BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS010H04

Length=631
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010661063.1|  PREDICTED: methyl-CpG-binding domain-contain...    124   1e-29   Vitis vinifera
ref|XP_010661055.1|  PREDICTED: methyl-CpG-binding domain-contain...    124   1e-29   Vitis vinifera
ref|XP_010661051.1|  PREDICTED: methyl-CpG-binding domain-contain...    124   1e-29   Vitis vinifera
ref|XP_002509754.1|  hypothetical protein RCOM_1685990                  126   2e-29   
gb|KDP25474.1|  hypothetical protein JCGZ_20630                         125   6e-29   Jatropha curcas
emb|CBI34715.3|  unnamed protein product                                125   7e-29   Vitis vinifera
ref|XP_011072312.1|  PREDICTED: uncharacterized protein LOC105157...    119   2e-27   Sesamum indicum [beniseed]
ref|XP_011072316.1|  PREDICTED: uncharacterized protein LOC105157...    119   2e-27   Sesamum indicum [beniseed]
ref|XP_008796740.1|  PREDICTED: uncharacterized protein LOC103712...    119   3e-27   Phoenix dactylifera
ref|XP_008796735.1|  PREDICTED: uncharacterized protein LOC103712...    119   4e-27   Phoenix dactylifera
ref|XP_008796737.1|  PREDICTED: uncharacterized protein LOC103712...    119   4e-27   Phoenix dactylifera
emb|CBI31785.3|  unnamed protein product                                116   2e-26   Vitis vinifera
ref|XP_004143925.1|  PREDICTED: uncharacterized protein LOC101223188    117   2e-26   Cucumis sativus [cucumbers]
ref|XP_010662494.1|  PREDICTED: uncharacterized protein LOC100263...    116   2e-26   Vitis vinifera
ref|XP_008796736.1|  PREDICTED: uncharacterized protein LOC103712...    115   5e-26   Phoenix dactylifera
ref|XP_008238911.1|  PREDICTED: uncharacterized protein LOC103337528    115   5e-26   
ref|XP_008796741.1|  PREDICTED: uncharacterized protein LOC103712...    115   5e-26   Phoenix dactylifera
ref|XP_008796738.1|  PREDICTED: uncharacterized protein LOC103712...    115   5e-26   Phoenix dactylifera
ref|XP_007158476.1|  hypothetical protein PHAVU_002G155600g             116   6e-26   Phaseolus vulgaris [French bean]
ref|XP_007158478.1|  hypothetical protein PHAVU_002G155600g             116   6e-26   Phaseolus vulgaris [French bean]
ref|XP_007158477.1|  hypothetical protein PHAVU_002G155600g             116   6e-26   Phaseolus vulgaris [French bean]
ref|XP_007158475.1|  hypothetical protein PHAVU_002G155600g             116   7e-26   Phaseolus vulgaris [French bean]
gb|KDO55595.1|  hypothetical protein CISIN_1g0013392mg                  110   1e-25   Citrus sinensis [apfelsine]
gb|KDO55594.1|  hypothetical protein CISIN_1g0013392mg                  110   1e-25   Citrus sinensis [apfelsine]
ref|XP_008437229.1|  PREDICTED: transcriptional regulator ATRX ho...    114   1e-25   Cucumis melo [Oriental melon]
ref|XP_002276814.3|  PREDICTED: methyl-CpG-binding domain-contain...    112   1e-25   Vitis vinifera
gb|KJB39637.1|  hypothetical protein B456_007G022700                    115   1e-25   Gossypium raimondii
gb|KDO55591.1|  hypothetical protein CISIN_1g0013392mg                  110   2e-25   Citrus sinensis [apfelsine]
ref|XP_008351681.1|  PREDICTED: uncharacterized protein LOC103415104    112   6e-25   
ref|XP_011463824.1|  PREDICTED: uncharacterized protein LOC101312...    112   9e-25   Fragaria vesca subsp. vesca
ref|XP_006440582.1|  hypothetical protein CICLE_v10018609mg             112   1e-24   Citrus clementina [clementine]
ref|XP_008392616.1|  PREDICTED: uncharacterized protein LOC103454798    112   1e-24   
ref|XP_006440581.1|  hypothetical protein CICLE_v10018609mg             112   1e-24   Citrus clementina [clementine]
ref|XP_006440583.1|  hypothetical protein CICLE_v10018609mg             112   1e-24   
ref|XP_010918514.1|  PREDICTED: methyl-CpG-binding domain-contain...    109   2e-24   
ref|XP_010273135.1|  PREDICTED: methyl-CpG-binding domain-contain...    110   2e-24   Nelumbo nucifera [Indian lotus]
ref|XP_010934846.1|  PREDICTED: uncharacterized protein LOC105054...    111   2e-24   Elaeis guineensis
ref|XP_010918513.1|  PREDICTED: methyl-CpG-binding domain-contain...    109   2e-24   
ref|XP_006477436.1|  PREDICTED: uncharacterized protein LOC102622266    110   5e-24   
ref|XP_007040167.1|  Uncharacterized protein TCM_016211                 110   7e-24   
gb|KEH21030.1|  methyl-CpG-binding domain protein                       110   1e-23   Medicago truncatula
ref|XP_008437227.1|  PREDICTED: uncharacterized protein LOC103482...    107   3e-23   Cucumis melo [Oriental melon]
ref|XP_008437228.1|  PREDICTED: uncharacterized protein LOC103482...    107   3e-23   Cucumis melo [Oriental melon]
ref|XP_009375788.1|  PREDICTED: methyl-CpG-binding domain-contain...    108   4e-23   Pyrus x bretschneideri [bai li]
ref|XP_009375787.1|  PREDICTED: uncharacterized protein LOC103964...    108   4e-23   
ref|XP_011463825.1|  PREDICTED: uncharacterized protein LOC101312...    108   5e-23   Fragaria vesca subsp. vesca
ref|XP_004503754.1|  PREDICTED: uncharacterized protein LOC101511357    108   5e-23   Cicer arietinum [garbanzo]
emb|CDP05220.1|  unnamed protein product                                105   6e-23   Coffea canephora [robusta coffee]
ref|XP_006358896.1|  PREDICTED: uncharacterized protein LOC102587...    107   8e-23   Solanum tuberosum [potatoes]
ref|XP_007038658.1|  Methyl-CPG-binding domain protein 13, putati...    106   8e-23   
ref|XP_007038659.1|  Methyl-CPG-binding domain protein 13, putati...    106   1e-22   
ref|XP_010325421.1|  PREDICTED: uncharacterized protein LOC101264...    107   1e-22   Solanum lycopersicum
ref|XP_008791903.1|  PREDICTED: uncharacterized protein LOC103708650    103   4e-22   Phoenix dactylifera
ref|XP_009369054.1|  PREDICTED: uncharacterized protein LOC103958513    103   1e-21   
ref|XP_006358895.1|  PREDICTED: uncharacterized protein LOC102587...    103   1e-21   Solanum tuberosum [potatoes]
ref|XP_006590528.1|  PREDICTED: methyl-CpG-binding domain-contain...  97.4    1e-21   
gb|KJB52811.1|  hypothetical protein B456_008G278300                    100   1e-20   Gossypium raimondii
gb|KHG28622.1|  Methyl-CpG-binding domain-containing 13 -like pro...  99.8    2e-20   Gossypium arboreum [tree cotton]
ref|XP_009401688.1|  PREDICTED: uncharacterized protein LOC103985...  99.4    2e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010676507.1|  PREDICTED: uncharacterized protein LOC104892...  98.2    1e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010676508.1|  PREDICTED: uncharacterized protein LOC104892...  97.8    1e-19   
ref|XP_010676506.1|  PREDICTED: uncharacterized protein LOC104892...  97.4    2e-19   Beta vulgaris subsp. vulgaris [field beet]
gb|EMS68477.1|  hypothetical protein TRIUR3_20569                     94.0    2e-18   Triticum urartu
ref|XP_008234128.1|  PREDICTED: methyl-CpG-binding domain-contain...  92.8    3e-18   Prunus mume [ume]
ref|XP_007152298.1|  hypothetical protein PHAVU_004G117900g           92.8    3e-18   Phaseolus vulgaris [French bean]
gb|EEC76899.1|  hypothetical protein OsI_15124                        90.5    5e-18   Oryza sativa Indica Group [Indian rice]
ref|NP_001052334.1|  Os04g0266400                                     90.1    5e-18   
emb|CAD39968.2|  OSJNBa0072D08.3                                      91.7    6e-18   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66253.1|  OSIGBa0139I12.2                                      91.7    6e-18   Oryza sativa [red rice]
dbj|BAG89597.1|  unnamed protein product                              91.3    1e-17   Oryza sativa Japonica Group [Japonica rice]
gb|EMT22364.1|  hypothetical protein F775_06449                       91.3    1e-17   
ref|XP_009390529.1|  PREDICTED: uncharacterized protein LOC103976...  90.9    1e-17   
ref|XP_003581103.2|  PREDICTED: uncharacterized protein LOC100844...  90.5    2e-17   Brachypodium distachyon [annual false brome]
ref|XP_009390518.1|  PREDICTED: uncharacterized protein LOC103976...  90.5    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390512.1|  PREDICTED: uncharacterized protein LOC103976...  90.5    2e-17   
gb|KJB39638.1|  hypothetical protein B456_007G022700                  90.9    2e-17   Gossypium raimondii
ref|XP_004977782.1|  PREDICTED: uncharacterized protein LOC101761695  89.7    3e-17   
ref|XP_009418270.1|  PREDICTED: uncharacterized protein LOC103998...  86.7    5e-17   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN16846.1|  Methyl-CpG-binding domain-containing protein 13       89.7    8e-17   Glycine soja [wild soybean]
ref|NP_001159179.1|  uncharacterized protein LOC100304264             87.4    8e-17   
ref|XP_003532403.1|  PREDICTED: methyl-CpG-binding domain-contain...  89.7    8e-17   Glycine max [soybeans]
ref|XP_008439211.1|  PREDICTED: methyl-CpG-binding domain-contain...  84.3    1e-16   Cucumis melo [Oriental melon]
gb|EYU25079.1|  hypothetical protein MIMGU_mgv11b021680mg             86.3    1e-16   Erythranthe guttata [common monkey flower]
ref|XP_006353332.1|  PREDICTED: methyl-CpG-binding domain-contain...  88.2    1e-16   Solanum tuberosum [potatoes]
ref|XP_004234378.1|  PREDICTED: methyl-CpG-binding domain-contain...  87.8    2e-16   Solanum lycopersicum
ref|XP_006653226.1|  PREDICTED: uncharacterized protein LOC102699500  87.8    2e-16   
ref|XP_002510809.1|  conserved hypothetical protein                   88.2    2e-16   
gb|AFW57954.1|  methyl-binding domain MBD113 protein                  87.0    2e-16   
ref|XP_008662320.1|  PREDICTED: LOC542207 isoform X3                  87.0    2e-16   Zea mays [maize]
ref|XP_008439209.1|  PREDICTED: methyl-CpG-binding domain-contain...  84.3    3e-16   Cucumis melo [Oriental melon]
ref|XP_008662316.1|  PREDICTED: LOC542207 isoform X1                  87.0    3e-16   
ref|XP_011030071.1|  PREDICTED: methyl-CpG-binding domain-contain...  87.0    4e-16   Populus euphratica
ref|XP_011030070.1|  PREDICTED: methyl-CpG-binding domain-contain...  87.0    4e-16   Populus euphratica
ref|XP_008662319.1|  PREDICTED: LOC542207 isoform X2                  86.3    5e-16   Zea mays [maize]
ref|XP_008378256.1|  PREDICTED: uncharacterized protein LOC103441353  87.0    5e-16   
ref|XP_006580605.1|  PREDICTED: uncharacterized protein LOC100782433  87.0    5e-16   Glycine max [soybeans]
ref|XP_011030072.1|  PREDICTED: methyl-CpG-binding domain-contain...  86.7    6e-16   Populus euphratica
ref|XP_011041593.1|  PREDICTED: uncharacterized protein LOC105137...  86.7    6e-16   Populus euphratica
gb|KHN23667.1|  Methyl-CpG-binding domain-containing protein 13       87.0    6e-16   Glycine soja [wild soybean]
ref|XP_011041595.1|  PREDICTED: uncharacterized protein LOC105137...  86.7    6e-16   Populus euphratica
ref|XP_011048654.1|  PREDICTED: methyl-CpG-binding domain-contain...  86.7    6e-16   Populus euphratica
ref|XP_011041590.1|  PREDICTED: uncharacterized protein LOC105137...  86.7    7e-16   Populus euphratica
ref|XP_011041592.1|  PREDICTED: uncharacterized protein LOC105137...  86.7    7e-16   Populus euphratica
ref|XP_011048657.1|  PREDICTED: uncharacterized protein LOC105142...  86.7    7e-16   Populus euphratica
ref|XP_011048652.1|  PREDICTED: methyl-CpG-binding domain-contain...  86.7    7e-16   Populus euphratica
ref|XP_011012359.1|  PREDICTED: methyl-CpG-binding domain-contain...  86.7    7e-16   Populus euphratica
ref|XP_011012358.1|  PREDICTED: methyl-CpG-binding domain-contain...  86.3    8e-16   Populus euphratica
ref|XP_011012360.1|  PREDICTED: methyl-CpG-binding domain-contain...  86.3    9e-16   Populus euphratica
ref|XP_011076193.1|  PREDICTED: methyl-CpG-binding domain-contain...  85.5    1e-15   
emb|CDP09782.1|  unnamed protein product                              85.5    2e-15   Coffea canephora [robusta coffee]
gb|KHN31504.1|  Methyl-CpG-binding domain-containing protein 13       84.7    2e-15   Glycine soja [wild soybean]
ref|XP_007160033.1|  hypothetical protein PHAVU_002G287000g           85.5    2e-15   Phaseolus vulgaris [French bean]
ref|XP_009595657.1|  PREDICTED: methyl-CpG-binding domain-contain...  84.3    3e-15   Nicotiana tomentosiformis
ref|XP_009589209.1|  PREDICTED: uncharacterized protein LOC104086...  85.1    3e-15   Nicotiana tomentosiformis
ref|XP_008439210.1|  PREDICTED: methyl-CpG-binding domain-contain...  80.1    5e-15   
ref|XP_009782391.1|  PREDICTED: uncharacterized protein LOC104231...  84.0    7e-15   Nicotiana sylvestris
ref|XP_009782390.1|  PREDICTED: uncharacterized protein LOC104231...  84.0    7e-15   Nicotiana sylvestris
ref|XP_009782392.1|  PREDICTED: uncharacterized protein LOC104231...  84.0    7e-15   Nicotiana sylvestris
ref|XP_009589208.1|  PREDICTED: uncharacterized protein LOC104086...  84.0    8e-15   Nicotiana tomentosiformis
gb|EMT21477.1|  hypothetical protein F775_23896                       82.0    9e-15   
ref|XP_006664919.1|  PREDICTED: uncharacterized protein LOC102722078  80.1    9e-15   
ref|XP_011048653.1|  PREDICTED: methyl-CpG-binding domain-contain...  83.2    9e-15   Populus euphratica
ref|XP_011041591.1|  PREDICTED: uncharacterized protein LOC105137...  83.2    9e-15   Populus euphratica
ref|XP_004245626.1|  PREDICTED: uncharacterized protein LOC101264...  83.6    1e-14   Solanum lycopersicum
ref|XP_010325420.1|  PREDICTED: uncharacterized protein LOC101264...  83.6    1e-14   Solanum lycopersicum
ref|XP_009401689.1|  PREDICTED: uncharacterized protein LOC103985...  82.0    1e-14   
emb|CAN74037.1|  hypothetical protein VITISV_023406                   82.4    2e-14   Vitis vinifera
ref|XP_006358894.1|  PREDICTED: uncharacterized protein LOC102587...  82.4    2e-14   Solanum tuberosum [potatoes]
ref|XP_009760427.1|  PREDICTED: methyl-CpG-binding domain-contain...  80.5    4e-14   Nicotiana sylvestris
ref|XP_008796742.1|  PREDICTED: uncharacterized protein LOC103712...  80.9    4e-14   Phoenix dactylifera
gb|EEC83090.1|  hypothetical protein OsI_28224                        79.7    9e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_002321896.2|  hypothetical protein POPTR_0015s13470g           80.1    1e-13   Populus trichocarpa [western balsam poplar]
ref|XP_002318826.1|  hypothetical protein POPTR_0012s13490g           79.7    1e-13   
gb|EEE68228.1|  hypothetical protein OsJ_26412                        79.7    1e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006827729.1|  hypothetical protein AMTR_s00009p00261370        79.7    1e-13   Amborella trichopoda
ref|XP_009371320.1|  PREDICTED: methyl-CpG-binding domain-contain...  79.0    2e-13   Pyrus x bretschneideri [bai li]
ref|XP_011084407.1|  PREDICTED: methyl-CpG-binding domain-contain...  78.6    2e-13   Sesamum indicum [beniseed]
ref|XP_009371318.1|  PREDICTED: methyl-CpG-binding domain-contain...  79.0    2e-13   Pyrus x bretschneideri [bai li]
gb|AFW57951.1|  methyl-binding domain MBD113 protein                  78.2    2e-13   
ref|NP_001061241.1|  Os08g0206700                                     77.4    3e-13   
gb|EYU38370.1|  hypothetical protein MIMGU_mgv1a007205mg              77.4    3e-13   Erythranthe guttata [common monkey flower]
ref|XP_004982529.1|  PREDICTED: uncharacterized protein LOC101763097  76.6    3e-13   
ref|XP_006653233.1|  PREDICTED: uncharacterized protein LOC102703961  75.5    4e-13   
gb|EAY93364.1|  hypothetical protein OsI_15161                        75.9    5e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_008376557.1|  PREDICTED: methyl-CpG-binding domain-contain...  77.4    5e-13   
ref|XP_002466890.1|  hypothetical protein SORBIDRAFT_01g015930        75.1    6e-13   
ref|XP_008796743.1|  PREDICTED: uncharacterized protein LOC103712...  77.4    6e-13   Phoenix dactylifera
emb|CAH67925.1|  OSIGBa0138E08-OSIGBa0161L23.6                        75.9    9e-13   Oryza sativa [red rice]
emb|CAD39866.2|  OSJNBb0058J09.3                                      75.9    1e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006659212.1|  PREDICTED: uncharacterized protein LOC102718198  77.0    1e-12   Oryza brachyantha
dbj|BAA89308.1|  AHM2                                                 75.1    1e-12   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004972592.1|  PREDICTED: methyl-CpG-binding domain-contain...  75.9    2e-12   Setaria italica
ref|XP_008665005.1|  PREDICTED: uncharacterized protein LOC103643620  73.9    3e-12   
ref|XP_002447565.1|  hypothetical protein SORBIDRAFT_06g004050        72.8    4e-12   
tpg|DAA50117.1|  TPA: hypothetical protein ZEAMMB73_042225            72.8    6e-12   
ref|XP_008367419.1|  PREDICTED: uncharacterized protein LOC103431052  74.7    7e-12   
ref|XP_009418271.1|  PREDICTED: uncharacterized protein LOC103998...  71.2    8e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002461981.1|  hypothetical protein SORBIDRAFT_02g011480        71.2    9e-12   
ref|XP_002444304.1|  hypothetical protein SORBIDRAFT_07g019900        72.0    1e-11   
ref|XP_002444023.1|  hypothetical protein SORBIDRAFT_07g006030        73.9    1e-11   Sorghum bicolor [broomcorn]
ref|XP_007211158.1|  hypothetical protein PRUPE_ppa027142mg           73.6    1e-11   
gb|KDO60033.1|  hypothetical protein CISIN_1g008463mg                 72.8    1e-11   Citrus sinensis [apfelsine]
emb|CAE04540.2|  OSJNBa0040D17.8                                      72.4    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006490367.1|  PREDICTED: methyl-CpG-binding domain-contain...  72.8    2e-11   Citrus sinensis [apfelsine]
gb|KDO60032.1|  hypothetical protein CISIN_1g008463mg                 72.8    2e-11   Citrus sinensis [apfelsine]
ref|XP_006421896.1|  hypothetical protein CICLE_v10004647mg           72.8    2e-11   Citrus clementina [clementine]
ref|XP_010035118.1|  PREDICTED: methyl-CpG-binding domain-contain...  73.2    2e-11   Eucalyptus grandis [rose gum]
ref|XP_010035117.1|  PREDICTED: uncharacterized protein LOC104424...  73.2    2e-11   Eucalyptus grandis [rose gum]
gb|EAZ29862.1|  hypothetical protein OsJ_13921                        72.0    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008678194.1|  PREDICTED: uncharacterized protein LOC103652994  72.8    2e-11   Zea mays [maize]
tpg|DAA59672.1|  TPA: hypothetical protein ZEAMMB73_581852            71.6    2e-11   
gb|EMS57086.1|  Methyl-CpG-binding domain-containing protein 13       72.8    2e-11   Triticum urartu
gb|AFW61002.1|  hypothetical protein ZEAMMB73_269384                  72.8    2e-11   
ref|XP_008662741.1|  PREDICTED: uncharacterized protein LOC103641...  72.8    3e-11   Zea mays [maize]
ref|XP_008662742.1|  PREDICTED: uncharacterized protein LOC103641...  72.8    3e-11   Zea mays [maize]
gb|EMT07793.1|  hypothetical protein F775_13908                       72.8    3e-11   
ref|XP_003572272.2|  PREDICTED: uncharacterized protein LOC100826562  70.9    3e-11   Brachypodium distachyon [annual false brome]
gb|AFW80349.1|  hypothetical protein ZEAMMB73_827373                  71.2    4e-11   
gb|EEC76836.1|  hypothetical protein OsI_14986                        69.3    4e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_010662495.1|  PREDICTED: uncharacterized protein LOC100263...  71.6    5e-11   Vitis vinifera
gb|EMT08445.1|  hypothetical protein F775_07512                       69.3    5e-11   
gb|EEE60561.1|  hypothetical protein OsJ_13923                        70.1    5e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002444202.1|  hypothetical protein SORBIDRAFT_07g014920        70.1    6e-11   
emb|CAH67758.1|  H0124E07.5                                           70.1    6e-11   Oryza sativa [red rice]
ref|XP_010934848.1|  PREDICTED: uncharacterized protein LOC105054...  71.2    6e-11   Elaeis guineensis
ref|XP_010255467.1|  PREDICTED: uncharacterized protein LOC104596...  70.9    8e-11   Nelumbo nucifera [Indian lotus]
ref|XP_004976791.1|  PREDICTED: methyl-CpG-binding domain-contain...  70.1    8e-11   
ref|XP_010255468.1|  PREDICTED: uncharacterized protein LOC104596...  70.9    8e-11   Nelumbo nucifera [Indian lotus]
gb|EEE60563.1|  hypothetical protein OsJ_13925                        69.3    1e-10   Oryza sativa Japonica Group [Japonica rice]
emb|CAE01997.2|  OSJNBb0033G08.13                                     69.3    1e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010089148.1|  Methyl-CpG-binding domain-containing protein 5   67.0    1e-10   
ref|XP_010317585.1|  PREDICTED: methyl-CpG-binding domain-contain...  70.1    1e-10   
gb|EEC77988.1|  hypothetical protein OsI_17375                        69.3    1e-10   Oryza sativa Indica Group [Indian rice]
ref|NP_001053858.1|  Os04g0613800                                     69.3    2e-10   
emb|CAE05215.3|  OSJNBa0070C17.22                                     69.3    2e-10   Oryza sativa Japonica Group [Japonica rice]
emb|CAE01991.2|  OSJNBb0033G08.7                                      69.3    2e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EPS58890.1|  hypothetical protein M569_15921                       64.3    2e-10   Genlisea aurea
gb|KHN28399.1|  Methyl-CpG-binding domain-containing protein 13       69.3    3e-10   Glycine soja [wild soybean]
ref|NP_001170014.1|  hypothetical protein                             68.6    3e-10   Zea mays [maize]
ref|XP_010234457.1|  PREDICTED: uncharacterized protein LOC100834...  68.9    5e-10   Brachypodium distachyon [annual false brome]
ref|XP_010234460.1|  PREDICTED: uncharacterized protein LOC100834...  68.9    5e-10   
gb|EMT11132.1|  hypothetical protein F775_24324                       67.4    7e-10   
ref|XP_007209689.1|  hypothetical protein PRUPE_ppa012392mg           64.7    7e-10   
ref|XP_006652812.1|  PREDICTED: methyl-CpG-binding domain-contain...  65.5    3e-09   Oryza brachyantha
dbj|BAK01530.1|  predicted protein                                    66.2    3e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006652814.1|  PREDICTED: methyl-CpG-binding domain-contain...  65.5    3e-09   Oryza brachyantha
gb|EAZ30036.1|  hypothetical protein OsJ_14093                        64.7    4e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010482573.1|  PREDICTED: methyl-CpG-binding domain-contain...  65.5    4e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010482572.1|  PREDICTED: methyl-CpG-binding domain-contain...  65.5    4e-09   Camelina sativa [gold-of-pleasure]
ref|XP_002448522.1|  hypothetical protein SORBIDRAFT_06g028360        65.1    5e-09   Sorghum bicolor [broomcorn]
ref|NP_001105290.1|  LOC542207                                        64.3    5e-09   
gb|KFK26832.1|  hypothetical protein AALP_AA8G299600                  65.1    7e-09   Arabis alpina [alpine rockcress]
ref|XP_010521336.1|  PREDICTED: methyl-CpG-binding domain-contain...  64.3    1e-08   
ref|XP_010444604.1|  PREDICTED: methyl-CpG-binding domain-contain...  63.9    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010444597.1|  PREDICTED: methyl-CpG-binding domain-contain...  63.9    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010107428.1|  Methyl-CpG-binding domain-containing protein 13  63.2    2e-08   
gb|AGT16604.1|  hypothetical protein SHCRBa_016_K03_R_160             62.8    3e-08   Saccharum hybrid cultivar R570
ref|XP_002299872.1|  methyl-CpG-binding domain-containing family ...  60.8    3e-08   Populus trichocarpa [western balsam poplar]
ref|XP_006369523.1|  hypothetical protein POPTR_0001s24690g           60.1    3e-08   
ref|XP_006279588.1|  hypothetical protein CARUB_v10026033mg           62.8    3e-08   
ref|XP_006369524.1|  hypothetical protein POPTR_0001s24690g           60.1    3e-08   
ref|XP_006279589.1|  hypothetical protein CARUB_v10026033mg           62.8    4e-08   Capsella rubella
ref|XP_011042705.1|  PREDICTED: methyl-CpG-binding domain-contain...  60.1    6e-08   Populus euphratica
ref|XP_008674081.1|  PREDICTED: uncharacterized protein LOC103650258  59.3    7e-08   
ref|XP_002314180.1|  methyl-CpG-binding domain-containing family ...  59.3    1e-07   
ref|XP_002466891.1|  hypothetical protein SORBIDRAFT_01g015940        59.3    1e-07   
emb|CBI34714.3|  unnamed protein product                              60.8    2e-07   Vitis vinifera
gb|KHN35006.1|  hypothetical protein glysoja_004772                   58.2    2e-07   Glycine soja [wild soybean]
gb|KDP34493.1|  hypothetical protein JCGZ_11043                       58.5    3e-07   Jatropha curcas
ref|XP_003580540.1|  PREDICTED: uncharacterized protein LOC100838054  59.7    3e-07   
ref|XP_010685830.1|  PREDICTED: methyl-CpG-binding domain-contain...  58.9    4e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003632148.1|  PREDICTED: methyl-CpG-binding domain-contain...  58.5    5e-07   Vitis vinifera
ref|XP_011015295.1|  PREDICTED: methyl-CpG-binding domain-contain...  56.6    6e-07   Populus euphratica
ref|XP_006401848.1|  hypothetical protein EUTSA_v10012954mg           58.5    7e-07   Eutrema salsugineum [saltwater cress]
emb|CDY31911.1|  BnaC09g28330D                                        58.5    8e-07   Brassica napus [oilseed rape]
ref|XP_009106826.1|  PREDICTED: LOW QUALITY PROTEIN: methyl-CpG-b...  58.5    9e-07   
emb|CBI16127.3|  unnamed protein product                              55.5    1e-06   Vitis vinifera
gb|ABO69709.1|  MBD3                                                  56.2    1e-06   Triticum aestivum [Canadian hard winter wheat]
gb|AAM97069.1|  unknown protein                                       58.2    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200036.1|  methyl-CPG-binding domain protein 13                57.8    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004294545.1|  PREDICTED: methyl-CpG-binding domain-contain...  55.8    2e-06   Fragaria vesca subsp. vesca
ref|XP_002865903.1|  hypothetical protein ARALYDRAFT_495292           57.4    2e-06   
ref|XP_002532846.1|  DNA binding protein, putative                    56.2    2e-06   
gb|KGN57363.1|  hypothetical protein Csa_3G181990                     56.6    3e-06   Cucumis sativus [cucumbers]
emb|CDY00521.1|  BnaA10g07520D                                        56.6    4e-06   
ref|XP_006846186.1|  hypothetical protein AMTR_s00012p00212320        55.5    7e-06   
ref|XP_003549104.1|  PREDICTED: methyl-CpG-binding domain-contain...  55.5    7e-06   Glycine max [soybeans]
ref|XP_009353664.1|  PREDICTED: methyl-CpG-binding domain-contain...  54.7    8e-06   Pyrus x bretschneideri [bai li]
dbj|BAJ99501.1|  predicted protein                                    55.5    8e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010264450.1|  PREDICTED: uncharacterized protein LOC104602...  55.1    8e-06   Nelumbo nucifera [Indian lotus]
ref|XP_010264451.1|  PREDICTED: uncharacterized protein LOC104602...  55.1    9e-06   Nelumbo nucifera [Indian lotus]
dbj|BAK04695.1|  predicted protein                                    55.1    1e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010934849.1|  PREDICTED: uncharacterized protein LOC105054...  54.3    2e-05   
ref|XP_010934847.1|  PREDICTED: uncharacterized protein LOC105054...  54.3    2e-05   
ref|XP_009364396.1|  PREDICTED: methyl-CpG-binding domain-contain...  53.5    2e-05   Pyrus x bretschneideri [bai li]
ref|XP_009345985.1|  PREDICTED: methyl-CpG-binding domain-contain...  53.5    2e-05   Pyrus x bretschneideri [bai li]
ref|XP_008357235.1|  PREDICTED: methyl-CpG-binding domain-contain...  53.5    2e-05   Malus domestica [apple tree]
ref|XP_009345984.1|  PREDICTED: methyl-CpG-binding domain-contain...  53.5    2e-05   Pyrus x bretschneideri [bai li]
gb|KCW52682.1|  hypothetical protein EUGRSUZ_J02050                   53.1    3e-05   Eucalyptus grandis [rose gum]
ref|XP_010106481.1|  Methyl-CpG-binding domain-containing protein 6   53.1    3e-05   Morus notabilis
ref|XP_010033125.1|  PREDICTED: methyl-CpG-binding domain-contain...  53.5    3e-05   Eucalyptus grandis [rose gum]
ref|XP_006418884.1|  hypothetical protein EUTSA_v10002683mg           52.0    3e-05   Eutrema salsugineum [saltwater cress]
emb|CDP06874.1|  unnamed protein product                              53.1    4e-05   Coffea canephora [robusta coffee]
ref|XP_010693525.1|  PREDICTED: uncharacterized protein LOC104906467  53.1    4e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008223622.1|  PREDICTED: methyl-CpG-binding domain-contain...  52.8    4e-05   Prunus mume [ume]
ref|XP_002961436.1|  hypothetical protein SELMODRAFT_437797           53.1    6e-05   
ref|XP_007016409.1|  Methyl-CPG-binding domain protein 5, putativ...  52.0    6e-05   
ref|XP_007016410.1|  Methyl-CPG-binding domain protein 5, putativ...  52.0    6e-05   Theobroma cacao [chocolate]
ref|XP_011048656.1|  PREDICTED: uncharacterized protein LOC105142...  52.4    9e-05   Populus euphratica
ref|XP_011041594.1|  PREDICTED: uncharacterized protein LOC105137...  52.4    9e-05   Populus euphratica
ref|XP_002990266.1|  hypothetical protein SELMODRAFT_428715           52.0    1e-04   
emb|CDY33033.1|  BnaA10g12390D                                        51.6    2e-04   Brassica napus [oilseed rape]
ref|XP_010685758.1|  PREDICTED: methyl-CpG-binding domain-contain...  50.8    2e-04   Beta vulgaris subsp. vulgaris [field beet]
gb|KHF99779.1|  Methyl-CpG-binding domain-containing 6 -like protein  50.4    2e-04   Gossypium arboreum [tree cotton]
gb|KJB55876.1|  hypothetical protein B456_009G099200                  50.4    2e-04   Gossypium raimondii
gb|KJB83777.1|  hypothetical protein B456_013G263700                  50.1    3e-04   Gossypium raimondii
gb|KHG20117.1|  Methyl-CpG-binding domain-containing 5 -like protein  50.1    3e-04   Gossypium arboreum [tree cotton]
ref|XP_009126698.1|  PREDICTED: methyl-CpG-binding domain-contain...  50.1    3e-04   Brassica rapa
ref|XP_007514055.1|  predicted protein                                50.8    3e-04   Bathycoccus prasinos
emb|CDY53445.1|  BnaA02g07070D                                        50.1    3e-04   
ref|XP_002448792.1|  hypothetical protein SORBIDRAFT_06g033275        50.1    4e-04   
ref|XP_010541401.1|  PREDICTED: methyl-CpG-binding domain-contain...  49.7    4e-04   
emb|CDX80274.1|  BnaC09g34680D                                        50.4    4e-04   
ref|XP_010541402.1|  PREDICTED: methyl-CpG-binding domain-contain...  49.7    4e-04   
ref|XP_006400967.1|  hypothetical protein EUTSA_v10014530mg           49.7    4e-04   
ref|XP_004168988.1|  PREDICTED: methyl-CpG-binding domain-contain...  49.3    4e-04   
gb|KFK27467.1|  hypothetical protein AALP_AA8G387100                  49.3    5e-04   
emb|CDY59223.1|  BnaCnng34510D                                        49.7    5e-04   
emb|CDY48687.1|  BnaC02g09990D                                        49.7    5e-04   
gb|KFK27470.1|  hypothetical protein AALP_AA8G387500                  49.3    6e-04   
gb|KGN65724.1|  hypothetical protein Csa_1G522010                     49.3    7e-04   
ref|XP_008457481.1|  PREDICTED: methyl-CpG-binding domain-contain...  49.3    7e-04   
ref|XP_009604783.1|  PREDICTED: methyl-CpG-binding domain-contain...  49.3    8e-04   
gb|KJB08887.1|  hypothetical protein B456_001G110900                  47.0    9e-04   
ref|NP_200746.1|  methyl-CpG-binding domain-containing protein 6      48.9    9e-04   
ref|XP_009787915.1|  PREDICTED: methyl-CpG-binding domain-contain...  48.9    0.001   
ref|XP_003619453.1|  Methyl binding domain protein                    49.3    0.001   
gb|KDP35643.1|  hypothetical protein JCGZ_09081                       49.3    0.001   



>ref|XP_010661063.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X3 [Vitis vinifera]
Length=482

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 97/180 (54%), Gaps = 48/180 (27%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAAN  289
            L   T +  DWLP GW +ELKT+ +GS  G  YKCY+ PS G +FYSK  V ++L     
Sbjct  14   LGIKTKKFPDWLPNGWILELKTQRSGSCVGKQYKCYLDPSTGYRFYSKPDVFRYL-----  68

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPA------  451
                                     +T K N S TSR++K          V P       
Sbjct  69   -------------------------KTIKHN-SCTSRQKK----------VGPGMPSLGK  92

Query  452  VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            V  +  +ADGLPAGW+KE++ R   +GIR+DPYY DPVSGY FRS++DV RYL+TG+I +
Sbjct  93   VVIERSTADGLPAGWIKEIKIRMNENGIRRDPYYTDPVSGYVFRSRKDVFRYLKTGEISR  152



>ref|XP_010661055.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Vitis vinifera]
Length=496

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 97/180 (54%), Gaps = 48/180 (27%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAAN  289
            L   T +  DWLP GW +ELKT+ +GS  G  YKCY+ PS G +FYSK  V ++L     
Sbjct  28   LGIKTKKFPDWLPNGWILELKTQRSGSCVGKQYKCYLDPSTGYRFYSKPDVFRYL-----  82

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPA------  451
                                     +T K N S TSR++K          V P       
Sbjct  83   -------------------------KTIKHN-SCTSRQKK----------VGPGMPSLGK  106

Query  452  VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            V  +  +ADGLPAGW+KE++ R   +GIR+DPYY DPVSGY FRS++DV RYL+TG+I +
Sbjct  107  VVIERSTADGLPAGWIKEIKIRMNENGIRRDPYYTDPVSGYVFRSRKDVFRYLKTGEISR  166



>ref|XP_010661051.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Vitis vinifera]
Length=544

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 97/180 (54%), Gaps = 48/180 (27%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAAN  289
            L   T +  DWLP GW +ELKT+ +GS  G  YKCY+ PS G +FYSK  V ++L     
Sbjct  76   LGIKTKKFPDWLPNGWILELKTQRSGSCVGKQYKCYLDPSTGYRFYSKPDVFRYL-----  130

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPA------  451
                                     +T K N S TSR++K          V P       
Sbjct  131  -------------------------KTIKHN-SCTSRQKK----------VGPGMPSLGK  154

Query  452  VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            V  +  +ADGLPAGW+KE++ R   +GIR+DPYY DPVSGY FRS++DV RYL+TG+I +
Sbjct  155  VVIERSTADGLPAGWIKEIKIRMNENGIRRDPYYTDPVSGYVFRSRKDVFRYLKTGEISR  214



>ref|XP_002509754.1| hypothetical protein RCOM_1685990 [Ricinus communis]
 gb|EEF51141.1| hypothetical protein RCOM_1685990 [Ricinus communis]
Length=978

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 96/177 (54%), Gaps = 37/177 (21%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAAN  289
            L   TN+  +WLP GW VELK +++GS  G  YKCY+ PS G KFYSK +V + L +   
Sbjct  3    LIEYTNERPEWLPHGWIVELKIKNSGSARGRKYKCYVEPSTGYKFYSKPEVFRHLETTGL  62

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVS-----PAV  454
                                           +S TS+++++V+       VS       V
Sbjct  63   -------------------------------KSCTSKQKEAVVSMLPTNKVSLRYPDAKV  91

Query  455  AAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
              +  + + LP GW+KE++ +   +GIRKDPYYIDPVSGY FRSKRDV RYLETG+I
Sbjct  92   KIEKSTVEDLPTGWIKEIKIQRKTNGIRKDPYYIDPVSGYVFRSKRDVQRYLETGEI  148



>gb|KDP25474.1| hypothetical protein JCGZ_20630 [Jatropha curcas]
Length=1044

 Score =   125 bits (313),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 91/174 (52%), Gaps = 36/174 (21%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAAN  289
            L    N+  +WLP GW VELKTR +G  +G  YKCY+ PS G KFYSK  V ++L +   
Sbjct  75   LIEYANERPEWLPNGWVVELKTRKSGDASGKVYKCYVDPSTGCKFYSKPAVVRYLETIKQ  134

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI  469
                                   ++ TPK+         K  + +  P +    V  +  
Sbjct  135  -----------------------RSYTPKQ---------KETLKSALPTS---EVKFEKS  159

Query  470  SADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            + D LP GW+KE++     +GIRKDPYYIDP+ GY FRSKRDV RYLETG I K
Sbjct  160  TVDDLPPGWIKEIKITANANGIRKDPYYIDPIKGYVFRSKRDVERYLETGKISK  213



>emb|CBI34715.3| unnamed protein product [Vitis vinifera]
Length=1076

 Score =   125 bits (313),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 97/180 (54%), Gaps = 48/180 (27%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAAN  289
            L   T +  DWLP GW +ELKT+ +GS  G  YKCY+ PS G +FYSK  V ++L     
Sbjct  28   LGIKTKKFPDWLPNGWILELKTQRSGSCVGKQYKCYLDPSTGYRFYSKPDVFRYL-----  82

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPA------  451
                                     +T K N S TSR++K          V P       
Sbjct  83   -------------------------KTIKHN-SCTSRQKK----------VGPGMPSLGK  106

Query  452  VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            V  +  +ADGLPAGW+KE++ R   +GIR+DPYY DPVSGY FRS++DV RYL+TG+I +
Sbjct  107  VVIERSTADGLPAGWIKEIKIRMNENGIRRDPYYTDPVSGYVFRSRKDVFRYLKTGEISR  166



>ref|XP_011072312.1| PREDICTED: uncharacterized protein LOC105157598 isoform X1 [Sesamum 
indicum]
Length=645

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 78/200 (39%), Positives = 105/200 (53%), Gaps = 32/200 (16%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAAN  289
            +   TN S  WLP GWT+E KTR +GS  GS YK Y    SG +FYS+A V+++LN+  +
Sbjct  78   ILDKTNDSPGWLPSGWTMEEKTRQSGSRKGSVYKVYTDLSSGSRFYSRAAVTRYLNTVDH  137

Query  290  SNTPIsnenknnieesssnleVPQ-------NQTPKENQSRTSRKRKSVMDNQTPKTVSP  448
            SNT ++ +NK +  +       PQ       +  P++N    S KR   +D  +P     
Sbjct  138  SNT-VTVQNKLDNVDEPVQNVSPQGISMTSTDHIPEKNNG--SFKRLDNVDEPSPDMFRE  194

Query  449  A---------------------VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPV  565
                                  VA +  +AD LP GW+KE+ T    + IRKDPYY DPV
Sbjct  195  GISMTNTDHVPEKKKKSNSFETVAVESSAADDLPPGWIKEIITSKSGNRIRKDPYYTDPV  254

Query  566  SGYEFRSKRDVMRYLETGDI  625
            SGY FRSK D +RYL+T DI
Sbjct  255  SGYVFRSKMDALRYLKTNDI  274



>ref|XP_011072316.1| PREDICTED: uncharacterized protein LOC105157598 isoform X2 [Sesamum 
indicum]
Length=644

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 78/200 (39%), Positives = 105/200 (53%), Gaps = 32/200 (16%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAAN  289
            +   TN S  WLP GWT+E KTR +GS  GS YK Y    SG +FYS+A V+++LN+  +
Sbjct  77   ILDKTNDSPGWLPSGWTMEEKTRQSGSRKGSVYKVYTDLSSGSRFYSRAAVTRYLNTVDH  136

Query  290  SNTPIsnenknnieesssnleVPQ-------NQTPKENQSRTSRKRKSVMDNQTPKTVSP  448
            SNT ++ +NK +  +       PQ       +  P++N    S KR   +D  +P     
Sbjct  137  SNT-VTVQNKLDNVDEPVQNVSPQGISMTSTDHIPEKNNG--SFKRLDNVDEPSPDMFRE  193

Query  449  A---------------------VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPV  565
                                  VA +  +AD LP GW+KE+ T    + IRKDPYY DPV
Sbjct  194  GISMTNTDHVPEKKKKSNSFETVAVESSAADDLPPGWIKEIITSKSGNRIRKDPYYTDPV  253

Query  566  SGYEFRSKRDVMRYLETGDI  625
            SGY FRSK D +RYL+T DI
Sbjct  254  SGYVFRSKMDALRYLKTNDI  273



>ref|XP_008796740.1| PREDICTED: uncharacterized protein LOC103712110 isoform X5 [Phoenix 
dactylifera]
Length=652

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 97/178 (54%), Gaps = 23/178 (13%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  289
            LA       DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    +
Sbjct  29   LAEQIKDFPDWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMS  88

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRK--RKSVMDNQTPKTVSPAVAAQ  463
             N             +     V    T     S + RK  ++S M+NQ    +       
Sbjct  89   CNP-----------RAKRKRSVVTKVTENACSSTSQRKGIKRSTMENQVRSQI-------  130

Query  464  DISADGLPAGWVKELRTRTCPS--GIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            + + DGLP+GW+KE+R R   S  G ++D YY DPV+G+ FRS++D ++Y+ETG++ K
Sbjct  131  EYTPDGLPSGWIKEIRYRKTSSRCGAKRDQYYTDPVNGFVFRSRKDAIQYIETGEVSK  188



>ref|XP_008796735.1| PREDICTED: uncharacterized protein LOC103712110 isoform X1 [Phoenix 
dactylifera]
Length=695

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 97/178 (54%), Gaps = 23/178 (13%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  289
            LA       DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    +
Sbjct  72   LAEQIKDFPDWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMS  131

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRK--RKSVMDNQTPKTVSPAVAAQ  463
             N             +     V    T     S + RK  ++S M+NQ    +       
Sbjct  132  CN-----------PRAKRKRSVVTKVTENACSSTSQRKGIKRSTMENQVRSQI-------  173

Query  464  DISADGLPAGWVKELRTRTCPS--GIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            + + DGLP+GW+KE+R R   S  G ++D YY DPV+G+ FRS++D ++Y+ETG++ K
Sbjct  174  EYTPDGLPSGWIKEIRYRKTSSRCGAKRDQYYTDPVNGFVFRSRKDAIQYIETGEVSK  231



>ref|XP_008796737.1| PREDICTED: uncharacterized protein LOC103712110 isoform X3 [Phoenix 
dactylifera]
Length=693

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 97/178 (54%), Gaps = 23/178 (13%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  289
            LA       DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    +
Sbjct  72   LAEQIKDFPDWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMS  131

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRK--RKSVMDNQTPKTVSPAVAAQ  463
             N             +     V    T     S + RK  ++S M+NQ    +       
Sbjct  132  CNP-----------RAKRKRSVVTKVTENACSSTSQRKGIKRSTMENQVRSQI-------  173

Query  464  DISADGLPAGWVKELRTRTCPS--GIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            + + DGLP+GW+KE+R R   S  G ++D YY DPV+G+ FRS++D ++Y+ETG++ K
Sbjct  174  EYTPDGLPSGWIKEIRYRKTSSRCGAKRDQYYTDPVNGFVFRSRKDAIQYIETGEVSK  231



>emb|CBI31785.3| unnamed protein product [Vitis vinifera]
Length=560

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 93/180 (52%), Gaps = 52/180 (29%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsn  310
            S DWLPPGW VE+K  STG      YKCYI PS G KFYSK +VS++LN A         
Sbjct  6    SDDWLPPGWKVEMKLTSTGR----KYKCYIHPSRGLKFYSKPEVSRYLNKA---------  52

Query  311  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPA-------------  451
                           P N        R S ++KS+      KT++PA             
Sbjct  53   ---------------PLN-------DRESIQKKSIERKTPIKTMAPAGKKKSMEKKKHCI  90

Query  452  ---VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGD  622
               V  + ++A+GLP GW+KE++ +     +R+D YY DPV+GY FRS +D +RYL+TGD
Sbjct  91   AKKVVFERVTAEGLPPGWIKEIKIQKKCGTVRRDAYYTDPVNGYIFRSMKDTLRYLKTGD  150



>ref|XP_004143925.1| PREDICTED: uncharacterized protein LOC101223188 [Cucumis sativus]
 ref|XP_004159962.1| PREDICTED: uncharacterized protein LOC101226976 [Cucumis sativus]
 gb|KGN50128.1| hypothetical protein Csa_5G154900 [Cucumis sativus]
Length=853

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/174 (37%), Positives = 91/174 (52%), Gaps = 36/174 (21%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  289
            L   +N+  +WLP GW VE +TR +GS+ G+ YKCYI P +  +FYSK +V + L +  N
Sbjct  75   LTVKSNEHPEWLPAGWKVESRTRMSGSNVGAVYKCYIDPVTDSRFYSKPEVFRHLRTVKN  134

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI  469
                                      T KE ++   +K +S             V  +  
Sbjct  135  KLC-----------------------TLKERRTSNGKKSRS------------RVVIEHY  159

Query  470  SADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
              + LP GW+KE++ +    GIRKDP+YIDP SGY FRSK++V RYLETG+I +
Sbjct  160  KDEDLPPGWIKEIKIKEKADGIRKDPFYIDPKSGYVFRSKKEVFRYLETGEISR  213


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 69/163 (42%), Gaps = 39/163 (24%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsn  310
            S DWLP GWTV+ K + T    G   + Y +  +G+ FY K  V  ++ S  +  +    
Sbjct  6    SPDWLPSGWTVQYKVQKT----GRKIRFYTNLENGKSFYYKDDVIGYIKSTQSQKSQ---  58

Query  311  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  490
                           P ++  K  QS  S  + +V  N+ P              + LPA
Sbjct  59   ---------------PTSRGVK-TQSGNSPLQLTVKSNEHP--------------EWLPA  88

Query  491  GWVKELRTRTCPSGIRKD-PYYIDPVSGYEFRSKRDVMRYLET  616
            GW  E RTR   S +      YIDPV+   F SK +V R+L T
Sbjct  89   GWKVESRTRMSGSNVGAVYKCYIDPVTDSRFYSKPEVFRHLRT  131



>ref|XP_010662494.1| PREDICTED: uncharacterized protein LOC100263513 isoform X1 [Vitis 
vinifera]
Length=637

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 93/180 (52%), Gaps = 52/180 (29%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsn  310
            S DWLPPGW VE+K  STG      YKCYI PS G KFYSK +VS++LN A         
Sbjct  6    SDDWLPPGWKVEMKLTSTGR----KYKCYIHPSRGLKFYSKPEVSRYLNKA---------  52

Query  311  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPA-------------  451
                           P N        R S ++KS+      KT++PA             
Sbjct  53   ---------------PLN-------DRESIQKKSIERKTPIKTMAPAGKKKSMEKKKHCI  90

Query  452  ---VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGD  622
               V  + ++A+GLP GW+KE++ +     +R+D YY DPV+GY FRS +D +RYL+TGD
Sbjct  91   AKKVVFERVTAEGLPPGWIKEIKIQKKCGTVRRDAYYTDPVNGYIFRSMKDTLRYLKTGD  150



>ref|XP_008796736.1| PREDICTED: uncharacterized protein LOC103712110 isoform X2 [Phoenix 
dactylifera]
Length=694

 Score =   115 bits (289),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 98/179 (55%), Gaps = 26/179 (15%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  289
            LA       DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    +
Sbjct  72   LAEQIKDFPDWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMS  131

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRK--RKSVMDNQTPKTVSPAVAAQ  463
             N             +     V    T     S + RK  ++S M+N         V +Q
Sbjct  132  CN-----------PRAKRKRSVVTKVTENACSSTSQRKGIKRSTMEN---------VRSQ  171

Query  464  -DISADGLPAGWVKELRTRTCPS--GIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             + + DGLP+GW+KE+R R   S  G ++D YY DPV+G+ FRS++D ++Y+ETG++ K
Sbjct  172  IEYTPDGLPSGWIKEIRYRKTSSRCGAKRDQYYTDPVNGFVFRSRKDAIQYIETGEVSK  230



>ref|XP_008238911.1| PREDICTED: uncharacterized protein LOC103337528 [Prunus mume]
Length=623

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 88/174 (51%), Gaps = 45/174 (26%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRK-FYSKAQVSQFLNSAAN  289
            L  NT +  +WLP GW VE++TR TG H G  YKCYI PS    FYSK +V ++L +   
Sbjct  77   LVVNTTEYPEWLPKGWKVEVRTRKTGVHVGKEYKCYIDPSTESSFYSKPEVFRYLKTV--  134

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI  469
                                                 KRKS   ++  KTV   V   D+
Sbjct  135  -------------------------------------KRKSC-KSRNLKTVD--VEKHDV  154

Query  470  SADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
              + LP+GW KE++ +   + +R+DPYY DPVSGY FRSK  VM YLETG+I +
Sbjct  155  --EDLPSGWTKEIKVKRVANRLRRDPYYTDPVSGYVFRSKNAVMHYLETGEISR  206



>ref|XP_008796741.1| PREDICTED: uncharacterized protein LOC103712110 isoform X6 [Phoenix 
dactylifera]
Length=651

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 98/179 (55%), Gaps = 26/179 (15%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  289
            LA       DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    +
Sbjct  29   LAEQIKDFPDWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMS  88

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRK--RKSVMDNQTPKTVSPAVAAQ  463
             N             +     V    T     S + RK  ++S M+N         V +Q
Sbjct  89   CNP-----------RAKRKRSVVTKVTENACSSTSQRKGIKRSTMEN---------VRSQ  128

Query  464  -DISADGLPAGWVKELRTRTCPS--GIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             + + DGLP+GW+KE+R R   S  G ++D YY DPV+G+ FRS++D ++Y+ETG++ K
Sbjct  129  IEYTPDGLPSGWIKEIRYRKTSSRCGAKRDQYYTDPVNGFVFRSRKDAIQYIETGEVSK  187



>ref|XP_008796738.1| PREDICTED: uncharacterized protein LOC103712110 isoform X4 [Phoenix 
dactylifera]
Length=692

 Score =   115 bits (289),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 98/179 (55%), Gaps = 26/179 (15%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  289
            LA       DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    +
Sbjct  72   LAEQIKDFPDWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMS  131

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRK--RKSVMDNQTPKTVSPAVAAQ  463
             N             +     V    T     S + RK  ++S M+N         V +Q
Sbjct  132  CNP-----------RAKRKRSVVTKVTENACSSTSQRKGIKRSTMEN---------VRSQ  171

Query  464  -DISADGLPAGWVKELRTRTCPS--GIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             + + DGLP+GW+KE+R R   S  G ++D YY DPV+G+ FRS++D ++Y+ETG++ K
Sbjct  172  IEYTPDGLPSGWIKEIRYRKTSSRCGAKRDQYYTDPVNGFVFRSRKDAIQYIETGEVSK  230



>ref|XP_007158476.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
 gb|ESW30470.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
Length=927

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 96/170 (56%), Gaps = 8/170 (5%)
 Frame = +2

Query  116  ASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN  295
            A  +N+  +WLP GW VE KTR +G++ G  YKCYI P+G KFYSK +V ++L +  NSN
Sbjct  25   AEKSNEHPEWLPDGWIVESKTRKSGANMGCGYKCYIDPTGCKFYSKPEVLRYLET-VNSN  83

Query  296  TPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISA  475
            +  S + K      +      ++  P +  +    K+ S      P TV  +        
Sbjct  84   SHSSKKEKMRKSNDAVEKSTAED-LPPDQIADVKMKKSSNGYRIDPDTVEKS------PV  136

Query  476  DGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            + LP GW  E + R   +G RKD +YIDPVSGY FRSK+D +RY+++GDI
Sbjct  137  EDLPPGWTIEAKVRKGGTGNRKDLFYIDPVSGYVFRSKKDALRYVKSGDI  186



>ref|XP_007158478.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
 gb|ESW30472.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
Length=972

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 96/170 (56%), Gaps = 8/170 (5%)
 Frame = +2

Query  116  ASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN  295
            A  +N+  +WLP GW VE KTR +G++ G  YKCYI P+G KFYSK +V ++L +  NSN
Sbjct  25   AEKSNEHPEWLPDGWIVESKTRKSGANMGCGYKCYIDPTGCKFYSKPEVLRYLET-VNSN  83

Query  296  TPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISA  475
            +  S + K      +      ++  P +  +    K+ S      P TV  +        
Sbjct  84   SHSSKKEKMRKSNDAVEKSTAED-LPPDQIADVKMKKSSNGYRIDPDTVEKS------PV  136

Query  476  DGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            + LP GW  E + R   +G RKD +YIDPVSGY FRSK+D +RY+++GDI
Sbjct  137  EDLPPGWTIEAKVRKGGTGNRKDLFYIDPVSGYVFRSKKDALRYVKSGDI  186


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 74/161 (46%), Gaps = 37/161 (23%)
 Frame = +2

Query  146  LPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnenkn  322
            LPPGWT+E K R  G+ N      YI P SG  F SK    +++ S   S   I    + 
Sbjct  139  LPPGWTIEAKVRKGGTGNRKDL-FYIDPVSGYVFRSKKDALRYVKSGDISACAIKPFKR-  196

Query  323  nieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVK  502
                        QNQ   E++   S K+  V D                    LP GW+ 
Sbjct  197  ------------QNQ--DEDKVSDSDKKSQVED--------------------LPPGWIT  222

Query  503  ELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            E + R   +G +KD  Y+DPVSGY FRSK+D +RY+ +GDI
Sbjct  223  EAKVRKGGTGKKKDLLYLDPVSGYVFRSKKDALRYVNSGDI  263



>ref|XP_007158477.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
 gb|ESW30471.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
Length=1004

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 96/170 (56%), Gaps = 8/170 (5%)
 Frame = +2

Query  116  ASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN  295
            A  +N+  +WLP GW VE KTR +G++ G  YKCYI P+G KFYSK +V ++L +  NSN
Sbjct  25   AEKSNEHPEWLPDGWIVESKTRKSGANMGCGYKCYIDPTGCKFYSKPEVLRYLET-VNSN  83

Query  296  TPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISA  475
            +  S + K      +      ++  P +  +    K+ S      P TV  +        
Sbjct  84   SHSSKKEKMRKSNDAVEKSTAED-LPPDQIADVKMKKSSNGYRIDPDTVEKS------PV  136

Query  476  DGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            + LP GW  E + R   +G RKD +YIDPVSGY FRSK+D +RY+++GDI
Sbjct  137  EDLPPGWTIEAKVRKGGTGNRKDLFYIDPVSGYVFRSKKDALRYVKSGDI  186


 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 80/161 (50%), Gaps = 5/161 (3%)
 Frame = +2

Query  146  LPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnenkn  322
            LPPGWT+E K R  G+ N      YI P SG  F SK    +++ S   S   I    + 
Sbjct  139  LPPGWTIEAKVRKGGTGNRKDL-FYIDPVSGYVFRSKKDALRYVKSGDISACAIKPFKRQ  197

Query  323  nieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVK  502
            N +E   +  V ++    E+       +  +      K + P  + +    + LP GW+ 
Sbjct  198  NQDEDKVSNAVEKSII--EDLPPGHLTKVKIRKGSNGKRIDPD-SDKKSQVEDLPPGWIT  254

Query  503  ELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            E + R   +G +KD  Y+DPVSGY FRSK+D +RY+ +GDI
Sbjct  255  EAKVRKGGTGKKKDLLYLDPVSGYVFRSKKDALRYVNSGDI  295



>ref|XP_007158475.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
 gb|ESW30469.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
Length=959

 Score =   116 bits (290),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 96/170 (56%), Gaps = 8/170 (5%)
 Frame = +2

Query  116  ASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN  295
            A  +N+  +WLP GW VE KTR +G++ G  YKCYI P+G KFYSK +V ++L +  NSN
Sbjct  25   AEKSNEHPEWLPDGWIVESKTRKSGANMGCGYKCYIDPTGCKFYSKPEVLRYLET-VNSN  83

Query  296  TPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISA  475
            +  S + K      +      ++  P +  +    K+ S      P TV  +        
Sbjct  84   SHSSKKEKMRKSNDAVEKSTAED-LPPDQIADVKMKKSSNGYRIDPDTVEKS------PV  136

Query  476  DGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            + LP GW  E + R   +G RKD +YIDPVSGY FRSK+D +RY+++GDI
Sbjct  137  EDLPPGWTIEAKVRKGGTGNRKDLFYIDPVSGYVFRSKKDALRYVKSGDI  186



>gb|KDO55595.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
Length=267

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 86/171 (50%), Gaps = 21/171 (12%)
 Frame = +2

Query  122  NTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNT  298
            + N   DWLP GW V+LKTR +GS  G  YK YI P +G KF+S  +V + L S  N N+
Sbjct  96   DENNRPDWLPDGWVVDLKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKNRNS  155

Query  299  PIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISAD  478
                +              P   +  E   + S KR+        +  +  V  +  +  
Sbjct  156  ECERKT------------TPTETSKYEGTRKVSTKRE--------RETTERVVVEKSTVV  195

Query  479  GLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             LP  W KE + +    GIRKD Y+ DPVSGY F SK+DV RYLETG+I K
Sbjct  196  DLPPSWTKETKIKKTARGIRKDRYFTDPVSGYVFCSKKDVFRYLETGEISK  246



>gb|KDO55594.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
Length=273

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 86/171 (50%), Gaps = 21/171 (12%)
 Frame = +2

Query  122  NTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNT  298
            + N   DWLP GW V+LKTR +GS  G  YK YI P +G KF+S  +V + L S  N N+
Sbjct  102  DENNRPDWLPDGWVVDLKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKNRNS  161

Query  299  PIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISAD  478
                +              P   +  E   + S KR+        +  +  V  +  +  
Sbjct  162  ECERKT------------TPTETSKYEGTRKVSTKRE--------RETTERVVVEKSTVV  201

Query  479  GLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             LP  W KE + +    GIRKD Y+ DPVSGY F SK+DV RYLETG+I K
Sbjct  202  DLPPSWTKETKIKKTARGIRKDRYFTDPVSGYVFCSKKDVFRYLETGEISK  252



>ref|XP_008437229.1| PREDICTED: transcriptional regulator ATRX homolog isoform X3 
[Cucumis melo]
Length=628

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 89/170 (52%), Gaps = 36/170 (21%)
 Frame = +2

Query  125  TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTP  301
            +N+  +WLP GW VE +TR +GS+ G+ YKCYI P +  +FYSK +V + L +  N    
Sbjct  79   SNEHPEWLPAGWKVESRTRMSGSNVGAVYKCYIDPVTDSRFYSKPEVFRHLRTVKNKLC-  137

Query  302  IsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADG  481
                                  T KE ++    K +S             V  +    + 
Sbjct  138  ----------------------TLKERRTSNGTKSRS------------RVVIEHYKDED  163

Query  482  LPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            LP GW+KE++ +    GIRKDP+YIDP SGY FRSK++V RYLETG+I +
Sbjct  164  LPPGWIKEIKIKEKADGIRKDPFYIDPKSGYIFRSKKEVFRYLETGEISR  213


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 70/163 (43%), Gaps = 39/163 (24%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsn  310
            S DWLP GWTV+ K + TG       + Y +  +G+ FY K  V  ++ S  +  +    
Sbjct  6    SPDWLPSGWTVQYKVQKTGRK----IRFYTNLETGKSFYYKDDVLGYIKSTQSQKSQ---  58

Query  311  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  490
                           P ++  K  QS  S  +++V  N+ P              + LPA
Sbjct  59   ---------------PTSRGIK-TQSGNSPVQQTVKSNEHP--------------EWLPA  88

Query  491  GWVKELRTRTCPSGIRKD-PYYIDPVSGYEFRSKRDVMRYLET  616
            GW  E RTR   S +      YIDPV+   F SK +V R+L T
Sbjct  89   GWKVESRTRMSGSNVGAVYKCYIDPVTDSRFYSKPEVFRHLRT  131



>ref|XP_002276814.3| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X4 [Vitis vinifera]
Length=462

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 92/173 (53%), Gaps = 52/173 (30%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsn  310
            S DW+P GWTV++K     + NG   KCY+ PS G +FYSK  V ++L            
Sbjct  5    SPDWIPEGWTVQVKL----AKNGRNVKCYLDPSTGYRFYSKPDVFRYL------------  48

Query  311  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPA------VAAQDIS  472
                              +T K N S TSR++K          V P       V  +  +
Sbjct  49   ------------------KTIKHN-SCTSRQKK----------VGPGMPSLGKVVIERST  79

Query  473  ADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            ADGLPAGW+KE++ R   +GIR+DPYY DPVSGY FRS++DV RYL+TG+I +
Sbjct  80   ADGLPAGWIKEIKIRMNENGIRRDPYYTDPVSGYVFRSRKDVFRYLKTGEISR  132



>gb|KJB39637.1| hypothetical protein B456_007G022700 [Gossypium raimondii]
Length=914

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/173 (38%), Positives = 88/173 (51%), Gaps = 38/173 (22%)
 Frame = +2

Query  116  ASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANS  292
            A   N+  +WLP  W VE+KT  +G   G   K Y+ PS G +FYSK  V +FL  A   
Sbjct  82   AVKENECPEWLPKNWFVEVKTHKSGEFIGKRVKIYVDPSTGLRFYSKPAVFRFLKQAEQR  141

Query  293  NTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDIS  472
            N                       +T K+ Q+  SRK+               V  +  +
Sbjct  142  N----------------------RKTNKKKQAAYSRKK---------------VVIEKST  164

Query  473  ADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             D LPAGW+KE++ +   +G+RKDPYY DPVSGY FRSK+ V+ YLETG+I +
Sbjct  165  VDDLPAGWIKEIKIQRNANGVRKDPYYTDPVSGYVFRSKKAVLHYLETGEIAR  217



>gb|KDO55591.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
 gb|KDO55592.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
 gb|KDO55593.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
Length=296

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 86/171 (50%), Gaps = 21/171 (12%)
 Frame = +2

Query  122  NTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNT  298
            + N   DWLP GW V+LKTR +GS  G  YK YI P +G KF+S  +V + L S  N N+
Sbjct  125  DENNRPDWLPDGWVVDLKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKNRNS  184

Query  299  PIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISAD  478
                +              P   +  E   + S KR+        +  +  V  +  +  
Sbjct  185  ECERKT------------TPTETSKYEGTRKVSTKRE--------RETTERVVVEKSTVV  224

Query  479  GLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             LP  W KE + +    GIRKD Y+ DPVSGY F SK+DV RYLETG+I K
Sbjct  225  DLPPSWTKETKIKKTARGIRKDRYFTDPVSGYVFCSKKDVFRYLETGEISK  275



>ref|XP_008351681.1| PREDICTED: uncharacterized protein LOC103415104 [Malus domestica]
Length=746

 Score =   112 bits (281),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 64/174 (37%), Positives = 90/174 (52%), Gaps = 25/174 (14%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAAN  289
            L  +  +  +WLP GW VEL+TR +G   G  YKCYI PSG   FYSK +V ++L +   
Sbjct  77   LEVDPTECPEWLPNGWKVELRTRQSGVQVGKEYKCYIDPSGECTFYSKPEVFRYLKTVKR  136

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI  469
             ++                    ++ T   +  R   ++K+V   Q  K V      +  
Sbjct  137  KSS--------------------KSGTLTISSKRCITEKKAVTTVQLAKNV----YVEKH  172

Query  470  SADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
              + LP GW+KE++     +  R+DPYY DP SGY FRSK+DV RYLETG+I K
Sbjct  173  HVEDLPPGWIKEIKVTKYANRFRRDPYYTDPDSGYVFRSKKDVFRYLETGEISK  226



>ref|XP_011463824.1| PREDICTED: uncharacterized protein LOC101312827 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=1030

 Score =   112 bits (281),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 92/176 (52%), Gaps = 28/176 (16%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAAN  289
            + +NT +  +WLP GW VEL+TR +G   G  YKCYI PS    FYSK +V + L +   
Sbjct  75   VVANTVEYPEWLPDGWKVELRTRKSGVQVGKEYKCYIDPSRECTFYSKPEVFRHLRTV--  132

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVS--PAVAAQ  463
                                   + ++ K    +T  +++ ++  +T   +     V  +
Sbjct  133  -----------------------KRKSYKSRSHKTVNRKRCIIKTKTVTAMHFPSKVVVE  169

Query  464  DISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
              + + LP GW+ E++ R   + IR+DPYY DPV GY FRSK+DV+RYL+TG+  K
Sbjct  170  KHNVEDLPPGWILEIKVRKVANRIRRDPYYTDPVHGYIFRSKKDVIRYLQTGETSK  225



>ref|XP_006440582.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
 gb|ESR53822.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
Length=1094

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 86/171 (50%), Gaps = 21/171 (12%)
 Frame = +2

Query  122  NTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNT  298
            + N   DWLP GW VELKTR +GS  G  YK YI P +G KF+S  +V + L S  N N+
Sbjct  125  DENNRPDWLPDGWVVELKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKNRNS  184

Query  299  PIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISAD  478
                +              P   +  E   + S KR+        +  +  V  +  +  
Sbjct  185  ECERKT------------TPTETSKYEGTRKVSTKRE--------RETTERVVVEKSTVV  224

Query  479  GLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             LP  W KE + +    GIRKD Y+ DPVSGY F SK+DV RYLETG+I K
Sbjct  225  DLPPSWTKETKIKKTARGIRKDRYFTDPVSGYVFCSKKDVFRYLETGEISK  275



>ref|XP_008392616.1| PREDICTED: uncharacterized protein LOC103454798 [Malus domestica]
Length=1228

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/174 (37%), Positives = 90/174 (52%), Gaps = 25/174 (14%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAAN  289
            L  +  +  +WLP GW VEL+TR +G   G  YKCYI PSG   FYSK +V ++L +   
Sbjct  77   LEVDPTECPEWLPNGWKVELRTRQSGVQVGKEYKCYIDPSGECTFYSKPEVFRYLKTVKR  136

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI  469
             ++                    ++ T   +  R   ++K+V   Q  K V      +  
Sbjct  137  KSS--------------------KSGTLTISSKRCITEKKAVTTVQLAKNV----YVEKH  172

Query  470  SADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
              + LP GW+KE++     +  R+DPYY DP SGY FRSK+DV RYLETG+I K
Sbjct  173  HVEDLPPGWIKEIKVTKYANRFRRDPYYTDPDSGYVFRSKKDVFRYLETGEISK  226



>ref|XP_006440581.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
 gb|ESR53821.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
Length=1065

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 86/171 (50%), Gaps = 21/171 (12%)
 Frame = +2

Query  122  NTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNT  298
            + N   DWLP GW VELKTR +GS  G  YK YI P +G KF+S  +V + L S  N N+
Sbjct  96   DENNRPDWLPDGWVVELKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKNRNS  155

Query  299  PIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISAD  478
                +              P   +  E   + S KR+        +  +  V  +  +  
Sbjct  156  ECERKT------------TPTETSKYEGTRKVSTKRE--------RETTERVVVEKSTVV  195

Query  479  GLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             LP  W KE + +    GIRKD Y+ DPVSGY F SK+DV RYLETG+I K
Sbjct  196  DLPPSWTKETKIKKTARGIRKDRYFTDPVSGYVFCSKKDVFRYLETGEISK  246



>ref|XP_006440583.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
 gb|ESR53823.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
Length=1065

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 86/171 (50%), Gaps = 21/171 (12%)
 Frame = +2

Query  122  NTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNT  298
            + N   DWLP GW VELKTR +GS  G  YK YI P +G KF+S  +V + L S  N N+
Sbjct  125  DENNRPDWLPDGWVVELKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKNRNS  184

Query  299  PIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISAD  478
                +              P   +  E   + S KR+        +  +  V  +  +  
Sbjct  185  ECERKT------------TPTETSKYEGTRKVSTKRE--------RETTERVVVEKSTVV  224

Query  479  GLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             LP  W KE + +    GIRKD Y+ DPVSGY F SK+DV RYLETG+I K
Sbjct  225  DLPPSWTKETKIKKTARGIRKDRYFTDPVSGYVFCSKKDVFRYLETGEISK  275



>ref|XP_010918514.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Elaeis guineensis]
Length=488

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 96/185 (52%), Gaps = 38/185 (21%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  289
            LA       DWLP GW +E KTR +G++ G  YKCYI P +G KFYSK +V +++     
Sbjct  46   LAEQIKDFPDWLPAGWGLEFKTRKSGTNAGRQYKCYIDPVTGYKFYSKNEVLRYIKDG--  103

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQS---------RTSRKRKSVMDNQTPKTV  442
                                 +P+N   K  +S         R+S  ++  +   T + +
Sbjct  104  ---------------------IPRNPRAKRKRSVVTRITEHTRSSTNQRKGIKRSTRENL  142

Query  443  SPAVAAQDISADGLPAGWVKELRTR--TCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLET  616
               +   + + DGLP+GW+KE+R R  T   G ++D YY DPV+GY FRS++D ++Y+ET
Sbjct  143  RSQI---EYTPDGLPSGWIKEIRYRKSTSSCGAKRDQYYTDPVNGYVFRSRKDAIQYIET  199

Query  617  GDIKK  631
            G + K
Sbjct  200  GQVSK  204



>ref|XP_010273135.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 [Nelumbo 
nucifera]
 ref|XP_010273136.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 [Nelumbo 
nucifera]
Length=553

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 91/166 (55%), Gaps = 44/166 (27%)
 Frame = +2

Query  140  DWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsnen  316
            +WLP GW VE+KTR +GS  G  YKCYI+PS G K YSK +V ++L+             
Sbjct  29   EWLPAGWVVEIKTRMSGSSAGQKYKCYIAPSTGCKLYSKKEVQRYLSC------------  76

Query  317  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  496
                        +P+             KRK   + Q+    +  V  +D++ + LP GW
Sbjct  77   -----------YMPE------------VKRKECKNMQS----ACNVVLKDVTEE-LPPGW  108

Query  497  VKELRTR--TCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIK  628
            +KE+R R  TC +  + D YYIDPV+GYEFRSK+DV RYL TGD++
Sbjct  109  IKEIRVRRKTCKTK-KSDTYYIDPVNGYEFRSKKDVFRYLGTGDLE  153



>ref|XP_010934846.1| PREDICTED: uncharacterized protein LOC105054908 isoform X1 [Elaeis 
guineensis]
Length=687

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 86/167 (51%), Gaps = 36/167 (22%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsn  310
            S  WLPPGW +E++T+  GS     YK Y  PS R +FYSK  V QF+ S          
Sbjct  79   SFKWLPPGWLLEIRTQRCGSKARQIYKSYFDPSTRSRFYSKGDVLQFVKSG---------  129

Query  311  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  490
                            +  +P  +Q R         ++++P+ V   +A  +   DGLP 
Sbjct  130  ----------------KIYSPTSDQKRH-------CESESPEHV---IAQIEFYPDGLPD  163

Query  491  GWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            GW KE R +   SGIRKDPYY DPVSGY FR+ +DV RY ETG+I +
Sbjct  164  GWYKETRIKKNRSGIRKDPYYADPVSGYVFRTLKDVQRYTETGEISR  210



>ref|XP_010918513.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Elaeis guineensis]
Length=514

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 96/185 (52%), Gaps = 38/185 (21%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  289
            LA       DWLP GW +E KTR +G++ G  YKCYI P +G KFYSK +V +++     
Sbjct  72   LAEQIKDFPDWLPAGWGLEFKTRKSGTNAGRQYKCYIDPVTGYKFYSKNEVLRYIKDG--  129

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQS---------RTSRKRKSVMDNQTPKTV  442
                                 +P+N   K  +S         R+S  ++  +   T + +
Sbjct  130  ---------------------IPRNPRAKRKRSVVTRITEHTRSSTNQRKGIKRSTRENL  168

Query  443  SPAVAAQDISADGLPAGWVKELRTR--TCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLET  616
               +   + + DGLP+GW+KE+R R  T   G ++D YY DPV+GY FRS++D ++Y+ET
Sbjct  169  RSQI---EYTPDGLPSGWIKEIRYRKSTSSCGAKRDQYYTDPVNGYVFRSRKDAIQYIET  225

Query  617  GDIKK  631
            G + K
Sbjct  226  GQVSK  230



>ref|XP_006477436.1| PREDICTED: uncharacterized protein LOC102622266 [Citrus sinensis]
Length=1096

 Score =   110 bits (276),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 86/171 (50%), Gaps = 21/171 (12%)
 Frame = +2

Query  122  NTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNT  298
            + N   DWLP GW V+LKTR +GS  G  YK YI P +G KF+S  +V + L S  N N+
Sbjct  125  DENNRPDWLPDGWVVDLKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKNRNS  184

Query  299  PIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISAD  478
                +              P   +  E   + S KR+        +  +  V  +  +  
Sbjct  185  ECERKT------------TPTETSKYEGTRKVSTKRE--------RETTERVVVEKSTVV  224

Query  479  GLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             LP  W KE + +    GIRKD Y+ DPVSGY F SK+DV RYLETG+I K
Sbjct  225  DLPPSWTKETKIKKTARGIRKDRYFTDPVSGYVFCSKKDVFRYLETGEISK  275



>ref|XP_007040167.1| Uncharacterized protein TCM_016211 [Theobroma cacao]
 gb|EOY24668.1| Uncharacterized protein TCM_016211 [Theobroma cacao]
Length=1028

 Score =   110 bits (275),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 90/172 (52%), Gaps = 38/172 (22%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAAN  289
            +    ++  +WLP  W  ELKT  +G+  G +YK Y+ PS G +F+S+ +V +FL+    
Sbjct  154  IVVKAHEHPEWLPKNWFTELKTYKSGAKFGKSYKIYVDPSTGLRFHSRPEVFRFLDKG--  211

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI  469
                                         E +S  S+ +K  + + +       V  +  
Sbjct  212  -----------------------------EQKSTKSKPKKRALCSTS------KVVTRKS  236

Query  470  SADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            + D LPAGW+KE++ +   +G+R+DPYY DP SGY FRSK+D++RYLETG+I
Sbjct  237  TVDDLPAGWIKEVKIKRHANGVRRDPYYTDPASGYVFRSKKDILRYLETGEI  288


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 75/173 (43%), Gaps = 38/173 (22%)
 Frame = +2

Query  116  ASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANS  292
            A N N+  +WLP  W +ELKTR +G   G  YK YI PS G +FYSK QV +FLN     
Sbjct  78   AVNANERPEWLPKNWFMELKTRKSGVRIGKHYKIYIDPSTGSRFYSKLQVFRFLNHV---  134

Query  293  NTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDIS  472
                                        E +S   +++K V       + S  V      
Sbjct  135  ----------------------------EQKSSKPKQKKKVSH-----STSEIVVKAHEH  161

Query  473  ADGLPAGWVKELRTRTCPSGIRKD-PYYIDPVSGYEFRSKRDVMRYLETGDIK  628
             + LP  W  EL+T    +   K    Y+DP +G  F S+ +V R+L+ G+ K
Sbjct  162  PEWLPKNWFTELKTYKSGAKFGKSYKIYVDPSTGLRFHSRPEVFRFLDKGEQK  214



>gb|KEH21030.1| methyl-CpG-binding domain protein [Medicago truncatula]
Length=1325

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/198 (35%), Positives = 104/198 (53%), Gaps = 34/198 (17%)
 Frame = +2

Query  140  DWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSA----ANSNTPI  304
            +WLP GW +E++TR +G   GS YKCYI PS   KFYSK +V + L +      +SN   
Sbjct  37   EWLPNGWDIEVRTRQSGPAMGSAYKCYIDPSNTYKFYSKPEVLRHLETIRDRKCSSNKKK  96

Query  305  snenknnieesssnleVPQNQTPKENQSRT-------SRKRKSVMDNQTPK---------  436
                 +  +E   + +  Q+   KE + +T       S++ +  ++  +P          
Sbjct  97   GTSKHSPSKEEGEHTKSKQHSPSKEEEKKTKSNQHSPSKEEEKCINMHSPNKGEEKHISM  156

Query  437  ------------TVSPA-VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYE  577
                          SP+ VA ++   + LP GW+KE++ R   SGI+KD +YIDPVSGY 
Sbjct  157  HSPSKDGEKCTNMHSPSNVAGENSIVEDLPPGWIKEVKIRKHRSGIKKDWFYIDPVSGYV  216

Query  578  FRSKRDVMRYLETGDIKK  631
            F SK+DV R+L++GDI K
Sbjct  217  FHSKKDVQRFLKSGDIAK  234



>ref|XP_008437227.1| PREDICTED: uncharacterized protein LOC103482721 isoform X1 [Cucumis 
melo]
Length=635

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 89/177 (50%), Gaps = 43/177 (24%)
 Frame = +2

Query  125  TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTP  301
            +N+  +WLP GW VE +TR +GS+ G+ YKCYI P +  +FYSK +V + L +  N    
Sbjct  79   SNEHPEWLPAGWKVESRTRMSGSNVGAVYKCYIDPVTDSRFYSKPEVFRHLRTVKNKLC-  137

Query  302  IsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADG  481
                                  T KE ++    K +S             V  +    + 
Sbjct  138  ----------------------TLKERRTSNGTKSRS------------RVVIEHYKDED  163

Query  482  LPAGWVKELRTRTCPSGIRKDP-------YYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            LP GW+KE++ +    GIRKDP       +YIDP SGY FRSK++V RYLETG+I +
Sbjct  164  LPPGWIKEIKIKEKADGIRKDPLYPTFLQFYIDPKSGYIFRSKKEVFRYLETGEISR  220


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 70/163 (43%), Gaps = 39/163 (24%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsn  310
            S DWLP GWTV+ K + TG       + Y +  +G+ FY K  V  ++ S  +  +    
Sbjct  6    SPDWLPSGWTVQYKVQKTGRK----IRFYTNLETGKSFYYKDDVLGYIKSTQSQKSQ---  58

Query  311  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  490
                           P ++  K  QS  S  +++V  N+ P              + LPA
Sbjct  59   ---------------PTSRGIK-TQSGNSPVQQTVKSNEHP--------------EWLPA  88

Query  491  GWVKELRTRTCPSGIRKD-PYYIDPVSGYEFRSKRDVMRYLET  616
            GW  E RTR   S +      YIDPV+   F SK +V R+L T
Sbjct  89   GWKVESRTRMSGSNVGAVYKCYIDPVTDSRFYSKPEVFRHLRT  131



>ref|XP_008437228.1| PREDICTED: uncharacterized protein LOC103482721 isoform X2 [Cucumis 
melo]
Length=634

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 89/177 (50%), Gaps = 43/177 (24%)
 Frame = +2

Query  125  TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTP  301
            +N+  +WLP GW VE +TR +GS+ G+ YKCYI P +  +FYSK +V + L +  N    
Sbjct  78   SNEHPEWLPAGWKVESRTRMSGSNVGAVYKCYIDPVTDSRFYSKPEVFRHLRTVKNKLC-  136

Query  302  IsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADG  481
                                  T KE ++    K +S             V  +    + 
Sbjct  137  ----------------------TLKERRTSNGTKSRS------------RVVIEHYKDED  162

Query  482  LPAGWVKELRTRTCPSGIRKDP-------YYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            LP GW+KE++ +    GIRKDP       +YIDP SGY FRSK++V RYLETG+I +
Sbjct  163  LPPGWIKEIKIKEKADGIRKDPLYPTFLQFYIDPKSGYIFRSKKEVFRYLETGEISR  219



>ref|XP_009375788.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Pyrus x bretschneideri]
Length=1172

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 86/165 (52%), Gaps = 25/165 (15%)
 Frame = +2

Query  140  DWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsnen  316
            +WLP GW VEL+TR +G   G  YKCYI P     FYSK +V ++L +    N+      
Sbjct  86   EWLPNGWKVELRTRQSGVQVGKEYKCYIDPFRECTFYSKPEVFRYLKTVKRKNS------  139

Query  317  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  496
                          ++ T   +  R   ++K+V   Q  K V      +    + LP GW
Sbjct  140  --------------KSGTLTISGKRCITEKKAVTTMQLAKNV----YVEKHHVEDLPPGW  181

Query  497  VKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            +KE++     +  R+DPYY DP SGY FRSK+DV+RYLETG++ K
Sbjct  182  IKEIKVTKYANRFRRDPYYTDPDSGYVFRSKKDVIRYLETGEMSK  226



>ref|XP_009375787.1| PREDICTED: uncharacterized protein LOC103964564 isoform X1 [Pyrus 
x bretschneideri]
Length=1224

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 86/165 (52%), Gaps = 25/165 (15%)
 Frame = +2

Query  140  DWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsnen  316
            +WLP GW VEL+TR +G   G  YKCYI P     FYSK +V ++L +    N+      
Sbjct  86   EWLPNGWKVELRTRQSGVQVGKEYKCYIDPFRECTFYSKPEVFRYLKTVKRKNS------  139

Query  317  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  496
                          ++ T   +  R   ++K+V   Q  K V      +    + LP GW
Sbjct  140  --------------KSGTLTISGKRCITEKKAVTTMQLAKNV----YVEKHHVEDLPPGW  181

Query  497  VKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            +KE++     +  R+DPYY DP SGY FRSK+DV+RYLETG++ K
Sbjct  182  IKEIKVTKYANRFRRDPYYTDPDSGYVFRSKKDVIRYLETGEMSK  226



>ref|XP_011463825.1| PREDICTED: uncharacterized protein LOC101312827 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=1009

 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 86/174 (49%), Gaps = 45/174 (26%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAAN  289
            + +NT +  +WLP GW VEL+TR +G   G  YKCYI PS    FYSK +V + L +   
Sbjct  75   VVANTVEYPEWLPDGWKVELRTRKSGVQVGKEYKCYIDPSRECTFYSKPEVFRHLRTV--  132

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI  469
                                         + +S  SR  K+V+              +  
Sbjct  133  -----------------------------KRKSYKSRSHKTVV-------------VEKH  150

Query  470  SADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            + + LP GW+ E++ R   + IR+DPYY DPV GY FRSK+DV+RYL+TG+  K
Sbjct  151  NVEDLPPGWILEIKVRKVANRIRRDPYYTDPVHGYIFRSKKDVIRYLQTGETSK  204



>ref|XP_004503754.1| PREDICTED: uncharacterized protein LOC101511357 [Cicer arietinum]
Length=1262

 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 109/217 (50%), Gaps = 45/217 (21%)
 Frame = +2

Query  116  ASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYI-SPSGRKFYSKAQVSQFLNSAANS  292
            A   N+  DWLP GW +E++TR +G   GS YKCYI S +G KFYSK +V ++L +   +
Sbjct  29   AEKGNEWPDWLPDGWDMEVRTRKSGPLMGSGYKCYIDSLNGNKFYSKPEVLRYLETTKGN  88

Query  293  NTP-------------------IsnenknnieesssnleVPQNQTPK-ENQSRTSRKRKS  412
            N                     I+  + +  EE  +N   P  +  K  N+  TS++   
Sbjct  89   NCTSKKKKFTRTHFPSKEGEKHINKHSPSKEEEKRTNKHSPSKEDEKCTNKHSTSKEEAK  148

Query  413  VMDNQTP--------------------KTV---SPAVAAQDIS-ADGLPAGWVKELRTRT  520
              D  +P                    K +   SP+ A  + S  + LP GW+KE++ R 
Sbjct  149  CNDKHSPNKEEEKCTNSSQHSPNKDGEKCINMHSPSNAVGEKSTVEDLPLGWIKEVKIRK  208

Query  521  CPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
              +GI+KD +Y DPVSGY FRSK DV+RYLE+GDI K
Sbjct  209  NGNGIKKDWFYTDPVSGYVFRSKMDVLRYLESGDIGK  245



>emb|CDP05220.1| unnamed protein product [Coffea canephora]
Length=480

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 87/165 (53%), Gaps = 39/165 (24%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSG-RKFYSKAQVSQFLNSAANSNTPIsn  310
            S DWLP GW VE++ R TG  +    KCY+ PS  RKFYSK +V ++L     S  P+  
Sbjct  7    SDDWLPAGWKVEVRVRKTGKKD----KCYVDPSNERKFYSKPEVLRYLKDVGVSQ-PVHE  61

Query  311  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  490
            E                     +N+S +SR             ++     ++ +A+GLPA
Sbjct  62   ET--------------------QNKSISSR-------------LAIKFVVKEEAAEGLPA  88

Query  491  GWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            GW+KE R     + IR+DPYYIDP SG+ FRS ++V RYL+TG +
Sbjct  89   GWIKETRVTQKGNKIRRDPYYIDPESGHLFRSMKEVFRYLDTGKM  133



>ref|XP_006358896.1| PREDICTED: uncharacterized protein LOC102587100 isoform X3 [Solanum 
tuberosum]
Length=1801

 Score =   107 bits (268),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 75/210 (36%), Positives = 97/210 (46%), Gaps = 53/210 (25%)
 Frame = +2

Query  128  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPI  304
            N S +WLPPGW VELKTR +GSH G+ YK YI PS G KFYSK +VS++L +   +N   
Sbjct  111  NNSHEWLPPGWIVELKTRKSGSHAGTPYKVYIDPSTGSKFYSKPEVSKYLKTMKQNNI--  168

Query  305  snenknnieesssnleVPQNQTPKEN--------QSRTSRKRKSVMDNQTP---------  433
                    +          NQ   E+        Q+R S++ KS  D  +P         
Sbjct  169  ----TGEGQIHGDGEVSSSNQKTSEDSKNIRGGGQTRKSKRLKSDTDQASPGIEEGSFSK  224

Query  434  ---------------------------KTVSPAVAAQDISADGLPAGWVKELRTRTCPSG  532
                                          SP+VA    SAD LP GW KE  +     G
Sbjct  225  LKASQDFEEVGEQSCTTKRKKSGITRTTKTSPSVAVDCDSADELPHGWKKE--SSQNDRG  282

Query  533  IRKDPYYIDPVSGYEFRSKRDVMRYLETGD  622
             R+   Y DPV GY+F SK++V+RYL+TGD
Sbjct  283  TREYLLYTDPVHGYKFYSKKEVLRYLQTGD  312


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  458   AQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIK  628
             +++ S DGLP GW  E R R     I+KDPYY+DPV GY FRSK+DVMRYL+TGDI+
Sbjct  1141  SKEASVDGLPPGWKTEFRMRKNARVIKKDPYYMDPVLGYVFRSKKDVMRYLQTGDIR  1197


 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  464  DISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            D S D LP GW KE++     +GIRKDP YIDPV GY FRSK+DV RYL+TGDI
Sbjct  527  DPSLDDLPPGWKKEIKITKKANGIRKDPLYIDPVDGYVFRSKKDVFRYLQTGDI  580


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 85/167 (51%), Gaps = 16/167 (10%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsn  310
            S DW PPGWT ++K       NG   K Y +  +G+KFYSK +V+++LN+    +     
Sbjct  6    SPDWPPPGWTEDVKV-----SNGRKIKYYTNGQTGKKFYSKKEVARYLNTKDTCDDVTQA  60

Query  311  enknnieesssnleVPQNQTP---KENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADG  481
                    S +N+    NQ     K+N S+     KS  +N     VS AV   + S + 
Sbjct  61   MTIQGKNCSENNVSHMDNQDESFSKDNVSQMDNLDKSCSEN----NVSEAVGRPNNSHEW  116

Query  482  LPAGWVKELRTRTCPSGIRKDPY--YIDPVSGYEFRSKRDVMRYLET  616
            LP GW+ EL+TR   S     PY  YIDP +G +F SK +V +YL+T
Sbjct  117  LPPGWIVELKTRKSGSHA-GTPYKVYIDPSTGSKFYSKPEVSKYLKT  162



>ref|XP_007038658.1| Methyl-CPG-binding domain protein 13, putative isoform 1 [Theobroma 
cacao]
 gb|EOY23159.1| Methyl-CPG-binding domain protein 13, putative isoform 1 [Theobroma 
cacao]
Length=625

 Score =   106 bits (264),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 83/167 (50%), Gaps = 39/167 (23%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsn  310
            + DWLPPGW VE++ R  G  +     CY +P G  +F S+A+VS++L+           
Sbjct  6    TDDWLPPGWKVEVRQRRNGKKDKLRVMCYYAPCGELRFISRAEVSRYLDKCG--------  57

Query  311  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  490
                                      +T  K     +N + K  S  V  +  +A+GLP 
Sbjct  58   -------------------------CKTEEK-----ENGSGKQSSKNVTVEKAAAEGLPP  87

Query  491  GWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            GW+KE+R       +RKDP+Y DPVSGY FRS +D +RY+ETG++ K
Sbjct  88   GWIKEIRITKRAHRVRKDPFYTDPVSGYVFRSMKDALRYVETGELGK  134



>ref|XP_007038659.1| Methyl-CPG-binding domain protein 13, putative isoform 2 [Theobroma 
cacao]
 gb|EOY23160.1| Methyl-CPG-binding domain protein 13, putative isoform 2 [Theobroma 
cacao]
Length=621

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 84/167 (50%), Gaps = 43/167 (26%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsn  310
            + DWLPPGW VE++ R     NG   KCY +P G  +F S+A+VS++L+           
Sbjct  6    TDDWLPPGWKVEVRQR----RNGKKDKCYYAPCGELRFISRAEVSRYLDKCG--------  53

Query  311  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  490
                                      +T  K     +N + K  S  V  +  +A+GLP 
Sbjct  54   -------------------------CKTEEK-----ENGSGKQSSKNVTVEKAAAEGLPP  83

Query  491  GWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            GW+KE+R       +RKDP+Y DPVSGY FRS +D +RY+ETG++ K
Sbjct  84   GWIKEIRITKRAHRVRKDPFYTDPVSGYVFRSMKDALRYVETGELGK  130



>ref|XP_010325421.1| PREDICTED: uncharacterized protein LOC101264354 isoform X3 [Solanum 
lycopersicum]
Length=1846

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 105/209 (50%), Gaps = 47/209 (22%)
 Frame = +2

Query  128  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPI  304
            N S +WLPPGW VELKTR +GSH G +YK YI PS G KFYSK +VS++L +   +N   
Sbjct  111  NNSHEWLPPGWIVELKTRKSGSHAGLSYKVYIDPSTGSKFYSKPEVSKYLKTMKQNNIAG  170

Query  305  snenknnieesssnleVPQNQTPKENQSRTSRKRKS------------------VMDNQT  430
              +     E S S L+  Q+      QS T++++KS                  +++ +T
Sbjct  171  EGQTPGIEEGSFSKLKASQDFEEVGEQSCTTKRKKSGITRTTKTYPSHGAGEVFILNEKT  230

Query  431  -------------------------PKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGI  535
                                      K+VS +VA    SAD LP GW KE  +R    G 
Sbjct  231  SLGSKENGAQSPQSKRQKPGSGCPSAKSVS-SVAVDCDSADELPPGWKKE--SRKNDRGT  287

Query  536  RKDPYYIDPVSGYEFRSKRDVMRYLETGD  622
            R    Y DPV GY+F SK++V+RYL+TGD
Sbjct  288  RNYLLYTDPVHGYKFHSKKEVLRYLQTGD  316


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  458   AQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIK  628
             +++ S DGLP GW  E R R   S I+KDPYY DPV GY FRSK+DVMRYL+TGDI+
Sbjct  1181  SKEASVDGLPPGWKTEFRIRKNASVIKKDPYYTDPVHGYVFRSKKDVMRYLQTGDIR  1237


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  464  DISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            D S D LP GW KE++     +GIRKDP YIDPV GY FRSK+DV RYL+TGDI
Sbjct  536  DPSLDDLPPGWKKEIKITKKANGIRKDPLYIDPVDGYVFRSKKDVFRYLQTGDI  589


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 83/169 (49%), Gaps = 20/169 (12%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsn  310
            S DW PPGWT ++K        G   K Y +  +G+KFYSK +V+++L +    +     
Sbjct  6    SPDWPPPGWTEDVKV-----SKGRKIKYYTNGETGKKFYSKKEVARYLKTKDTCDDVTQA  60

Query  311  enknnieesssnleVPQNQTPKENQSRT-SRKRKSVMDNQ----TPKTVSPAVAAQDISA  475
             N      S        N +  +NQ  + ++   S MDNQ    +   VS  V   + S 
Sbjct  61   MNIQGKSFSE------NNVSDMDNQDGSFAKDNGSQMDNQDNCCSENNVSQTVGKPNNSH  114

Query  476  DGLPAGWVKELRTRTCPS--GIRKDPYYIDPVSGYEFRSKRDVMRYLET  616
            + LP GW+ EL+TR   S  G+     YIDP +G +F SK +V +YL+T
Sbjct  115  EWLPPGWIVELKTRKSGSHAGLSYK-VYIDPSTGSKFYSKPEVSKYLKT  162



>ref|XP_008791903.1| PREDICTED: uncharacterized protein LOC103708650 [Phoenix dactylifera]
Length=569

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 80/167 (48%), Gaps = 36/167 (22%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsn  310
            S  WLPPGW +E++T+  GS     Y  Y  PS G +FYSK  V QF+ S          
Sbjct  79   SFKWLPPGWLLEIRTQRRGSKAQQIYMSYFEPSTGSRFYSKGDVLQFVKSG---------  129

Query  311  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  490
                            +   P  +Q+R              +++   +A  +   DGLP 
Sbjct  130  ----------------KIYGPTSDQTRHCEA----------ESLENVIAQIEFYPDGLPH  163

Query  491  GWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            GW KE+R +   SG R+DPYY DP SGY FR+ +DV RY ETG+I K
Sbjct  164  GWYKEIRIKKNRSGFRRDPYYADPESGYVFRTLKDVQRYTETGEISK  210



>ref|XP_009369054.1| PREDICTED: uncharacterized protein LOC103958513 [Pyrus x bretschneideri]
Length=1208

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 86/167 (51%), Gaps = 28/167 (17%)
 Frame = +2

Query  140  DWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsnen  316
            +WLP GW VEL+ R +G+  G  YKCYI PS    FYSK +V ++L +            
Sbjct  86   EWLPNGWKVELRIRQSGAQVGREYKCYIDPSRECTFYSKPEVFRYLKTV-----------  134

Query  317  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQ--TPKTVSPAVAAQDISADGLPA  490
                          + ++ K    ++   ++ + + +  T   ++  V  +    + LP 
Sbjct  135  --------------KRKSSKSGNLKSISSKRCITEGKDVTTMQLTKNVYVEKHHVEDLPP  180

Query  491  GWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            GW+KE++     +  RKDPYY DP SGY FRSK+DV+ YLETG+I K
Sbjct  181  GWIKEIKVTKYANRFRKDPYYTDPDSGYVFRSKKDVICYLETGEISK  227



>ref|XP_006358895.1| PREDICTED: uncharacterized protein LOC102587100 isoform X2 [Solanum 
tuberosum]
Length=1805

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 77/209 (37%), Positives = 105/209 (50%), Gaps = 47/209 (22%)
 Frame = +2

Query  128  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPI  304
            N S +WLPPGW VELKTR +GSH G+ YK YI PS G KFYSK +VS++L +   +N   
Sbjct  111  NNSHEWLPPGWIVELKTRKSGSHAGTPYKVYIDPSTGSKFYSKPEVSKYLKTMKQNNITG  170

Query  305  snenknnieesssnleVPQNQTPKENQSRTSRKRKS------------------VMDNQT  430
              +     E S S L+  Q+      QS T++++KS                  +++ +T
Sbjct  171  EGQIPGIEEGSFSKLKASQDFEEVGEQSCTTKRKKSGITRTTKTSPSHGAGEDFILNEKT  230

Query  431  -------------------------PKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGI  535
                                      K+VS +VA    SAD LP GW KE  +     G 
Sbjct  231  SLGSKENGAQSPQSKRQKPGSGCLSAKSVS-SVAVDCDSADELPHGWKKE--SSQNDRGT  287

Query  536  RKDPYYIDPVSGYEFRSKRDVMRYLETGD  622
            R+   Y DPV GY+F SK++V+RYL+TGD
Sbjct  288  REYLLYTDPVHGYKFYSKKEVLRYLQTGD  316


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  458   AQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIK  628
             +++ S DGLP GW  E R R     I+KDPYY+DPV GY FRSK+DVMRYL+TGDI+
Sbjct  1145  SKEASVDGLPPGWKTEFRMRKNARVIKKDPYYMDPVLGYVFRSKKDVMRYLQTGDIR  1201


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  464  DISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            D S D LP GW KE++     +GIRKDP YIDPV GY FRSK+DV RYL+TGDI
Sbjct  531  DPSLDDLPPGWKKEIKITKKANGIRKDPLYIDPVDGYVFRSKKDVFRYLQTGDI  584


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 85/167 (51%), Gaps = 16/167 (10%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsn  310
            S DW PPGWT ++K       NG   K Y +  +G+KFYSK +V+++LN+    +     
Sbjct  6    SPDWPPPGWTEDVKV-----SNGRKIKYYTNGQTGKKFYSKKEVARYLNTKDTCDDVTQA  60

Query  311  enknnieesssnleVPQNQTP---KENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADG  481
                    S +N+    NQ     K+N S+     KS  +N     VS AV   + S + 
Sbjct  61   MTIQGKNCSENNVSHMDNQDESFSKDNVSQMDNLDKSCSEN----NVSEAVGRPNNSHEW  116

Query  482  LPAGWVKELRTRTCPSGIRKDPY--YIDPVSGYEFRSKRDVMRYLET  616
            LP GW+ EL+TR   S     PY  YIDP +G +F SK +V +YL+T
Sbjct  117  LPPGWIVELKTRKSGSHA-GTPYKVYIDPSTGSKFYSKPEVSKYLKT  162



>ref|XP_006590528.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
[Glycine max]
Length=163

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 83/143 (58%), Gaps = 8/143 (6%)
 Frame = +2

Query  200  GSTYKCYISPSGRKFYSKAQVSQFLNSA-ANSNTPIsnenknnieesssnleVPQNQTPK  376
            G  YKCYI+PSG KFYSK +V ++L++   NSN+  S + K      +      ++  P 
Sbjct  2    GHGYKCYIAPSGHKFYSKPEVLRYLDTVNINSNSHTSKKEKICKSNDTVEKSTIEDLPP-  60

Query  377  ENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYI  556
              Q +  + RK   DN+    V P V  +    D LP GW+ E + R   +G RKD +YI
Sbjct  61   -GQIKEVKIRKGSNDNR----VDPDVVEKSPVED-LPPGWITEAKVRKGDTGNRKDMFYI  114

Query  557  DPVSGYEFRSKRDVMRYLETGDI  625
            DPVSGY FRSK+D +RY+++GDI
Sbjct  115  DPVSGYVFRSKKDALRYVKSGDI  137



>gb|KJB52811.1| hypothetical protein B456_008G278300 [Gossypium raimondii]
Length=600

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 83/167 (50%), Gaps = 43/167 (26%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsn  310
            S DWLPPGW VE++ R     NG   KCY +P G  +F S+A+V ++L +          
Sbjct  6    SDDWLPPGWKVEVRQR----RNGKKDKCYYAPCGELRFISRAEVVRYLKNCG--------  53

Query  311  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  490
                                     S+T  K K V   Q+ K V+     +   A+GLP 
Sbjct  54   -------------------------SKTEEKEK-VPSKQSSKNVT----VEKAEAEGLPP  83

Query  491  GWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            GW KE++     + +R+DP+Y DPVSGY FRS +D +RY+ETG + K
Sbjct  84   GWTKEVKITKKGNKVRRDPFYTDPVSGYVFRSMKDALRYVETGKLGK  130



>gb|KHG28622.1| Methyl-CpG-binding domain-containing 13 -like protein [Gossypium 
arboreum]
Length=598

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 82/167 (49%), Gaps = 43/167 (26%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsn  310
            S DWLPPGW VE++ R     NG   KCY +P G  +F S+A+V ++L            
Sbjct  6    SDDWLPPGWKVEVRQR----RNGKKDKCYYTPCGELRFISRAEVVRYLEKCG--------  53

Query  311  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  490
                                     S+T  K K V   Q+ K ++     +   A+GLP 
Sbjct  54   -------------------------SKTEEKEK-VPSKQSSKNIT----VEKAEAEGLPP  83

Query  491  GWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            GW KE++     + +R+DP+Y DPVSGY FRS +D +RY+ETG + K
Sbjct  84   GWTKEVKITKKGNKVRRDPFYTDPVSGYVFRSMKDALRYVETGKLGK  130



>ref|XP_009401688.1| PREDICTED: uncharacterized protein LOC103985652 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=573

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/163 (37%), Positives = 81/163 (50%), Gaps = 24/163 (15%)
 Frame = +2

Query  140  DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnen  316
            DWLP GWT   KT    + +G+   C+  P +G +F SK +V Q L S     +P     
Sbjct  8    DWLPEGWTAVAKT----TRSGAVLWCFHDPYTGSRFCSKKEVLQHLKSGKFRGSPTKQTR  63

Query  317  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  496
                             T  E +++T+  +   ++N TP                LP GW
Sbjct  64   SITTRSMEKLCA----STNLEEENKTNSAKNDQIEN-TPYE--------------LPHGW  104

Query  497  VKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            +KE+R R   + I+KDP+Y DPVSGYEFRS +DV RYLETGDI
Sbjct  105  IKEIRLRNSGTKIKKDPFYFDPVSGYEFRSLKDVFRYLETGDI  147



>ref|XP_010676507.1| PREDICTED: uncharacterized protein LOC104892309 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1021

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/175 (37%), Positives = 98/175 (56%), Gaps = 16/175 (9%)
 Frame = +2

Query  137  SDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS--AANSNTPIs  307
            S+WLP GW +E + R +G+  G+ YKC+I PS G K +SK +V ++L S      N   S
Sbjct  82   SEWLPSGWVMETRFRKSGARVGTEYKCFIDPSTGTKLFSKPEVLRYLGSEKTKQHNAESS  141

Query  308  nenknnieesssnleVPQ------NQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI  469
             +      E SS+  V +      N  PK +Q   SR RKS+  ++ PK V+   A ++ 
Sbjct  142  RQKDRGGSEHSSSKVVDRLSAQKSNLEPKVSQISKSRVRKSI-SSEKPKVVTERTADEE-  199

Query  470  SADGLPAGWVKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
                LP+GW+KE R +   +  +R+D +Y DP S   F SK +V+RY+ETG++ +
Sbjct  200  ----LPSGWIKETRIKMLDNKVVRRDSFYSDPASRLVFCSKLEVLRYVETGEVSR  250



>ref|XP_010676508.1| PREDICTED: uncharacterized protein LOC104892309 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=942

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 99/176 (56%), Gaps = 17/176 (10%)
 Frame = +2

Query  137  SDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS-------AANS  292
            S+WLP GW +E + R +G+  G+ YKC+I PS G K +SK +V ++L S       A +S
Sbjct  82   SEWLPSGWVMETRFRKSGARVGTEYKCFIDPSTGTKLFSKPEVLRYLGSEKTKQHNAESS  141

Query  293  NTPIsnenknnieesssnleVPQ--NQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQD  466
                   ++++  +   +    Q  N  PK +Q   SR RKS+  ++ PK V+   A ++
Sbjct  142  RQKDRGGSEHSSSKKVVDRLSAQKSNLEPKVSQISKSRVRKSI-SSEKPKVVTERTADEE  200

Query  467  ISADGLPAGWVKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
                 LP+GW+KE R +   +  +R+D +Y DP S   F SK +V+RY+ETG++ +
Sbjct  201  -----LPSGWIKETRIKMLDNKVVRRDSFYSDPASRLVFCSKLEVLRYVETGEVSR  251



>ref|XP_010676506.1| PREDICTED: uncharacterized protein LOC104892309 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1022

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 99/176 (56%), Gaps = 17/176 (10%)
 Frame = +2

Query  137  SDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS-------AANS  292
            S+WLP GW +E + R +G+  G+ YKC+I PS G K +SK +V ++L S       A +S
Sbjct  82   SEWLPSGWVMETRFRKSGARVGTEYKCFIDPSTGTKLFSKPEVLRYLGSEKTKQHNAESS  141

Query  293  NTPIsnenknnieesssnleVPQ--NQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQD  466
                   ++++  +   +    Q  N  PK +Q   SR RKS+  ++ PK V+   A ++
Sbjct  142  RQKDRGGSEHSSSKKVVDRLSAQKSNLEPKVSQISKSRVRKSI-SSEKPKVVTERTADEE  200

Query  467  ISADGLPAGWVKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
                 LP+GW+KE R +   +  +R+D +Y DP S   F SK +V+RY+ETG++ +
Sbjct  201  -----LPSGWIKETRIKMLDNKVVRRDSFYSDPASRLVFCSKLEVLRYVETGEVSR  251



>gb|EMS68477.1| hypothetical protein TRIUR3_20569 [Triticum urartu]
Length=619

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 77/164 (47%), Gaps = 41/164 (25%)
 Frame = +2

Query  143  WLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsnenk  319
            WLP GW VE++    G+     YK Y+  P+G +F+SK  V +++N    S   +     
Sbjct  167  WLPDGWVVEVRA---GTMQDKMYKFYVHLPTGMRFFSKEDVLRYVNEGKISECDV-----  218

Query  320  nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWV  499
                                         K + D  +   +   +A  + + DGLP GWV
Sbjct  219  -----------------------------KGLCDTISEDNI---LAQVEFNPDGLPKGWV  246

Query  500  KELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            KEL  R C  GIRKDPYY DPVS   FR+ + V+ YL+TG+I +
Sbjct  247  KELVFRKCNDGIRKDPYYTDPVSHLLFRTLKSVISYLQTGEISR  290



>ref|XP_008234128.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Prunus mume]
Length=547

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 79/161 (49%), Gaps = 39/161 (24%)
 Frame = +2

Query  131  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSNTPIsn  310
            +S DWLP GWTVE+K R+ G  +   Y    S SG KF SKA+VS++LN+          
Sbjct  5    KSEDWLPTGWTVEVKVRNNGKRDKYYYD---SASGHKFNSKAEVSRYLNT----------  51

Query  311  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  490
                                     S+ S + K  ++    ++ +  V  + I A GLP 
Sbjct  52   -------------------------SQISDEVKQKVEETLKRSANDVVVEKTI-AGGLPQ  85

Query  491  GWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLE  613
            GW+KE+R       IR+D YYIDPVS   FRS +DV RYLE
Sbjct  86   GWIKEIRMTKKDHKIRRDSYYIDPVSEKLFRSMKDVNRYLE  126



>ref|XP_007152298.1| hypothetical protein PHAVU_004G117900g [Phaseolus vulgaris]
 gb|ESW24292.1| hypothetical protein PHAVU_004G117900g [Phaseolus vulgaris]
Length=579

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 76/165 (46%), Gaps = 49/165 (30%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsn  310
            S D LPPGWTVE+K R     NG   K Y  PS G KF SK +V ++L++A N       
Sbjct  6    SDDQLPPGWTVEVKVRK----NGKRDKYYFLPSSGLKFNSKVEVYRYLDNANN-------  54

Query  311  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  490
                                                   + + +SP V  +   A+GLP 
Sbjct  55   -------------------------------------KVSIQKISPNVVVEKAIAEGLPP  77

Query  491  GWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            GWVK+ R  T    +R+D YYIDPVSGY F S  DV  YLE+G++
Sbjct  78   GWVKKTRIATKGDTVRRDTYYIDPVSGYAFHSIEDVDHYLESGEV  122



>gb|EEC76899.1| hypothetical protein OsI_15124 [Oryza sativa Indica Group]
 gb|EEE53269.1| hypothetical protein OsJ_36209 [Oryza sativa Japonica Group]
Length=371

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 74/164 (45%), Gaps = 40/164 (24%)
 Frame = +2

Query  143  WLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsnenk  319
            WLP GW +E+  R+ G      YK Y+  P+G +F SK  V  + N    S   +     
Sbjct  168  WLPDGWAIEV--RAGGKKMEKMYKFYVHLPTGMRFLSKENVLLYSNEGKISRCDV-----  220

Query  320  nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWV  499
                                         K + D  +   +   +A  + + DGLP GWV
Sbjct  221  -----------------------------KGLCDTSSEDNI---LAMVEFNPDGLPEGWV  248

Query  500  KELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            KE+  R C  GIRKDPYY DPVS + FR+ + V+ YLETG I K
Sbjct  249  KEIIFRKCNDGIRKDPYYTDPVSRHVFRTLKSVINYLETGQITK  292



>ref|NP_001052334.1| Os04g0266400 [Oryza sativa Japonica Group]
 dbj|BAF14248.1| Os04g0266400 [Oryza sativa Japonica Group]
Length=313

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 74/164 (45%), Gaps = 40/164 (24%)
 Frame = +2

Query  143  WLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsnenk  319
            WLP GW +E+  R+ G      YK Y+  P+G +F SK  V  + N    S   +     
Sbjct  168  WLPDGWAIEV--RAGGKKMEKMYKFYVHLPTGMRFLSKENVLLYSNEGKISRCDV-----  220

Query  320  nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWV  499
                                         K + D  +   +   +A  + + DGLP GWV
Sbjct  221  -----------------------------KGLCDTSSEDNI---LAMVEFNPDGLPEGWV  248

Query  500  KELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            KE+  R C  GIRKDPYY DPVS + FR+ + V+ YLETG I K
Sbjct  249  KEIIFRKCNDGIRKDPYYTDPVSRHVFRTLKSVINYLETGQITK  292



>emb|CAD39968.2| OSJNBa0072D08.3 [Oryza sativa Japonica Group]
Length=505

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 74/164 (45%), Gaps = 40/164 (24%)
 Frame = +2

Query  143  WLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsnenk  319
            WLP GW +E+  R+ G      YK Y+  P+G +F SK  V  + N    S   +     
Sbjct  105  WLPDGWAIEV--RAGGKKMEKMYKFYVHLPTGMRFLSKENVLLYSNEGKISRCDV-----  157

Query  320  nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWV  499
                                         K + D  +   +   +A  + + DGLP GWV
Sbjct  158  -----------------------------KGLCDTSSEDNI---LAMVEFNPDGLPEGWV  185

Query  500  KELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            KE+  R C  GIRKDPYY DPVS + FR+ + V+ YLETG I K
Sbjct  186  KEIIFRKCNDGIRKDPYYTDPVSRHVFRTLKSVINYLETGQITK  229



>emb|CAH66253.1| OSIGBa0139I12.2 [Oryza sativa Indica Group]
Length=505

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 74/164 (45%), Gaps = 40/164 (24%)
 Frame = +2

Query  143  WLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsnenk  319
            WLP GW +E+  R+ G      YK Y+  P+G +F SK  V  + N    S   +     
Sbjct  105  WLPDGWAIEV--RAGGKKMEKMYKFYVHLPTGMRFLSKENVLLYSNEGKISRCDV-----  157

Query  320  nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWV  499
                                         K + D  +   +   +A  + + DGLP GWV
Sbjct  158  -----------------------------KGLCDTSSEDNI---LAMVEFNPDGLPEGWV  185

Query  500  KELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            KE+  R C  GIRKDPYY DPVS + FR+ + V+ YLETG I K
Sbjct  186  KEIIFRKCNDGIRKDPYYTDPVSRHVFRTLKSVINYLETGQITK  229



>dbj|BAG89597.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97335.1| unnamed protein product [Oryza sativa Japonica Group]
Length=568

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 74/164 (45%), Gaps = 40/164 (24%)
 Frame = +2

Query  143  WLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsnenk  319
            WLP GW +E+  R+ G      YK Y+  P+G +F SK  V  + N    S   +     
Sbjct  168  WLPDGWAIEV--RAGGKKMEKMYKFYVHLPTGMRFLSKENVLLYSNEGKISRCDV-----  220

Query  320  nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWV  499
                                         K + D  +   +   +A  + + DGLP GWV
Sbjct  221  -----------------------------KGLCDTSSEDNI---LAMVEFNPDGLPEGWV  248

Query  500  KELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            KE+  R C  GIRKDPYY DPVS + FR+ + V+ YLETG I K
Sbjct  249  KEIIFRKCNDGIRKDPYYTDPVSRHVFRTLKSVINYLETGQITK  292



>gb|EMT22364.1| hypothetical protein F775_06449 [Aegilops tauschii]
Length=566

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 76/164 (46%), Gaps = 41/164 (25%)
 Frame = +2

Query  143  WLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsnenk  319
            WLP GW VE++    G+     YK Y+  P+G +F+SK  V +++N    S   +     
Sbjct  144  WLPDGWVVEVRA---GTMRDKMYKFYVHLPTGMRFFSKEDVLRYVNEGKISEWDV-----  195

Query  320  nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWV  499
                                         K + D  +   +   +A  + + DGLP GWV
Sbjct  196  -----------------------------KGLCDTISEDNI---LAQVEFNPDGLPKGWV  223

Query  500  KELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            KEL  R C  GIRKDPYY DPVS   FR+ +  + YL+TG+I K
Sbjct  224  KELVFRKCNDGIRKDPYYTDPVSHLLFRTLKSAISYLQTGEISK  267



>ref|XP_009390529.1| PREDICTED: uncharacterized protein LOC103976890 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=569

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 83/175 (47%), Gaps = 17/175 (10%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAAN  289
            L      S DWLP GW +E +T+  G++ G   KCY +PS G +FYSK QV + LN+  +
Sbjct  25   LVREVKDSPDWLPSGWVLETRTQKNGAYAGREIKCYYNPSTGSRFYSKKQVFRHLNARKD  84

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI  469
             +  I                 P   T +E         KS+ ++ +    S   A    
Sbjct  85   FSPTIRETRSITSSNMKK----PCTSTSQE---------KSIKESSSNNVCS--YAPTGY  129

Query  470  SADGLPAGWVKELRTRTCPSGI-RKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             ++ LP GW+KE+R R    G    +  YIDP   Y FRS +D  RY+ETGD+ K
Sbjct  130  GSNELPHGWIKEIRFRKYKRGKPVNETLYIDPDGEYAFRSLKDAFRYIETGDVNK  184



>ref|XP_003581103.2| PREDICTED: uncharacterized protein LOC100844950 isoform X1 [Brachypodium 
distachyon]
Length=533

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 76/164 (46%), Gaps = 40/164 (24%)
 Frame = +2

Query  143  WLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsnenk  319
            WLP GW +E+  R+ G      YK Y+  P+G +F+SK  V +++N    S         
Sbjct  187  WLPDGWVIEV--RAGGKVMDKMYKFYVHLPTGTRFFSKEDVLRYVNEGEIS---------  235

Query  320  nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWV  499
                                        R++V +     +    +A  + + DGLP GWV
Sbjct  236  ----------------------------RRNVNELCCTSSEENILAQVEFNPDGLPNGWV  267

Query  500  KELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            KE+  R C  GIRKDPYY DP+S   FR+ + V  YLETG+I K
Sbjct  268  KEVIFRKCNDGIRKDPYYTDPISHLVFRTLKSVTNYLETGEISK  311



>ref|XP_009390518.1| PREDICTED: uncharacterized protein LOC103976890 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=589

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 84/179 (47%), Gaps = 29/179 (16%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAAN  289
            L      S DWLP GW +E +T+  G++ G   KCY +PS G +FYSK QV + LN+  +
Sbjct  25   LVREVKDSPDWLPSGWVLETRTQKNGAYAGREIKCYYNPSTGSRFYSKKQVFRHLNARKD  84

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRK----SVMDNQTPKTVSPAVA  457
             +  I                       +E +S TS   K    S    ++ K  S   A
Sbjct  85   FSPTI-----------------------RETRSITSSNMKKPCTSTSQEKSIKESSSNNA  121

Query  458  AQDISADGLPAGWVKELRTRTCPSGI-RKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
                 ++ LP GW+KE+R R    G    +  YIDP   Y FRS +D  RY+ETGD+ K
Sbjct  122  PTGYGSNELPHGWIKEIRFRKYKRGKPVNETLYIDPDGEYAFRSLKDAFRYIETGDVNK  180



>ref|XP_009390512.1| PREDICTED: uncharacterized protein LOC103976890 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=593

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 83/175 (47%), Gaps = 17/175 (10%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAAN  289
            L      S DWLP GW +E +T+  G++ G   KCY +PS G +FYSK QV + LN+  +
Sbjct  25   LVREVKDSPDWLPSGWVLETRTQKNGAYAGREIKCYYNPSTGSRFYSKKQVFRHLNARKD  84

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI  469
             +  I                 P   T +E         KS+ ++ +    S   A    
Sbjct  85   FSPTIRETRSITSSNMKK----PCTSTSQE---------KSIKESSSNNVCS--YAPTGY  129

Query  470  SADGLPAGWVKELRTRTCPSGI-RKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             ++ LP GW+KE+R R    G    +  YIDP   Y FRS +D  RY+ETGD+ K
Sbjct  130  GSNELPHGWIKEIRFRKYKRGKPVNETLYIDPDGEYAFRSLKDAFRYIETGDVNK  184



>gb|KJB39638.1| hypothetical protein B456_007G022700 [Gossypium raimondii]
Length=880

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/215 (30%), Positives = 87/215 (40%), Gaps = 86/215 (40%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTG---SH------------------------------------  196
            S DWLP GWT E + + TG   +H                                    
Sbjct  6    SPDWLPAGWTQEFRFQKTGRRITHYVNLATGQKFFTKDDLIRYTKTETKTESKQYDDRLL  65

Query  197  ---------NGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsnenknnieesssn  346
                       S    Y+ PS G +FYSK  V +FL  A   N                 
Sbjct  66   TLKQITKPSTNSQVNIYVDPSTGLRFYSKPAVFRFLKQAEQRN-----------------  108

Query  347  leVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCP  526
                  +T K+ Q+  SRK+               V  +  + D LPAGW+KE++ +   
Sbjct  109  -----RKTNKKKQAAYSRKK---------------VVIEKSTVDDLPAGWIKEIKIQRNA  148

Query  527  SGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            +G+RKDPYY DPVSGY FRSK+ V+ YLETG+I +
Sbjct  149  NGVRKDPYYTDPVSGYVFRSKKAVLHYLETGEIAR  183



>ref|XP_004977782.1| PREDICTED: uncharacterized protein LOC101761695 [Setaria italica]
Length=511

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 76/167 (46%), Gaps = 40/167 (24%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsn  310
            S  WLP GW +E+  R+ G      YK Y  P +G +F SKA+V  ++N    S + +  
Sbjct  160  SHTWLPGGWLIEV--RAGGKKMNKMYKFYFHPPTGMRFLSKAEVLHYVNEGKISASDMDV  217

Query  311  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  490
                                              + D +T   +   +A  + + DGLP 
Sbjct  218  ----------------------------------LCDTRTDDNI---LAHVEFNPDGLPD  240

Query  491  GWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            GWVKE   R C  GIRKDPYY DP+S   FR+ + V+ YL TG+I K
Sbjct  241  GWVKETIFRNCNDGIRKDPYYTDPISRRVFRTLKSVLSYLGTGEISK  287



>ref|XP_009418270.1| PREDICTED: uncharacterized protein LOC103998509 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=268

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 81/177 (46%), Gaps = 38/177 (21%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAAN  289
            L      S  WLP GW +E++TR  G+     YKCY+  S G  FYSK +V QF+ +   
Sbjct  72   LVHKVKDSLKWLPRGWIMEIRTRKIGAEAEERYKCYLHQSTGTVFYSKEEVLQFIEAGNA  131

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI  469
               P                              +SRKR+    N++   V   +   + 
Sbjct  132  CGPPT-----------------------------SSRKRRC--RNKSGDLVLYRI---EY  157

Query  470  SADGLPAGWVKEL---RTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            S DGLP GW+KE+   R +   S  ++D YY DP SGY FR+ +D + Y+E G + K
Sbjct  158  SPDGLPDGWIKEIKFRRNKDKKSPTKQDAYYTDPESGYVFRTLKDCICYIEHGVLSK  214



>gb|KHN16846.1| Methyl-CpG-binding domain-containing protein 13 [Glycine soja]
Length=1122

 Score = 89.7 bits (221),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 57/87 (66%), Gaps = 6/87 (7%)
 Frame = +2

Query  368  TPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDP  547
            +P +N   + +K  S MD+ T       V  +  + + LP GWVKEL+ R    GIRKDP
Sbjct  216  SPIDNSCSSKKKNCSNMDSPT------DVVVEKSTVEDLPPGWVKELKIRKNSKGIRKDP  269

Query  548  YYIDPVSGYEFRSKRDVMRYLETGDIK  628
            +YIDP SGY FRSK+DV+RYLE+GDI+
Sbjct  270  FYIDPASGYVFRSKKDVLRYLESGDIR  296


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = +2

Query  128  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  283
            N+  DWLP GW VE++TR +G H GS YKCYI P  G KF+SK +V ++L + 
Sbjct  33   NEHPDWLPDGWNVEVRTRKSGVHMGSGYKCYIEPLKGYKFFSKPEVLRYLETV  85



>ref|NP_001159179.1| uncharacterized protein LOC100304264 [Zea mays]
 gb|ACN25334.1| unknown [Zea mays]
Length=397

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 77/169 (46%), Gaps = 40/169 (24%)
 Frame = +2

Query  128  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPI  304
            ++S  WLP GW +E+  R+ G      YK Y+  P+G++F SKA+V  F+N    S   +
Sbjct  55   HESHTWLPRGWVIEV--RAGGKKMDKMYKFYVHLPTGQRFLSKAEVLHFVNKGMVSTCDM  112

Query  305  snenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGL  484
                                                + D  T   +   +A  + + DGL
Sbjct  113  DV----------------------------------LCDTSTDDNI---LAHVEFNPDGL  135

Query  485  PAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            P GWVKE  +R    GIRKD YY DPVS   FR+ + V+ YL TG+I +
Sbjct  136  PDGWVKETISRKFNDGIRKDQYYTDPVSHRVFRTLKSVLSYLGTGEISR  184



>ref|XP_003532403.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Glycine max]
 ref|XP_006584707.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Glycine max]
Length=1122

 Score = 89.7 bits (221),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 57/87 (66%), Gaps = 6/87 (7%)
 Frame = +2

Query  368  TPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDP  547
            +P +N   + +K  S MD+ T       V  +  + + LP GWVKEL+ R    GIRKDP
Sbjct  216  SPIDNSCSSKKKNCSNMDSPT------DVVVEKSTVEDLPPGWVKELKIRKNSKGIRKDP  269

Query  548  YYIDPVSGYEFRSKRDVMRYLETGDIK  628
            +YIDP SGY FRSK+DV+RYLE+GDI+
Sbjct  270  FYIDPASGYVFRSKKDVLRYLESGDIR  296


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = +2

Query  128  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  283
            N+  DWLP GW VE++TR +G H GS YKCYI P  G KF+SK +V ++L + 
Sbjct  33   NEHPDWLPDGWNVEVRTRKSGVHMGSGYKCYIEPLKGYKFFSKPEVLRYLETV  85



>ref|XP_008439211.1| PREDICTED: methyl-CpG-binding domain-containing protein 7 isoform 
X4 [Cucumis melo]
Length=165

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/168 (33%), Positives = 84/168 (50%), Gaps = 33/168 (20%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsn  310
            S D LPPGWTV++K R +G  +    K Y  PS + +F S+A+V ++L +AA  +     
Sbjct  6    SKDLLPPGWTVKVKVRKSGKKD----KYYFEPSSQMRFNSRAEVFRYLKTAAICH-----  56

Query  311  enknnieesssnleVPQNQTPKENQSRTSRK-RKSVMDNQTPKTVSPAVAAQDISADGLP  487
                                P+  +SRT ++   +V     P T +  V  +   A  LP
Sbjct  57   --------------------PESEESRTIKEPGNNVCQKNLPSTYN--VEVKKTIAKDLP  94

Query  488  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             GW+ E+R     + IR+D  YIDP++G+  RS RDV RYL +G + +
Sbjct  95   TGWIGEIRETKTANRIRRDSSYIDPINGHALRSIRDVHRYLTSGKVSR  142



>gb|EYU25079.1| hypothetical protein MIMGU_mgv11b021680mg [Erythranthe guttata]
Length=330

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 80/168 (48%), Gaps = 50/168 (30%)
 Frame = +2

Query  131  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIs  307
            +S DWLP GW V +K R++G  +    K Y++PS GR+F SK +V +++ S+        
Sbjct  65   ESLDWLPVGWRVSVKVRNSGKKD----KYYVNPSNGRRFNSKPEVLRYVKSSV-------  113

Query  308  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  487
                             +N  PKE                        +  +    + LP
Sbjct  114  -----------------KNPNPKE---------------------PSKIKIEKTVTENLP  135

Query  488  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             GW+KE+RT+      R+DP YIDPVSG  FRS ++V RYLE+ D++K
Sbjct  136  PGWIKEIRTKKKGGRTRRDPCYIDPVSGRHFRSMQEVFRYLESKDVRK  183



>ref|XP_006353332.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006353333.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Solanum tuberosum]
Length=594

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 78/160 (49%), Gaps = 41/160 (26%)
 Frame = +2

Query  140  DWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsnen  316
            +W+P GW VE++TR  G       K YI PS G KF SKA V  +L S+ +SN       
Sbjct  9    NWVPNGWKVEVRTRKKGKKE----KWYIDPSKGLKFCSKADVLHYL-SSVDSN-------  56

Query  317  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  496
                          ++   KE + + + K                   +  +++GLP GW
Sbjct  57   ------------CSKSSNTKEMEKKGTEK----------------CFTEKTASEGLPPGW  88

Query  497  VKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLET  616
            +KEL+ R     IRKDPYYIDPVSG  FRS + V R+LET
Sbjct  89   IKELKVRRKGRKIRKDPYYIDPVSGQTFRSMKQVSRFLET  128



>ref|XP_004234378.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Solanum lycopersicum]
Length=587

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 80/160 (50%), Gaps = 42/160 (26%)
 Frame = +2

Query  140  DWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsnen  316
            +W+P GW VE++TR      G   K YI PS G KF SKA V  +L+S  +         
Sbjct  9    NWVPDGWKVEVRTR-----KGKKEKWYIDPSKGLKFCSKADVLHYLSSVDS---------  54

Query  317  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  496
                                 N S++S  ++  M+N+     +     +  +++GLP GW
Sbjct  55   ---------------------NCSKSSNTKE--MENKG----TNKCFIEKTASEGLPPGW  87

Query  497  VKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLET  616
            +KEL+ R     IRKDPYYIDPVSG  FRS + V R+LET
Sbjct  88   IKELKVRKKGRKIRKDPYYIDPVSGQTFRSLKQVSRFLET  127



>ref|XP_006653226.1| PREDICTED: uncharacterized protein LOC102699500 [Oryza brachyantha]
Length=520

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 74/164 (45%), Gaps = 40/164 (24%)
 Frame = +2

Query  143  WLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsnenk  319
            WLP GW +E+  R+ G      YK Y   P+G +F SK  V ++      S   +     
Sbjct  111  WLPDGWIIEI--RAGGKKMEKMYKFYAHLPTGVRFLSKENVLRYSIEGKISRCDV-----  163

Query  320  nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWV  499
                                         K + D  +   +   +A  + + DGLP GWV
Sbjct  164  -----------------------------KVLCDTSSEDNI---LATVEFNPDGLPEGWV  191

Query  500  KELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            KE+  R C  GIRKDPYY DPVS + FR+ + V+ YLETG+I K
Sbjct  192  KEMIFRKCNDGIRKDPYYTDPVSRHVFRTLKSVINYLETGEITK  235



>ref|XP_002510809.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51411.1| conserved hypothetical protein [Ricinus communis]
Length=644

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 83/202 (41%), Gaps = 70/202 (35%)
 Frame = +2

Query  116  ASNTNQSSDWLPPGWTVELKTRSTGSHN---------------GSTYK------------  214
            + N   S D LP GWTV++K  ++G                  GS +K            
Sbjct  6    SGNNCNSDDQLPDGWTVKVKVSASGKKYKSSAVGKVLGMQPLLGSKFKTAQQQPPCPEFS  65

Query  215  ----CYISPSGR-KFYSKAQVSQFLNSAANSNTPIsnenknnieesssnleVPQNQTPKE  379
                CY  PSG  KFYSK +V++FL                                 K 
Sbjct  66   SYNPCYFPPSGEGKFYSKLEVARFL---------------------------------KR  92

Query  380  NQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYID  559
            N  ++  K   +  +   K V      +    +GLP GW KE++       IR+DPYY D
Sbjct  93   NNPKSDEKENCIEQHSLDKFV-----VEKSEPEGLPLGWTKEIKVTKRGHKIRRDPYYTD  147

Query  560  PVSGYEFRSKRDVMRYLETGDI  625
            PVSGY FRS +D +RYLETG++
Sbjct  148  PVSGYVFRSMKDALRYLETGEV  169



>gb|AFW57954.1| methyl-binding domain MBD113 protein [Zea mays]
Length=485

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 77/169 (46%), Gaps = 40/169 (24%)
 Frame = +2

Query  128  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPI  304
            ++S  WLP GW +E+  R+ G      YK Y+  P+G++F SKA+V  F+N    S   +
Sbjct  143  HESHTWLPRGWVIEV--RAGGKKMDKMYKFYVHLPTGQRFLSKAEVLHFVNKGMVSTCDM  200

Query  305  snenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGL  484
                                                + D  T   +   +A  + + DGL
Sbjct  201  DV----------------------------------LCDTSTDDNI---LAHVEFNPDGL  223

Query  485  PAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            P GWVKE  +R    GIRKD YY DPVS   FR+ + V+ YL TG+I +
Sbjct  224  PDGWVKETISRKFNDGIRKDQYYTDPVSHRVFRTLKSVLSYLGTGEISR  272



>ref|XP_008662320.1| PREDICTED: LOC542207 isoform X3 [Zea mays]
 gb|AFW57952.1| methyl-binding domain MBD113 protein isoform 1 [Zea mays]
 gb|AFW57953.1| methyl-binding domain MBD113 protein isoform 2 [Zea mays]
Length=491

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 77/169 (46%), Gaps = 40/169 (24%)
 Frame = +2

Query  128  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPI  304
            ++S  WLP GW +E+  R+ G      YK Y+  P+G++F SKA+V  F+N    S   +
Sbjct  149  HESHTWLPRGWVIEV--RAGGKKMDKMYKFYVHLPTGQRFLSKAEVLHFVNKGMVSTCDM  206

Query  305  snenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGL  484
                                                + D  T   +   +A  + + DGL
Sbjct  207  DV----------------------------------LCDTSTDDNI---LAHVEFNPDGL  229

Query  485  PAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            P GWVKE  +R    GIRKD YY DPVS   FR+ + V+ YL TG+I +
Sbjct  230  PDGWVKETISRKFNDGIRKDQYYTDPVSHRVFRTLKSVLSYLGTGEISR  278



>ref|XP_008439209.1| PREDICTED: methyl-CpG-binding domain-containing protein 7 isoform 
X2 [Cucumis melo]
Length=212

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/168 (33%), Positives = 84/168 (50%), Gaps = 33/168 (20%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsn  310
            S D LPPGWTV++K R +G  +    K Y  PS + +F S+A+V ++L +AA  +     
Sbjct  6    SKDLLPPGWTVKVKVRKSGKKD----KYYFEPSSQMRFNSRAEVFRYLKTAAICH-----  56

Query  311  enknnieesssnleVPQNQTPKENQSRTSRK-RKSVMDNQTPKTVSPAVAAQDISADGLP  487
                                P+  +SRT ++   +V     P T +  V  +   A  LP
Sbjct  57   --------------------PESEESRTIKEPGNNVCQKNLPSTYN--VEVKKTIAKDLP  94

Query  488  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             GW+ E+R     + IR+D  YIDP++G+  RS RDV RYL +G + +
Sbjct  95   TGWIGEIRETKTANRIRRDSSYIDPINGHALRSIRDVHRYLTSGKVSR  142



>ref|XP_008662316.1| PREDICTED: LOC542207 isoform X1 [Zea mays]
 ref|XP_008662317.1| PREDICTED: LOC542207 isoform X1 [Zea mays]
 ref|XP_008662318.1| PREDICTED: LOC542207 isoform X1 [Zea mays]
Length=506

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 77/169 (46%), Gaps = 40/169 (24%)
 Frame = +2

Query  128  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPI  304
            ++S  WLP GW +E+  R+ G      YK Y+  P+G++F SKA+V  F+N    S   +
Sbjct  164  HESHTWLPRGWVIEV--RAGGKKMDKMYKFYVHLPTGQRFLSKAEVLHFVNKGMVSTCDM  221

Query  305  snenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGL  484
                                                + D  T   +   +A  + + DGL
Sbjct  222  DV----------------------------------LCDTSTDDNI---LAHVEFNPDGL  244

Query  485  PAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            P GWVKE  +R    GIRKD YY DPVS   FR+ + V+ YL TG+I +
Sbjct  245  PDGWVKETISRKFNDGIRKDQYYTDPVSHRVFRTLKSVLSYLGTGEISR  293



>ref|XP_011030071.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Populus euphratica]
Length=773

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 76/164 (46%), Gaps = 43/164 (26%)
 Frame = +2

Query  131  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIs  307
            +S DWLP GW VE+K R    +NG   K Y  PSG  +F SK +VS++LNS+        
Sbjct  5    KSDDWLPEGWRVEVKVR----NNGKKDKFYFPPSGGCRFNSKIEVSRYLNSS--------  52

Query  308  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  487
                           +   Q  + N  R S +                V  +    +GLP
Sbjct  53   --------------HLNSEQKVRSNDWRHSNE----------------VLIEKTVPEGLP  82

Query  488  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETG  619
             GW KE++       IR+DP Y DPVSGY FRS +D  RY+E+G
Sbjct  83   LGWTKEIKVTKRGGRIRRDPLYTDPVSGYVFRSMKDACRYIESG  126



>ref|XP_011030070.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Populus euphratica]
Length=775

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 76/164 (46%), Gaps = 43/164 (26%)
 Frame = +2

Query  131  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIs  307
            +S DWLP GW VE+K R    +NG   K Y  PSG  +F SK +VS++LNS+        
Sbjct  5    KSDDWLPEGWRVEVKVR----NNGKKDKFYFPPSGGCRFNSKIEVSRYLNSS--------  52

Query  308  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  487
                           +   Q  + N  R S +                V  +    +GLP
Sbjct  53   --------------HLNSEQKVRSNDWRHSNE----------------VLIEKTVPEGLP  82

Query  488  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETG  619
             GW KE++       IR+DP Y DPVSGY FRS +D  RY+E+G
Sbjct  83   LGWTKEIKVTKRGGRIRRDPLYTDPVSGYVFRSMKDACRYIESG  126



>ref|XP_008662319.1| PREDICTED: LOC542207 isoform X2 [Zea mays]
Length=497

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 76/168 (45%), Gaps = 40/168 (24%)
 Frame = +2

Query  131  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIs  307
            +S  WLP GW +E+  R+ G      YK Y+  P+G++F SKA+V  F+N    S   + 
Sbjct  156  ESHTWLPRGWVIEV--RAGGKKMDKMYKFYVHLPTGQRFLSKAEVLHFVNKGMVSTCDMD  213

Query  308  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  487
                                               + D  T   +   +A  + + DGLP
Sbjct  214  V----------------------------------LCDTSTDDNI---LAHVEFNPDGLP  236

Query  488  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             GWVKE  +R    GIRKD YY DPVS   FR+ + V+ YL TG+I +
Sbjct  237  DGWVKETISRKFNDGIRKDQYYTDPVSHRVFRTLKSVLSYLGTGEISR  284



>ref|XP_008378256.1| PREDICTED: uncharacterized protein LOC103441353 [Malus domestica]
Length=863

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 79/160 (49%), Gaps = 39/160 (24%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSNTPIsne  313
            S +WLP GWTVE+K R  G  +   Y+   S SG +F S+A+VS++L++           
Sbjct  174  SEEWLPAGWTVEVKVRKNGRRDKYYYE---SSSGHRFSSRAEVSRYLST-----------  219

Query  314  nknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAG  493
                                    S+TSR+ K  ++ +T K  S  V  +   A+ LP G
Sbjct  220  ------------------------SKTSREDKQKIE-ETLKRPSDDVVVEKTVAERLPPG  254

Query  494  WVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLE  613
            W+KE+R       IR+D +YI PVS   FRS RDV RYLE
Sbjct  255  WIKEIRMTKKARKIRRDTHYIAPVSEKVFRSLRDVHRYLE  294



>ref|XP_006580605.1| PREDICTED: uncharacterized protein LOC100782433 [Glycine max]
Length=1209

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +2

Query  452  VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIK  628
            V  +  + + LP GWVKEL+ R    GIRKDP+YIDP SGY FRSK+DV+RYLE+GDI+
Sbjct  220  VVVEKSTVEDLPPGWVKELKIRKNSKGIRKDPFYIDPASGYVFRSKKDVLRYLESGDIR  278


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = +2

Query  128  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSA  283
            N+  DWLP GW VE++TR +G H GS YKCYI P  R KF+SK +V ++L + 
Sbjct  32   NEHPDWLPDGWNVEVRTRKSGVHMGSGYKCYIEPLKRYKFFSKPEVLRYLETV  84



>ref|XP_011030072.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X3 [Populus euphratica]
Length=764

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 75/164 (46%), Gaps = 54/164 (33%)
 Frame = +2

Query  131  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIs  307
            +S DWLP GW VE+K R    +NG   K Y  PSG  +F SK +VS++LNS         
Sbjct  5    KSDDWLPEGWRVEVKVR----NNGKKDKFYFPPSGGCRFNSKIEVSRYLNS---------  51

Query  308  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  487
                                      S  + ++K +++   P              +GLP
Sbjct  52   --------------------------SHLNSEQKVLIEKTVP--------------EGLP  71

Query  488  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETG  619
             GW KE++       IR+DP Y DPVSGY FRS +D  RY+E+G
Sbjct  72   LGWTKEIKVTKRGGRIRRDPLYTDPVSGYVFRSMKDACRYIESG  115



>ref|XP_011041593.1| PREDICTED: uncharacterized protein LOC105137520 isoform X4 [Populus 
euphratica]
Length=807

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 76/166 (46%), Gaps = 43/166 (26%)
 Frame = +2

Query  131  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSG-RKFYSKAQVSQFLNSAANSNTPIs  307
            +S DWLP GW VE+K R     NG   K Y  P+G  +F SK +VS++LN +        
Sbjct  86   KSDDWLPEGWRVEVKVRD----NGKKDKFYFPPTGGLRFNSKIEVSRYLNGSH-------  134

Query  308  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  487
                                 PK  +   S  ++S          S  V  +    +GLP
Sbjct  135  ---------------------PKSEEKEGSNDQRS----------SNKVVIEKTVPEGLP  163

Query  488  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
             GW KE++       IR+DP+Y DPVSGY FRS +   RY+E+G +
Sbjct  164  LGWTKEIKVTKKGGRIRRDPFYTDPVSGYVFRSMKGAHRYIESGGV  209



>gb|KHN23667.1| Methyl-CpG-binding domain-containing protein 13 [Glycine soja]
Length=1188

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +2

Query  452  VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIK  628
            V  +  + + LP GWVKEL+ R    GIRKDP+YIDP SGY FRSK+DV+RYLE+GDI+
Sbjct  220  VVVEKSTVEDLPPGWVKELKIRKNSKGIRKDPFYIDPASGYVFRSKKDVLRYLESGDIR  278


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = +2

Query  128  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSA  283
            N+  DWLP GW VE++TR +G H GS YKCYI P  R KF+SK +V ++L + 
Sbjct  32   NEHPDWLPDGWNVEVRTRKSGVHMGSGYKCYIEPLKRYKFFSKPEVLRYLETV  84



>ref|XP_011041595.1| PREDICTED: uncharacterized protein LOC105137520 isoform X6 [Populus 
euphratica]
Length=802

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 76/166 (46%), Gaps = 43/166 (26%)
 Frame = +2

Query  131  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSG-RKFYSKAQVSQFLNSAANSNTPIs  307
            +S DWLP GW VE+K R     NG   K Y  P+G  +F SK +VS++LN +        
Sbjct  86   KSDDWLPEGWRVEVKVRD----NGKKDKFYFPPTGGLRFNSKIEVSRYLNGSH-------  134

Query  308  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  487
                                 PK  +   S  ++S       KTV           +GLP
Sbjct  135  ---------------------PKSEEKEGSNDQRSSNKVVIEKTV----------PEGLP  163

Query  488  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
             GW KE++       IR+DP+Y DPVSGY FRS +   RY+E+G +
Sbjct  164  LGWTKEIKVTKKGGRIRRDPFYTDPVSGYVFRSMKGAHRYIESGGV  209



>ref|XP_011048654.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X3 [Populus euphratica]
Length=828

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 76/166 (46%), Gaps = 43/166 (26%)
 Frame = +2

Query  131  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSG-RKFYSKAQVSQFLNSAANSNTPIs  307
            +S DWLP GW VE+K R     NG   K Y  P+G  +F SK +VS++LN +        
Sbjct  86   KSDDWLPEGWRVEVKVRD----NGKKDKFYFPPTGGLRFNSKIEVSRYLNGSH-------  134

Query  308  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  487
                                 PK  +   S  ++S          S  V  +    +GLP
Sbjct  135  ---------------------PKSEEKEGSNDQRS----------SNKVVIEKTVPEGLP  163

Query  488  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
             GW KE++       IR+DP+Y DPVSGY FRS +   RY+E+G +
Sbjct  164  LGWTKEIKVTKKGGRIRRDPFYTDPVSGYVFRSMKGAHRYIESGGV  209



>ref|XP_011041590.1| PREDICTED: uncharacterized protein LOC105137520 isoform X1 [Populus 
euphratica]
Length=857

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 76/166 (46%), Gaps = 43/166 (26%)
 Frame = +2

Query  131  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSG-RKFYSKAQVSQFLNSAANSNTPIs  307
            +S DWLP GW VE+K R     NG   K Y  P+G  +F SK +VS++LN +        
Sbjct  86   KSDDWLPEGWRVEVKVRD----NGKKDKFYFPPTGGLRFNSKIEVSRYLNGS--------  133

Query  308  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  487
                                 PK  +   S  ++S       KTV           +GLP
Sbjct  134  --------------------HPKSEEKEGSNDQRSSNKVVIEKTV----------PEGLP  163

Query  488  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
             GW KE++       IR+DP+Y DPVSGY FRS +   RY+E+G +
Sbjct  164  LGWTKEIKVTKKGGRIRRDPFYTDPVSGYVFRSMKGAHRYIESGGV  209



>ref|XP_011041592.1| PREDICTED: uncharacterized protein LOC105137520 isoform X3 [Populus 
euphratica]
Length=830

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 76/166 (46%), Gaps = 43/166 (26%)
 Frame = +2

Query  131  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSG-RKFYSKAQVSQFLNSAANSNTPIs  307
            +S DWLP GW VE+K R     NG   K Y  P+G  +F SK +VS++LN +        
Sbjct  86   KSDDWLPEGWRVEVKVRD----NGKKDKFYFPPTGGLRFNSKIEVSRYLNGSH-------  134

Query  308  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  487
                                 PK  +   S  ++S       KTV           +GLP
Sbjct  135  ---------------------PKSEEKEGSNDQRSSNKVVIEKTV----------PEGLP  163

Query  488  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
             GW KE++       IR+DP+Y DPVSGY FRS +   RY+E+G +
Sbjct  164  LGWTKEIKVTKKGGRIRRDPFYTDPVSGYVFRSMKGAHRYIESGGV  209



>ref|XP_011048657.1| PREDICTED: uncharacterized protein LOC105142633 isoform X5 [Populus 
euphratica]
Length=800

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 76/166 (46%), Gaps = 43/166 (26%)
 Frame = +2

Query  131  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSG-RKFYSKAQVSQFLNSAANSNTPIs  307
            +S DWLP GW VE+K R     NG   K Y  P+G  +F SK +VS++LN +        
Sbjct  86   KSDDWLPEGWRVEVKVRD----NGKKDKFYFPPTGGLRFNSKIEVSRYLNGSH-------  134

Query  308  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  487
                                 PK  +   S  ++S       KTV           +GLP
Sbjct  135  ---------------------PKSEEKEGSNDQRSSNKVVIEKTV----------PEGLP  163

Query  488  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
             GW KE++       IR+DP+Y DPVSGY FRS +   RY+E+G +
Sbjct  164  LGWTKEIKVTKKGGRIRRDPFYTDPVSGYVFRSMKGAHRYIESGGV  209



>ref|XP_011048652.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Populus euphratica]
Length=855

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 76/166 (46%), Gaps = 43/166 (26%)
 Frame = +2

Query  131  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSG-RKFYSKAQVSQFLNSAANSNTPIs  307
            +S DWLP GW VE+K R     NG   K Y  P+G  +F SK +VS++LN +        
Sbjct  86   KSDDWLPEGWRVEVKVRD----NGKKDKFYFPPTGGLRFNSKIEVSRYLNGSH-------  134

Query  308  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  487
                                 PK  +   S  ++S       KTV           +GLP
Sbjct  135  ---------------------PKSEEKEGSNDQRSSNKVVIEKTV----------PEGLP  163

Query  488  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
             GW KE++       IR+DP+Y DPVSGY FRS +   RY+E+G +
Sbjct  164  LGWTKEIKVTKKGGRIRRDPFYTDPVSGYVFRSMKGAHRYIESGGV  209



>ref|XP_011012359.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Populus euphratica]
Length=773

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 76/166 (46%), Gaps = 43/166 (26%)
 Frame = +2

Query  131  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIs  307
            +S DWLP GW VE+K R    +NG   K Y  PSG  +F SK +VS++LNS+        
Sbjct  5    KSDDWLPEGWRVEVKVR----NNGKKDKFYFPPSGGCRFNSKIEVSRYLNSSH-------  53

Query  308  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  487
                                 P   Q   S   +   +    KTV           +GLP
Sbjct  54   ---------------------PNSEQKVRSNDWRHSNEVLIEKTV----------PEGLP  82

Query  488  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
             GW KE++       IR+DP Y DPVSGY FRS +D  RY+E+G +
Sbjct  83   LGWTKEIKVTKRGGRIRRDPLYTDPVSGYVFRSMKDACRYIESGVV  128



>ref|XP_011012358.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Populus euphratica]
Length=775

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 76/166 (46%), Gaps = 43/166 (26%)
 Frame = +2

Query  131  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIs  307
            +S DWLP GW VE+K R    +NG   K Y  PSG  +F SK +VS++LNS+        
Sbjct  5    KSDDWLPEGWRVEVKVR----NNGKKDKFYFPPSGGCRFNSKIEVSRYLNSSH-------  53

Query  308  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  487
                                 P   Q   S   +   +    KTV           +GLP
Sbjct  54   ---------------------PNSEQKVRSNDWRHSNEVLIEKTV----------PEGLP  82

Query  488  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
             GW KE++       IR+DP Y DPVSGY FRS +D  RY+E+G +
Sbjct  83   LGWTKEIKVTKRGGRIRRDPLYTDPVSGYVFRSMKDACRYIESGVV  128



>ref|XP_011012360.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X3 [Populus euphratica]
Length=764

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 76/166 (46%), Gaps = 54/166 (33%)
 Frame = +2

Query  131  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIs  307
            +S DWLP GW VE+K R    +NG   K Y  PSG  +F SK +VS++LNS         
Sbjct  5    KSDDWLPEGWRVEVKVR----NNGKKDKFYFPPSGGCRFNSKIEVSRYLNS---------  51

Query  308  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  487
                                      S  + ++K +++   P              +GLP
Sbjct  52   --------------------------SHPNSEQKVLIEKTVP--------------EGLP  71

Query  488  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
             GW KE++       IR+DP Y DPVSGY FRS +D  RY+E+G +
Sbjct  72   LGWTKEIKVTKRGGRIRRDPLYTDPVSGYVFRSMKDACRYIESGVV  117



>ref|XP_011076193.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Sesamum indicum]
 ref|XP_011076194.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Sesamum indicum]
Length=654

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 74/162 (46%), Gaps = 49/162 (30%)
 Frame = +2

Query  140  DWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsnen  316
            DWLP GW V +K RS G  +    K Y++PS G KF SK +V ++L  +A          
Sbjct  7    DWLPVGWRVSVKVRSCGRKD----KYYVNPSNGLKFNSKPEVLRYLKYSAKG--------  54

Query  317  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  496
                                                + P+ ++  V  +   AD LP GW
Sbjct  55   ------------------------------------RKPRALNNKVEIRKTVADKLPPGW  78

Query  497  VKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGD  622
            +KE+RT       R+DPYYIDPV+G  FRS ++V RYLE+ D
Sbjct  79   IKEIRTTKKGRKTRRDPYYIDPVTGRYFRSMQEVFRYLESKD  120



>emb|CDP09782.1| unnamed protein product [Coffea canephora]
Length=819

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 56/93 (60%), Gaps = 6/93 (6%)
 Frame = +2

Query  353  VPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSG  532
             PQ+    +++S  S K ++ MD    K        +    D LP GW+KE+R R    G
Sbjct  245  APQHCESTKSKSHISEKEENRMD----KPFLEIAVDESKVLDELPPGWIKEIRARK--QG  298

Query  533  IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             RKDPYYIDPVSGYEFRSK+D +RYLE GDI +
Sbjct  299  TRKDPYYIDPVSGYEFRSKKDALRYLEFGDISR  331


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = +2

Query  128  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTP  301
            N S +WLP GW +E + R +G+  GS YK Y+ P +G KFYSK QV Q+L S   + +P
Sbjct  85   NSSLEWLPQGWIIESRYRKSGATAGSVYKTYVDPLTGSKFYSKPQVMQYLESVNFNASP  143



>gb|KHN31504.1| Methyl-CpG-binding domain-containing protein 13 [Glycine soja]
Length=590

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 78/162 (48%), Gaps = 49/162 (30%)
 Frame = +2

Query  143  WLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsnenk  319
            WLPPGWTVE++ R     NG   K Y  PS G KF SK +V ++L++A            
Sbjct  9    WLPPGWTVEVRVR----KNGKRDKYYFPPSSGLKFNSKVEVFRYLDNA------------  52

Query  320  nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWV  499
                                 Q++ S ++           +SP V  +   A+GLP G V
Sbjct  53   ---------------------QNKVSIQK-----------ISPNVIVEKAIAEGLPPGRV  80

Query  500  KELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            K+ R  T    +R+D +YIDPV+GY F S +DV  YLE+G+I
Sbjct  81   KKTRITTNGDSVRRDTFYIDPVNGYTFCSIKDVDCYLESGEI  122



>ref|XP_007160033.1| hypothetical protein PHAVU_002G287000g [Phaseolus vulgaris]
 gb|ESW32027.1| hypothetical protein PHAVU_002G287000g [Phaseolus vulgaris]
Length=1225

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  473  ADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIK  628
            A+ LP GWVKEL+      GIRKDP+YIDPVSGY FRSK+DV+RYLE+GD++
Sbjct  226  AEDLPPGWVKELKITKNSKGIRKDPFYIDPVSGYVFRSKKDVLRYLESGDVR  277


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = +2

Query  140  DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANS  292
            +WLP GW +E++ R +G H GS YKCYI P  G KF+SK +V ++L +  +S
Sbjct  37   EWLPDGWNMEVRIRKSGLHMGSGYKCYIEPLKGYKFFSKPEVLRYLETVKDS  88



>ref|XP_009595657.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 [Nicotiana 
tomentosiformis]
Length=541

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 71/160 (44%), Gaps = 44/160 (28%)
 Frame = +2

Query  140  DWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsnen  316
            DWLP GW VE +        G   K Y  PS G KF SKA V  +L+S            
Sbjct  9    DWLPAGWKVEFR-------KGKKEKWYSDPSKGLKFCSKADVLHYLSSVG----------  51

Query  317  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  496
                                      S   KS    +  K  +  V  +  +++GLP GW
Sbjct  52   --------------------------SNCFKSSSTKEIEKKDTGKVVTEKATSEGLPPGW  85

Query  497  VKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLET  616
            +KE+R R     I+KDPYY DPVSG+ FRS ++V R+LET
Sbjct  86   IKEVRVRRKGHKIKKDPYYTDPVSGHTFRSMKEVSRFLET  125



>ref|XP_009589209.1| PREDICTED: uncharacterized protein LOC104086600 isoform X2 [Nicotiana 
tomentosiformis]
Length=1739

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 58/88 (66%), Gaps = 3/88 (3%)
 Frame = +2

Query  374  KEN--QSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDP  547
            KEN  QS  S+++K   D+ + KTV  +VA    S D LP GW KE+  R    GIRKDP
Sbjct  274  KENGVQSPLSKRQKPGSDSPSSKTVC-SVAVDCNSVDELPPGWKKEVIIRQTDRGIRKDP  332

Query  548  YYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             Y DPV GY FRSK+DV+RYL+TGDI K
Sbjct  333  LYTDPVHGYVFRSKKDVLRYLQTGDISK  360


 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  461   QDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             ++ S D LP GW KE+R R    GIRKDP+Y DPV GY FRSK+DVMRYL+TGDI +
Sbjct  1148  REASVDELPPGWKKEIRIRQNARGIRKDPFYTDPVHGYVFRSKKDVMRYLQTGDISR  1204


 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 78/154 (51%), Gaps = 2/154 (1%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAAN  289
            +   T +S +WLP GW VEL+ R +GSH G  YK YI PS G KFYS+ +VS++L +   
Sbjct  106  IVEETKKSPEWLPAGWIVELRNRKSGSHAGLAYKVYIDPSTGNKFYSRPEVSKYLKTMKQ  165

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI  469
            +N     +     E SSSN +  +N      QSR S+++KS  D  +      + + Q  
Sbjct  166  NNIAGEEQIHGTGEVSSSNQKASENSKDIGGQSRISKRQKSDGDRPSHDIKEGSFSKQKP  225

Query  470  SADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSG  571
            S D    G    + ++T  SGI +    I P  G
Sbjct  226  SQDSEEVGEPSCI-SKTQKSGINRPSTKISPSHG  258


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 54/165 (33%), Positives = 90/165 (55%), Gaps = 15/165 (9%)
 Frame = +2

Query  137  SDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNS--AANSNTPIs  307
            +DW PPGWT ++K  S     G   K Y +  +G+KFYSK +V++++N+    +  T + 
Sbjct  8    ADWPPPGWTEDVKITS-----GRKTKYYTNVETGKKFYSKKEVTRYMNTKDTCHDVTQVL  62

Query  308  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  487
            N++K++ + + S +        + N S+ + + +S  +N     VS  V     S + LP
Sbjct  63   NQDKSSSQNNVSQMNHQDKSFSENNVSQMNYQDRSCSEN----NVSQIVEETKKSPEWLP  118

Query  488  AGWVKELRTRTCPS--GIRKDPYYIDPVSGYEFRSKRDVMRYLET  616
            AGW+ ELR R   S  G+     YIDP +G +F S+ +V +YL+T
Sbjct  119  AGWIVELRNRKSGSHAGLAYK-VYIDPSTGNKFYSRPEVSKYLKT  162



>ref|XP_008439210.1| PREDICTED: methyl-CpG-binding domain-containing protein 7 isoform 
X3 [Cucumis melo]
Length=201

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 83/167 (50%), Gaps = 42/167 (25%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsn  310
            S D LPPGWTV++K R +G  +    K Y  PS + +F S+A+V ++L +AA  +     
Sbjct  6    SKDLLPPGWTVKVKVRKSGKKD----KYYFEPSSQMRFNSRAEVFRYLKTAAICH-----  56

Query  311  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  490
                                P+  +SRT ++  +  + +  KT+          A  LP 
Sbjct  57   --------------------PESEESRTIKEPGN--NVEVKKTI----------AKDLPT  84

Query  491  GWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            GW+ E+R     + IR+D  YIDP++G+  RS RDV RYL +G + +
Sbjct  85   GWIGEIRETKTANRIRRDSSYIDPINGHALRSIRDVHRYLTSGKVSR  131



>ref|XP_009782391.1| PREDICTED: uncharacterized protein LOC104231139 isoform X2 [Nicotiana 
sylvestris]
Length=1881

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  461   QDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             ++ S D LP GW KE+R R    GIRKDP+Y DPV GY FRSK+DVMRYL+TGDI +
Sbjct  1290  REASVDELPPGWKKEIRIRQNARGIRKDPFYTDPVHGYVFRSKKDVMRYLQTGDISR  1346


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +2

Query  464  DISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            + S D LP GW KE++      GIRKDP Y DPV GY FRSK+DV+RYL+TGDI K
Sbjct  573  EASVDELPPGWKKEIKVTKKARGIRKDPLYTDPVHGYVFRSKKDVLRYLQTGDISK  628


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 55/88 (63%), Gaps = 6/88 (7%)
 Frame = +2

Query  374  KEN--QSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDP  547
            KEN  QS +S+++K   D+ +  TV    A    S D LP GW KE+  R    GIRKDP
Sbjct  274  KENGVQSPSSKRQKPGSDSPSAMTV----AVDCNSVDELPPGWKKEVIIRQTDRGIRKDP  329

Query  548  YYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             Y DPV GY+FRSK++V RYL+TGD  K
Sbjct  330  VYTDPVHGYKFRSKKEVFRYLQTGDTSK  357


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS  280
            +   T +S +WLP GW VELKTR +GS+ G  YK YI PS G KFYS+ +VS++L +
Sbjct  106  IVEETKKSPEWLPAGWIVELKTRKSGSNAGLAYKVYIDPSTGNKFYSRPEVSKYLKT  162


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 89/165 (54%), Gaps = 15/165 (9%)
 Frame = +2

Query  137  SDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsne  313
            +DW PPGWT ++K  S     G   K Y    +G+KFYSK +V++++N+    +      
Sbjct  8    ADWPPPGWTEDVKITS-----GRKTKYYTHVETGKKFYSKKEVTRYMNTKDTCHDVAQVL  62

Query  314  nknnieesssnleV-PQNQTPKENQ-SRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  487
            N++     ++  ++  Q+++  EN  S+ + + +S  +N     VS  V     S + LP
Sbjct  63   NQDKSSTENNVSQMNHQDKSFSENNVSQMNYQDRSCSEN----NVSQIVEETKKSPEWLP  118

Query  488  AGWVKELRTRTCPS--GIRKDPYYIDPVSGYEFRSKRDVMRYLET  616
            AGW+ EL+TR   S  G+     YIDP +G +F S+ +V +YL+T
Sbjct  119  AGWIVELKTRKSGSNAGLAYK-VYIDPSTGNKFYSRPEVSKYLKT  162



>ref|XP_009782390.1| PREDICTED: uncharacterized protein LOC104231139 isoform X1 [Nicotiana 
sylvestris]
Length=1884

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  461   QDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             ++ S D LP GW KE+R R    GIRKDP+Y DPV GY FRSK+DVMRYL+TGDI +
Sbjct  1293  REASVDELPPGWKKEIRIRQNARGIRKDPFYTDPVHGYVFRSKKDVMRYLQTGDISR  1349


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 57/88 (65%), Gaps = 3/88 (3%)
 Frame = +2

Query  374  KEN--QSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDP  547
            KEN  QS +S+++K   D+ +  TV  +VA    S D LP GW KE+  R    GIRKDP
Sbjct  274  KENGVQSPSSKRQKPGSDSPSAMTVC-SVAVDCNSVDELPPGWKKEVIIRQTDRGIRKDP  332

Query  548  YYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             Y DPV GY+FRSK++V RYL+TGD  K
Sbjct  333  VYTDPVHGYKFRSKKEVFRYLQTGDTSK  360


 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +2

Query  464  DISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            + S D LP GW KE++      GIRKDP Y DPV GY FRSK+DV+RYL+TGDI K
Sbjct  576  EASVDELPPGWKKEIKVTKKARGIRKDPLYTDPVHGYVFRSKKDVLRYLQTGDISK  631


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS  280
            +   T +S +WLP GW VELKTR +GS+ G  YK YI PS G KFYS+ +VS++L +
Sbjct  106  IVEETKKSPEWLPAGWIVELKTRKSGSNAGLAYKVYIDPSTGNKFYSRPEVSKYLKT  162


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 89/165 (54%), Gaps = 15/165 (9%)
 Frame = +2

Query  137  SDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsne  313
            +DW PPGWT ++K  S     G   K Y    +G+KFYSK +V++++N+    +      
Sbjct  8    ADWPPPGWTEDVKITS-----GRKTKYYTHVETGKKFYSKKEVTRYMNTKDTCHDVAQVL  62

Query  314  nknnieesssnleV-PQNQTPKENQ-SRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  487
            N++     ++  ++  Q+++  EN  S+ + + +S  +N     VS  V     S + LP
Sbjct  63   NQDKSSTENNVSQMNHQDKSFSENNVSQMNYQDRSCSEN----NVSQIVEETKKSPEWLP  118

Query  488  AGWVKELRTRTCPS--GIRKDPYYIDPVSGYEFRSKRDVMRYLET  616
            AGW+ EL+TR   S  G+     YIDP +G +F S+ +V +YL+T
Sbjct  119  AGWIVELKTRKSGSNAGLAYK-VYIDPSTGNKFYSRPEVSKYLKT  162



>ref|XP_009782392.1| PREDICTED: uncharacterized protein LOC104231139 isoform X3 [Nicotiana 
sylvestris]
Length=1613

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  461   QDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             ++ S D LP GW KE+R R    GIRKDP+Y DPV GY FRSK+DVMRYL+TGDI +
Sbjct  1022  REASVDELPPGWKKEIRIRQNARGIRKDPFYTDPVHGYVFRSKKDVMRYLQTGDISR  1078


 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 58/88 (66%), Gaps = 3/88 (3%)
 Frame = +2

Query  374  KEN--QSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDP  547
            KEN  QS +S+++K   D+ +  TV  +VA    S D LP GW KE+  R    GIRKDP
Sbjct  274  KENGVQSPSSKRQKPGSDSPSAMTVC-SVAVDCNSVDELPPGWKKEVIIRQTDRGIRKDP  332

Query  548  YYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             Y DPV GY FRSK+DV+RYL+TGDI K
Sbjct  333  LYTDPVHGYVFRSKKDVLRYLQTGDISK  360


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS  280
            +   T +S +WLP GW VELKTR +GS+ G  YK YI PS G KFYS+ +VS++L +
Sbjct  106  IVEETKKSPEWLPAGWIVELKTRKSGSNAGLAYKVYIDPSTGNKFYSRPEVSKYLKT  162


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 89/165 (54%), Gaps = 15/165 (9%)
 Frame = +2

Query  137  SDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsne  313
            +DW PPGWT ++K  S     G   K Y    +G+KFYSK +V++++N+    +      
Sbjct  8    ADWPPPGWTEDVKITS-----GRKTKYYTHVETGKKFYSKKEVTRYMNTKDTCHDVAQVL  62

Query  314  nknnieesssnleV-PQNQTPKENQ-SRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  487
            N++     ++  ++  Q+++  EN  S+ + + +S  +N     VS  V     S + LP
Sbjct  63   NQDKSSTENNVSQMNHQDKSFSENNVSQMNYQDRSCSEN----NVSQIVEETKKSPEWLP  118

Query  488  AGWVKELRTRTCPS--GIRKDPYYIDPVSGYEFRSKRDVMRYLET  616
            AGW+ EL+TR   S  G+     YIDP +G +F S+ +V +YL+T
Sbjct  119  AGWIVELKTRKSGSNAGLAYK-VYIDPSTGNKFYSRPEVSKYLKT  162



>ref|XP_009589208.1| PREDICTED: uncharacterized protein LOC104086600 isoform X1 [Nicotiana 
tomentosiformis]
Length=2010

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  461   QDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             ++ S D LP GW KE+R R    GIRKDP+Y DPV GY FRSK+DVMRYL+TGDI +
Sbjct  1419  REASVDELPPGWKKEIRIRQNARGIRKDPFYTDPVHGYVFRSKKDVMRYLQTGDISR  1475


 Score = 80.9 bits (198),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 56/88 (64%), Gaps = 3/88 (3%)
 Frame = +2

Query  374  KEN--QSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDP  547
            KEN  QS  S+++K   D+ + KTV  +VA    S D LP GW KE+  R    GIRKDP
Sbjct  274  KENGVQSPLSKRQKPGSDSPSSKTVC-SVAVDCNSVDELPPGWKKEVIIRQTDRGIRKDP  332

Query  548  YYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             Y DPV GY+FRSK++V RYL TGD  K
Sbjct  333  MYTDPVHGYKFRSKKEVFRYLHTGDTSK  360


 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  449  AVAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIK  628
            A  + + S D LP GW KE++      GIRKDP Y DPV GY FRSK+DV+RYL+TGDI 
Sbjct  571  ASLSGETSVDELPPGWKKEIKVTKKARGIRKDPLYTDPVHGYVFRSKKDVLRYLQTGDIS  630

Query  629  K  631
            K
Sbjct  631  K  631


 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 78/154 (51%), Gaps = 2/154 (1%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAAN  289
            +   T +S +WLP GW VEL+ R +GSH G  YK YI PS G KFYS+ +VS++L +   
Sbjct  106  IVEETKKSPEWLPAGWIVELRNRKSGSHAGLAYKVYIDPSTGNKFYSRPEVSKYLKTMKQ  165

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI  469
            +N     +     E SSSN +  +N      QSR S+++KS  D  +      + + Q  
Sbjct  166  NNIAGEEQIHGTGEVSSSNQKASENSKDIGGQSRISKRQKSDGDRPSHDIKEGSFSKQKP  225

Query  470  SADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSG  571
            S D    G    + ++T  SGI +    I P  G
Sbjct  226  SQDSEEVGEPSCI-SKTQKSGINRPSTKISPSHG  258


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 54/165 (33%), Positives = 90/165 (55%), Gaps = 15/165 (9%)
 Frame = +2

Query  137  SDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNS--AANSNTPIs  307
            +DW PPGWT ++K  S     G   K Y +  +G+KFYSK +V++++N+    +  T + 
Sbjct  8    ADWPPPGWTEDVKITS-----GRKTKYYTNVETGKKFYSKKEVTRYMNTKDTCHDVTQVL  62

Query  308  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  487
            N++K++ + + S +        + N S+ + + +S  +N     VS  V     S + LP
Sbjct  63   NQDKSSSQNNVSQMNHQDKSFSENNVSQMNYQDRSCSEN----NVSQIVEETKKSPEWLP  118

Query  488  AGWVKELRTRTCPS--GIRKDPYYIDPVSGYEFRSKRDVMRYLET  616
            AGW+ ELR R   S  G+     YIDP +G +F S+ +V +YL+T
Sbjct  119  AGWIVELRNRKSGSHAGLAYK-VYIDPSTGNKFYSRPEVSKYLKT  162



>gb|EMT21477.1| hypothetical protein F775_23896 [Aegilops tauschii]
Length=424

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 80/168 (48%), Gaps = 40/168 (24%)
 Frame = +2

Query  131  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIs  307
            +S +WLP GW +E+  R+ G +    YK Y+ P+ G + +SK  V  ++N          
Sbjct  175  KSHEWLPKGWLLEI--RAGGENMDKMYKFYVYPALGIRAFSKEDVLLYVNEM--------  224

Query  308  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  487
                          ++P+  T   N    +  R +++            A  + +  GLP
Sbjct  225  --------------KIPECDT---NGKCDTSSRDNIL------------AEVEFNPSGLP  255

Query  488  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             GWVKE+  R    G RKDPYY DPVS Y FR+   V+R+L+TG+I K
Sbjct  256  DGWVKEMVYRKTLKGTRKDPYYTDPVSSYAFRTLTSVVRFLQTGNITK  303



>ref|XP_006664919.1| PREDICTED: uncharacterized protein LOC102722078, partial [Oryza 
brachyantha]
Length=249

 Score = 80.1 bits (196),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 77/168 (46%), Gaps = 40/168 (24%)
 Frame = +2

Query  131  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIs  307
             + +WLP  W +E+  R+ G +    +K Y+ P +G + +SK  V  ++N +    TP  
Sbjct  100  MTHEWLPNDWMIEV--RAGGENIDKMFKFYVYPPAGVRLFSKEDVLTYINKS--KITPFD  155

Query  308  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  487
                                     Q  TS K     DN         +A  + +   LP
Sbjct  156  TN----------------------GQCDTSMK-----DN--------ILANVEFNPHSLP  180

Query  488  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             GWVKEL  R   +G+RKDPYY DPVS Y FR++R  M Y++TG I K
Sbjct  181  KGWVKELVFRKTENGVRKDPYYTDPVSNYSFRTRRSAMLYVQTGKIPK  228



>ref|XP_011048653.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Populus euphratica]
Length=844

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 74/166 (45%), Gaps = 54/166 (33%)
 Frame = +2

Query  131  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSG-RKFYSKAQVSQFLNSAANSNTPIs  307
            +S DWLP GW VE+K R     NG   K Y  P+G  +F SK +VS++LN +        
Sbjct  86   KSDDWLPEGWRVEVKVRD----NGKKDKFYFPPTGGLRFNSKIEVSRYLNGSH-------  134

Query  308  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  487
                                 PK  +       K V++   P              +GLP
Sbjct  135  ---------------------PKSEE-------KVVIEKTVP--------------EGLP  152

Query  488  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
             GW KE++       IR+DP+Y DPVSGY FRS +   RY+E+G +
Sbjct  153  LGWTKEIKVTKKGGRIRRDPFYTDPVSGYVFRSMKGAHRYIESGGV  198



>ref|XP_011041591.1| PREDICTED: uncharacterized protein LOC105137520 isoform X2 [Populus 
euphratica]
Length=846

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 74/166 (45%), Gaps = 54/166 (33%)
 Frame = +2

Query  131  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSG-RKFYSKAQVSQFLNSAANSNTPIs  307
            +S DWLP GW VE+K R     NG   K Y  P+G  +F SK +VS++LN +        
Sbjct  86   KSDDWLPEGWRVEVKVRD----NGKKDKFYFPPTGGLRFNSKIEVSRYLNGS--------  133

Query  308  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  487
                                 PK  +       K V++   P              +GLP
Sbjct  134  --------------------HPKSEE-------KVVIEKTVP--------------EGLP  152

Query  488  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
             GW KE++       IR+DP+Y DPVSGY FRS +   RY+E+G +
Sbjct  153  LGWTKEIKVTKKGGRIRRDPFYTDPVSGYVFRSMKGAHRYIESGGV  198



>ref|XP_004245626.1| PREDICTED: uncharacterized protein LOC101264354 isoform X1 [Solanum 
lycopersicum]
Length=1886

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  458   AQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIK  628
             +++ S DGLP GW  E R R   S I+KDPYY DPV GY FRSK+DVMRYL+TGDI+
Sbjct  1221  SKEASVDGLPPGWKTEFRIRKNASVIKKDPYYTDPVHGYVFRSKKDVMRYLQTGDIR  1277


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  464  DISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            D S D LP GW KE++     +GIRKDP YIDPV GY FRSK+DV RYL+TGDI
Sbjct  576  DPSLDDLPPGWKKEIKITKKANGIRKDPLYIDPVDGYVFRSKKDVFRYLQTGDI  629


 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = +2

Query  128  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSN  295
            N S +WLPPGW VELKTR +GSH G +YK YI PS G KFYSK +VS++L +   +N
Sbjct  111  NNSHEWLPPGWIVELKTRKSGSHAGLSYKVYIDPSTGSKFYSKPEVSKYLKTMKQNN  167


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 83/169 (49%), Gaps = 20/169 (12%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsn  310
            S DW PPGWT ++K        G   K Y +  +G+KFYSK +V+++L +    +     
Sbjct  6    SPDWPPPGWTEDVKV-----SKGRKIKYYTNGETGKKFYSKKEVARYLKTKDTCDDVTQA  60

Query  311  enknnieesssnleVPQNQTPKENQSRT-SRKRKSVMDNQ----TPKTVSPAVAAQDISA  475
             N      S        N +  +NQ  + ++   S MDNQ    +   VS  V   + S 
Sbjct  61   MNIQGKSFSE------NNVSDMDNQDGSFAKDNGSQMDNQDNCCSENNVSQTVGKPNNSH  114

Query  476  DGLPAGWVKELRTRTCPS--GIRKDPYYIDPVSGYEFRSKRDVMRYLET  616
            + LP GW+ EL+TR   S  G+     YIDP +G +F SK +V +YL+T
Sbjct  115  EWLPPGWIVELKTRKSGSHAGLSYK-VYIDPSTGSKFYSKPEVSKYLKT  162


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 52/85 (61%), Gaps = 5/85 (6%)
 Frame = +2

Query  374  KEN--QSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDP  547
            KEN  QS  S+++K      + K+VS +VA    SAD LP GW KE  +R    G R   
Sbjct  275  KENGAQSPQSKRQKPGSGCPSAKSVS-SVAVDCDSADELPPGWKKE--SRKNDRGTRNYL  331

Query  548  YYIDPVSGYEFRSKRDVMRYLETGD  622
             Y DPV GY+F SK++V+RYL+TGD
Sbjct  332  LYTDPVHGYKFHSKKEVLRYLQTGD  356



>ref|XP_010325420.1| PREDICTED: uncharacterized protein LOC101264354 isoform X2 [Solanum 
lycopersicum]
Length=1852

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  458   AQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIK  628
             +++ S DGLP GW  E R R   S I+KDPYY DPV GY FRSK+DVMRYL+TGDI+
Sbjct  1187  SKEASVDGLPPGWKTEFRIRKNASVIKKDPYYTDPVHGYVFRSKKDVMRYLQTGDIR  1243


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  464  DISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            D S D LP GW KE++     +GIRKDP YIDPV GY FRSK+DV RYL+TGDI
Sbjct  576  DPSLDDLPPGWKKEIKITKKANGIRKDPLYIDPVDGYVFRSKKDVFRYLQTGDI  629


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = +2

Query  128  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSN  295
            N S +WLPPGW VELKTR +GSH G +YK YI PS G KFYSK +VS++L +   +N
Sbjct  111  NNSHEWLPPGWIVELKTRKSGSHAGLSYKVYIDPSTGSKFYSKPEVSKYLKTMKQNN  167


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 83/169 (49%), Gaps = 20/169 (12%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsn  310
            S DW PPGWT ++K        G   K Y +  +G+KFYSK +V+++L +    +     
Sbjct  6    SPDWPPPGWTEDVKV-----SKGRKIKYYTNGETGKKFYSKKEVARYLKTKDTCDDVTQA  60

Query  311  enknnieesssnleVPQNQTPKENQSRT-SRKRKSVMDNQ----TPKTVSPAVAAQDISA  475
             N      S        N +  +NQ  + ++   S MDNQ    +   VS  V   + S 
Sbjct  61   MNIQGKSFSE------NNVSDMDNQDGSFAKDNGSQMDNQDNCCSENNVSQTVGKPNNSH  114

Query  476  DGLPAGWVKELRTRTCPS--GIRKDPYYIDPVSGYEFRSKRDVMRYLET  616
            + LP GW+ EL+TR   S  G+     YIDP +G +F SK +V +YL+T
Sbjct  115  EWLPPGWIVELKTRKSGSHAGLSYK-VYIDPSTGSKFYSKPEVSKYLKT  162


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 52/85 (61%), Gaps = 5/85 (6%)
 Frame = +2

Query  374  KEN--QSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDP  547
            KEN  QS  S+++K      + K+VS +VA    SAD LP GW KE  +R    G R   
Sbjct  275  KENGAQSPQSKRQKPGSGCPSAKSVS-SVAVDCDSADELPPGWKKE--SRKNDRGTRNYL  331

Query  548  YYIDPVSGYEFRSKRDVMRYLETGD  622
             Y DPV GY+F SK++V+RYL+TGD
Sbjct  332  LYTDPVHGYKFHSKKEVLRYLQTGD  356



>ref|XP_009401689.1| PREDICTED: uncharacterized protein LOC103985652 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=504

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  482  LPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            LP GW+KE+R R   + I+KDP+Y DPVSGYEFRS +DV RYLETGDI
Sbjct  31   LPHGWIKEIRLRNSGTKIKKDPFYFDPVSGYEFRSLKDVFRYLETGDI  78



>emb|CAN74037.1| hypothetical protein VITISV_023406 [Vitis vinifera]
Length=730

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 78/164 (48%), Gaps = 52/164 (32%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsn  310
            S DWLPPGW VE+K  STG      YKCYI PS G KFYSK +VS++LN A         
Sbjct  6    SDDWLPPGWKVEMKLTSTGRK----YKCYIHPSRGLKFYSKPEVSRYLNKA---------  52

Query  311  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  490
                           P N        R S ++KS+      KT++PA   + +       
Sbjct  53   ---------------PLN-------DRESIQKKSIERKTPIKTMAPAGKKKSMEK-----  85

Query  491  GWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGD  622
                    + C   I K  YY DPV+GY FRS +D +RYL+TGD
Sbjct  86   -------KKHC---IAKK-YYTDPVNGYIFRSMKDTLRYLKTGD  118



>ref|XP_006358894.1| PREDICTED: uncharacterized protein LOC102587100 isoform X1 [Solanum 
tuberosum]
Length=1845

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  458   AQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIK  628
             +++ S DGLP GW  E R R     I+KDPYY+DPV GY FRSK+DVMRYL+TGDI+
Sbjct  1185  SKEASVDGLPPGWKTEFRMRKNARVIKKDPYYMDPVLGYVFRSKKDVMRYLQTGDIR  1241


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  464  DISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            D S D LP GW KE++     +GIRKDP YIDPV GY FRSK+DV RYL+TGDI
Sbjct  571  DPSLDDLPPGWKKEIKITKKANGIRKDPLYIDPVDGYVFRSKKDVFRYLQTGDI  624


 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = +2

Query  128  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSN  295
            N S +WLPPGW VELKTR +GSH G+ YK YI PS G KFYSK +VS++L +   +N
Sbjct  111  NNSHEWLPPGWIVELKTRKSGSHAGTPYKVYIDPSTGSKFYSKPEVSKYLKTMKQNN  167


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 85/167 (51%), Gaps = 16/167 (10%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsn  310
            S DW PPGWT ++K       NG   K Y +  +G+KFYSK +V+++LN+    +     
Sbjct  6    SPDWPPPGWTEDVKV-----SNGRKIKYYTNGQTGKKFYSKKEVARYLNTKDTCDDVTQA  60

Query  311  enknnieesssnleVPQNQTP---KENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADG  481
                    S +N+    NQ     K+N S+     KS  +N     VS AV   + S + 
Sbjct  61   MTIQGKNCSENNVSHMDNQDESFSKDNVSQMDNLDKSCSEN----NVSEAVGRPNNSHEW  116

Query  482  LPAGWVKELRTRTCPSGIRKDPY--YIDPVSGYEFRSKRDVMRYLET  616
            LP GW+ EL+TR   S     PY  YIDP +G +F SK +V +YL+T
Sbjct  117  LPPGWIVELKTRKSGSHAGT-PYKVYIDPSTGSKFYSKPEVSKYLKT  162


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 52/85 (61%), Gaps = 5/85 (6%)
 Frame = +2

Query  374  KEN--QSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDP  547
            KEN  QS  S+++K      + K+VS +VA    SAD LP GW KE  +     G R+  
Sbjct  275  KENGAQSPQSKRQKPGSGCLSAKSVS-SVAVDCDSADELPHGWKKE--SSQNDRGTREYL  331

Query  548  YYIDPVSGYEFRSKRDVMRYLETGD  622
             Y DPV GY+F SK++V+RYL+TGD
Sbjct  332  LYTDPVHGYKFYSKKEVLRYLQTGD  356



>ref|XP_009760427.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
[Nicotiana sylvestris]
Length=522

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 74/160 (46%), Gaps = 44/160 (28%)
 Frame = +2

Query  140  DWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsnen  316
            DWLP GW VE +        G   K Y  PS   KF SK  V ++L+S  +         
Sbjct  9    DWLPAGWKVEFR-------KGKKEKWYSDPSKELKFNSKTDVLRYLSSVGS---------  52

Query  317  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  496
                                 N S++S  ++  M+ +     S   AA    ++GLP GW
Sbjct  53   ---------------------NCSKSSNTKE--MEKKDTGKFSTGKAA----SEGLPPGW  85

Query  497  VKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLET  616
            +KE+R R     IRKDPYYIDPVSG  FRS ++V R LET
Sbjct  86   IKEMRVRRKGHKIRKDPYYIDPVSGQTFRSMKEVSRLLET  125



>ref|XP_008796742.1| PREDICTED: uncharacterized protein LOC103712110 isoform X7 [Phoenix 
dactylifera]
Length=644

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 50/149 (34%), Positives = 73/149 (49%), Gaps = 23/149 (15%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  289
            LA       DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    +
Sbjct  72   LAEQIKDFPDWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMS  131

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRK--RKSVMDNQTPKTVSPAVAAQ  463
             N             +     V    T     S + RK  ++S M+NQ    +       
Sbjct  132  CNP-----------RAKRKRSVVTKVTENACSSTSQRKGIKRSTMENQVRSQI-------  173

Query  464  DISADGLPAGWVKELRTRTCPS--GIRKD  544
            + + DGLP+GW+KE+R R   S  G ++D
Sbjct  174  EYTPDGLPSGWIKEIRYRKTSSRCGAKRD  202


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/162 (30%), Positives = 67/162 (41%), Gaps = 42/162 (26%)
 Frame = +2

Query  140  DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnen  316
            +WLP GW + +KT  TG  +     CY  P S R F+SK ++  +LN             
Sbjct  8    EWLPEGWKMVVKTSMTGDKD----VCYTCPTSSRTFHSKEEIMHYLNY------------  51

Query  317  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  496
                               +      S+      DN     V P         D LPAGW
Sbjct  52   -------------------ERVDGYISKPTSCFGDN-----VHPLAEQIKDFPDWLPAGW  87

Query  497  VKELRTRTCPSGI-RKDPYYIDPVSGYEFRSKRDVMRYLETG  619
            V E +TR   +   R+   YIDPV+G+ F SK +V+RY++ G
Sbjct  88   VLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDG  129



>gb|EEC83090.1| hypothetical protein OsI_28224 [Oryza sativa Indica Group]
Length=676

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  464  DISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            D+  DGLP GW KE R R   S ++ DPYYIDPVSGYEFRS +DV R+L++GDI K
Sbjct  105  DLIVDGLPDGWWKEDRPRKNGSNLKTDPYYIDPVSGYEFRSLKDVHRFLKSGDIYK  160



>ref|XP_002321896.2| hypothetical protein POPTR_0015s13470g [Populus trichocarpa]
 gb|EEF06023.2| hypothetical protein POPTR_0015s13470g [Populus trichocarpa]
Length=774

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 77/166 (46%), Gaps = 43/166 (26%)
 Frame = +2

Query  131  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSG-RKFYSKAQVSQFLNSAANSNTPIs  307
            +S DWLP GW VE+K R++G  +    K Y  P+G  +F SK +VS++LN +        
Sbjct  5    KSDDWLPEGWRVEVKVRNSGKKD----KFYFPPTGGFRFNSKIEVSRYLNGSH-------  53

Query  308  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  487
                                 PK  +   S  + S       KTV           +GLP
Sbjct  54   ---------------------PKSEEKVGSNDQWSSNKVVIEKTV----------PEGLP  82

Query  488  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
             GW KE++       IR+DP+Y DPVSG  FRS ++  RY+E+G +
Sbjct  83   LGWTKEIKVTKKGGRIRRDPFYTDPVSGCVFRSMKEAHRYIESGVV  128



>ref|XP_002318826.1| hypothetical protein POPTR_0012s13490g [Populus trichocarpa]
 gb|EEE97046.1| hypothetical protein POPTR_0012s13490g [Populus trichocarpa]
Length=762

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 74/166 (45%), Gaps = 54/166 (33%)
 Frame = +2

Query  131  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIs  307
            +S DWLP GW VE+K R    +NG   K Y  PSG  +F SK +VS++LN          
Sbjct  5    KSDDWLPEGWRVEVKVR----NNGKKDKFYFPPSGGCRFNSKIEVSRYLNG---------  51

Query  308  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  487
                                      S  + ++K +++   P              +GLP
Sbjct  52   --------------------------SHPNSEQKVLIEKTVP--------------EGLP  71

Query  488  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
             GW +E++       IR+D  Y DPVSGY FRS +D  RY+E+G +
Sbjct  72   LGWTQEIKVTKKGGRIRRDSLYTDPVSGYVFRSMKDACRYIESGVV  117



>gb|EEE68228.1| hypothetical protein OsJ_26412 [Oryza sativa Japonica Group]
Length=899

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  464  DISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            D+  DGLP GW KE R R   S ++ DPYYIDPVSGYEFRS +DV R+L++GDI K
Sbjct  105  DLIVDGLPDGWWKEDRPRKNGSNLKTDPYYIDPVSGYEFRSLKDVHRFLKSGDIYK  160



>ref|XP_006827729.1| hypothetical protein AMTR_s00009p00261370 [Amborella trichopoda]
 gb|ERM95145.1| hypothetical protein AMTR_s00009p00261370 [Amborella trichopoda]
Length=1239

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 91/171 (53%), Gaps = 8/171 (5%)
 Frame = +2

Query  119  SNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSN  295
            S + QSSDWLPPGWT+E+KTR  G   G   K YI   +G+KF S+  V ++L    + N
Sbjct  101  SESGQSSDWLPPGWTIEIKTRKNGVSAGMREKFYIELATGKKFASRLAVLRYL---TDGN  157

Query  296  TPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISA  475
              +S    N ++  + +L   + +  K  + +      S +++     VS  + A+++  
Sbjct  158  ASVSTPRTNMLDTGNVHLTAKEYEGMKAAEEKGPLPENSSLNSTGIVPVS-TMGAEELPP  216

Query  476  DGLPAGWVKE--LRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGD  622
            D LP GW+ E  +R R   SG +   +YI+  +G  F S+  V+RYLE G+
Sbjct  217  DWLPTGWMMETKVRKRGKSSGAQSK-FYIELATGQRFTSRLAVLRYLENGN  266


 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 77/174 (44%), Gaps = 53/174 (30%)
 Frame = +2

Query  140  DWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsnen  316
            +WLPPGWT+++K R +G   G   K YI P+ G  F S+  + +++ +            
Sbjct  573  EWLPPGWTMQIKVRKSGKTAGMREKYYIDPATGCSFRSRVAILRYVKT------------  620

Query  317  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVA---------AQDI  469
                                        K+ S    + PKT+SP  +         A++ 
Sbjct  621  ----------------------------KKPSATKQKKPKTLSPKSSGNVMATTPDAKEQ  652

Query  470  SADGLPAGWVKELRTRTC--PSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
              + LP GW  E++ R     +G+R + YYIDP +G  FRS+  ++RY+E G +
Sbjct  653  PPEWLPPGWTMEIKERKSGKSAGLR-EKYYIDPATGRSFRSRIAIVRYIEAGKL  705


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 89/168 (53%), Gaps = 21/168 (13%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYI-SPSGRKFYSKAQVSQFLNSAANSNT--PI  304
            S++WLP GW +E K R +G+  G   K +I + +GR F SK QV ++L +   +    P+
Sbjct  6    STNWLPDGWIMEQKRRKSGATKGLADKYFIEAATGRFFRSKLQVLRYLKTEKYTGKLWPV  65

Query  305  snenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGL  484
               + N             N    E ++ +++    ++  +  +T+SP+ + Q  S+D L
Sbjct  66   KLVSNNKELT---------NGESMEKETSSAK----ILQEKVQRTLSPSESGQ--SSDWL  110

Query  485  PAGWVKELRTRT--CPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGD  622
            P GW  E++TR     +G+R + +YI+  +G +F S+  V+RYL  G+
Sbjct  111  PPGWTIEIKTRKNGVSAGMR-EKFYIELATGKKFASRLAVLRYLTDGN  157


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/176 (27%), Positives = 82/176 (47%), Gaps = 26/176 (15%)
 Frame = +2

Query  140  DWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsnen  316
            +WLPPGWT+ +  R  G   G   K YI   +G++F S+  V ++L    N N  +    
Sbjct  454  EWLPPGWTMVVTVRKAGKTAGRREKFYIELATGQRFASRLAVVRYLE---NGNASLERLK  510

Query  317  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVA-------------  457
                  S  +    ++ +P +      RK  +V+  +  K   P +              
Sbjct  511  SQEHGASKIDFIAEESNSPFQK-----RKESTVIKTKEKKDPLPEICPTNSSGNATVVTS  565

Query  458  -AQDISADGLPAGWVKELRTRTC--PSGIRKDPYYIDPVSGYEFRSKRDVMRYLET  616
             A+++  + LP GW  +++ R     +G+R + YYIDP +G  FRS+  ++RY++T
Sbjct  566  GAEELRPEWLPPGWTMQIKVRKSGKTAGMR-EKYYIDPATGCSFRSRVAILRYVKT  620


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 82/171 (48%), Gaps = 12/171 (7%)
 Frame = +2

Query  140  DWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIsnen  316
            +WLPPGW  E+  R +G   G   K YI   +G++F S+  V ++L +   S + + ++ 
Sbjct  335  EWLPPGWATEISVRKSGKTAGRREKFYIELATGQRFGSRLAVLRYLTNGNASPSGLKSKE  394

Query  317  k---nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVS-----PAVAAQDIS  472
                N       +  + +N   KE+    + ++K  +   +P   S       V A +++
Sbjct  395  LGVPNIDLNMEESDALIENL--KESTVMKTTQKKGSLPEFSPSKSSGNVGVSTVCAGELT  452

Query  473  ADGLPAGWVKELRTRTC-PSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGD  622
             + LP GW   +  R    +  R++ +YI+  +G  F S+  V+RYLE G+
Sbjct  453  PEWLPPGWTMVVTVRKAGKTAGRREKFYIELATGQRFASRLAVVRYLENGN  503



>ref|XP_009371320.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Pyrus x bretschneideri]
Length=572

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 75/160 (47%), Gaps = 41/160 (26%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSNTPIsne  313
            S DWLP GWTVE+K R  G  +   Y+   S SG +F S+A+VS++L+++++ +      
Sbjct  6    SEDWLPTGWTVEVKFRKNGRRDKYYYE---SSSGHRFSSRAEVSRYLSTSSHED------  56

Query  314  nknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAG  493
                             Q  KE   R S       D    KTV          A+GLP G
Sbjct  57   ----------------EQKIKETLKRPSD------DIVVEKTV----------AEGLPPG  84

Query  494  WVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLE  613
            W KE+R        R+D +YI PVS   F S RDV RYLE
Sbjct  85   WTKEIRITKKARKTRRDTHYIAPVSEKVFCSIRDVHRYLE  124



>ref|XP_011084407.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
[Sesamum indicum]
Length=523

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 74/161 (46%), Gaps = 50/161 (31%)
 Frame = +2

Query  143  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnenk  319
            WLP  W V +K RS G  +    K YI+P +G KF SK +V ++L +A            
Sbjct  8    WLPVDWKVCVKNRSFGRKD----KYYINPLNGLKFNSKLEVLRYLKNAG-----------  52

Query  320  nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWV  499
                                      +K K + +    KTV          A+ LP GW+
Sbjct  53   ------------------------KDQKLKQLNEIGIKKTV----------AEKLPPGWI  78

Query  500  KELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGD  622
            KE+RT+      R+DPYYIDPVSG  FRS ++V R+LE+ D
Sbjct  79   KEIRTKRKGGKTRRDPYYIDPVSGRHFRSMQEVFRFLESTD  119



>ref|XP_009371318.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Pyrus x bretschneideri]
Length=697

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 75/160 (47%), Gaps = 41/160 (26%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSNTPIsne  313
            S DWLP GWTVE+K R  G  +   Y+   S SG +F S+A+VS++L+++++ +      
Sbjct  6    SEDWLPTGWTVEVKFRKNGRRDKYYYE---SSSGHRFSSRAEVSRYLSTSSHED------  56

Query  314  nknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAG  493
                             Q  KE   R S       D    KTV          A+GLP G
Sbjct  57   ----------------EQKIKETLKRPSD------DIVVEKTV----------AEGLPPG  84

Query  494  WVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLE  613
            W KE+R        R+D +YI PVS   F S RDV RYLE
Sbjct  85   WTKEIRITKKARKTRRDTHYIAPVSEKVFCSIRDVHRYLE  124



>gb|AFW57951.1| methyl-binding domain MBD113 protein [Zea mays]
Length=482

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 83/192 (43%), Gaps = 39/192 (20%)
 Frame = +2

Query  143  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnenk  319
            WLP GWT+E+        NGS YK Y SP SG  F SK +   +L S           + 
Sbjct  88   WLPDGWTMEV----CQEDNGSIYKYYTSPMSGYMFTSKMETLHYLFSGVEERMLELQASA  143

Query  320  nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPA----------------  451
             + E   S+  +P+       + R   K+   MD    + +S A                
Sbjct  144  EDNELHESHTWLPRGWVI---EVRAGGKK---MDKMYKRFLSKAEVLHFVNKGMVSTCDM  197

Query  452  ------------VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRD  595
                        +A  + + DGLP GWVKE  +R    GIRKD YY DPVS   FR+ + 
Sbjct  198  DVLCDTSTDDNILAHVEFNPDGLPDGWVKETISRKFNDGIRKDQYYTDPVSHRVFRTLKS  257

Query  596  VMRYLETGDIKK  631
            V+ YL TG+I +
Sbjct  258  VLSYLGTGEISR  269



>ref|NP_001061241.1| Os08g0206700 [Oryza sativa Japonica Group]
 dbj|BAD11558.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD12843.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23155.1| Os08g0206700 [Oryza sativa Japonica Group]
 dbj|BAG92499.1| unnamed protein product [Oryza sativa Japonica Group]
Length=422

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  464  DISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            D+  DGLP GW KE R R   S ++ DPYYIDPVSGYEFRS +DV R+L++GDI K
Sbjct  337  DLIVDGLPDGWWKEDRPRKNGSNLKTDPYYIDPVSGYEFRSLKDVHRFLKSGDIYK  392



>gb|EYU38370.1| hypothetical protein MIMGU_mgv1a007205mg [Erythranthe guttata]
Length=415

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +2

Query  452  VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            VA + ++AD LP GW+KE+ T    + IRKDPYY DPVSGY FRSK DV RYL T +I
Sbjct  20   VACETVAADDLPPGWIKEIVTSKFGNKIRKDPYYTDPVSGYVFRSKLDVERYLTTNNI  77



>ref|XP_004982529.1| PREDICTED: uncharacterized protein LOC101763097 [Setaria italica]
Length=338

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 74/175 (42%), Gaps = 42/175 (24%)
 Frame = +2

Query  116  ASNTNQSSD-WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  289
            A NT Q    WLP GW +E+  R+ G      YK Y+ P +G +  SK  V  ++N A  
Sbjct  85   AENTFQKEHKWLPKGWVMEI--RAGGEKMDKMYKFYVYPKTGVRLLSKQDVLLYINEATV  142

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI  469
            S                        +     Q  TS +             +  +A  D 
Sbjct  143  S------------------------KCDTNGQCNTSSE-------------ANLLAIVDF  165

Query  470  SADGLPAGWVKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
               GLP GWVKEL  R    G IR+DPYY DP S Y FR+ +  + ++ETG I K
Sbjct  166  HPSGLPEGWVKELVFRKTKEGLIRRDPYYTDPASSYTFRTLKSALCFVETGKISK  220



>ref|XP_006653233.1| PREDICTED: uncharacterized protein LOC102703961 [Oryza brachyantha]
Length=280

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 73/166 (44%), Gaps = 40/166 (24%)
 Frame = +2

Query  131  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIs  307
             + +WLP  W +E+  R+ G +    +K Y+ P +G + +SK  V  ++N          
Sbjct  100  MTHEWLPNDWLIEI--RAGGENTDKMFKFYVYPPAGVRLFSKEDVLTYINKC--------  149

Query  308  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  487
                                TP +   +   + K   DN         +A  + +   LP
Sbjct  150  ------------------KITPFDTNGQCDTRTK---DN--------ILANVEFNPHSLP  180

Query  488  AGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
             GWVKEL  R     +RKDPYY DPVS Y FR++R  M +++TG +
Sbjct  181  KGWVKELVFRKTKDAVRKDPYYTDPVSNYSFRTRRSAMLFVQTGKV  226



>gb|EAY93364.1| hypothetical protein OsI_15161 [Oryza sativa Indica Group]
Length=316

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 78/169 (46%), Gaps = 41/169 (24%)
 Frame = +2

Query  131  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIs  307
             + +WLP GW +E+  R+ G +    YK Y+ P +G + +SK  V  ++N +        
Sbjct  120  MTHEWLPKGWIIEV--RAGGKNMNKMYKFYVYPPAGVRLFSKEDVLLYINKSE-------  170

Query  308  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  487
                           +    T  E  +RT        DN         +A  + +   LP
Sbjct  171  ---------------ITGFDTNGECDTRTK-------DN--------ILANVEFNPHSLP  200

Query  488  AGWVKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             GWVKE+  R   +G IRKDPY+ DPV+ Y FR+++  M Y++TG + K
Sbjct  201  EGWVKEVVFRKTKTGVIRKDPYFTDPVNNYSFRTRKSAMLYVQTGKVPK  249



>ref|XP_008376557.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 [Malus 
domestica]
Length=574

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 73/160 (46%), Gaps = 41/160 (26%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSNTPIsne  313
            S DWLP GWTVE+K R  G  +   Y+   S SG +F S+A+VS++L+++++ +      
Sbjct  6    SEDWLPTGWTVEVKFRKNGKRDKYYYE---SSSGHRFSSRAEVSRYLSTSSHED------  56

Query  314  nknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAG  493
                             Q  KE                T K  S  V  +   A+GLP G
Sbjct  57   ----------------EQKIKE----------------TLKRPSDDVVVEKTVAEGLPPG  84

Query  494  WVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLE  613
            W KE+R        R+D +YI P S   F S RDV RYLE
Sbjct  85   WTKEIRITKKARKTRRDTHYIAPASEKVFCSIRDVHRYLE  124



>ref|XP_002466890.1| hypothetical protein SORBIDRAFT_01g015930 [Sorghum bicolor]
 gb|EER93888.1| hypothetical protein SORBIDRAFT_01g015930 [Sorghum bicolor]
Length=278

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 75/171 (44%), Gaps = 42/171 (25%)
 Frame = +2

Query  116  ASNTNQ-SSDWLPPGWTVELKTRSTGSHNGSTYKCYI-SPSGRKFYSKAQVSQFLNSAAN  289
            A NT Q   +WLP GW +E+  R+ G      YK Y+ S +G +  SK  V  ++N A  
Sbjct  91   AENTLQRQHEWLPKGWVMEI--RAGGEKTDKMYKFYVHSITGVRLLSKQDVLLYINEAKI  148

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI  469
            S                        +     Q  TS +     DN         +A  DI
Sbjct  149  S------------------------RCDTNGQCDTSSE-----DN--------ILAKVDI  171

Query  470  SADGLPAGWVKELRTRTCPSGI-RKDPYYIDPVSGYEFRSKRDVMRYLETG  619
               GLP GWVKE+  R    G+ R+DPYY DP S Y FR+ +  + +LETG
Sbjct  172  RPSGLPEGWVKEIVYRKTKDGLTRRDPYYTDPASSYTFRTLKSALSFLETG  222



>ref|XP_008796743.1| PREDICTED: uncharacterized protein LOC103712110 isoform X8 [Phoenix 
dactylifera]
Length=600

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 74/150 (49%), Gaps = 26/150 (17%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  289
            LA       DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    +
Sbjct  29   LAEQIKDFPDWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMS  88

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRK--RKSVMDNQTPKTVSPAVAAQ  463
             N             +     V    T     S + RK  ++S M+N         V +Q
Sbjct  89   CNP-----------RAKRKRSVVTKVTENACSSTSQRKGIKRSTMEN---------VRSQ  128

Query  464  -DISADGLPAGWVKELRTRTCPS--GIRKD  544
             + + DGLP+GW+KE+R R   S  G ++D
Sbjct  129  IEYTPDGLPSGWIKEIRYRKTSSRCGAKRD  158


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 33/49 (67%), Gaps = 1/49 (2%)
 Frame = +2

Query  476  DGLPAGWVKELRTRTCPSGI-RKDPYYIDPVSGYEFRSKRDVMRYLETG  619
            D LPAGWV E +TR   +   R+   YIDPV+G+ F SK +V+RY++ G
Sbjct  38   DWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDG  86



>emb|CAH67925.1| OSIGBa0138E08-OSIGBa0161L23.6 [Oryza sativa Indica Group]
Length=383

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 78/169 (46%), Gaps = 41/169 (24%)
 Frame = +2

Query  131  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIs  307
             + +WLP GW +E+  R+ G +    YK Y+ P +G + +SK  V  ++N +        
Sbjct  120  MTHEWLPKGWIIEV--RAGGKNMNKMYKFYVYPPAGVRLFSKEDVLLYINKSE-------  170

Query  308  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  487
                           +    T  E  +RT        DN         +A  + +   LP
Sbjct  171  ---------------ITGFDTNGECDTRTK-------DN--------ILANVEFNPHSLP  200

Query  488  AGWVKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             GWVKE+  R   +G IRKDPY+ DPV+ Y FR+++  M Y++TG + K
Sbjct  201  EGWVKEVVFRKTKTGVIRKDPYFTDPVNNYSFRTRKSAMLYVQTGKVPK  249



>emb|CAD39866.2| OSJNBb0058J09.3 [Oryza sativa Japonica Group]
Length=385

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 78/169 (46%), Gaps = 41/169 (24%)
 Frame = +2

Query  131  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIs  307
             + +WLP GW +E+  R+ G +    YK Y+ P +G + +SK  V  ++N +        
Sbjct  120  MTHEWLPKGWIIEV--RAGGKNMNKMYKFYVYPPAGVRLFSKEDVLLYINKSE-------  170

Query  308  nenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLP  487
                           +    T  E  +RT        DN         +A  + +   LP
Sbjct  171  ---------------ITGFDTNGECDTRTK-------DN--------ILANVEFNPHSLP  200

Query  488  AGWVKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             GWVKE+  R   +G IRKDPY+ DPV+ Y FR+++  M Y++TG + K
Sbjct  201  EGWVKEVVFRKTKTGVIRKDPYFTDPVNNYSFRTRKSAMLYVQTGKVPK  249



>ref|XP_006659212.1| PREDICTED: uncharacterized protein LOC102718198 [Oryza brachyantha]
Length=1007

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = +2

Query  401  KRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEF  580
            K   ++ N++     P     +++ +GLP GW KE R R   S  + DPYYIDPVSGYEF
Sbjct  272  KEDMLIKNESEHRSDPVQRKDELTINGLPDGWWKEDRPRKNGSNQKTDPYYIDPVSGYEF  331

Query  581  RSKRDVMRYLETGDIKK  631
            RS +DV R+L++GDI K
Sbjct  332  RSLKDVHRFLKSGDIYK  348



>dbj|BAA89308.1| AHM2 [Triticum aestivum]
Length=353

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  476  DGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            DGLP GWVKEL  R C  GIRKDPYY DPVS   FR+ + V+ YL+TG+I
Sbjct  3    DGLPKGWVKELVFRKCNDGIRKDPYYTDPVSHLLFRTLKSVISYLQTGEI  52



>ref|XP_004972592.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Setaria italica]
 ref|XP_004972593.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Setaria italica]
Length=954

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 2/52 (4%)
 Frame = +2

Query  476  DGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            +GLP GW+KE R R   +G  +DP+YIDPVSGYEFRS +DV RYLETGDI +
Sbjct  282  EGLPDGWLKEYRPRK--TGSFQDPFYIDPVSGYEFRSLKDVHRYLETGDINQ  331



>ref|XP_008665005.1| PREDICTED: uncharacterized protein LOC103643620 [Zea mays]
Length=343

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 73/173 (42%), Gaps = 42/173 (24%)
 Frame = +2

Query  116  ASNTNQ-SSDWLPPGWTVELKTRSTGSHNGSTYKCYI-SPSGRKFYSKAQVSQFLNSAAN  289
            A NT Q   +WLP GW +E+  R+ G      YK Y+ S +G +  SK  V  ++N A  
Sbjct  92   AENTLQRQHEWLPKGWVMEV--RAGGEKADKMYKFYVHSITGLRLLSKQDVLLYINEAKV  149

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI  469
            S    +                 Q  T  E             DN   K         D 
Sbjct  150  SGCDTNE----------------QCDTTSE-------------DNILSKV--------DF  172

Query  470  SADGLPAGWVKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
               GLP GWVKEL  R    G IR+DPYY DP S Y FR+ +  + +LETG +
Sbjct  173  RPSGLPEGWVKELVYRKTKEGLIRRDPYYTDPASSYTFRTLKSALSFLETGKV  225



>ref|XP_002447565.1| hypothetical protein SORBIDRAFT_06g004050 [Sorghum bicolor]
 gb|EES11893.1| hypothetical protein SORBIDRAFT_06g004050 [Sorghum bicolor]
Length=295

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  452  VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            +A  + S DGLP GWVKE   R C  GIRKDPYY DPVS   FR+ + V+ YL TG+I K
Sbjct  20   LAQVEFSPDGLPDGWVKETIFRKCNDGIRKDPYYTDPVSRRVFRTLKSVLSYLGTGEISK  79



>tpg|DAA50117.1| TPA: hypothetical protein ZEAMMB73_042225 [Zea mays]
Length=320

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 72/171 (42%), Gaps = 42/171 (25%)
 Frame = +2

Query  116  ASNTNQ-SSDWLPPGWTVELKTRSTGSHNGSTYKCYI-SPSGRKFYSKAQVSQFLNSAAN  289
            A NT Q   +WLP GW +E+  R+ G      YK Y+ S +G +  SK  V  ++N A  
Sbjct  93   AENTLQRQHEWLPKGWVMEV--RAGGEKADKMYKFYVHSITGLRLLSKQDVLLYINEAKV  150

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI  469
            S    +                 Q  T  E+                       ++  D 
Sbjct  151  SGCDTNE----------------QCDTTSEDN---------------------ILSKVDF  173

Query  470  SADGLPAGWVKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETG  619
               GLP GWVKEL  R    G IR+DPYY DP S Y FR+ +  + +LETG
Sbjct  174  RPSGLPEGWVKELVYRKTKEGLIRRDPYYTDPASSYTFRTLKSALSFLETG  224



>ref|XP_008367419.1| PREDICTED: uncharacterized protein LOC103431052 [Malus domestica]
Length=1123

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 68/145 (47%), Gaps = 34/145 (23%)
 Frame = +2

Query  215  CYISPSGR-KFYSKAQVSQFLNSAANSNTPIsnenknnieesssnleVPQNQTPKENQSR  391
            CYI PS    FYSK +V ++L +                        V +  +   N   
Sbjct  29   CYIDPSRECTFYSKPEVFRYLKT------------------------VKRKSSKSGNLKS  64

Query  392  TSRKR-----KSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYI  556
            TS KR     K+V   Q  K V      +    + LP GW+KE++     +  RKDPYY 
Sbjct  65   TSSKRCITEGKAVTTLQLTKNV----YVEKHHVEDLPPGWIKEIKVTKYANRFRKDPYYT  120

Query  557  DPVSGYEFRSKRDVMRYLETGDIKK  631
            DP SGY FRSK+DV+ YLETG+I K
Sbjct  121  DPDSGYVFRSKKDVICYLETGEISK  145



>ref|XP_009418271.1| PREDICTED: uncharacterized protein LOC103998509 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=223

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 83/174 (48%), Gaps = 22/174 (13%)
 Frame = +2

Query  140  DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnen  316
            DWLP GW +E++        G TY+ Y  P S   F SK +V  +LN  A ++       
Sbjct  8    DWLPDGWIMEVRR----GKKGFTYRYYTCPISEYTFCSKEEVIHYLNIVAAAS-------  56

Query  317  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPA------VAAQDISAD  478
             +  E++    +  Q    K   S     R  +M+ +T K  + A      +   + S D
Sbjct  57   -HASEDTECFGDEDQQLVHKVKDSLKWLPRGWIMEIRTRKIGAEAEERYKVLYRIEYSPD  115

Query  479  GLPAGWVKEL---RTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            GLP GW+KE+   R +   S  ++D YY DP SGY FR+ +D + Y+E G + K
Sbjct  116  GLPDGWIKEIKFRRNKDKKSPTKQDAYYTDPESGYVFRTLKDCICYIEHGVLSK  169



>ref|XP_002461981.1| hypothetical protein SORBIDRAFT_02g011480 [Sorghum bicolor]
 gb|EER98502.1| hypothetical protein SORBIDRAFT_02g011480 [Sorghum bicolor]
Length=249

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 51/166 (31%), Positives = 71/166 (43%), Gaps = 49/166 (30%)
 Frame = +2

Query  140  DWLPPGWTVELKTRSTGSHNGSTYKCYI-SPSGRKFYSKAQVSQFLNSA----ANSNTPI  304
            +WLP GW +E+  R+ G      YK Y+ S +G +  SK  V  ++N A     N+N   
Sbjct  61   EWLPKGWVMEI--RAAGEKTDKMYKFYVHSITGVRLLSKQDVLLYINEANVSGCNTN---  115

Query  305  snenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGL  484
                                      Q  TS +     DN         +A  D    GL
Sbjct  116  -------------------------GQCDTSSE-----DN--------ILAKVDFRPSGL  137

Query  485  PAGWVKELRTRTCPSGI-RKDPYYIDPVSGYEFRSKRDVMRYLETG  619
            P GW+KE+  R    G+ R+DPYY DP S Y FR+ +  + +LETG
Sbjct  138  PEGWIKEIVYRKTKEGLTRRDPYYTDPASSYTFRTLKSALSFLETG  183



>ref|XP_002444304.1| hypothetical protein SORBIDRAFT_07g019900 [Sorghum bicolor]
 gb|EES13799.1| hypothetical protein SORBIDRAFT_07g019900 [Sorghum bicolor]
Length=317

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 71/171 (42%), Gaps = 41/171 (24%)
 Frame = +2

Query  119  SNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYI-SPSGRKFYSKAQVSQFLNSAANSN  295
            S   +  +WLP GW +E+  R+ G      YK Y+ S +G +  SK  V  ++N A  S 
Sbjct  93   STLQRQREWLPKGWVLEI--RAGGEKTDKMYKFYVHSITGVRLLSKQDVLLYINEAIVSG  150

Query  296  TPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISA  475
                                         Q   S +     DN         +A  D+  
Sbjct  151  CDT------------------------HGQCDISSE-----DN--------ILAQVDLWP  173

Query  476  DGLPAGWVKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
             GLP GWVKEL  R    G IRKD YY DP S Y FR+ +  + +LETG I
Sbjct  174  SGLPEGWVKELVYRKTKEGLIRKDRYYTDPASSYTFRTLKSALSFLETGKI  224



>ref|XP_002444023.1| hypothetical protein SORBIDRAFT_07g006030 [Sorghum bicolor]
 gb|EES13518.1| hypothetical protein SORBIDRAFT_07g006030 [Sorghum bicolor]
Length=961

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 40/53 (75%), Gaps = 2/53 (4%)
 Frame = +2

Query  473  ADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
             +G P GW KE R R   SG  +DPYYIDPVSGYEFRS +DV RYL+TGDI++
Sbjct  265  VEGFPDGWRKEYRPRK--SGSFQDPYYIDPVSGYEFRSLKDVHRYLKTGDIRQ  315



>ref|XP_007211158.1| hypothetical protein PRUPE_ppa027142mg, partial [Prunus persica]
 gb|EMJ12357.1| hypothetical protein PRUPE_ppa027142mg, partial [Prunus persica]
Length=747

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +2

Query  452  VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            V  +  + + LP+GW KE++ +   + +R+DPYY DPVSGY FRSK  VM YLETG+I +
Sbjct  1    VDVEKHNVEDLPSGWTKEIKVKRVANRLRRDPYYTDPVSGYVFRSKNAVMHYLETGEISR  60



>gb|KDO60033.1| hypothetical protein CISIN_1g008463mg [Citrus sinensis]
Length=537

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  476  DGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            DGLP GW KE++       +R+DPYYIDP SGY FRS +D +RY+ETG+I
Sbjct  11   DGLPPGWTKEIKVTKTGRKVRRDPYYIDPASGYIFRSMKDAVRYVETGEI  60



>emb|CAE04540.2| OSJNBa0040D17.8 [Oryza sativa Japonica Group]
Length=377

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/173 (29%), Positives = 75/173 (43%), Gaps = 41/173 (24%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAAN  289
            + SN  ++ +WLP GW VE+  R+ G +    YK Y+ P  R + +SK  V  ++     
Sbjct  63   VGSNLTRTHEWLPKGWLVEI--RAGGDNMDKMYKFYVYPPNRVRLFSKDDVLLYIKEMKI  120

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI  469
            S                            + Q  TS             T    +A  + 
Sbjct  121  SGFD------------------------TDGQCNTS-------------TQENILAILEF  143

Query  470  SADGLPAGWVKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            + +GLP GWVKE+  R   +G IR+D +Y DP+  Y FR+KR    Y+ETG +
Sbjct  144  NPEGLPQGWVKEVVFRKTHTGRIRRDRHYTDPIKSYVFRTKRSAAFYVETGKV  196



>ref|XP_006490367.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
[Citrus sinensis]
 gb|KDO60031.1| hypothetical protein CISIN_1g008463mg [Citrus sinensis]
Length=564

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  476  DGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            DGLP GW KE++       +R+DPYYIDP SGY FRS +D +RY+ETG+I
Sbjct  38   DGLPPGWTKEIKVTKTGRKVRRDPYYIDPASGYIFRSMKDAVRYVETGEI  87



>gb|KDO60032.1| hypothetical protein CISIN_1g008463mg [Citrus sinensis]
Length=549

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  476  DGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            DGLP GW KE++       +R+DPYYIDP SGY FRS +D +RY+ETG+I
Sbjct  38   DGLPPGWTKEIKVTKTGRKVRRDPYYIDPASGYIFRSMKDAVRYVETGEI  87



>ref|XP_006421896.1| hypothetical protein CICLE_v10004647mg [Citrus clementina]
 gb|ESR35136.1| hypothetical protein CICLE_v10004647mg [Citrus clementina]
Length=564

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  476  DGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            DGLP GW KE++       +R+DPYYIDP SGY FRS +D +RY+ETG+I
Sbjct  38   DGLPPGWTKEIKVTKTGRKVRRDPYYIDPASGYIFRSMKDAVRYVETGEI  87



>ref|XP_010035118.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Eucalyptus grandis]
Length=812

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = +2

Query  473  ADGLPAGWVKELRT-RTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            A+GLP GW KE++  R   + IR+DPYY DPVSGY FRS +DV RYL+TGDI
Sbjct  259  AEGLPEGWTKEIKVKRKNGTIIRRDPYYTDPVSGYVFRSMKDVRRYLDTGDI  310



>ref|XP_010035117.1| PREDICTED: uncharacterized protein LOC104424406 isoform X1 [Eucalyptus 
grandis]
 gb|KCW46411.1| hypothetical protein EUGRSUZ_K00243 [Eucalyptus grandis]
Length=818

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = +2

Query  473  ADGLPAGWVKELRT-RTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            A+GLP GW KE++  R   + IR+DPYY DPVSGY FRS +DV RYL+TGDI
Sbjct  259  AEGLPEGWTKEIKVKRKNGTIIRRDPYYTDPVSGYVFRSMKDVRRYLDTGDI  310



>gb|EAZ29862.1| hypothetical protein OsJ_13921 [Oryza sativa Japonica Group]
Length=411

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/173 (29%), Positives = 75/173 (43%), Gaps = 41/173 (24%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAAN  289
            + SN  ++ +WLP GW VE+  R+ G +    YK Y+ P  R + +SK  V  ++     
Sbjct  97   VGSNLTRTHEWLPKGWLVEI--RAGGDNMDKMYKFYVYPPNRVRLFSKDDVLLYIKEMKI  154

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI  469
            S                            + Q  TS             T    +A  + 
Sbjct  155  SGFD------------------------TDGQCNTS-------------TQENILAILEF  177

Query  470  SADGLPAGWVKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            + +GLP GWVKE+  R   +G IR+D +Y DP+  Y FR+KR    Y+ETG +
Sbjct  178  NPEGLPQGWVKEVVFRKTHTGRIRRDRHYTDPIKSYVFRTKRSAAFYVETGKV  230



>ref|XP_008678194.1| PREDICTED: uncharacterized protein LOC103652994 [Zea mays]
 ref|XP_008678195.1| PREDICTED: uncharacterized protein LOC103652994 [Zea mays]
Length=912

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 45/66 (68%), Gaps = 2/66 (3%)
 Frame = +2

Query  434  KTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLE  613
            + V+  V+    + +GLP GW KE R R   +G   D YYIDPVSGYEFRS +DV RYLE
Sbjct  220  RLVAKTVSKDKRAVEGLPDGWRKEYRPRK--NGSFLDVYYIDPVSGYEFRSFKDVHRYLE  277

Query  614  TGDIKK  631
            TGDI++
Sbjct  278  TGDIRQ  283



>tpg|DAA59672.1| TPA: hypothetical protein ZEAMMB73_581852 [Zea mays]
Length=393

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/164 (32%), Positives = 69/164 (42%), Gaps = 41/164 (25%)
 Frame = +2

Query  140  DWLPPGWTVELKTRSTGSHNGSTYKCYI-SPSGRKFYSKAQVSQFLNSAANSNTPIsnen  316
            +WLP GW +E+  R+ G      YK Y+ S +G +  SK  V  ++N A  S    +   
Sbjct  171  EWLPKGWVMEV--RAGGEKADKMYKFYVHSITGLRLLSKQDVLLYINEAKVSGCDTNG--  226

Query  317  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  496
                          Q  T  E             DN   K         D    GLP GW
Sbjct  227  --------------QCDTTSE-------------DNILSKV--------DFRPSGLPEGW  251

Query  497  VKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            VKEL  R    G I++DPYY DP S Y FR+ +  + +LETG +
Sbjct  252  VKELVYRKTMEGLIKRDPYYTDPASSYTFRTLKSALSFLETGKV  295



>gb|EMS57086.1| Methyl-CpG-binding domain-containing protein 13 [Triticum urartu]
Length=946

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 39/55 (71%), Gaps = 2/55 (4%)
 Frame = +2

Query  467  ISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            +S   LP GW KE+R R    G + DPYY DPVSGYEFRS +DV RY+E+GDI K
Sbjct  174  LSKGQLPDGWRKEVRPRK--DGTKSDPYYTDPVSGYEFRSLKDVQRYIESGDISK  226



>gb|AFW61002.1| hypothetical protein ZEAMMB73_269384 [Zea mays]
Length=921

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 45/66 (68%), Gaps = 2/66 (3%)
 Frame = +2

Query  434  KTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLE  613
            + V+  V+    + +GLP GW KE R R   +G   D YYIDPVSGYEFRS +DV RYLE
Sbjct  229  RLVAKTVSKDKRAVEGLPDGWRKEYRPRK--NGSFLDVYYIDPVSGYEFRSFKDVHRYLE  286

Query  614  TGDIKK  631
            TGDI++
Sbjct  287  TGDIRQ  292



>ref|XP_008662741.1| PREDICTED: uncharacterized protein LOC103641148 isoform X1 [Zea 
mays]
Length=942

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 44/65 (68%), Gaps = 7/65 (11%)
 Frame = +2

Query  452  VAAQDISAD-----GLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLET  616
            +AA+ +S D     GLP GW KE R R   +G   DPYYIDPVSGYEFRS +DV  YLET
Sbjct  252  LAAKTVSEDKRGVEGLPDGWQKEYRPRK--NGPCSDPYYIDPVSGYEFRSLKDVHNYLET  309

Query  617  GDIKK  631
            GDI +
Sbjct  310  GDISQ  314



>ref|XP_008662742.1| PREDICTED: uncharacterized protein LOC103641148 isoform X2 [Zea 
mays]
Length=934

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 44/65 (68%), Gaps = 7/65 (11%)
 Frame = +2

Query  452  VAAQDISAD-----GLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLET  616
            +AA+ +S D     GLP GW KE R R   +G   DPYYIDPVSGYEFRS +DV  YLET
Sbjct  244  LAAKTVSEDKRGVEGLPDGWQKEYRPRK--NGPCSDPYYIDPVSGYEFRSLKDVHNYLET  301

Query  617  GDIKK  631
            GDI +
Sbjct  302  GDISQ  306



>gb|EMT07793.1| hypothetical protein F775_13908 [Aegilops tauschii]
Length=1078

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 39/55 (71%), Gaps = 2/55 (4%)
 Frame = +2

Query  467  ISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            +S   LP GW KE+R R    G + DPYY DPVSGYEFRS +DV RY+E+GDI K
Sbjct  306  LSKGQLPDGWRKEVRPRK--DGTKSDPYYTDPVSGYEFRSLKDVQRYIESGDISK  358



>ref|XP_003572272.2| PREDICTED: uncharacterized protein LOC100826562 [Brachypodium 
distachyon]
Length=328

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 73/173 (42%), Gaps = 42/173 (24%)
 Frame = +2

Query  116  ASNTNQSSD-WLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAAN  289
            A NT  S+  WLP GW +E+  R+ G +    +K YI P    + +SK  V  ++     
Sbjct  97   ARNTLHSTHLWLPKGWFIEI--RAGGENMDKMFKFYIYPPMEIRLFSKEDVLLYVKEMVV  154

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKT-VSPAVAAQD  466
            S                            E Q  TS +     DN       +P+V    
Sbjct  155  S------------------------ACDTEGQCDTSSQ-----DNILALVEFNPSVL---  182

Query  467  ISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
                 LP GWVKE+  R    GIRKDPY+ DPV+ Y FR+ +  M YL TG I
Sbjct  183  -----LPEGWVKEIVYRKTKEGIRKDPYFTDPVNHYVFRTLKAAMTYLSTGKI  230



>gb|AFW80349.1| hypothetical protein ZEAMMB73_827373 [Zea mays]
Length=407

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/164 (32%), Positives = 69/164 (42%), Gaps = 41/164 (25%)
 Frame = +2

Query  140  DWLPPGWTVELKTRSTGSHNGSTYKCYI-SPSGRKFYSKAQVSQFLNSAANSNTPIsnen  316
            +WLP GW +E+  R+ G      YK Y+ S +G +  SK  V  ++N A  S    +   
Sbjct  185  EWLPKGWVMEV--RAGGEKANKMYKFYVHSITGLRLLSKQDVLLYINEAKVSGCDTNG--  240

Query  317  knnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW  496
                          Q  T  E             DN   K         D    GLP GW
Sbjct  241  --------------QCDTTSE-------------DNILSKV--------DFRPSGLPEGW  265

Query  497  VKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            VKEL  R    G I++DPYY DP S Y FR+ +  + +LETG +
Sbjct  266  VKELVYRKTMEGLIKRDPYYTDPASSYTFRTLKSALSFLETGKV  309



>gb|EEC76836.1| hypothetical protein OsI_14986 [Oryza sativa Indica Group]
Length=247

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 50/173 (29%), Positives = 71/173 (41%), Gaps = 41/173 (24%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAAN  289
            +  N  ++ +WLP GW VE+  R+ G +    YK Y+ P  R + YSK  V  ++     
Sbjct  25   VGCNLMRTHEWLPKGWLVEI--RAGGDNMDKMYKFYVYPPHRVRLYSKDDVLLYIKEMKI  82

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI  469
            S                            + Q  TS             T    +A  + 
Sbjct  83   SGFD------------------------TDGQCNTS-------------TQENILAILEF  105

Query  470  SADGLPAGWVKELRTR-TCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            +  GLP GWVKE+  R T   GIR+D +Y DP+  Y FR  R    Y+ETG +
Sbjct  106  NPKGLPQGWVKEVVFRKTNTGGIRRDRHYTDPIKNYVFRIMRSAALYVETGKV  158



>ref|XP_010662495.1| PREDICTED: uncharacterized protein LOC100263513 isoform X2 [Vitis 
vinifera]
Length=564

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  440  VSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETG  619
            ++  V  + ++A+GLP GW+KE++ +     +R+D YY DPV+GY FRS +D +RYL+TG
Sbjct  17   IAKKVVFERVTAEGLPPGWIKEIKIQKKCGTVRRDAYYTDPVNGYIFRSMKDTLRYLKTG  76

Query  620  D  622
            D
Sbjct  77   D  77



>gb|EMT08445.1| hypothetical protein F775_07512 [Aegilops tauschii]
Length=247

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 59/204 (29%), Positives = 86/204 (42%), Gaps = 35/204 (17%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFL-----  274
            L     Q  DWLP GW +E++       NG+ YK +ISP +G KF  K QV  +L     
Sbjct  21   LEDGMEQPPDWLPDGWIMEVRRDD----NGALYKYFISPVTGVKFRLKEQVLDYLFSEME  76

Query  275  ------NSAANSNTPIsne---------------nknnieesssnleVPQNQTPKENQSR  391
                  N     +TP ++E                   + +      +      KE+   
Sbjct  77   EHYIESNDCVACSTPHAHEWLPDGWLVEVRAGGEKMEKMYKFYLFSPLEVRVFSKEDVLL  136

Query  392  TSRKRKSV---MDNQT-PKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYID  559
             ++++K      D Q    +    +A  + +  GLP GWVKE+  R     IRKD Y+ D
Sbjct  137  YTKEKKIFKCDTDGQCDTDSQDNILATVEFNPHGLPQGWVKEVVYRKSEERIRKDSYFTD  196

Query  560  PVSGYEFRSKRDVMRYLETGDIKK  631
            PVS   FRS      Y+ TG++KK
Sbjct  197  PVSHKVFRSLNYATHYINTGEVKK  220



>gb|EEE60561.1| hypothetical protein OsJ_13923 [Oryza sativa Japonica Group]
Length=325

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 50/173 (29%), Positives = 72/173 (42%), Gaps = 41/173 (24%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAAN  289
            +  N  ++ +WLP GW VE+  R+ G +    YK Y+ P  R + YSK  V  ++     
Sbjct  97   VGCNLMRTHEWLPKGWLVEI--RAGGDNMDKMYKFYVYPPHRVRLYSKDDVLLYIKEMKI  154

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI  469
            S                            + Q  TS             T    +A  + 
Sbjct  155  SGFDT------------------------DGQCNTS-------------TQENILAILEF  177

Query  470  SADGLPAGWVKELRTR-TCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            +  GLP GWVKE+  R T   GIR+D +Y DP+  Y FR+ R    Y+ETG +
Sbjct  178  NPKGLPQGWVKEVVFRKTNTGGIRRDRHYTDPIKNYVFRTMRSAALYVETGKV  230



>ref|XP_002444202.1| hypothetical protein SORBIDRAFT_07g014920 [Sorghum bicolor]
 gb|EES13697.1| hypothetical protein SORBIDRAFT_07g014920 [Sorghum bicolor]
Length=317

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 71/171 (42%), Gaps = 41/171 (24%)
 Frame = +2

Query  119  SNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYI-SPSGRKFYSKAQVSQFLNSAANSN  295
            S   +  +WLP GW +E+  R+ G      YK Y+ S +G +  SK  V  ++N A  S 
Sbjct  93   STLQRQREWLPKGWVMEI--RAGGEKTDKMYKFYVHSITGVRLLSKQDVLLYINEAIVSG  150

Query  296  TPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISA  475
                                         Q   S +     DN         +A  D+  
Sbjct  151  CDT------------------------HGQCDISSE-----DN--------ILAKVDLWP  173

Query  476  DGLPAGWVKELRTRTCPSGI-RKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
             GLP GWVKEL  R    G+ RKD Y+ DP S Y FR+ +  + +LETG I
Sbjct  174  SGLPEGWVKELVFRKTKEGLMRKDRYFTDPASSYTFRTLKSALSFLETGKI  224



>emb|CAH67758.1| H0124E07.5 [Oryza sativa Indica Group]
Length=332

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 75/173 (43%), Gaps = 41/173 (24%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAAN  289
            + SN  ++ +WLP GW VE+  R+ G +    YK Y+ P  R + +SK  V  ++     
Sbjct  86   VGSNLMRTHEWLPKGWLVEI--RAGGDNMDKMYKFYVYPPNRVRLFSKDDVLIYIKEMKI  143

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI  469
            S      +                N   +EN                       +A  + 
Sbjct  144  SGFDTDGQC---------------NTNTQEN----------------------ILAILEF  166

Query  470  SADGLPAGWVKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            + +GLP GWVKE+  R   +G IR+D +Y DP+  Y FR+KR    Y+ETG +
Sbjct  167  NPEGLPQGWVKEVVFRKTNTGKIRRDRHYTDPIKNYVFRTKRSAALYVETGKV  219



>ref|XP_010934848.1| PREDICTED: uncharacterized protein LOC105054908 isoform X3 [Elaeis 
guineensis]
Length=638

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 47/140 (34%), Positives = 64/140 (46%), Gaps = 36/140 (26%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsn  310
            S  WLPPGW +E++T+  GS     YK Y  PS R +FYSK  V QF+ S          
Sbjct  79   SFKWLPPGWLLEIRTQRCGSKARQIYKSYFDPSTRSRFYSKGDVLQFVKSG---------  129

Query  311  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  490
                            +  +P  +Q R         ++++P+ V   +A  +   DGLP 
Sbjct  130  ----------------KIYSPTSDQKRH-------CESESPEHV---IAQIEFYPDGLPD  163

Query  491  GWVKELRTRTCPSGIRKDPY  550
            GW KE R +   SGIRKDP 
Sbjct  164  GWYKETRIKKNRSGIRKDPL  183



>ref|XP_010255467.1| PREDICTED: uncharacterized protein LOC104596134 isoform X1 [Nelumbo 
nucifera]
Length=577

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 83/164 (51%), Gaps = 17/164 (10%)
 Frame = +2

Query  125  TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTP  301
              +S DWLP GW +++K R TG  +    K YI   +GRKF SK  V +++ +  + N  
Sbjct  3    AEKSPDWLPDGWVMDVKVRKTGQKD----KYYIHLKTGRKFRSKDGVLRYIETGESHNC-  57

Query  302  IsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADG  481
            +  + +      SS+ +VP   +  ++   T  + K  M  + P   SP         D 
Sbjct  58   MPLQIERQANTCSSDKDVPNTCSSDKDMPNTCSRDKD-MPLEMPMEDSP---------DW  107

Query  482  LPAGWVKELRTRTCPSGI-RKDPYYIDPVSGYEFRSKRDVMRYL  610
            LPAGWV E++TR   S + +K   YI P++G    SKRDV RYL
Sbjct  108  LPAGWVVEIKTRRGGSKVGQKYKCYIAPITGCRLYSKRDVYRYL  151



>ref|XP_004976791.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Setaria italica]
 ref|XP_004976792.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Setaria italica]
 ref|XP_004976793.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X3 [Setaria italica]
 ref|XP_004976794.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X4 [Setaria italica]
 ref|XP_004976795.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X5 [Setaria italica]
Length=389

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 2/56 (4%)
 Frame = +2

Query  470  SADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            + +GLP GW+KE R R   +G  I+ D +YIDPV+GYEFRS +DV RYLE+GDI +
Sbjct  9    AGEGLPDGWLKECRPRKNRNGSRIKGDMFYIDPVNGYEFRSLKDVYRYLESGDISQ  64



>ref|XP_010255468.1| PREDICTED: uncharacterized protein LOC104596134 isoform X2 [Nelumbo 
nucifera]
Length=572

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 83/164 (51%), Gaps = 17/164 (10%)
 Frame = +2

Query  125  TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTP  301
              +S DWLP GW +++K R TG  +    K YI   +GRKF SK  V +++ +  + N  
Sbjct  3    AEKSPDWLPDGWVMDVKVRKTGQKD----KYYIHLKTGRKFRSKDGVLRYIETGESHNC-  57

Query  302  IsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADG  481
            +  + +      SS+ +VP   +  ++   T  + K  M  + P   SP         D 
Sbjct  58   MPLQIERQANTCSSDKDVPNTCSSDKDMPNTCSRDKD-MPLEMPMEDSP---------DW  107

Query  482  LPAGWVKELRTRTCPSGI-RKDPYYIDPVSGYEFRSKRDVMRYL  610
            LPAGWV E++TR   S + +K   YI P++G    SKRDV RYL
Sbjct  108  LPAGWVVEIKTRRGGSKVGQKYKCYIAPITGCRLYSKRDVYRYL  151



>gb|EEE60563.1| hypothetical protein OsJ_13925 [Oryza sativa Japonica Group]
Length=337

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/173 (28%), Positives = 74/173 (43%), Gaps = 41/173 (24%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAAN  289
            + SN  ++ +WLP GW VE+  R+ G +    YK Y+ P  R + +SK  V  ++     
Sbjct  97   VGSNLTRTHEWLPKGWLVEI--RAGGDNMDKMYKFYVYPPNRVRLFSKDDVLIYIKEMKI  154

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI  469
            S      +                N   +EN                       +A  + 
Sbjct  155  SGFDTDGQC---------------NTNTQEN----------------------ILAILEF  177

Query  470  SADGLPAGWVKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            + +GLP GWVKE+  R   +G IR+D +Y DP+  Y F +KR    Y+ETG +
Sbjct  178  NPEGLPQGWVKEVVFRKTNTGKIRRDRHYTDPIKNYVFHTKRSAALYVETGKV  230



>emb|CAE01997.2| OSJNBb0033G08.13 [Oryza sativa Japonica Group]
 emb|CAE04535.2| OSJNBa0040D17.1 [Oryza sativa Japonica Group]
Length=336

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/173 (29%), Positives = 72/173 (42%), Gaps = 41/173 (24%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAAN  289
            +  N  ++ +WLP GW VE+  R+ G +    YK Y+ P  R + YSK  V  ++     
Sbjct  86   VGCNLMRTHEWLPKGWLVEI--RAGGDNMDKMYKFYVYPPHRVRLYSKDDVLLYIKEMKI  143

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI  469
            S                            + Q  TS             T    +A  + 
Sbjct  144  SGFD------------------------TDGQCNTS-------------TQENILAILEF  166

Query  470  SADGLPAGWVKELRTR-TCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            +  GLP GWVKE+  R T   GIR+D +Y DP+  Y FR+ R    Y+ETG +
Sbjct  167  NPKGLPQGWVKEVVFRKTNTGGIRRDRHYTDPIKNYVFRTMRSAALYVETGKV  219



>ref|XP_010089148.1| Methyl-CpG-binding domain-containing protein 5 [Morus notabilis]
 gb|EXB37395.1| Methyl-CpG-binding domain-containing protein 5 [Morus notabilis]
Length=171

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/165 (32%), Positives = 80/165 (48%), Gaps = 37/165 (22%)
 Frame = +2

Query  128  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYI-SPSGRKFYSKAQVSQFLNSAANSNTPI  304
            N SSDWLP GWTV+ K   +G   G     Y  + +G+   SK +V Q +++ ++ +T  
Sbjct  4    NDSSDWLPSGWTVQFKVLKSGRKVG----IYTNTETGKIVLSKHEVFQLISAGSSCST--  57

Query  305  snenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGL  484
                                      Q +TS    S+   +TP  + P V  +D+  + L
Sbjct  58   --------------------------QPQTSNTHVSLQAERTP--LQP-VNEKDLLPEWL  88

Query  485  PAGWVKELRTRTCPSGIRKD-PYYIDPVSGYEFRSKRDVMRYLET  616
            P GW  E+RTR   +   K+   YIDP++G +F SK +V+RYL+T
Sbjct  89   PKGWKVEVRTRKSGTLAGKEYKSYIDPLNGSKFYSKLEVLRYLKT  133


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +2

Query  140  DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  283
            +WLP GW VE++TR +G+  G  YK YI P +G KFYSK +V ++L + 
Sbjct  86   EWLPKGWKVEVRTRKSGTLAGKEYKSYIDPLNGSKFYSKLEVLRYLKTV  134



>ref|XP_010317585.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Solanum lycopersicum]
 ref|XP_010317586.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Solanum lycopersicum]
 ref|XP_010317587.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Solanum lycopersicum]
Length=523

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  470  SADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLET  616
            +++GLP GW+KEL+ R     IRKDPYYIDPVSG  FRS + V R+LET
Sbjct  15   ASEGLPPGWIKELKVRKKGRKIRKDPYYIDPVSGQTFRSLKQVSRFLET  63



>gb|EEC77988.1| hypothetical protein OsI_17375 [Oryza sativa Indica Group]
Length=394

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 45/65 (69%), Gaps = 5/65 (8%)
 Frame = +2

Query  446  PAVAAQ---DISADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYL  610
            PAV A    + + +GLP GW+KE R R   SG  ++ D +YIDP + YEFRS++DV RYL
Sbjct  20   PAVTADGKIEPAGEGLPHGWLKEYRPRKNQSGSRVKGDTFYIDPTNMYEFRSQKDVQRYL  79

Query  611  ETGDI  625
            E+GD+
Sbjct  80   ESGDV  84



>ref|NP_001053858.1| Os04g0613800 [Oryza sativa Japonica Group]
 dbj|BAF15772.1| Os04g0613800 [Oryza sativa Japonica Group]
 dbj|BAG91729.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92796.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67422.1| hypothetical protein OsJ_24762 [Oryza sativa Japonica Group]
Length=394

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 45/65 (69%), Gaps = 5/65 (8%)
 Frame = +2

Query  446  PAVAAQ---DISADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYL  610
            PAV A    + + +GLP GW+KE R R   SG  ++ D +YIDP + YEFRS++DV RYL
Sbjct  20   PAVTADGKIEPAGEGLPHGWLKEYRPRKNQSGSRVKGDTFYIDPTNMYEFRSQKDVQRYL  79

Query  611  ETGDI  625
            E+GD+
Sbjct  80   ESGDV  84



>emb|CAE05215.3| OSJNBa0070C17.22 [Oryza sativa Japonica Group]
Length=438

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 45/65 (69%), Gaps = 5/65 (8%)
 Frame = +2

Query  446  PAVAAQ---DISADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYL  610
            PAV A    + + +GLP GW+KE R R   SG  ++ D +YIDP + YEFRS++DV RYL
Sbjct  20   PAVTADGKIEPAGEGLPHGWLKEYRPRKNQSGSRVKGDTFYIDPTNMYEFRSQKDVQRYL  79

Query  611  ETGDI  625
            E+GD+
Sbjct  80   ESGDV  84



>emb|CAE01991.2| OSJNBb0033G08.7 [Oryza sativa Japonica Group]
Length=418

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/173 (28%), Positives = 74/173 (43%), Gaps = 41/173 (24%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAAN  289
            + SN  ++ +WLP GW VE+  R+ G +    YK Y+ P  R + +SK  V  ++     
Sbjct  86   VGSNLTRTHEWLPKGWLVEI--RAGGDNMDKMYKFYVYPPNRVRLFSKDDVLIYIKEMKI  143

Query  290  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI  469
            S      +                N   +EN                       +A  + 
Sbjct  144  SGFDTDGQC---------------NTNTQEN----------------------ILAILEF  166

Query  470  SADGLPAGWVKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            + +GLP GWVKE+  R   +G IR+D +Y DP+  Y F +KR    Y+ETG +
Sbjct  167  NPEGLPQGWVKEVVFRKTNTGKIRRDRHYTDPIKNYVFHTKRSAALYVETGKV  219



>gb|EPS58890.1| hypothetical protein M569_15921, partial [Genlisea aurea]
Length=77

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  452  VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            +A +   AD LP GW+KE++T+   +  RKD ++ DP SGY F SK D +RYL+T DI K
Sbjct  2    IAVETFPADELPPGWIKEIKTKKRGNMTRKDLFFTDPKSGYTFYSKLDALRYLKTDDISK  61



>gb|KHN28399.1| Methyl-CpG-binding domain-containing protein 13, partial [Glycine 
soja]
Length=612

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 47/84 (56%), Gaps = 0/84 (0%)
 Frame = +2

Query  374  KENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDPYY  553
            K N     R   +V +  + + +SP +  +    +GLP GWVK+ R  T    +R+D +Y
Sbjct  76   KFNSKEVFRYLDNVQNKVSIQKISPNIIVEKAIVEGLPPGWVKKTRITTNGDSVRRDTFY  135

Query  554  IDPVSGYEFRSKRDVMRYLETGDI  625
            IDPV+GY F S  DV  YLETG I
Sbjct  136  IDPVNGYTFCSIEDVDHYLETGKI  159



>ref|NP_001170014.1| hypothetical protein [Zea mays]
 gb|ACN35529.1| unknown [Zea mays]
 gb|AFW59433.1| hypothetical protein ZEAMMB73_114433 [Zea mays]
Length=432

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 50/79 (63%), Gaps = 8/79 (10%)
 Frame = +2

Query  419  DNQTPKTVSPA--VAAQD----ISADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGY  574
            D+ T + V PA  +A  D     + +GLP GW+KE R R    G  ++ D +YIDP++GY
Sbjct  8    DHITQRKVVPAKHIALVDGKNEPAVEGLPNGWLKECRPRKNRYGSRVKSDTFYIDPINGY  67

Query  575  EFRSKRDVMRYLETGDIKK  631
            EF S +DV RYLE+GDI K
Sbjct  68   EFHSLKDVHRYLESGDISK  86



>ref|XP_010234457.1| PREDICTED: uncharacterized protein LOC100834821 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010234458.1| PREDICTED: uncharacterized protein LOC100834821 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010234459.1| PREDICTED: uncharacterized protein LOC100834821 isoform X1 [Brachypodium 
distachyon]
Length=1096

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  482  LPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            LP GW +E R R   S  + DPYYIDPV+GYEFRS +DV RY+++GDIK+
Sbjct  321  LPDGWRREDRPRRNGSTNKTDPYYIDPVNGYEFRSMKDVHRYIKSGDIKQ  370



>ref|XP_010234460.1| PREDICTED: uncharacterized protein LOC100834821 isoform X2 [Brachypodium 
distachyon]
Length=1092

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  482  LPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            LP GW +E R R   S  + DPYYIDPV+GYEFRS +DV RY+++GDIK+
Sbjct  317  LPDGWRREDRPRRNGSTNKTDPYYIDPVNGYEFRSMKDVHRYIKSGDIKQ  366



>gb|EMT11132.1| hypothetical protein F775_24324 [Aegilops tauschii]
Length=387

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +2

Query  452  VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            +A  + +  GLP GWVKE+  R    GIRKDPYY DPV+ Y FR+    +RYLETG + K
Sbjct  205  LAEVEFNPFGLPHGWVKEIVYRKTSEGIRKDPYYTDPVNQYVFRTLTSAVRYLETGKVTK  264



>ref|XP_007209689.1| hypothetical protein PRUPE_ppa012392mg [Prunus persica]
 gb|EMJ10888.1| hypothetical protein PRUPE_ppa012392mg [Prunus persica]
Length=171

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSA  283
            L  NT +  +WLP GW VE++TR TG H G  YKCYI PS    FYSK +V ++L + 
Sbjct  77   LVVNTTEYPEWLPKGWKVEVRTRKTGVHVGKEYKCYIDPSTECSFYSKPEVFRYLKTV  134



>ref|XP_006652812.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Oryza brachyantha]
 ref|XP_006652813.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Oryza brachyantha]
Length=393

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = +2

Query  470  SADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            + +GLP GW+K  R R   SG  I+ D +YIDP + YEFRS +DV RYLE+GD+
Sbjct  31   AGEGLPPGWLKAYRPRKSQSGSKIKGDTFYIDPTNMYEFRSLKDVHRYLESGDV  84



>dbj|BAK01530.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1091

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 35/50 (70%), Gaps = 2/50 (4%)
 Frame = +2

Query  482  LPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            LP GW +E R R    G + D YY DPVSGYEFRS +DV RY+E+GDI K
Sbjct  318  LPDGWRREDRLRK--DGTKSDTYYTDPVSGYEFRSLKDVQRYIESGDISK  365



>ref|XP_006652814.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X3 [Oryza brachyantha]
Length=365

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = +2

Query  470  SADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            + +GLP GW+K  R R   SG  I+ D +YIDP + YEFRS +DV RYLE+GD+
Sbjct  31   AGEGLPPGWLKAYRPRKSQSGSKIKGDTFYIDPTNMYEFRSLKDVHRYLESGDV  84



>gb|EAZ30036.1| hypothetical protein OsJ_14093 [Oryza sativa Japonica Group]
Length=319

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 79/165 (48%), Gaps = 27/165 (16%)
 Frame = +2

Query  143  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnenk  319
            WLP GW +E+        +G+ Y+ Y SP SG  F  K++   +  +       +   +K
Sbjct  44   WLPDGWIMEV----YQGDDGTIYRYYTSPISGLTFTMKSEFYVYPPAG------VRLFSK  93

Query  320  nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWV  499
             ++    +  E+    T  E  +RT        DN         +A  + +   LP GWV
Sbjct  94   EDVLLYINKSEITGFDTNGECDTRTK-------DN--------ILANVEFNPHSLPEGWV  138

Query  500  KELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            KE+  R   +G IRKDPY+ DPV+ Y FR+++  M Y++TG + K
Sbjct  139  KEVVFRKTKTGVIRKDPYFTDPVNNYSFRTRKSAMLYVQTGKVPK  183



>ref|XP_010482573.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Camelina sativa]
Length=804

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +2

Query  452  VAAQDISADGLPAGWVKELR-TRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            V  +  +A GLP GW+K+L  T      IR+DP++IDP SGY F+S +D  RY+ETGDI
Sbjct  25   VIVEKSAAKGLPEGWIKKLEITNRSSRKIRRDPFFIDPKSGYIFQSFKDASRYVETGDI  83



>ref|XP_010482572.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Camelina sativa]
Length=808

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +2

Query  452  VAAQDISADGLPAGWVKELR-TRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            V  +  +A GLP GW+K+L  T      IR+DP++IDP SGY F+S +D  RY+ETGDI
Sbjct  25   VIVEKSAAKGLPEGWIKKLEITNRSSRKIRRDPFFIDPKSGYIFQSFKDASRYVETGDI  83



>ref|XP_002448522.1| hypothetical protein SORBIDRAFT_06g028360 [Sorghum bicolor]
 gb|EES12850.1| hypothetical protein SORBIDRAFT_06g028360 [Sorghum bicolor]
Length=431

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 2/56 (4%)
 Frame = +2

Query  470  SADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            + +GLP GW+KE R R    G  ++ D +YIDP++GY+F S +DV RYLE+GDI +
Sbjct  32   AGEGLPDGWLKEYRPRKNLYGSRVKGDTFYIDPINGYKFHSLKDVHRYLESGDINQ  87



>ref|NP_001105290.1| LOC542207 [Zea mays]
 gb|AAW56446.1| methyl-binding domain protein MBD113 [Zea mays]
 gb|AFW57949.1| methyl-binding domain MBD113 protein [Zea mays]
Length=292

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +2

Query  452  VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            +A  + + DGLP GWVKE  +R    GIRKD YY DPVS   FR+ + V+ YL TG+I +
Sbjct  20   LAHVEFNPDGLPDGWVKETISRKFNDGIRKDQYYTDPVSHRVFRTLKSVLSYLGTGEISR  79



>gb|KFK26832.1| hypothetical protein AALP_AA8G299600 [Arabis alpina]
Length=702

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 3/60 (5%)
 Frame = +2

Query  452  VAAQDISADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            V  +  +A+GLP GW+K+L   T  +G  IR+DP++IDP SGY F+S RD  RY+ETG I
Sbjct  24   VIVEQSAAEGLPEGWIKKLEL-TIRTGRKIRRDPFFIDPKSGYIFQSFRDASRYVETGRI  82



>ref|XP_010521336.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010521337.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010521338.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Tarenaya hassleriana]
Length=713

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +2

Query  470  SADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            +A+GLP GW+KEL  R     +RKDP +IDP SGY F S +D  RY+ TG I
Sbjct  35   AAEGLPEGWIKELMIRRKARKLRKDPLFIDPKSGYIFLSFKDASRYVRTGVI  86



>ref|XP_010444604.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Camelina sativa]
Length=697

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 3/60 (5%)
 Frame = +2

Query  452  VAAQDISADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            V  +  +A GLP GW+K+L   T  SG  IR+DP++IDP SGY F+S +D  RY++TGDI
Sbjct  25   VIVEKSAAKGLPEGWIKKLEI-TNRSGRKIRRDPFFIDPKSGYIFQSFKDASRYVKTGDI  83



>ref|XP_010444597.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Camelina sativa]
Length=701

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 3/60 (5%)
 Frame = +2

Query  452  VAAQDISADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            V  +  +A GLP GW+K+L   T  SG  IR+DP++IDP SGY F+S +D  RY++TGDI
Sbjct  25   VIVEKSAAKGLPEGWIKKLEI-TNRSGRKIRRDPFFIDPKSGYIFQSFKDASRYVKTGDI  83



>ref|XP_010107428.1| Methyl-CpG-binding domain-containing protein 13 [Morus notabilis]
 gb|EXC15966.1| Methyl-CpG-binding domain-containing protein 13 [Morus notabilis]
Length=574

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +2

Query  452  VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            V  +   A+GLP GW+KE+R R     IRKDP+Y DPVS   FRS + V R+L+T ++
Sbjct  29   VVVEKGEAEGLPPGWIKEIRVRKRGDSIRKDPFYFDPVSKNVFRSLKAVNRHLKTEEL  86



>gb|AGT16604.1| hypothetical protein SHCRBa_016_K03_R_160 [Saccharum hybrid cultivar 
R570]
Length=431

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = +2

Query  470  SADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            + +GLP GW+KE R R    G  ++ D +YIDPV+GY+F S +DV  YLE+GDI +
Sbjct  32   AGEGLPDGWLKEYRPRKNQYGSRVKGDTFYIDPVNGYKFHSLKDVHFYLESGDISQ  87



>ref|XP_002299872.1| methyl-CpG-binding domain-containing family protein [Populus 
trichocarpa]
 gb|ABK93437.1| unknown [Populus trichocarpa]
 gb|EEE84677.1| methyl-CpG-binding domain-containing family protein [Populus 
trichocarpa]
Length=214

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 3/52 (6%)
 Frame = +2

Query  482  LPAGWVKELRTRT--CPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            LP GWV E R RT    +G R D YYI+PVSG  FRSK+DV  YLETG +KK
Sbjct  74   LPPGWVVEDRVRTSGATAGTR-DKYYIEPVSGRRFRSKKDVQYYLETGTLKK  124


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = +2

Query  119  SNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  283
            S T   + WLPPGW VE + R++G+  G+  K YI P SGR+F SK  V  +L + 
Sbjct  65   SETAVDTSWLPPGWVVEDRVRTSGATAGTRDKYYIEPVSGRRFRSKKDVQYYLETG  120



>ref|XP_006369523.1| hypothetical protein POPTR_0001s24690g [Populus trichocarpa]
 gb|ERP66092.1| hypothetical protein POPTR_0001s24690g [Populus trichocarpa]
Length=162

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 3/52 (6%)
 Frame = +2

Query  482  LPAGWVKELRTRT--CPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            LP GWV E R RT    +G R D YYI+PVSG  FRSK+DV  YLETG +KK
Sbjct  74   LPPGWVVEDRVRTSGATAGTR-DKYYIEPVSGRRFRSKKDVQYYLETGTLKK  124


 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = +2

Query  119  SNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  283
            S T   + WLPPGW VE + R++G+  G+  K YI P SGR+F SK  V  +L + 
Sbjct  65   SETAVDTSWLPPGWVVEDRVRTSGATAGTRDKYYIEPVSGRRFRSKKDVQYYLETG  120



>ref|XP_006279588.1| hypothetical protein CARUB_v10026033mg [Capsella rubella]
 gb|EOA12486.1| hypothetical protein CARUB_v10026033mg [Capsella rubella]
Length=659

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 40/60 (67%), Gaps = 3/60 (5%)
 Frame = +2

Query  452  VAAQDISADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            V  +  +A GLP GW+K+L      SG  +R+DP++IDP SGY F S +D  RY+ETGDI
Sbjct  24   VIVEKSAAKGLPEGWIKKLEISN-RSGRKLRRDPFFIDPKSGYIFHSFKDASRYVETGDI  82



>ref|XP_006369524.1| hypothetical protein POPTR_0001s24690g [Populus trichocarpa]
 gb|ERP66093.1| hypothetical protein POPTR_0001s24690g [Populus trichocarpa]
Length=167

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 3/52 (6%)
 Frame = +2

Query  482  LPAGWVKELRTRT--CPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            LP GWV E R RT    +G R D YYI+PVSG  FRSK+DV  YLETG +KK
Sbjct  74   LPPGWVVEDRVRTSGATAGTR-DKYYIEPVSGRRFRSKKDVQYYLETGTLKK  124


 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = +2

Query  119  SNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  283
            S T   + WLPPGW VE + R++G+  G+  K YI P SGR+F SK  V  +L + 
Sbjct  65   SETAVDTSWLPPGWVVEDRVRTSGATAGTRDKYYIEPVSGRRFRSKKDVQYYLETG  120



>ref|XP_006279589.1| hypothetical protein CARUB_v10026033mg [Capsella rubella]
 gb|EOA12487.1| hypothetical protein CARUB_v10026033mg [Capsella rubella]
Length=667

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 3/60 (5%)
 Frame = +2

Query  452  VAAQDISADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            V  +  +A GLP GW+K+L   +  SG  +R+DP++IDP SGY F S +D  RY+ETGDI
Sbjct  24   VIVEKSAAKGLPEGWIKKLEI-SNRSGRKLRRDPFFIDPKSGYIFHSFKDASRYVETGDI  82



>ref|XP_011042705.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Populus euphratica]
Length=214

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = +2

Query  467  ISADGLPAGWVKELRTRTC-PSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            I    LP GWV E R RT   +    D YYIDP SG +FRSK+DV  YLETG IKK
Sbjct  69   IETSWLPPGWVVEDRIRTSGATAGTVDKYYIDPASGRKFRSKKDVQYYLETGTIKK  124


 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +2

Query  116  ASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  283
            +S T   + WLPPGW VE + R++G+  G+  K YI P SGRKF SK  V  +L + 
Sbjct  64   SSETTIETSWLPPGWVVEDRIRTSGATAGTVDKYYIDPASGRKFRSKKDVQYYLETG  120



>ref|XP_008674081.1| PREDICTED: uncharacterized protein LOC103650258 [Zea mays]
Length=182

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = +2

Query  464  DISADGLPAGWVKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            D    GLP GWVKEL  R    G I++DPYY DP S Y FR+ +  + +LETG +
Sbjct  63   DFRPSGLPEGWVKELVYRKTKEGLIKRDPYYTDPASFYTFRTLKSALSFLETGKV  117



>ref|XP_002314180.1| methyl-CpG-binding domain-containing family protein [Populus 
trichocarpa]
 gb|EEE88135.1| methyl-CpG-binding domain-containing family protein [Populus 
trichocarpa]
Length=214

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = +2

Query  467  ISADGLPAGWVKELRTRTC-PSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            I    LP GWV E R RT   +    D YYIDP SG +FRSK+DV  YLETG +KK
Sbjct  69   IETSWLPPGWVVEDRIRTSGATAGTVDKYYIDPASGRKFRSKKDVQYYLETGTLKK  124


 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +2

Query  116  ASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  283
            +S T   + WLPPGW VE + R++G+  G+  K YI P SGRKF SK  V  +L + 
Sbjct  64   SSETTIETSWLPPGWVVEDRIRTSGATAGTVDKYYIDPASGRKFRSKKDVQYYLETG  120



>ref|XP_002466891.1| hypothetical protein SORBIDRAFT_01g015940 [Sorghum bicolor]
 gb|EER93889.1| hypothetical protein SORBIDRAFT_01g015940 [Sorghum bicolor]
Length=219

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +2

Query  452  VAAQDISADGLPAGWVKELRTRTCPSGI-RKDPYYIDPVSGYEFRSKRDVMRYLETG  619
            +A  DI   GLP GWV E+  R    G+ R+DPYY DP S Y FR+ +  + +LETG
Sbjct  107  LAKVDIRPSGLPEGWVNEIVYRKTKEGLTRRDPYYTDPASSYTFRTLKSALSFLETG  163



>emb|CBI34714.3| unnamed protein product [Vitis vinifera]
Length=936

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  530  GIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            GIR+DPYY DPVSGY FRS++DV RYL+TG+I +
Sbjct  5    GIRRDPYYTDPVSGYVFRSRKDVFRYLKTGEISR  38



>gb|KHN35006.1| hypothetical protein glysoja_004772 [Glycine soja]
Length=188

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 72/169 (43%), Gaps = 39/169 (23%)
 Frame = +2

Query  125  TNQSSDWLPPGWTVELKTRSTGSHNG----------------------------STYKCY  220
            +N+  +WLP  W V+ +TR +G++ G                                CY
Sbjct  28   SNEHPEWLPDDWNVDFRTRKSGANMGHGQSKGPLAKCSILRLFMAGTSQGHPQICIEYCY  87

Query  221  ISPSGRKFYSKAQVSQFLNSA-ANSNTPIsnenknnieesssnleVPQNQTPKENQSRTS  397
            I+PSG KFYSK +V ++L++   NSN+  S + K      +      ++  P   Q +  
Sbjct  88   IAPSGHKFYSKPEVLRYLDTVNINSNSHTSKKEKICKSNDTVEKSTIEDLPP--GQIKEV  145

Query  398  RKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKD  544
            + RK   DN+     SP         + LP GW+ E + R   +G RKD
Sbjct  146  KIRKGSNDNRDVVEKSP--------VEDLPPGWITEAKVRKGDTGNRKD  186



>gb|KDP34493.1| hypothetical protein JCGZ_11043 [Jatropha curcas]
Length=237

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 43/70 (61%), Gaps = 4/70 (6%)
 Frame = +2

Query  425  QTPKTVSPAVAAQDISADGLPAGWVKELRTRTC-PSGIRKDPYYIDPVSGYEFRSKRDVM  601
            + P T++P  A    SA  LP GW+ E R RT   +    D YYI+P +G +FRSKR+V 
Sbjct  87   KVPVTMAPGSAE---SASWLPPGWLVEDRVRTSGATAGTVDKYYIEPTTGRKFRSKREVQ  143

Query  602  RYLETGDIKK  631
             YLETG +KK
Sbjct  144  YYLETGTLKK  153


 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +2

Query  113  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  283
            +A  + +S+ WLPPGW VE + R++G+  G+  K YI P +GRKF SK +V  +L + 
Sbjct  92   MAPGSAESASWLPPGWLVEDRVRTSGATAGTVDKYYIEPTTGRKFRSKREVQYYLETG  149



>ref|XP_003580540.1| PREDICTED: uncharacterized protein LOC100838054 [Brachypodium 
distachyon]
 ref|XP_010240414.1| PREDICTED: uncharacterized protein LOC100838054 [Brachypodium 
distachyon]
 ref|XP_010240415.1| PREDICTED: uncharacterized protein LOC100838054 [Brachypodium 
distachyon]
 ref|XP_010240416.1| PREDICTED: uncharacterized protein LOC100838054 [Brachypodium 
distachyon]
 ref|XP_010240417.1| PREDICTED: uncharacterized protein LOC100838054 [Brachypodium 
distachyon]
Length=400

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 40/71 (56%), Gaps = 5/71 (7%)
 Frame = +2

Query  428  TPKTVSPAVAAQ---DISADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKR  592
            TP    P V      + + +GLP GW K  R R    G  IR D +YIDP + YEFRS +
Sbjct  11   TPNGAKPTVMVDSKIEPAGEGLPDGWSKGCRPRKSRPGSRIRGDKFYIDPTNSYEFRSLK  70

Query  593  DVMRYLETGDI  625
            DV RY+E+ DI
Sbjct  71   DVYRYIESQDI  81



>ref|XP_010685830.1| PREDICTED: methyl-CpG-binding domain-containing protein 7 [Beta 
vulgaris subsp. vulgaris]
Length=308

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 71/172 (41%), Gaps = 40/172 (23%)
 Frame = +2

Query  146  LPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnenkn  322
            LP  W VE++ R   S    + K Y  P SGR+F S   V ++L+   +   P       
Sbjct  52   LPEDWVVEVRPRGPNSSLKISDKYYYEPGSGRQFRSLISVKRYLSGEEHIEIP-------  104

Query  323  nieesssnleVPQNQ-TPKENQSRTSR---------------KRKSVMDNQTPKTVSPAV  454
                     + P N   P +N     R                R+  +D+  P+T+ P  
Sbjct  105  --------RKKPSNSLVPYQNSGSFRRIAYGGKILRPDELEEARQGDLDDIYPETIQPK-  155

Query  455  AAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYL  610
                 SA  LP GW+ E   R C  G R D YYI+P +G  FRS  +V RYL
Sbjct  156  -----SASILPDGWIVEEIPRRC--GFRSDRYYIEPGTGQRFRSVPEVQRYL  200



>ref|XP_003632148.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Vitis vinifera]
Length=297

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 50/86 (58%), Gaps = 10/86 (12%)
 Frame = +2

Query  377  ENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTC-PSGIRKDPYY  553
            E+Q R  RKR S        T S A   ++   D LP GW+ E R R+   S   +D Y+
Sbjct  146  ESQPRRGRKRASEA------TASMASVERE---DWLPPGWIVEGRVRSSGASAGSRDKYF  196

Query  554  IDPVSGYEFRSKRDVMRYLETGDIKK  631
            I+P++G  FRSK++V  YLETG+++K
Sbjct  197  IEPITGRRFRSKKEVRYYLETGEVRK  222


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = +2

Query  131  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  283
            +  DWLPPGW VE + RS+G+  GS  K +I P +GR+F SK +V  +L + 
Sbjct  167  EREDWLPPGWIVEGRVRSSGASAGSRDKYFIEPITGRRFRSKKEVRYYLETG  218



>ref|XP_011015295.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like, 
partial [Populus euphratica]
Length=182

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 35/52 (67%), Gaps = 3/52 (6%)
 Frame = +2

Query  482  LPAGWVKELRTRT--CPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            LP GW+ E R R+    +G R D YY +PVSG  FRSK+DV  YLETG +KK
Sbjct  62   LPPGWIVEDRVRSSGATAGTR-DKYYFEPVSGRRFRSKKDVQYYLETGTLKK  112


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 33/56 (59%), Gaps = 1/56 (2%)
 Frame = +2

Query  119  SNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  283
            S T   + WLPPGW VE + RS+G+  G+  K Y  P SGR+F SK  V  +L + 
Sbjct  53   SETAVDTSWLPPGWIVEDRVRSSGATAGTRDKYYFEPVSGRRFRSKKDVQYYLETG  108



>ref|XP_006401848.1| hypothetical protein EUTSA_v10012954mg [Eutrema salsugineum]
 gb|ESQ43301.1| hypothetical protein EUTSA_v10012954mg [Eutrema salsugineum]
Length=633

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = +2

Query  452  VAAQDISADGLPAGWVKELRTRTCPS-GIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            V  +  +A+GLP GW+K+L     P    R+DP++IDP S Y F+S +D  RY ETGD+
Sbjct  29   VIVEKSTAEGLPEGWIKKLVISNRPGRKSRRDPFFIDPKSEYIFQSFKDASRYAETGDL  87



>emb|CDY31911.1| BnaC09g28330D [Brassica napus]
Length=617

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  452  VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            V  +  +A+GLP GW+K+L         R+DP++IDP S Y F S R   RY+ETGDI
Sbjct  27   VIVEKSAAEGLPEGWIKKLVISNRSGRKRRDPFFIDPQSEYIFPSFRAASRYVETGDI  84



>ref|XP_009106826.1| PREDICTED: LOW QUALITY PROTEIN: methyl-CpG-binding domain-containing 
protein 13 [Brassica rapa]
Length=628

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  452  VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            V  +  +A+GLP GW+K+L         R+DP++IDP S Y F S R   RY+ETGDI
Sbjct  27   VIVEKSAAEGLPEGWIKKLVISNRSGRKRRDPFFIDPQSEYIFPSFRAASRYVETGDI  84



>emb|CBI16127.3| unnamed protein product [Vitis vinifera]
Length=135

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = +2

Query  476  DGLPAGWVKELRTRTC-PSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            D LP GW+ E R R+   S   +D Y+I+P++G  FRSK++V  YLETG+++K
Sbjct  8    DWLPPGWIVEGRVRSSGASAGSRDKYFIEPITGRRFRSKKEVRYYLETGEVRK  60


 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = +2

Query  131  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTP  301
            +  DWLPPGW VE + RS+G+  GS  K +I P +GR+F SK +V  +L +      P
Sbjct  5    EREDWLPPGWIVEGRVRSSGASAGSRDKYFIEPITGRRFRSKKEVRYYLETGEVRKKP  62



>gb|ABO69709.1| MBD3 [Triticum aestivum]
Length=180

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 34/53 (64%), Gaps = 2/53 (4%)
 Frame = +2

Query  470  SADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYLETGD  622
            + +GLP GW+KE R R    G   R+D +YIDP + YEFRS ++   YLE+ D
Sbjct  9    AGEGLPDGWLKEYRPRKPRPGSRFRRDKFYIDPTNSYEFRSLKEAHHYLESQD  61



>gb|AAM97069.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15545.1| unknown protein [Arabidopsis thaliana]
Length=746

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 40/60 (67%), Gaps = 3/60 (5%)
 Frame = +2

Query  452  VAAQDISADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            V  +  +A GLP GW+K+L   T  SG   R+DP++IDP S Y F+S +D  RY+ETG+I
Sbjct  29   VIVEKSAAQGLPEGWIKKLEI-TNRSGRKTRRDPFFIDPKSEYIFQSFKDASRYVETGNI  87



>ref|NP_200036.1| methyl-CPG-binding domain protein 13 [Arabidopsis thaliana]
 ref|NP_001190520.1| methyl-CPG-binding domain protein 13 [Arabidopsis thaliana]
 sp|Q9LTJ8.1|MBD13_ARATH RecName: Full=Methyl-CpG-binding domain-containing protein 13; 
Short=AtMBD13; Short=MBD13; AltName: Full=Methyl-CpG-binding 
protein MBD13 [Arabidopsis thaliana]
 dbj|BAA97466.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96188.1| methyl-CPG-binding domain protein 13 [Arabidopsis thaliana]
 gb|AED96189.1| methyl-CPG-binding domain protein 13 [Arabidopsis thaliana]
Length=746

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 40/60 (67%), Gaps = 3/60 (5%)
 Frame = +2

Query  452  VAAQDISADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            V  +  +A GLP GW+K+L   T  SG   R+DP++IDP S Y F+S +D  RY+ETG+I
Sbjct  29   VIVEKSAAQGLPEGWIKKLEI-TNRSGRKTRRDPFFIDPKSEYIFQSFKDASRYVETGNI  87



>ref|XP_004294545.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Fragaria vesca subsp. vesca]
Length=209

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +2

Query  467  ISADGLPAGWVKELRTRTC-PSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            +S D LPAGW  E + R+   +    D YY DPVSG  FRSK++V+ +LETG  KK
Sbjct  70   MSMDWLPAGWRVEYKVRSSGATAGSTDRYYHDPVSGRRFRSKKEVLHFLETGTPKK  125


 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 33/52 (63%), Gaps = 1/52 (2%)
 Frame = +2

Query  131  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  283
             S DWLP GW VE K RS+G+  GST + Y  P SGR+F SK +V  FL + 
Sbjct  70   MSMDWLPAGWRVEYKVRSSGATAGSTDRYYHDPVSGRRFRSKKEVLHFLETG  121



>ref|XP_002865903.1| hypothetical protein ARALYDRAFT_495292 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42162.1| hypothetical protein ARALYDRAFT_495292 [Arabidopsis lyrata subsp. 
lyrata]
Length=680

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 40/60 (67%), Gaps = 3/60 (5%)
 Frame = +2

Query  452  VAAQDISADGLPAGWVKELRTRTCPSGI--RKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            V  +  +A GLP GW+K+L   T  SG   R+DP++IDP S Y F+S +D  RY+ETG++
Sbjct  31   VIVEKSAAQGLPEGWIKKLEI-TSRSGRKNRRDPFFIDPKSEYIFQSFKDASRYVETGNV  89



>ref|XP_002532846.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF29524.1| DNA binding protein, putative [Ricinus communis]
Length=234

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 44/70 (63%), Gaps = 3/70 (4%)
 Frame = +2

Query  425  QTPKTVSPAVAAQDISADGLPAGWVKELRTRTC-PSGIRKDPYYIDPVSGYEFRSKRDVM  601
            + P T++PA +A   SA+ LP GW+ E R R    +    D YYI+PV+G  FRSK++V 
Sbjct  83   KVPVTMAPAPSAD--SANWLPPGWLVEDRVRASGATAGTVDKYYIEPVTGRRFRSKKEVQ  140

Query  602  RYLETGDIKK  631
             +LETG  KK
Sbjct  141  YFLETGTKKK  150


 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +2

Query  134  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNT  298
            S++WLPPGW VE + R++G+  G+  K YI P +GR+F SK +V  FL +     T
Sbjct  96   SANWLPPGWLVEDRVRASGATAGTVDKYYIEPVTGRRFRSKKEVQYFLETGTKKKT  151



>gb|KGN57363.1| hypothetical protein Csa_3G181990 [Cucumis sativus]
Length=561

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +2

Query  452  VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            V  +   A  LP GW+ E+R     + IR+D  YIDPV+G   RS RDV RYL +G + +
Sbjct  36   VEVKKTIAKDLPTGWIGEIRETKTANRIRRDSSYIDPVNGNALRSIRDVHRYLTSGKVSR  95



>emb|CDY00521.1| BnaA10g07520D [Brassica napus]
Length=595

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  452  VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI  625
            V  +  +A+GLP GW+K+L         R+DP++IDP S Y F S R   RY+ETG+I
Sbjct  27   VIVEKSAAEGLPEGWIKKLVISNRSGRKRRDPFFIDPQSEYIFPSFRAASRYVETGNI  84



>ref|XP_006846186.1| hypothetical protein AMTR_s00012p00212320 [Amborella trichopoda]
 gb|ERN07861.1| hypothetical protein AMTR_s00012p00212320 [Amborella trichopoda]
Length=425

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 9/63 (14%)
 Frame = +2

Query  458  AQDISA----DGLPAGWVKELRTRTCPSGIR---KDPYYIDPVSGYEFRSKRDVMRYLET  616
            A D+SA    D LPAGW+ E++ R   +G+    KD Y+ DPVS  +FRSK++V  +LET
Sbjct  116  ANDLSAVSSPDWLPAGWITEIKVRA--NGLTAGTKDKYFYDPVSKRKFRSKKEVFSFLET  173

Query  617  GDI  625
            G +
Sbjct  174  GKL  176



>ref|XP_003549104.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
[Glycine max]
Length=546

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 58/135 (43%), Gaps = 49/135 (36%)
 Frame = +2

Query  143  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnenk  319
            WLPPGWTVE++ R     NG   K Y  P SG KF SK +V ++L++A            
Sbjct  9    WLPPGWTVEVRVR----KNGKRDKYYFPPSSGLKFNSKVEVFRYLDNA------------  52

Query  320  nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWV  499
                                 Q++ S ++           +SP V  +   A+GLP GWV
Sbjct  53   ---------------------QNKVSIQK-----------ISPNVIVEKAIAEGLPPGWV  80

Query  500  KELRTRTCPSGIRKD  544
            K+ R  T    +R+D
Sbjct  81   KKTRITTNGDSVRRD  95



>ref|XP_009353664.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Pyrus x bretschneideri]
Length=231

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 34/51 (67%), Gaps = 1/51 (2%)
 Frame = +2

Query  482  LPAGWVKELRTRTC-PSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK  631
            LP GW  + + R+   +    D YYIDPVSG  FRSK +V+R+LETG IKK
Sbjct  98   LPQGWSVQEKVRSSGATAGSTDRYYIDPVSGRRFRSKIEVLRFLETGTIKK  148


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = +2

Query  125  TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  283
            T+    WLP GW+V+ K RS+G+  GST + YI P SGR+F SK +V +FL + 
Sbjct  91   TDSMESWLPQGWSVQEKVRSSGATAGSTDRYYIDPVSGRRFRSKIEVLRFLETG  144



>dbj|BAJ99501.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=380

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 34/53 (64%), Gaps = 2/53 (4%)
 Frame = +2

Query  470  SADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYLETGD  622
            + + LP GW+ E R R    G  +R+D +YIDP + YEFRS R+V  YLE+ D
Sbjct  9    AGEELPDGWLVEYRPRKTRPGSRVRRDKFYIDPTNSYEFRSLREVHHYLESQD  61



>ref|XP_010264450.1| PREDICTED: uncharacterized protein LOC104602459 isoform X1 [Nelumbo 
nucifera]
Length=304

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 40/57 (70%), Gaps = 4/57 (7%)
 Frame = +2

Query  455  AAQDISADGLPAGWVKELRTRT--CPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETG  619
            A+QD+  D LP GW  E R R+    +G+R D Y+ DPVSG +FRSKR+V+ +LETG
Sbjct  153  ASQDLP-DWLPPGWRMESRVRSSGVTAGMR-DRYFYDPVSGRQFRSKREVLCFLETG  207



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906702465875