sbjct  1    MDPEQTFIRVQERFSQILTPRIRGFLEYTYLFVAITLFCVLVVMHANYVQQPGCSSELTG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKV  613
            V++++ +++QIKITSAGLW +N+ E    DV    + ++ L+V
Sbjct  61   VELTEAELMQIKITSAGLWSRND-ESTAADVPQVVATTDSLEV  102



>ref|XP_002886570.1| hypothetical protein ARALYDRAFT_475227 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62829.1| hypothetical protein ARALYDRAFT_475227 [Arabidopsis lyrata subsp. 
lyrata]
Length=623

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 85/103 (83%), Gaps = 1/103 (1%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQ+L+PRIR  LEY  LFVA+TLFCILVVMHANYVQQPGCSSEL+ 
Sbjct  1    MDPEQTFIRVQERFSQILTPRIRGFLEYTYLFVAITLFCILVVMHANYVQQPGCSSELTG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKV  613
            V++++ +++QIKITSAGLW +N+ E    DV    + ++ L+V
Sbjct  61   VELAEAELMQIKITSAGLWSRND-ESTAADVPRVVTATDSLEV  102



>ref|XP_010430092.1| PREDICTED: membralin-like [Camelina sativa]
Length=626

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQ+L+PRIR  LEY  LFVA+TLFCILVVMHANYVQQPGCSSEL+ 
Sbjct  1    MDPEQTFIRVQERFSQILTPRIRGFLEYTYLFVAITLFCILVVMHANYVQQPGCSSELTG  60

Query  485  VDISDVQIIQIKITSAGLWFQNE  553
            V++++ +++QIKITSAGLW +N+
Sbjct  61   VELTEAELMQIKITSAGLWSRND  83



>ref|XP_006301185.1| hypothetical protein CARUB_v10021584mg [Capsella rubella]
 gb|EOA34083.1| hypothetical protein CARUB_v10021584mg [Capsella rubella]
Length=623

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 85/103 (83%), Gaps = 1/103 (1%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQ+L+PRIR  LEY  L VA+TLFCILVVMHANYVQQPGCSSEL+ 
Sbjct  1    MDPEQTFIRVQERFSQILTPRIRGFLEYTYLCVAITLFCILVVMHANYVQQPGCSSELTG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKV  613
            V++++ +++QIKITSAGLW +N+ E   VDV    + ++ L+V
Sbjct  61   VELTEAELMQIKITSAGLWSRND-ESTAVDVPQVVATTDSLEV  102



>ref|XP_010473303.1| PREDICTED: uncharacterized protein LOC104752769 [Camelina sativa]
Length=625

 Score =   139 bits (351),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQ+L+PRIR  LEY  LFVA+TLFCILVVMHANYVQQPGCSSEL+ 
Sbjct  1    MDPEQTFIRVQERFSQILTPRIRGFLEYTYLFVAITLFCILVVMHANYVQQPGCSSELTG  60

Query  485  VDISDVQIIQIKITSAGLWFQNE  553
             ++++ +++QIKITSAGLW +N+
Sbjct  61   FELTEAELMQIKITSAGLWSRND  83



>emb|CDY52486.1| BnaA01g36030D [Brassica napus]
Length=445

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQ+L+PRIRA LEY  LFVA+TLF ILVVMHANYVQQPGCSSEL+ 
Sbjct  1    MDPEQTFIRVQERFSQILNPRIRALLEYTFLFVAITLFSILVVMHANYVQQPGCSSELTG  60

Query  485  VDISDVQIIQIKITSAGLW  541
            V++S+ +++QIKITSAGLW
Sbjct  61   VELSEAELLQIKITSAGLW  79



>emb|CDY61338.1| BnaCnng37740D [Brassica napus]
Length=615

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 83/103 (81%), Gaps = 1/103 (1%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQ+L PR+R  LEY  LFVA+TLFCILVVMHANYVQQPGCSSEL+ 
Sbjct  1    MDPEQTFIRVQERFSQILKPRVRDFLEYTFLFVAITLFCILVVMHANYVQQPGCSSELTG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKV  613
            V++S+ +++ IKITSAGLW +++ E    DV   ++  + L+V
Sbjct  61   VELSEAELLHIKITSAGLWSRSD-ESTAADVPQVKAAGDNLQV  102



>ref|XP_009104283.1| PREDICTED: membralin [Brassica rapa]
Length=622

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQ+L+PRIRA LEY  LFVA+TLF ILVVMHANYVQQPGCSSEL+ 
Sbjct  1    MDPEQTFIRVQERFSQILNPRIRALLEYTFLFVAITLFSILVVMHANYVQQPGCSSELTG  60

Query  485  VDISDVQIIQIKITSAGLW  541
            V++S+ +++QIKITSAGLW
Sbjct  61   VELSEAELLQIKITSAGLW  79



>emb|CDY03777.1| BnaC01g28940D [Brassica napus]
Length=625

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTFIRVQERFSQ+L+PRIRA LEY  LFVA+TLF ILVVMHANYVQQPGCSSEL+ 
Sbjct  1    MDPEQTFIRVQERFSQILNPRIRALLEYTFLFVAITLFSILVVMHANYVQQPGCSSELTG  60

Query  485  VDISDVQIIQIKITSAGLW  541
            V++S+ +++QIKITSAGLW
Sbjct  61   VELSEAELLQIKITSAGLW  79



>gb|EPS72367.1| hypothetical protein M569_02391, partial [Genlisea aurea]
Length=568

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPE+TFIRVQERF+++LS RIR  LEYF LF+AVTLFCILVVMHANYV+QPGCS   S 
Sbjct  1    MDPEETFIRVQERFAEILSSRIRRKLEYFFLFLAVTLFCILVVMHANYVRQPGCSRAFSN  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSE  601
            V +SD Q+IQI ITSAGLW  +E+  +   V   E+  E
Sbjct  61   VQVSDAQLIQITITSAGLWVHDESPNDTAVVHDVETEKE  99



>gb|KDO53488.1| hypothetical protein CISIN_1g005878mg [Citrus sinensis]
Length=663

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 82/109 (75%), Gaps = 16/109 (15%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQ---------  457
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQ         
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQKSYAPFDLN  60

Query  458  -------PGCSSELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  583
                   PGCSSE + + +++ Q+IQIKI+SAGLW QN+++ N VDV+S
Sbjct  61   LNILLIKPGCSSEFAGIRMTEAQLIQIKISSAGLWSQNDSDSNVVDVTS  109



>ref|XP_006471108.1| PREDICTED: uncharacterized protein LOC102618114 isoform X4 [Citrus 
sinensis]
Length=646

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQPGCSSEFAG  60

Query  485  VDISDVQIIQIKITSAGL  538
            + +++ Q+IQIKI+SAG+
Sbjct  61   IRMTEAQLIQIKISSAGM  78



>gb|KDO53492.1| hypothetical protein CISIN_1g005878mg [Citrus sinensis]
Length=644

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQPGCSSEFAG  60

Query  485  VDISDVQIIQIKITSAGL  538
            + +++ Q+IQIKI+SAG+
Sbjct  61   IRMTEAQLIQIKISSAGM  78



>gb|KDO53493.1| hypothetical protein CISIN_1g005878mg [Citrus sinensis]
Length=619

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQPGCSSEFAG  60

Query  485  VDISDVQIIQIKITSAG  535
            + +++ Q+IQIKI+SAG
Sbjct  61   IRMTEAQLIQIKISSAG  77



>ref|XP_006471109.1| PREDICTED: uncharacterized protein LOC102618114 isoform X5 [Citrus 
sinensis]
Length=621

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQPGCSSEFAG  60

Query  485  VDISDVQIIQIKITSAG  535
            + +++ Q+IQIKI+SAG
Sbjct  61   IRMTEAQLIQIKISSAG  77



>ref|XP_010923767.1| PREDICTED: uncharacterized protein LOC105046754 isoform X14 [Elaeis 
guineensis]
Length=304

 Score =   120 bits (300),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 74/110 (67%), Gaps = 4/110 (4%)
 Frame = +2

Query  305  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R     SQ+L+PR R  LEY  L VAV LFC+L VMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARVSGMLSQLLTPRTRLALEYGYLAVAVALFCLLAVMHINFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKVIHV  622
            E S ++ ++ Q+IQIKI S GLW Q+  + N VD    E+ +E  K+  V
Sbjct  61   EFSGIEFTEAQLIQIKIISGGLWAQSTADQNVVDFQKHEALTENSKISEV  110



>ref|XP_010923766.1| PREDICTED: uncharacterized protein LOC105046754 isoform X13 [Elaeis 
guineensis]
Length=334

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 74/110 (67%), Gaps = 4/110 (4%)
 Frame = +2

Query  305  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R     SQ+L+PR R  LEY  L VAV LFC+L VMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARVSGMLSQLLTPRTRLALEYGYLAVAVALFCLLAVMHINFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKVIHV  622
            E S ++ ++ Q+IQIKI S GLW Q+  + N VD    E+ +E  K+  V
Sbjct  61   EFSGIEFTEAQLIQIKIISGGLWAQSTADQNVVDFQKHEALTENSKISEV  110



>ref|XP_010923765.1| PREDICTED: uncharacterized protein LOC105046754 isoform X12 [Elaeis 
guineensis]
Length=336

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 74/110 (67%), Gaps = 4/110 (4%)
 Frame = +2

Query  305  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R     SQ+L+PR R  LEY  L VAV LFC+L VMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARVSGMLSQLLTPRTRLALEYGYLAVAVALFCLLAVMHINFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKVIHV  622
            E S ++ ++ Q+IQIKI S GLW Q+  + N VD    E+ +E  K+  V
Sbjct  61   EFSGIEFTEAQLIQIKIISGGLWAQSTADQNVVDFQKHEALTENSKISEV  110



>gb|AFW68066.1| hypothetical protein ZEAMMB73_082522, partial [Zea mays]
Length=169

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 70/107 (65%), Gaps = 4/107 (4%)
 Frame = +2

Query  305  MDPEQTFIRVQERFS----QMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R S    Q+L+PRIR  LEY  L  AV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARLSGTLSQLLTPRIRLVLEYLYLAGAVALFCLLVVMHTNFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKV  613
            E S ++  + Q++QIKI S GLW      Y     + G S  +IL+V
Sbjct  61   EFSGIEFGEAQLVQIKIISGGLWSSRGASYIMDLQNLGRSAEKILEV  107



>ref|XP_010923763.1| PREDICTED: uncharacterized protein LOC105046754 isoform X10 [Elaeis 
guineensis]
Length=397

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 74/110 (67%), Gaps = 4/110 (4%)
 Frame = +2

Query  305  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R     SQ+L+PR R  LEY  L VAV LFC+L VMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARVSGMLSQLLTPRTRLALEYGYLAVAVALFCLLAVMHINFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKVIHV  622
            E S ++ ++ Q+IQIKI S GLW Q+  + N VD    E+ +E  K+  V
Sbjct  61   EFSGIEFTEAQLIQIKIISGGLWAQSTADQNVVDFQKHEALTENSKISEV  110



>ref|XP_010923762.1| PREDICTED: uncharacterized protein LOC105046754 isoform X9 [Elaeis 
guineensis]
Length=414

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 74/110 (67%), Gaps = 4/110 (4%)
 Frame = +2

Query  305  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R     SQ+L+PR R  LEY  L VAV LFC+L VMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARVSGMLSQLLTPRTRLALEYGYLAVAVALFCLLAVMHINFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKVIHV  622
            E S ++ ++ Q+IQIKI S GLW Q+  + N VD    E+ +E  K+  V
Sbjct  61   EFSGIEFTEAQLIQIKIISGGLWAQSTADQNVVDFQKHEALTENSKISEV  110



>ref|XP_010923758.1| PREDICTED: uncharacterized protein LOC105046754 isoform X5 [Elaeis 
guineensis]
Length=476

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 74/110 (67%), Gaps = 4/110 (4%)
 Frame = +2

Query  305  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R     SQ+L+PR R  LEY  L VAV LFC+L VMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARVSGMLSQLLTPRTRLALEYGYLAVAVALFCLLAVMHINFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKVIHV  622
            E S ++ ++ Q+IQIKI S GLW Q+  + N VD    E+ +E  K+  V
Sbjct  61   EFSGIEFTEAQLIQIKIISGGLWAQSTADQNVVDFQKHEALTENSKISEV  110



>ref|XP_010923759.1| PREDICTED: uncharacterized protein LOC105046754 isoform X6 [Elaeis 
guineensis]
Length=476

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 74/110 (67%), Gaps = 4/110 (4%)
 Frame = +2

Query  305  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R     SQ+L+PR R  LEY  L VAV LFC+L VMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARVSGMLSQLLTPRTRLALEYGYLAVAVALFCLLAVMHINFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKVIHV  622
            E S ++ ++ Q+IQIKI S GLW Q+  + N VD    E+ +E  K+  V
Sbjct  61   EFSGIEFTEAQLIQIKIISGGLWAQSTADQNVVDFQKHEALTENSKISEV  110



>ref|XP_010923760.1| PREDICTED: uncharacterized protein LOC105046754 isoform X7 [Elaeis 
guineensis]
Length=466

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 74/110 (67%), Gaps = 4/110 (4%)
 Frame = +2

Query  305  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R     SQ+L+PR R  LEY  L VAV LFC+L VMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARVSGMLSQLLTPRTRLALEYGYLAVAVALFCLLAVMHINFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKVIHV  622
            E S ++ ++ Q+IQIKI S GLW Q+  + N VD    E+ +E  K+  V
Sbjct  61   EFSGIEFTEAQLIQIKIISGGLWAQSTADQNVVDFQKHEALTENSKISEV  110



>gb|KJB12207.1| hypothetical protein B456_002G006000 [Gossypium raimondii]
Length=604

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 73/102 (72%), Gaps = 2/102 (2%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  484
            MDPEQTF+RVQ RFSQ+L+PR+R  LEY  LF+A+T FCILV MHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFMRVQGRFSQILTPRVRVALEYIYLFIAITSFCILVTMHANYVQQPGCSSELSG  60

Query  485  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILK  610
            +D ++VQ+IQIK      WF +     +       ++ +++K
Sbjct  61   IDSNEVQLIQIKFWLN--WFDSGARKGKSAWKFWNTDGDLIK  100



>ref|XP_010923761.1| PREDICTED: uncharacterized protein LOC105046754 isoform X8 [Elaeis 
guineensis]
Length=444

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 74/110 (67%), Gaps = 4/110 (4%)
 Frame = +2

Query  305  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R     SQ+L+PR R  LEY  L VAV LFC+L VMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARVSGMLSQLLTPRTRLALEYGYLAVAVALFCLLAVMHINFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKVIHV  622
            E S ++ ++ Q+IQIKI S GLW Q+  + N VD    E+ +E  K+  V
Sbjct  61   EFSGIEFTEAQLIQIKIISGGLWAQSTADQNVVDFQKHEALTENSKISEV  110



>ref|XP_010923757.1| PREDICTED: uncharacterized protein LOC105046754 isoform X4 [Elaeis 
guineensis]
Length=483

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 74/110 (67%), Gaps = 4/110 (4%)
 Frame = +2

Query  305  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R     SQ+L+PR R  LEY  L VAV LFC+L VMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARVSGMLSQLLTPRTRLALEYGYLAVAVALFCLLAVMHINFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKVIHV  622
            E S ++ ++ Q+IQIKI S GLW Q+  + N VD    E+ +E  K+  V
Sbjct  61   EFSGIEFTEAQLIQIKIISGGLWAQSTADQNVVDFQKHEALTENSKISEV  110



>ref|XP_010923756.1| PREDICTED: uncharacterized protein LOC105046754 isoform X3 [Elaeis 
guineensis]
Length=515

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 74/110 (67%), Gaps = 4/110 (4%)
 Frame = +2

Query  305  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R     SQ+L+PR R  LEY  L VAV LFC+L VMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARVSGMLSQLLTPRTRLALEYGYLAVAVALFCLLAVMHINFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKVIHV  622
            E S ++ ++ Q+IQIKI S GLW Q+  + N VD    E+ +E  K+  V
Sbjct  61   EFSGIEFTEAQLIQIKIISGGLWAQSTADQNVVDFQKHEALTENSKISEV  110



>ref|XP_010923755.1| PREDICTED: uncharacterized protein LOC105046754 isoform X2 [Elaeis 
guineensis]
Length=529

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 74/110 (67%), Gaps = 4/110 (4%)
 Frame = +2

Query  305  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R     SQ+L+PR R  LEY  L VAV LFC+L VMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARVSGMLSQLLTPRTRLALEYGYLAVAVALFCLLAVMHINFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKVIHV  622
            E S ++ ++ Q+IQIKI S GLW Q+  + N VD    E+ +E  K+  V
Sbjct  61   EFSGIEFTEAQLIQIKIISGGLWAQSTADQNVVDFQKHEALTENSKISEV  110



>ref|XP_010923754.1| PREDICTED: uncharacterized protein LOC105046754 isoform X1 [Elaeis 
guineensis]
Length=543

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 74/110 (67%), Gaps = 4/110 (4%)
 Frame = +2

Query  305  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R     SQ+L+PR R  LEY  L VAV LFC+L VMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARVSGMLSQLLTPRTRLALEYGYLAVAVALFCLLAVMHINFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKVIHV  622
            E S ++ ++ Q+IQIKI S GLW Q+  + N VD    E+ +E  K+  V
Sbjct  61   EFSGIEFTEAQLIQIKIISGGLWAQSTADQNVVDFQKHEALTENSKISEV  110



>gb|AAG51636.1|AC018908_2 unknown protein; 69131-60853 [Arabidopsis thaliana]
Length=974

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 75/93 (81%), Gaps = 1/93 (1%)
 Frame = +2

Query  335  QERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSKVDISDVQIIQ  514
            QERFSQ+L+PRIR  LEY  LFVA+TLFCILVVMHANYVQQPGCSSEL+ V++++ +++Q
Sbjct  413  QERFSQILTPRIRGFLEYTYLFVAITLFCILVVMHANYVQQPGCSSELTGVELAEAELMQ  472

Query  515  IKITSAGLWFQNETEYNEVDVSSGESNSEILKV  613
            IKITSAGLW +N+ E    DV    + ++ L+V
Sbjct  473  IKITSAGLWSRND-ESTAADVPRVVAATDSLEV  504



>ref|XP_008787340.1| PREDICTED: uncharacterized protein LOC103705414 isoform X2 [Phoenix 
dactylifera]
Length=629

 Score =   118 bits (295),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 75/110 (68%), Gaps = 4/110 (4%)
 Frame = +2

Query  305  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R     SQ+L+PRIR  LEY  L VAV LFC+L VMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARVSGMLSQLLTPRIRLALEYGYLAVAVALFCLLAVMHVNFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKVIHV  622
            E S V+ ++ Q++QIKI S GLW Q+  + N V+    ++ +E  K+  V
Sbjct  61   EFSGVEFTEAQLVQIKIISGGLWGQSAADRNIVEFQKQDTLTENSKIPEV  110



>dbj|BAK02995.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=308

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 69/107 (64%), Gaps = 4/107 (4%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLS----PRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R S MLS    PRIR  LEY  L  AV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARLSGMLSQLLTPRIRLALEYLYLAGAVALFCLLVVMHTNFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKV  613
            E + ++  + Q++QIKI S GLW      Y     + G S  +IL+V
Sbjct  61   EFTGIEFGEAQLVQIKIISGGLWASKGASYIMDLQNLGRSAEKILEV  107



>ref|XP_008787339.1| PREDICTED: uncharacterized protein LOC103705414 isoform X1 [Phoenix 
dactylifera]
Length=668

 Score =   118 bits (295),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 75/110 (68%), Gaps = 4/110 (4%)
 Frame = +2

Query  305  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R     SQ+L+PRIR  LEY  L VAV LFC+L VMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARVSGMLSQLLTPRIRLALEYGYLAVAVALFCLLAVMHVNFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKVIHV  622
            E S V+ ++ Q++QIKI S GLW Q+  + N V+    ++ +E  K+  V
Sbjct  61   EFSGVEFTEAQLVQIKIISGGLWGQSAADRNIVEFQKQDTLTENSKIPEV  110



>ref|XP_004982244.1| PREDICTED: uncharacterized protein LOC101752972 isoform X2 [Setaria 
italica]
Length=632

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 69/107 (64%), Gaps = 4/107 (4%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLS----PRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R S MLS    PRIR  LEY  L  AV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARLSGMLSQLLTPRIRLALEYLYLAGAVALFCLLVVMHTNFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKV  613
            E S ++  + Q++QIKI S GLW      Y     + G S  +IL+V
Sbjct  61   EFSGIEFGEAQLVQIKIISGGLWASRGASYIMDLQNLGRSAEKILEV  107



>ref|NP_001050822.1| Os03g0659900 [Oryza sativa Japonica Group]
 gb|AAS07113.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF98007.1| S3 self-incompatibility locus-linked pollen 3.15 protein, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF12736.1| Os03g0659900 [Oryza sativa Japonica Group]
Length=664

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 69/107 (64%), Gaps = 4/107 (4%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLS----PRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R S MLS    PRIR  LEY  L  AV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARLSGMLSQLLTPRIRLALEYLYLAGAVALFCLLVVMHTNFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKV  613
            E S ++  + Q++QIKI S GLW      Y     + G S  +IL+V
Sbjct  61   EFSGIEFGEAQLVQIKIISGGLWVSKGASYIMDLQNLGRSAEKILEV  107



>ref|XP_006650375.1| PREDICTED: uncharacterized protein LOC102702737 [Oryza brachyantha]
Length=660

 Score =   115 bits (287),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 69/107 (64%), Gaps = 4/107 (4%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLS----PRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R S MLS    PRIR  LEY  L  AV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARLSGMLSQLLTPRIRLALEYLYLAGAVALFCLLVVMHTNFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKV  613
            E S ++  + Q++QIKI S GLW      Y     + G S  +IL+V
Sbjct  61   EFSGIEFGEAQLVQIKIISGGLWVSKGASYIMDLQNLGRSAEKILEV  107



>ref|XP_010231807.1| PREDICTED: uncharacterized protein LOC100825172 isoform X2 [Brachypodium 
distachyon]
Length=634

 Score =   114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 69/107 (64%), Gaps = 4/107 (4%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLS----PRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R S MLS    PRIR  LEY  L  AV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARLSGMLSQLLTPRIRLALEYLYLAGAVALFCLLVVMHTNFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKV  613
            E S ++  + Q++QIKI S GLW      Y     + G S  +IL+V
Sbjct  61   EFSGIEFGEAQLVQIKIISGGLWASKGASYIMDLQNLGRSAEKILEV  107



>ref|XP_003561560.1| PREDICTED: uncharacterized protein LOC100825172 isoform X1 [Brachypodium 
distachyon]
Length=665

 Score =   115 bits (287),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 69/107 (64%), Gaps = 4/107 (4%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLS----PRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R S MLS    PRIR  LEY  L  AV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARLSGMLSQLLTPRIRLALEYLYLAGAVALFCLLVVMHTNFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKV  613
            E S ++  + Q++QIKI S GLW      Y     + G S  +IL+V
Sbjct  61   EFSGIEFGEAQLVQIKIISGGLWASKGASYIMDLQNLGRSAEKILEV  107



>gb|EEC75863.1| hypothetical protein OsI_12877 [Oryza sativa Indica Group]
Length=713

 Score =   115 bits (287),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 69/107 (64%), Gaps = 4/107 (4%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLS----PRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R S MLS    PRIR  LEY  L  AV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARLSGMLSQLLTPRIRLALEYLYLAGAVALFCLLVVMHTNFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKV  613
            E S ++  + Q++QIKI S GLW      Y     + G S  +IL+V
Sbjct  61   EFSGIEFGEAQLVQIKIISGGLWVSKGASYIMDLQNLGRSAEKILEV  107



>ref|XP_004982243.1| PREDICTED: uncharacterized protein LOC101752972 isoform X1 [Setaria 
italica]
Length=663

 Score =   114 bits (286),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 69/107 (64%), Gaps = 4/107 (4%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLS----PRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R S MLS    PRIR  LEY  L  AV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARLSGMLSQLLTPRIRLALEYLYLAGAVALFCLLVVMHTNFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKV  613
            E S ++  + Q++QIKI S GLW      Y     + G S  +IL+V
Sbjct  61   EFSGIEFGEAQLVQIKIISGGLWASRGASYIMDLQNLGRSAEKILEV  107



>ref|XP_002464124.1| hypothetical protein SORBIDRAFT_01g012790 [Sorghum bicolor]
 gb|EER91122.1| hypothetical protein SORBIDRAFT_01g012790 [Sorghum bicolor]
Length=662

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 70/107 (65%), Gaps = 4/107 (4%)
 Frame = +2

Query  305  MDPEQTFIRVQERFS----QMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R S    Q+L+PRIR  LEY  L  AV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARLSGTLSQLLTPRIRLALEYLYLAGAVALFCLLVVMHTNFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKV  613
            E S ++  + Q++QIKI S GLW      Y     + G S  +IL+V
Sbjct  61   EFSGIEFGEAQLVQIKIISGGLWSSRGASYIMDLQNLGRSAEKILEV  107



>gb|EMS54971.1| hypothetical protein TRIUR3_11843 [Triticum urartu]
Length=667

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 69/107 (64%), Gaps = 4/107 (4%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLS----PRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R S MLS    PRIR  LEY  L  AV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARLSGMLSQLLTPRIRLALEYLYLAGAVALFCLLVVMHTNFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKV  613
            E + ++  + Q++QIKI S GLW      Y     + G S  +IL+V
Sbjct  61   EFTGIEFGEAQLVQIKIISGGLWASKGASYIMDLQNLGRSAEKILEV  107



>ref|XP_010942375.1| PREDICTED: uncharacterized protein LOC105060393 [Elaeis guineensis]
Length=666

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 66/94 (70%), Gaps = 4/94 (4%)
 Frame = +2

Query  305  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MD EQTF+RV  R     SQ+L+PRIR  LEY  L VAV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDTEQTFLRVHARVSGMLSQLLTPRIRLALEYGYLAVAVALFCLLVVMHTNFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVD  574
            E S ++ ++ Q++ IKI S GLW Q   + N VD
Sbjct  61   EFSGIEFTEAQLVHIKIISGGLWAQTAADQNIVD  94



>gb|EEE59630.1| hypothetical protein OsJ_11978 [Oryza sativa Japonica Group]
Length=996

 Score =   114 bits (286),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 57/107 (53%), Positives = 70/107 (65%), Gaps = 4/107 (4%)
 Frame = +2

Query  305  MDPEQTFIRVQERFS----QMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R S    Q+L+PRIR  LEY  L  AV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARLSGMLSQLLTPRIRLALEYLYLAGAVALFCLLVVMHTNFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKV  613
            E S ++  + Q++QIKI S GLW      Y     + G S  +IL+V
Sbjct  61   EFSGIEFGEAQLVQIKIISGGLWVSKGASYIMDLQNLGRSAEKILEV  107



>ref|XP_008782691.1| PREDICTED: uncharacterized protein LOC103702156 [Phoenix dactylifera]
Length=668

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 74/109 (68%), Gaps = 6/109 (6%)
 Frame = +2

Query  305  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MD EQTF+RV  R     SQ+L+PRIR  LEY  L VAV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDTEQTFLRVHARVSGMLSQLLTPRIRLALEYGYLAVAVALFCLLVVMHTNFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGES--NSEILKV  613
            E S ++ ++ Q++ IKI S GLW Q+  + N V+     S  NS+I +V
Sbjct  61   EFSGIEFNEAQLVHIKIMSGGLWAQSAADQNIVNFQQETSTENSKIPEV  109



>ref|XP_010231815.1| PREDICTED: uncharacterized protein LOC100825172 isoform X3 [Brachypodium 
distachyon]
Length=590

 Score =   112 bits (279),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 61/83 (73%), Gaps = 4/83 (5%)
 Frame = +2

Query  305  MDPEQTFIRVQERFS----QMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R S    Q+L+PRIR  LEY  L  AV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARLSGMLSQLLTPRIRLALEYLYLAGAVALFCLLVVMHTNFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLW  541
            E S ++  + Q++QIKI S GLW
Sbjct  61   EFSGIEFGEAQLVQIKIISGGLW  83



>gb|EMT20955.1| hypothetical protein F775_05632 [Aegilops tauschii]
Length=890

 Score =   112 bits (280),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 56/107 (52%), Positives = 70/107 (65%), Gaps = 4/107 (4%)
 Frame = +2

Query  305  MDPEQTFIRVQERFS----QMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R S    Q+L+PRIR  LEY  L  AV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARLSGMLSQLLTPRIRLALEYLYLAGAVALFCLLVVMHTNFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILKV  613
            E + ++  + Q++QIKI S GLW      Y     + G S  +IL+V
Sbjct  61   EFTGIEFGEAQLVQIKIISGGLWASKGASYIMDLQNLGRSAEKILEV  107



>ref|XP_009387979.1| PREDICTED: uncharacterized protein LOC103974813 [Musa acuminata 
subsp. malaccensis]
Length=647

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 63/98 (64%), Gaps = 4/98 (4%)
 Frame = +2

Query  305  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPE TF+RV  R     SQ+L PR+R  LEY  L  A  LFC+LV+MH N+VQQPGCS 
Sbjct  1    MDPEHTFLRVHARVSGSLSQLLGPRVRLMLEYACLAAAGALFCLLVIMHINFVQQPGCSR  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSG  586
            E S ++ ++ Q++QIKIT  GLW Q+  E   V    G
Sbjct  61   EFSGLEFTEAQVVQIKITGGGLWTQSSAETERVSFQKG  98



>gb|AFW68067.1| hypothetical protein ZEAMMB73_082522 [Zea mays]
Length=96

 Score =   101 bits (252),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 57/77 (74%), Gaps = 4/77 (5%)
 Frame = +2

Query  305  MDPEQTFIRVQERFS----QMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R S    Q+L+PRIR  LEY  L  AV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARLSGTLSQLLTPRIRLVLEYLYLAGAVALFCLLVVMHTNFVQQPGCSS  60

Query  473  ELSKVDISDVQIIQIKI  523
            E S ++  + Q++QIK+
Sbjct  61   EFSGIEFGEAQLVQIKV  77



>gb|ACN39930.1| unknown [Picea sitchensis]
Length=767

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 71/99 (72%), Gaps = 6/99 (6%)
 Frame = +2

Query  305  MDPEQTFIRVQERFS----QMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDP+ TF+RV  R S    Q+L+PRIR++LEY  L VA+ L  IL VMH N+V QPGC++
Sbjct  1    MDPQHTFLRVHARLSGMLAQLLTPRIRSSLEYASLGVAIVLLGILTVMHVNFVAQPGCAN  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGE  589
            ELS  +IS+ Q++QIKITS+ LW Q  TE +E   S+GE
Sbjct  61   ELSGSNISESQLVQIKITSSRLWSQTFTELSE--TSAGE  97



>ref|XP_006853401.1| hypothetical protein AMTR_s00032p00148750 [Amborella trichopoda]
 gb|ERN14868.1| hypothetical protein AMTR_s00032p00148750 [Amborella trichopoda]
Length=573

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +2

Query  341  RFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSKVDISDVQIIQIK  520
            + SQ+L PRIR  LEY  L VA  LFC+LVVMH N+V QPGCSSELS  +I +  ++QIK
Sbjct  12   KLSQLLKPRIRVALEYVFLVVAFALFCLLVVMHTNFVAQPGCSSELSGPEILEAHLVQIK  71

Query  521  ITSAGLW  541
            ITSAGLW
Sbjct  72   ITSAGLW  78



>gb|AAQ09998.1| S2 self-incompatibility locus-linked pollen 3.15 protein [Petunia 
integrifolia subsp. inflata]
Length=610

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  431  VMHANYVQQPGCSSELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILK  610
            VMHANYVQQPGCSSELS+V+I + Q+IQIKITSAGLW QN+  Y+ VDV++ E  SE LK
Sbjct  1    VMHANYVQQPGCSSELSRVNIMEAQLIQIKITSAGLWSQNQPNYDVVDVANKEPFSENLK  60



>gb|AAQ09997.1| S1 self-incompatibility locus-linked pollen 3.15 protein [Petunia 
integrifolia subsp. inflata]
Length=610

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +2

Query  431  VMHANYVQQPGCSSELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGESNSEILK  610
            VMHANYVQQPGCSSELSKV I + Q+IQIKIT AGLW QN+  Y+ V+V++ E  SE LK
Sbjct  1    VMHANYVQQPGCSSELSKVTIMEAQLIQIKITRAGLWSQNQPNYDVVNVANKEPFSENLK  60



>ref|XP_002970045.1| hypothetical protein SELMODRAFT_440969 [Selaginella moellendorffii]
 gb|EFJ29169.1| hypothetical protein SELMODRAFT_440969 [Selaginella moellendorffii]
Length=646

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 59/90 (66%), Gaps = 6/90 (7%)
 Frame = +2

Query  305  MDPEQTFIRVQERFS----QMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R S    ++L+PR R  LEY  LF AV L  +LVVMH N+V QPGC++
Sbjct  1    MDPEQTFLRVHARLSGVLARLLTPRFRTVLEYLCLFNAVVLLALLVVMHVNFVAQPGCAT  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEY  562
            E      SD Q+IQ+KIT +   F+ + ++
Sbjct  61   EFHAA--SDAQLIQVKITGSSRAFEEQHQF  88



>ref|XP_002985235.1| hypothetical protein SELMODRAFT_446163 [Selaginella moellendorffii]
 gb|EFJ13729.1| hypothetical protein SELMODRAFT_446163 [Selaginella moellendorffii]
Length=681

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 59/90 (66%), Gaps = 6/90 (7%)
 Frame = +2

Query  305  MDPEQTFIRVQERFS----QMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDPEQTF+RV  R S    ++L+PR R  LEY  LF AV L  +LVVMH N+V QPGC++
Sbjct  1    MDPEQTFLRVHARLSGVLARLLTPRFRTVLEYLCLFNAVVLLALLVVMHVNFVAQPGCAA  60

Query  473  ELSKVDISDVQIIQIKITSAGLWFQNETEY  562
            E      SD Q+IQ+KIT +   F+ + ++
Sbjct  61   EFRAA--SDAQLIQVKITGSSRAFEEQHQF  88



>gb|KEH36424.1| S3 self-incompatibility locus-linked pollen 3.15 protein [Medicago 
truncatula]
Length=630

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +2

Query  455  QPGCSSELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSGES  592
            +PGCSSELS V  SD Q+IQIKITSAGLW+ N++E N +D    E+
Sbjct  6    KPGCSSELSGVLTSDAQLIQIKITSAGLWYHNDSEPNIIDPPDTEA  51



>gb|ABK24891.1| unknown [Picea sitchensis]
Length=270

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 50/88 (57%), Gaps = 17/88 (19%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLS----PRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCS-  469
            MDP  TF+RV  R S ML+    PR R++L      +A+ L  +L VMH N+V Q G + 
Sbjct  1    MDPHHTFLRVHARLSGMLAQLLMPRNRSSLR-----LAIVLLGVLTVMHVNFVAQAGYAN  55

Query  470  -------SELSKVDISDVQIIQIKITSA  532
                   +ELS  +IS+ Q++QIK+  A
Sbjct  56   ELSGSNFNELSGSNISESQLLQIKLGYA  83



>gb|ABK23338.1| unknown [Picea sitchensis]
Length=270

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 50/88 (57%), Gaps = 17/88 (19%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLS----PRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  472
            MDP  TF+RV  RFS ML+    PR R++L      +A+ L  +L VMH N++ Q G ++
Sbjct  1    MDPHHTFLRVHVRFSGMLAQLLMPRNRSSLR-----LAIVLLGVLTVMHVNFIAQAGYAN  55

Query  473  ELS--------KVDISDVQIIQIKITSA  532
            ELS          +IS+ Q+ QIK+  A
Sbjct  56   ELSGSNFNELLGSNISESQLPQIKLGYA  83



>gb|ACN41062.1| unknown [Picea sitchensis]
Length=280

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 50/88 (57%), Gaps = 17/88 (19%)
 Frame = +2

Query  305  MDPEQTFIRVQERFSQMLS----PRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCS-  469
            MDP  TF+RV  R S ML+    PR R++L      +A+ L  +L VMH N+V Q G + 
Sbjct  1    MDPHHTFLRVHARLSGMLAQLLMPRNRSSLR-----LAIVLLGVLTVMHVNFVAQVGYAN  55

Query  470  -------SELSKVDISDVQIIQIKITSA  532
                   +ELS  +IS+ Q++QIK+  A
Sbjct  56   ELSGSNFNELSGSNISESQLLQIKLGYA  83



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380