BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS010E07

Length=613
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009783972.1|  PREDICTED: uncharacterized protein LOC104232454    293   3e-89   Nicotiana sylvestris
ref|XP_009616023.1|  PREDICTED: uncharacterized protein LOC104108647    293   4e-89   Nicotiana tomentosiformis
ref|XP_004230310.1|  PREDICTED: uncharacterized protein LOC101249681    291   2e-88   
ref|XP_006344767.1|  PREDICTED: uncharacterized protein LOC102580046    291   2e-88   Solanum tuberosum [potatoes]
ref|XP_009373286.1|  PREDICTED: uncharacterized protein LOC103962316    281   1e-84   Pyrus x bretschneideri [bai li]
gb|KHG26707.1|  Efr3b                                                   281   2e-84   Gossypium arboreum [tree cotton]
gb|KHG26706.1|  Protein EFR3 B                                          281   2e-84   Gossypium arboreum [tree cotton]
ref|XP_008370375.1|  PREDICTED: uncharacterized protein LOC103433867    279   5e-84   Malus domestica [apple tree]
ref|XP_007031155.1|  Uncharacterized protein isoform 1                  278   2e-83   
emb|CDP18254.1|  unnamed protein product                                278   2e-83   Coffea canephora [robusta coffee]
gb|EYU40497.1|  hypothetical protein MIMGU_mgv1a000785mg                276   5e-83   Erythranthe guttata [common monkey flower]
ref|XP_008359849.1|  PREDICTED: uncharacterized protein LOC103423542    276   9e-83   
gb|KJB81105.1|  hypothetical protein B456_013G129500                    274   1e-82   Gossypium raimondii
ref|XP_007208429.1|  hypothetical protein PRUPE_ppa000798mg             275   1e-82   Prunus persica
gb|KJB81106.1|  hypothetical protein B456_013G129500                    274   1e-82   Gossypium raimondii
ref|XP_007031156.1|  Uncharacterized protein isoform 2                  275   1e-82   
ref|XP_002318950.2|  hypothetical protein POPTR_0013s00990g             275   1e-82   
ref|XP_008246002.1|  PREDICTED: uncharacterized protein LOC103344152    275   1e-82   Prunus mume [ume]
gb|KJB45453.1|  hypothetical protein B456_007G306600                    275   2e-82   Gossypium raimondii
gb|KHG02153.1|  Protein EFR3                                            275   3e-82   Gossypium arboreum [tree cotton]
gb|KJB81104.1|  hypothetical protein B456_013G129500                    274   4e-82   Gossypium raimondii
ref|XP_011023781.1|  PREDICTED: uncharacterized protein LOC105125162    273   6e-82   Populus euphratica
ref|XP_011092150.1|  PREDICTED: uncharacterized protein LOC105172430    271   3e-81   Sesamum indicum [beniseed]
ref|XP_004302237.1|  PREDICTED: uncharacterized protein LOC101313...    271   4e-81   Fragaria vesca subsp. vesca
ref|XP_011466140.1|  PREDICTED: uncharacterized protein LOC101313...    271   5e-81   Fragaria vesca subsp. vesca
gb|KDP23388.1|  hypothetical protein JCGZ_23221                         269   2e-80   Jatropha curcas
emb|CAN82509.1|  hypothetical protein VITISV_012725                     272   3e-80   Vitis vinifera
ref|XP_002512512.1|  conserved hypothetical protein                     268   6e-80   
ref|XP_010546763.1|  PREDICTED: uncharacterized protein LOC104818746    266   2e-79   Tarenaya hassleriana [spider flower]
ref|XP_006394914.1|  hypothetical protein EUTSA_v10003593mg             265   5e-79   Eutrema salsugineum [saltwater cress]
ref|XP_006394915.1|  hypothetical protein EUTSA_v10003593mg             265   5e-79   Eutrema salsugineum [saltwater cress]
ref|XP_010024133.1|  PREDICTED: uncharacterized protein LOC104414673    265   8e-79   Eucalyptus grandis [rose gum]
gb|AAB61061.1|  Hypothetical protein F2P16.24                           264   9e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006433539.1|  hypothetical protein CICLE_v10000144mg             265   9e-79   Citrus clementina [clementine]
dbj|BAC41892.1|  unknown protein                                        264   2e-78   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198037.3|  uncharacterized protein                               264   2e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002282109.1|  PREDICTED: uncharacterized protein LOC100264846    264   2e-78   Vitis vinifera
ref|XP_002872241.1|  hypothetical protein ARALYDRAFT_489516             263   2e-78   
ref|XP_006472204.1|  PREDICTED: uncharacterized protein LOC102623618    262   8e-78   Citrus sinensis [apfelsine]
ref|XP_010493942.1|  PREDICTED: protein EFR3 homolog B-like isofo...    261   2e-77   Camelina sativa [gold-of-pleasure]
ref|XP_010455044.1|  PREDICTED: uncharacterized protein LOC104736707    261   3e-77   Camelina sativa [gold-of-pleasure]
ref|XP_010421542.1|  PREDICTED: uncharacterized protein LOC104706...    260   3e-77   Camelina sativa [gold-of-pleasure]
gb|KEH43106.1|  cyclin-like protein                                     260   5e-77   Medicago truncatula
ref|XP_004495652.1|  PREDICTED: uncharacterized protein LOC101508...    257   6e-76   
ref|XP_009111721.1|  PREDICTED: protein EFR3 homolog B-like             256   1e-75   Brassica rapa
ref|XP_010493940.1|  PREDICTED: protein EFR3 homolog B-like isofo...    256   2e-75   Camelina sativa [gold-of-pleasure]
emb|CDX87029.1|  BnaC09g03440D                                          256   2e-75   
ref|XP_010267985.1|  PREDICTED: uncharacterized protein LOC104605...    254   6e-75   Nelumbo nucifera [Indian lotus]
ref|XP_010267987.1|  PREDICTED: uncharacterized protein LOC104605...    254   7e-75   Nelumbo nucifera [Indian lotus]
emb|CDY19753.1|  BnaA09g04060D                                          253   1e-74   Brassica napus [oilseed rape]
gb|KHN23227.1|  Protein EFR3 like cmp44E                                252   1e-74   Glycine soja [wild soybean]
ref|XP_003555181.1|  PREDICTED: uncharacterized protein LOC100788290    253   2e-74   
ref|XP_006589118.1|  PREDICTED: uncharacterized protein LOC100785...    251   5e-74   
ref|XP_003536043.1|  PREDICTED: uncharacterized protein LOC100785...    251   5e-74   Glycine max [soybeans]
ref|XP_008778937.1|  PREDICTED: protein EFR3 homolog cmp44E-like        236   5e-73   
ref|XP_010092978.1|  hypothetical protein L484_018915                   247   2e-72   
ref|XP_007145003.1|  hypothetical protein PHAVU_007G201500g             244   2e-71   Phaseolus vulgaris [French bean]
ref|XP_009384437.1|  PREDICTED: uncharacterized protein LOC103971...    244   2e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009384434.1|  PREDICTED: uncharacterized protein LOC103971...    244   2e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008808672.1|  PREDICTED: uncharacterized protein LOC103720...    243   6e-71   Phoenix dactylifera
gb|ABF95548.1|  cyclin, putative, expressed                             240   7e-71   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008808671.1|  PREDICTED: uncharacterized protein LOC103720...    242   1e-70   Phoenix dactylifera
ref|XP_010674649.1|  PREDICTED: protein EFR3 homolog A                  242   1e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008781115.1|  PREDICTED: uncharacterized protein LOC103700...    241   1e-70   Phoenix dactylifera
ref|XP_008453377.1|  PREDICTED: uncharacterized protein LOC103494111    241   2e-70   Cucumis melo [Oriental melon]
ref|XP_010938250.1|  PREDICTED: uncharacterized protein LOC105057...    241   2e-70   
ref|XP_010938251.1|  PREDICTED: uncharacterized protein LOC105057...    241   2e-70   Elaeis guineensis
ref|XP_006649970.1|  PREDICTED: uncharacterized protein LOC102701065    241   3e-70   Oryza brachyantha
ref|XP_010921489.1|  PREDICTED: uncharacterized protein LOC105045026    240   4e-70   Elaeis guineensis
ref|NP_001049903.1|  Os03g0308200                                       239   1e-69   
ref|XP_004165925.1|  PREDICTED: uncharacterized LOC101202927            239   2e-69   
ref|XP_004144747.1|  PREDICTED: uncharacterized protein LOC101202927    239   2e-69   Cucumis sativus [cucumbers]
ref|XP_008781114.1|  PREDICTED: protein EFR3 homolog cmp44E-like ...    238   3e-69   
ref|XP_006840435.1|  hypothetical protein AMTR_s00045p00164850          238   4e-69   Amborella trichopoda
ref|XP_004984608.1|  PREDICTED: uncharacterized protein LOC101782956    236   2e-68   Setaria italica
ref|XP_002465372.1|  hypothetical protein SORBIDRAFT_01g037420          235   4e-68   Sorghum bicolor [broomcorn]
ref|XP_003558072.1|  PREDICTED: uncharacterized protein LOC100831...    234   9e-68   Brachypodium distachyon [annual false brome]
ref|XP_010228707.1|  PREDICTED: uncharacterized protein LOC100831...    234   9e-68   Brachypodium distachyon [annual false brome]
ref|XP_008646153.1|  PREDICTED: uncharacterized protein LOC100384...    233   2e-67   
ref|XP_010094723.1|  hypothetical protein L484_003597                   226   5e-67   
ref|XP_008646145.1|  PREDICTED: uncharacterized protein LOC100384...    228   7e-66   Zea mays [maize]
emb|CDX80597.1|  BnaC07g28470D                                          228   1e-65   
emb|CDX88246.1|  BnaA06g28370D                                          228   1e-65   
ref|XP_009151505.1|  PREDICTED: uncharacterized protein LOC103874824    225   4e-65   
ref|XP_009765963.1|  PREDICTED: protein EFR3 homolog cmp44E-like        204   4e-62   Nicotiana sylvestris
ref|XP_009405043.1|  PREDICTED: uncharacterized protein LOC103988214    208   2e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004250744.1|  PREDICTED: uncharacterized protein LOC101250...    207   2e-58   Solanum lycopersicum
ref|XP_010313082.1|  PREDICTED: uncharacterized protein LOC101250...    207   2e-58   Solanum lycopersicum
ref|XP_006352099.1|  PREDICTED: uncharacterized protein LOC102584...    207   2e-58   Solanum tuberosum [potatoes]
ref|XP_006352098.1|  PREDICTED: uncharacterized protein LOC102584...    207   2e-58   Solanum tuberosum [potatoes]
ref|XP_009625867.1|  PREDICTED: protein EFR3 homolog isoform X2         206   8e-58   Nicotiana tomentosiformis
ref|XP_009625862.1|  PREDICTED: protein EFR3 homolog isoform X1         206   1e-57   
ref|XP_008798151.1|  PREDICTED: uncharacterized protein LOC103713119    206   2e-57   Phoenix dactylifera
ref|XP_010932401.1|  PREDICTED: uncharacterized protein LOC105053...    204   2e-57   
gb|KDO53678.1|  hypothetical protein CISIN_1g0359231mg                  191   2e-57   Citrus sinensis [apfelsine]
ref|XP_009393518.1|  PREDICTED: uncharacterized protein LOC103979184    205   3e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006838291.1|  hypothetical protein AMTR_s00103p00108190          204   5e-57   Amborella trichopoda
ref|XP_006858684.1|  hypothetical protein AMTR_s00066p00085830          203   1e-56   Amborella trichopoda
ref|XP_011457274.1|  PREDICTED: uncharacterized protein LOC101313...    202   1e-56   Fragaria vesca subsp. vesca
ref|XP_009401306.1|  PREDICTED: uncharacterized protein LOC103985362    203   2e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004309822.1|  PREDICTED: uncharacterized protein LOC101313...    202   2e-56   Fragaria vesca subsp. vesca
ref|XP_006443048.1|  hypothetical protein CICLE_v100186802mg            188   2e-56   
ref|XP_010257179.1|  PREDICTED: uncharacterized protein LOC104597...    202   2e-56   Nelumbo nucifera [Indian lotus]
ref|XP_008231409.1|  PREDICTED: uncharacterized protein LOC103330592    202   3e-56   Prunus mume [ume]
ref|XP_007218911.1|  hypothetical protein PRUPE_ppa000649mg             202   3e-56   
ref|XP_004308677.1|  PREDICTED: uncharacterized protein LOC101307642    202   3e-56   Fragaria vesca subsp. vesca
ref|XP_010257180.1|  PREDICTED: uncharacterized protein LOC104597...    202   3e-56   
ref|XP_009626575.1|  PREDICTED: protein EFR3 homolog B-like             188   3e-56   Nicotiana tomentosiformis
ref|XP_008784321.1|  PREDICTED: uncharacterized protein LOC103703...    202   4e-56   Phoenix dactylifera
ref|XP_008784320.1|  PREDICTED: uncharacterized protein LOC103703...    202   4e-56   Phoenix dactylifera
ref|XP_008784316.1|  PREDICTED: protein EFR3 homolog isoform X1         202   5e-56   
gb|EAY92960.1|  hypothetical protein OsI_14753                          190   5e-56   Oryza sativa Indica Group [Indian rice]
ref|XP_002264735.1|  PREDICTED: uncharacterized protein LOC100264...    201   1e-55   Vitis vinifera
gb|KGN59399.1|  hypothetical protein Csa_3G816120                       199   1e-55   Cucumis sativus [cucumbers]
ref|XP_010241226.1|  PREDICTED: uncharacterized protein LOC104585...    200   1e-55   Nelumbo nucifera [Indian lotus]
ref|XP_004166917.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    200   1e-55   
ref|XP_009355500.1|  PREDICTED: uncharacterized protein LOC103946512    200   2e-55   Pyrus x bretschneideri [bai li]
ref|XP_004136762.1|  PREDICTED: uncharacterized protein LOC101210251    200   2e-55   
ref|XP_011078902.1|  PREDICTED: uncharacterized protein LOC105162543    199   3e-55   Sesamum indicum [beniseed]
dbj|BAK01387.1|  predicted protein                                      199   3e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009391228.1|  PREDICTED: uncharacterized protein LOC103977445    199   4e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010907685.1|  PREDICTED: uncharacterized protein LOC105034...    198   4e-55   
ref|XP_010907684.1|  PREDICTED: uncharacterized protein LOC105034...    198   6e-55   Elaeis guineensis
ref|XP_007203221.1|  hypothetical protein PRUPE_ppa000725mg             198   7e-55   
ref|XP_008443197.1|  PREDICTED: uncharacterized protein LOC103486...    198   7e-55   Cucumis melo [Oriental melon]
ref|XP_010907683.1|  PREDICTED: uncharacterized protein LOC105034...    198   9e-55   Elaeis guineensis
ref|XP_010907681.1|  PREDICTED: uncharacterized protein LOC105034...    198   9e-55   Elaeis guineensis
ref|XP_010907682.1|  PREDICTED: uncharacterized protein LOC105034...    198   9e-55   Elaeis guineensis
ref|XP_003591099.1|  EFR3-like protein                                  184   1e-54   
emb|CDP16550.1|  unnamed protein product                                197   1e-54   Coffea canephora [robusta coffee]
ref|XP_010241507.1|  PREDICTED: uncharacterized protein LOC104586...    197   1e-54   Nelumbo nucifera [Indian lotus]
ref|XP_010241506.1|  PREDICTED: uncharacterized protein LOC104586...    197   1e-54   Nelumbo nucifera [Indian lotus]
ref|XP_004304390.1|  PREDICTED: uncharacterized protein LOC101298629    197   2e-54   Fragaria vesca subsp. vesca
ref|XP_010420957.1|  PREDICTED: uncharacterized protein LOC104706460    197   2e-54   Camelina sativa [gold-of-pleasure]
ref|XP_009379628.1|  PREDICTED: uncharacterized protein LOC103968...    197   2e-54   Pyrus x bretschneideri [bai li]
ref|XP_009379627.1|  PREDICTED: uncharacterized protein LOC103968...    197   2e-54   
ref|XP_010493228.1|  PREDICTED: uncharacterized protein LOC104770495    197   2e-54   Camelina sativa [gold-of-pleasure]
ref|XP_006286974.1|  hypothetical protein CARUB_v10000121mg             197   2e-54   Capsella rubella
gb|EPS68493.1|  hypothetical protein M569_06272                         197   2e-54   Genlisea aurea
ref|XP_010069300.1|  PREDICTED: protein EFR3 homolog B isoform X1       196   4e-54   Eucalyptus grandis [rose gum]
ref|XP_006421414.1|  hypothetical protein CICLE_v10006843mg             196   5e-54   
ref|XP_009124331.1|  PREDICTED: uncharacterized protein LOC103849280    196   6e-54   Brassica rapa
emb|CDY09095.1|  BnaA02g05210D                                          195   6e-54   Brassica napus [oilseed rape]
gb|KCW57602.1|  hypothetical protein EUGRSUZ_H00374                     196   6e-54   Eucalyptus grandis [rose gum]
ref|XP_003605757.1|  EFR3-like protein                                  196   6e-54   Medicago truncatula
gb|EYU27043.1|  hypothetical protein MIMGU_mgv1a000818mg                195   7e-54   Erythranthe guttata [common monkey flower]
ref|NP_197607.5|  uncharacterized protein                               195   7e-54   Arabidopsis thaliana [mouse-ear cress]
gb|KDO47318.1|  hypothetical protein CISIN_1g001882mg                   195   9e-54   Citrus sinensis [apfelsine]
gb|KDO47320.1|  hypothetical protein CISIN_1g001882mg                   195   9e-54   Citrus sinensis [apfelsine]
ref|XP_010653791.1|  PREDICTED: uncharacterized protein LOC100255...    195   1e-53   Vitis vinifera
gb|KDO47319.1|  hypothetical protein CISIN_1g001882mg                   194   1e-53   Citrus sinensis [apfelsine]
ref|XP_007028783.1|  Uncharacterized protein isoform 3                  192   1e-53   
gb|KCW90195.1|  hypothetical protein EUGRSUZ_A02368                     195   1e-53   Eucalyptus grandis [rose gum]
gb|EPS68833.1|  hypothetical protein M569_05934                         191   1e-53   Genlisea aurea
ref|XP_002277870.1|  PREDICTED: uncharacterized protein LOC100255...    195   1e-53   Vitis vinifera
ref|XP_004236620.1|  PREDICTED: protein EFR3 homolog B isoform X2       194   1e-53   Solanum lycopersicum
ref|XP_010057221.1|  PREDICTED: uncharacterized protein LOC104445...    195   1e-53   Eucalyptus grandis [rose gum]
ref|XP_007033975.1|  ARM repeat superfamily protein isoform 5           194   1e-53   
ref|XP_010319191.1|  PREDICTED: protein EFR3 homolog B isoform X1       194   1e-53   Solanum lycopersicum
ref|XP_010057214.1|  PREDICTED: uncharacterized protein LOC104445...    195   1e-53   Eucalyptus grandis [rose gum]
ref|XP_007033971.1|  ARM repeat superfamily protein isoform 1           194   1e-53   
ref|XP_002322714.1|  cyclin-related family protein                      194   2e-53   
ref|XP_011075238.1|  PREDICTED: uncharacterized protein LOC105159...    194   2e-53   Sesamum indicum [beniseed]
ref|XP_007225374.1|  hypothetical protein PRUPE_ppa000810mg             194   2e-53   Prunus persica
ref|XP_010319193.1|  PREDICTED: protein EFR3 homolog B isoform X3       194   2e-53   Solanum lycopersicum
ref|XP_008222533.1|  PREDICTED: uncharacterized protein LOC103322398    194   2e-53   Prunus mume [ume]
ref|XP_011075240.1|  PREDICTED: uncharacterized protein LOC105159...    194   2e-53   Sesamum indicum [beniseed]
ref|XP_006350204.1|  PREDICTED: protein EFR3 homolog B-like isofo...    194   2e-53   Solanum tuberosum [potatoes]
ref|XP_010523668.1|  PREDICTED: protein EFR3 homolog isoform X2         194   2e-53   Tarenaya hassleriana [spider flower]
ref|XP_006345431.1|  PREDICTED: uncharacterized protein LOC102584593    194   3e-53   Solanum tuberosum [potatoes]
gb|KEH23652.1|  cyclin-like protein                                     194   3e-53   Medicago truncatula
ref|XP_006350206.1|  PREDICTED: protein EFR3 homolog B-like isofo...    193   3e-53   
ref|XP_004229640.1|  PREDICTED: protein EFR3 homolog B-like             194   3e-53   Solanum lycopersicum
ref|XP_006657548.1|  PREDICTED: uncharacterized protein LOC102712271    194   3e-53   Oryza brachyantha
ref|XP_010523667.1|  PREDICTED: protein EFR3 homolog isoform X1         194   3e-53   Tarenaya hassleriana [spider flower]
ref|XP_006597228.1|  PREDICTED: uncharacterized protein LOC100811...    193   3e-53   Glycine max [soybeans]
ref|XP_002874031.1|  hypothetical protein ARALYDRAFT_489019             194   3e-53   
ref|XP_009789122.1|  PREDICTED: protein EFR3 homolog B isoform X2       193   3e-53   Nicotiana sylvestris
ref|XP_002975992.1|  hypothetical protein SELMODRAFT_443103             193   3e-53   
ref|XP_002968494.1|  hypothetical protein SELMODRAFT_90004              192   3e-53   
ref|XP_009789120.1|  PREDICTED: protein EFR3 homolog B isoform X1       193   4e-53   Nicotiana sylvestris
ref|XP_009789124.1|  PREDICTED: protein EFR3 homolog B isoform X3       193   4e-53   Nicotiana sylvestris
ref|XP_006489936.1|  PREDICTED: uncharacterized protein LOC102624456    193   4e-53   Citrus sinensis [apfelsine]
ref|XP_009789125.1|  PREDICTED: protein EFR3 homolog B isoform X4       193   4e-53   Nicotiana sylvestris
ref|XP_003540587.1|  PREDICTED: uncharacterized protein LOC100816475    193   5e-53   Glycine max [soybeans]
ref|XP_009610943.1|  PREDICTED: protein EFR3 homolog B isoform X3       193   5e-53   Nicotiana tomentosiformis
ref|XP_010930207.1|  PREDICTED: uncharacterized protein LOC105051451    193   5e-53   Elaeis guineensis
ref|XP_009610919.1|  PREDICTED: protein EFR3 homolog B isoform X1       193   5e-53   Nicotiana tomentosiformis
ref|XP_004951914.1|  PREDICTED: uncharacterized protein LOC101783...    193   5e-53   Setaria italica
ref|XP_009789839.1|  PREDICTED: protein EFR3 homolog B-like isofo...    193   5e-53   Nicotiana sylvestris
ref|XP_002308951.2|  cyclin-related family protein                      192   5e-53   
ref|XP_009610937.1|  PREDICTED: protein EFR3 homolog B isoform X2       193   5e-53   Nicotiana tomentosiformis
ref|XP_006400678.1|  hypothetical protein EUTSA_v10012553mg             193   5e-53   Eutrema salsugineum [saltwater cress]
ref|XP_009610957.1|  PREDICTED: protein EFR3 homolog B isoform X5       192   5e-53   Nicotiana tomentosiformis
ref|XP_009610949.1|  PREDICTED: protein EFR3 homolog B isoform X4       193   5e-53   Nicotiana tomentosiformis
ref|XP_001767624.1|  predicted protein                                  191   6e-53   
ref|XP_009789840.1|  PREDICTED: protein EFR3 homolog B-like isofo...    193   6e-53   Nicotiana sylvestris
ref|XP_007028781.1|  Uncharacterized protein isoform 1                  192   7e-53   
ref|XP_011048039.1|  PREDICTED: uncharacterized protein LOC105142218    192   7e-53   Populus euphratica
ref|XP_011033324.1|  PREDICTED: protein EFR3 homolog B-like isofo...    192   9e-53   Populus euphratica
ref|XP_006478683.1|  PREDICTED: uncharacterized protein LOC102614...    192   9e-53   Citrus sinensis [apfelsine]
ref|XP_011033323.1|  PREDICTED: uncharacterized protein LOC105131...    192   9e-53   Populus euphratica
gb|KJB71806.1|  hypothetical protein B456_011G143200                    191   9e-53   Gossypium raimondii
ref|XP_006648302.1|  PREDICTED: uncharacterized protein LOC102704216    192   9e-53   Oryza brachyantha
gb|EEC81712.1|  hypothetical protein OsI_25322                          192   1e-52   Oryza sativa Indica Group [Indian rice]
ref|NP_001059150.1|  Os07g0205900                                       192   1e-52   
ref|XP_002517810.1|  conserved hypothetical protein                     192   1e-52   
emb|CDP18636.1|  unnamed protein product                                192   1e-52   Coffea canephora [robusta coffee]
gb|KFK26320.1|  hypothetical protein AALP_AA8G232400                    192   2e-52   Arabis alpina [alpine rockcress]
ref|XP_009363645.1|  PREDICTED: uncharacterized protein LOC103953608    191   2e-52   Pyrus x bretschneideri [bai li]
dbj|BAK04246.1|  predicted protein                                      191   2e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006648006.1|  PREDICTED: protein EFR3 homolog B-like isofo...    191   2e-52   Oryza brachyantha
ref|XP_006587694.1|  PREDICTED: uncharacterized protein LOC100808352    191   3e-52   Glycine max [soybeans]
ref|XP_011087843.1|  PREDICTED: uncharacterized protein LOC105169196    191   3e-52   Sesamum indicum [beniseed]
ref|XP_008790619.1|  PREDICTED: uncharacterized protein LOC103707...    191   3e-52   
ref|NP_001048304.1|  Os02g0780500                                       190   4e-52   
gb|EMS53000.1|  Protein EFR3-like protein B                             190   5e-52   Triticum urartu
ref|XP_002529611.1|  conserved hypothetical protein                     190   6e-52   
ref|XP_004493504.1|  PREDICTED: uncharacterized protein LOC101511...    190   6e-52   Cicer arietinum [garbanzo]
ref|XP_004493505.1|  PREDICTED: uncharacterized protein LOC101511...    190   6e-52   Cicer arietinum [garbanzo]
ref|XP_004140882.1|  PREDICTED: uncharacterized protein LOC101203725    189   6e-52   Cucumis sativus [cucumbers]
gb|EMT11310.1|  hypothetical protein F775_16040                         190   7e-52   
ref|XP_008445731.1|  PREDICTED: uncharacterized protein LOC103488...    190   7e-52   Cucumis melo [Oriental melon]
ref|XP_008445732.1|  PREDICTED: uncharacterized protein LOC103488...    189   7e-52   Cucumis melo [Oriental melon]
ref|XP_006595061.1|  PREDICTED: uncharacterized protein LOC100806...    189   8e-52   Glycine max [soybeans]
ref|XP_010666756.1|  PREDICTED: uncharacterized protein LOC104883885    189   1e-51   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN11694.1|  Protein EFR3 like B                                     189   1e-51   Glycine soja [wild soybean]
gb|KEH39475.1|  cyclin-like protein                                     189   1e-51   Medicago truncatula
ref|XP_002277709.2|  PREDICTED: uncharacterized protein LOC100265428    189   1e-51   Vitis vinifera
ref|XP_003597513.1|  EFR3-like protein                                  189   2e-51   
ref|XP_009118564.1|  PREDICTED: protein EFR3 homolog                    188   2e-51   Brassica rapa
emb|CDY06190.1|  BnaA09g50130D                                          188   2e-51   
ref|XP_007131432.1|  hypothetical protein PHAVU_011G013000g             189   2e-51   Phaseolus vulgaris [French bean]
emb|CDY09999.1|  BnaC08g44520D                                          188   2e-51   Brassica napus [oilseed rape]
ref|XP_002309810.1|  hypothetical protein POPTR_0007s02020g             188   2e-51   
gb|KJB49179.1|  hypothetical protein B456_008G105100                    187   2e-51   Gossypium raimondii
ref|XP_011026408.1|  PREDICTED: uncharacterized protein LOC105127...    188   3e-51   Populus euphratica
ref|XP_011026411.1|  PREDICTED: uncharacterized protein LOC105127...    188   3e-51   Populus euphratica
gb|KHN30101.1|  Protein EFR3 like B                                     187   3e-51   Glycine soja [wild soybean]
gb|KHG10450.1|  Protein EFR3                                            187   4e-51   Gossypium arboreum [tree cotton]
ref|XP_004506319.1|  PREDICTED: uncharacterized protein LOC101489771    188   4e-51   Cicer arietinum [garbanzo]
gb|KJB49180.1|  hypothetical protein B456_008G105100                    187   4e-51   Gossypium raimondii
ref|NP_001045867.1|  Os02g0143200                                       187   5e-51   
ref|XP_006417969.1|  hypothetical protein EUTSA_v10006704mg             187   5e-51   
gb|KJB71809.1|  hypothetical protein B456_011G143200                    187   6e-51   Gossypium raimondii
gb|KJB37960.1|  hypothetical protein B456_006G228200                    185   6e-51   Gossypium raimondii
ref|XP_007162228.1|  hypothetical protein PHAVU_001G134800g             187   6e-51   Phaseolus vulgaris [French bean]
gb|EEE56284.1|  hypothetical protein OsJ_05346                          187   6e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007162229.1|  hypothetical protein PHAVU_001G134800g             187   6e-51   Phaseolus vulgaris [French bean]
gb|EEC72466.1|  hypothetical protein OsI_05818                          187   6e-51   Oryza sativa Indica Group [Indian rice]
gb|KJB49178.1|  hypothetical protein B456_008G105100                    187   7e-51   Gossypium raimondii
ref|XP_002457472.1|  hypothetical protein SORBIDRAFT_03g007790          187   7e-51   
gb|KJB71804.1|  hypothetical protein B456_011G143200                    187   7e-51   Gossypium raimondii
tpg|DAA53702.1|  TPA: hypothetical protein ZEAMMB73_302622              185   8e-51   
gb|KJB71808.1|  hypothetical protein B456_011G143200                    186   8e-51   Gossypium raimondii
ref|XP_004486920.1|  PREDICTED: uncharacterized protein LOC101509...    186   1e-50   Cicer arietinum [garbanzo]
gb|AAK56279.1|AF367291_1  At1g05960/T21E18_20                           184   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010485557.1|  PREDICTED: uncharacterized protein LOC104763859    186   2e-50   Camelina sativa [gold-of-pleasure]
gb|KJB37959.1|  hypothetical protein B456_006G228200                    186   2e-50   Gossypium raimondii
ref|XP_010457707.1|  PREDICTED: uncharacterized protein LOC104739144    185   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010475319.1|  PREDICTED: uncharacterized protein LOC104754751    185   3e-50   Camelina sativa [gold-of-pleasure]
ref|XP_006576825.1|  PREDICTED: uncharacterized protein LOC100817...    185   3e-50   Glycine max [soybeans]
ref|XP_003520520.1|  PREDICTED: uncharacterized protein LOC100817...    185   3e-50   Glycine max [soybeans]
ref|XP_010546486.1|  PREDICTED: uncharacterized protein LOC104818...    185   3e-50   
ref|NP_563755.1|  ARM repeat superfamily protein                        184   5e-50   Arabidopsis thaliana [mouse-ear cress]
emb|CDY63789.1|  BnaA08g31700D                                          184   5e-50   Brassica napus [oilseed rape]
ref|XP_008673097.1|  PREDICTED: uncharacterized protein LOC100381...    184   5e-50   
ref|XP_008799995.1|  PREDICTED: uncharacterized protein LOC103714...    184   5e-50   Phoenix dactylifera
ref|XP_008673100.1|  PREDICTED: uncharacterized protein LOC100381...    184   5e-50   Zea mays [maize]
ref|XP_006303900.1|  hypothetical protein CARUB_v10008206mg             183   6e-50   
ref|XP_008673099.1|  PREDICTED: uncharacterized protein LOC100381...    184   6e-50   Zea mays [maize]
ref|XP_004954123.1|  PREDICTED: protein EFR3 homolog B-like             184   7e-50   Setaria italica
emb|CDY10165.1|  BnaC05g04080D                                          183   1e-49   Brassica napus [oilseed rape]
ref|XP_006303899.1|  hypothetical protein CARUB_v10008206mg             183   1e-49   Capsella rubella
ref|XP_006293443.1|  hypothetical protein CARUB_v10022560mg             184   1e-49   Capsella rubella
gb|EYU20743.1|  hypothetical protein MIMGU_mgv1a000711mg                183   1e-49   Erythranthe guttata [common monkey flower]
emb|CDX86545.1|  BnaC08g01580D                                          183   1e-49   
ref|XP_010555004.1|  PREDICTED: uncharacterized protein LOC104824606    184   1e-49   
ref|XP_007150426.1|  hypothetical protein PHAVU_005G152600g             183   2e-49   Phaseolus vulgaris [French bean]
ref|XP_004158232.1|  PREDICTED: protein EFR3 homolog cmp44E-like        181   2e-49   
ref|XP_010546363.1|  PREDICTED: uncharacterized protein LOC104818...    183   2e-49   
gb|KEH30318.1|  cyclin-like protein                                     182   2e-49   
gb|AAF80120.1|AC024174_2  Contains similarity to an unknown prote...    184   3e-49   
ref|XP_008655586.1|  PREDICTED: uncharacterized protein LOC103634...    182   3e-49   
gb|EAY89716.1|  hypothetical protein OsI_11254                          182   3e-49   
gb|AFW70121.1|  hypothetical protein ZEAMMB73_889435                    182   3e-49   
ref|XP_008644195.1|  PREDICTED: uncharacterized protein LOC100501...    182   3e-49   
ref|XP_009119100.1|  PREDICTED: uncharacterized protein LOC103844080    182   4e-49   
emb|CDY47707.1|  BnaA10g03960D                                          181   4e-49   
gb|KGN64805.1|  hypothetical protein Csa_1G108300                       182   4e-49   
ref|XP_008644196.1|  PREDICTED: uncharacterized protein LOC100501...    182   4e-49   
gb|EAZ26671.1|  hypothetical protein OsJ_10574                          182   4e-49   
ref|XP_004147289.1|  PREDICTED: uncharacterized protein LOC101219905    182   5e-49   
ref|XP_002892313.1|  predicted protein                                  183   5e-49   
ref|XP_002533049.1|  conserved hypothetical protein                     181   8e-49   
ref|XP_010522186.1|  PREDICTED: uncharacterized protein LOC104800...    181   8e-49   
ref|XP_010522184.1|  PREDICTED: uncharacterized protein LOC104800...    181   8e-49   
gb|EEE55815.1|  hypothetical protein OsJ_04415                          181   8e-49   
ref|XP_006592150.1|  PREDICTED: uncharacterized protein LOC100799...    181   9e-49   
ref|NP_001045092.1|  Os01g0898300                                       181   9e-49   
ref|XP_008463075.1|  PREDICTED: uncharacterized protein LOC103501...    181   9e-49   
ref|XP_008463083.1|  PREDICTED: uncharacterized protein LOC103501...    181   1e-48   
ref|XP_006411452.1|  hypothetical protein EUTSA_v10016171mg             181   1e-48   
ref|XP_004136123.1|  PREDICTED: uncharacterized protein LOC101211879    181   1e-48   
ref|XP_010672159.1|  PREDICTED: uncharacterized protein LOC104888...    181   1e-48   
ref|XP_010672158.1|  PREDICTED: uncharacterized protein LOC104888...    181   1e-48   
ref|XP_008644201.1|  PREDICTED: uncharacterized protein LOC100501...    181   1e-48   
ref|XP_008644200.1|  PREDICTED: uncharacterized protein LOC100501...    181   1e-48   
ref|XP_008644199.1|  PREDICTED: uncharacterized protein LOC100501...    181   1e-48   
ref|XP_008644198.1|  PREDICTED: uncharacterized protein LOC100501...    181   2e-48   
ref|XP_008644197.1|  PREDICTED: uncharacterized protein LOC100501...    181   2e-48   
ref|XP_009111016.1|  PREDICTED: protein EFR3 homolog isoform X1         180   2e-48   
ref|XP_003539042.1|  PREDICTED: uncharacterized protein LOC100817...    180   2e-48   
ref|XP_009111018.1|  PREDICTED: protein EFR3 homolog isoform X3         180   2e-48   
gb|KHN06209.1|  Protein EFR3 like B                                     180   2e-48   
ref|XP_010454428.1|  PREDICTED: uncharacterized protein LOC104736187    180   3e-48   
gb|KDP42800.1|  hypothetical protein JCGZ_23742                         179   3e-48   
gb|EYU18743.1|  hypothetical protein MIMGU_mgv1a0012531mg               166   3e-48   
gb|KHN25286.1|  Protein EFR3 like B                                     179   3e-48   
ref|XP_008461314.1|  PREDICTED: uncharacterized protein LOC103499...    179   4e-48   
emb|CDY06905.1|  BnaA04g24100D                                          179   4e-48   
emb|CDY14788.1|  BnaC04g47850D                                          179   4e-48   
ref|XP_002451526.1|  hypothetical protein SORBIDRAFT_04g003310          179   5e-48   
ref|XP_010505973.1|  PREDICTED: uncharacterized protein LOC104782671    179   5e-48   
gb|KHG08769.1|  Protein EFR3 B                                          179   5e-48   
ref|XP_009142011.1|  PREDICTED: uncharacterized protein LOC103865...    179   5e-48   
ref|XP_009142012.1|  PREDICTED: uncharacterized protein LOC103865...    179   6e-48   
ref|XP_009142010.1|  PREDICTED: uncharacterized protein LOC103865...    179   6e-48   
ref|XP_009142008.1|  PREDICTED: uncharacterized protein LOC103865...    179   6e-48   
ref|XP_010508669.1|  PREDICTED: uncharacterized protein LOC104785...    179   7e-48   
ref|XP_007131956.1|  hypothetical protein PHAVU_011G054800g             178   7e-48   
ref|XP_004507331.1|  PREDICTED: uncharacterized protein LOC101496...    177   1e-47   
gb|EMS54754.1|  Protein EFR3-like protein A                             176   2e-47   
gb|AFW84297.1|  hypothetical protein ZEAMMB73_469985                    174   3e-47   
ref|XP_004970911.1|  PREDICTED: uncharacterized protein LOC101769...    176   5e-47   
gb|EMT28557.1|  Protein EFR3-like protein                               175   5e-47   
ref|XP_004970908.1|  PREDICTED: uncharacterized protein LOC101769...    176   5e-47   
ref|XP_002881801.1|  hypothetical protein ARALYDRAFT_483264             175   1e-46   
gb|AFW84298.1|  hypothetical protein ZEAMMB73_469985                    175   1e-46   
gb|AFW84299.1|  hypothetical protein ZEAMMB73_469985                    175   1e-46   
ref|XP_006645172.1|  PREDICTED: uncharacterized protein LOC102710074    175   1e-46   
dbj|BAF00551.1|  hypothetical protein                                   174   2e-46   
ref|XP_010557094.1|  PREDICTED: uncharacterized protein LOC104826...    174   2e-46   
ref|XP_003570918.1|  PREDICTED: uncharacterized protein LOC100821...    174   2e-46   
ref|NP_181714.3|  uncharacterized protein                               174   2e-46   
gb|KJB16447.1|  hypothetical protein B456_002G230500                    174   3e-46   
ref|XP_010523669.1|  PREDICTED: uncharacterized protein LOC104801...    174   4e-46   
emb|CDX79909.1|  BnaA05g02470D                                          173   6e-46   
ref|XP_008655589.1|  PREDICTED: uncharacterized protein LOC103634...    172   9e-46   
ref|XP_011033325.1|  PREDICTED: uncharacterized protein LOC105131...    172   1e-45   
ref|NP_001154308.1|  ARM repeat superfamily protein                     171   2e-45   
gb|KJB37958.1|  hypothetical protein B456_006G228200                    171   2e-45   
ref|XP_008790620.1|  PREDICTED: uncharacterized protein LOC103707...    171   3e-45   
ref|XP_002456786.1|  hypothetical protein SORBIDRAFT_03g042720          171   3e-45   
ref|XP_008790616.1|  PREDICTED: uncharacterized protein LOC103707...    171   3e-45   
gb|EMS60662.1|  Protein EFR3-like protein                               171   3e-45   
ref|XP_010232688.1|  PREDICTED: uncharacterized protein LOC100842...    171   3e-45   
ref|XP_003564842.1|  PREDICTED: uncharacterized protein LOC100842...    171   3e-45   
ref|XP_010232687.1|  PREDICTED: uncharacterized protein LOC100842...    171   4e-45   
emb|CDM85315.1|  unnamed protein product                                171   4e-45   
gb|KHG30683.1|  Protein EFR3 cmp44E                                     170   5e-45   
gb|KHN33312.1|  Protein EFR3 like B                                     170   7e-45   
gb|EMT06694.1|  Putative mitochondrial protein                          170   9e-45   
ref|XP_008240995.1|  PREDICTED: uncharacterized protein LOC103339476    170   9e-45   
ref|XP_010413002.1|  PREDICTED: uncharacterized protein LOC104699388    168   4e-44   
ref|XP_008647477.1|  PREDICTED: uncharacterized protein LOC100217...    166   1e-43   
ref|XP_008647478.1|  PREDICTED: uncharacterized protein LOC100217...    166   1e-43   
gb|EPS74671.1|  hypothetical protein M569_00084                         151   3e-43   
gb|KJB46322.1|  hypothetical protein B456_007G360200                    164   6e-43   
ref|XP_007052501.1|  Uncharacterized protein TCM_005862                 163   1e-42   
ref|XP_008645036.1|  PREDICTED: uncharacterized protein LOC103626...    164   1e-42   
ref|XP_008645035.1|  PREDICTED: uncharacterized protein LOC103626...    164   1e-42   
ref|XP_001770437.1|  predicted protein                                  164   2e-42   
gb|EMT12879.1|  hypothetical protein F775_15212                         163   2e-42   
gb|AFW69349.1|  hypothetical protein ZEAMMB73_015704                    163   2e-42   
ref|XP_008354962.1|  PREDICTED: protein EFR3 homolog A-like             146   6e-41   
gb|KGN45115.1|  hypothetical protein Csa_7G426560                       156   4e-40   
gb|AAC02765.1|  hypothetical protein                                    153   7e-39   
ref|XP_004966105.1|  PREDICTED: uncharacterized protein LOC101758656    151   3e-38   
ref|XP_008355520.1|  PREDICTED: uncharacterized protein LOC103419180    138   5e-38   
ref|XP_010097525.1|  hypothetical protein L484_024736                   137   6e-37   
emb|CBI29857.3|  unnamed protein product                                144   8e-36   
gb|AFK33385.1|  unknown                                                 132   2e-35   
emb|CBI24919.3|  unnamed protein product                                142   5e-35   
gb|KHN32414.1|  Protein EFR3 like B                                     141   9e-35   
gb|EEE57911.1|  hypothetical protein OsJ_08605                          140   1e-34   
gb|EEC74114.1|  hypothetical protein OsI_09170                          136   2e-34   
gb|AES61350.2|  cyclin-like protein                                     127   1e-33   
emb|CDY48767.1|  BnaC04g02200D                                          136   6e-33   
gb|KHN11423.1|  hypothetical protein glysoja_015318                     129   1e-30   
ref|XP_008461315.1|  PREDICTED: uncharacterized protein LOC103499...    127   7e-30   
ref|XP_010557096.1|  PREDICTED: uncharacterized protein LOC104826...    127   7e-30   
gb|AFK46351.1|  unknown                                                 115   1e-27   
ref|XP_008463089.1|  PREDICTED: uncharacterized protein LOC103501...    119   5e-27   
ref|XP_004160819.1|  PREDICTED: uncharacterized LOC101203725            105   9e-25   
ref|XP_010092917.1|  hypothetical protein L484_004958                   104   9e-25   
ref|XP_010236037.1|  PREDICTED: uncharacterized protein LOC100837488    112   1e-24   
gb|KDO83457.1|  hypothetical protein CISIN_1g035569mg                   110   4e-24   
ref|XP_006287016.1|  hypothetical protein CARUB_v10000164mg             110   6e-24   
ref|XP_009412884.1|  PREDICTED: uncharacterized protein LOC103994280    110   6e-24   
dbj|BAH57285.1|  AT5G26850                                              109   1e-23   
gb|KHN07377.1|  hypothetical protein glysoja_012675                     105   3e-22   
emb|CAJ44368.1|  putative cyclin-related protein                        103   1e-21   
gb|KDP26045.1|  hypothetical protein JCGZ_21078                         101   7e-21   
ref|XP_008350293.1|  PREDICTED: polygalacturonase ADPG2-like          94.7    6e-20   
ref|XP_008387322.1|  PREDICTED: uncharacterized protein LOC103449776  93.2    3e-19   
gb|KJB71039.1|  hypothetical protein B456_011G101600                  88.6    2e-18   
gb|KJB71038.1|  hypothetical protein B456_011G101600                  86.7    7e-18   
gb|KDO81671.1|  hypothetical protein CISIN_1g0461822mg                84.0    1e-17   
ref|XP_006482855.1|  PREDICTED: uncharacterized protein LOC102612183  85.9    1e-17   
ref|XP_004168868.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  86.7    6e-16   
ref|XP_006350205.1|  PREDICTED: protein EFR3 homolog B-like isofo...  84.0    5e-15   
ref|XP_006439087.1|  hypothetical protein CICLE_v10033334mg           82.4    1e-14   
ref|XP_008463098.1|  PREDICTED: uncharacterized protein LOC103501...  81.6    3e-14   
ref|XP_005846281.1|  hypothetical protein CHLNCDRAFT_135622           73.2    2e-12   
gb|KJB16446.1|  hypothetical protein B456_002G230500                  75.5    3e-12   
ref|XP_010313083.1|  PREDICTED: uncharacterized protein LOC101250...  73.6    1e-11   
ref|XP_010927191.1|  PREDICTED: uncharacterized protein LOC105049285  71.6    5e-11   
ref|XP_006648008.1|  PREDICTED: protein EFR3 homolog B-like isofo...  68.9    3e-10   
ref|XP_008655590.1|  PREDICTED: uncharacterized protein LOC103634...  68.6    5e-10   
ref|XP_008443202.1|  PREDICTED: uncharacterized protein LOC103486...  67.8    9e-10   
ref|XP_002405516.1|  transmembrane protein cmp44E, putative           63.9    1e-08   
dbj|BAC31942.1|  unnamed protein product                              61.6    8e-08   
ref|XP_005645965.1|  hypothetical protein COCSUDRAFT_48103            61.6    8e-08   
ref|XP_003744820.1|  PREDICTED: protein EFR3 homolog B-like           61.2    1e-07   
ref|XP_004935930.1|  PREDICTED: protein EFR3 homolog B isoform X8     61.2    1e-07   
ref|XP_002585860.1|  hypothetical protein BRAFLDRAFT_256891           60.5    1e-07   
ref|XP_010842616.1|  PREDICTED: protein EFR3 homolog A isoform X3     61.2    1e-07   
ref|XP_010319194.1|  PREDICTED: uncharacterized protein LOC101246...  61.2    1e-07   
ref|XP_010842617.1|  PREDICTED: protein EFR3 homolog A isoform X4     61.2    1e-07   
ref|XP_010842614.1|  PREDICTED: protein EFR3 homolog A isoform X1     61.2    1e-07   
ref|XP_004935931.1|  PREDICTED: protein EFR3 homolog B isoform X9     61.2    1e-07   
ref|XP_010932402.1|  PREDICTED: uncharacterized protein LOC105053...  60.8    1e-07   
gb|ELV13761.1|  Protein EFR3 like protein B                           60.8    1e-07   
ref|XP_008172122.1|  PREDICTED: protein EFR3 homolog B isoform X3     60.5    2e-07   
ref|XP_009610963.1|  PREDICTED: uncharacterized protein LOC104104...  60.5    2e-07   
gb|KFM73651.1|  Protein EFR3-like protein                             59.3    2e-07   
gb|ELK14036.1|  Protein EFR3 like protein B                           60.5    2e-07   
ref|XP_004656384.1|  PREDICTED: protein EFR3 homolog A                60.1    2e-07   
ref|XP_010129665.1|  PREDICTED: protein EFR3 homolog B-like           57.8    3e-07   
ref|XP_008119523.1|  PREDICTED: LOW QUALITY PROTEIN: protein EFR3...  60.1    3e-07   
gb|ELW57135.1|  Protein EFR3 like protein A                           60.1    3e-07   
gb|ETE64925.1|  Protein EFR3-like B                                   59.7    3e-07   
ref|XP_010603223.1|  PREDICTED: protein EFR3 homolog B                60.1    3e-07   
ref|XP_005024084.1|  PREDICTED: protein EFR3 homolog B isoform X1     59.7    3e-07   
ref|XP_007488406.1|  PREDICTED: protein EFR3 homolog A isoform X1     59.7    3e-07   
gb|ERE67357.1|  putative protein EFR3                                 59.7    3e-07   
ref|XP_007488407.1|  PREDICTED: protein EFR3 homolog A isoform X2     59.7    3e-07   
gb|ELR56400.1|  Protein EFR3-like protein B                           59.7    3e-07   
dbj|BAC35197.1|  unnamed protein product                              57.0    4e-07   
ref|XP_010069302.1|  PREDICTED: uncharacterized protein LOC104456...  59.7    4e-07   
ref|XP_010842615.1|  PREDICTED: protein EFR3 homolog A isoform X2     59.7    4e-07   
ref|XP_006091798.1|  PREDICTED: protein EFR3 homolog B                59.7    4e-07   
ref|XP_005900795.1|  PREDICTED: protein EFR3 homolog A                59.3    4e-07   
ref|XP_006079422.1|  PREDICTED: protein EFR3 homolog A isoform X1     59.3    4e-07   
ref|XP_005872847.1|  PREDICTED: protein EFR3 homolog A isoform X3     59.3    4e-07   
gb|ELR52803.1|  Protein EFR3-like protein A                           59.3    4e-07   
ref|XP_011484515.1|  PREDICTED: protein EFR3 homolog A isoform X1     59.3    4e-07   
ref|XP_006079423.1|  PREDICTED: protein EFR3 homolog A isoform X2     59.3    4e-07   
ref|XP_011484516.1|  PREDICTED: protein EFR3 homolog A isoform X2     59.3    4e-07   
ref|XP_003497111.1|  PREDICTED: protein EFR3 homolog B                59.3    4e-07   
ref|XP_005872845.1|  PREDICTED: protein EFR3 homolog A isoform X1     59.3    4e-07   
ref|XP_004627609.1|  PREDICTED: protein EFR3 homolog B                59.3    5e-07   
ref|XP_009914907.1|  PREDICTED: protein EFR3 homolog B-like           58.9    5e-07   
ref|XP_011484517.1|  PREDICTED: protein EFR3 homolog A isoform X3     59.3    5e-07   
ref|XP_005872846.1|  PREDICTED: protein EFR3 homolog A isoform X2     59.3    5e-07   
dbj|BAA76797.1|  KIAA0953 protein                                     58.9    5e-07   
ref|XP_007899098.1|  PREDICTED: protein EFR3 homolog A isoform X1     58.9    5e-07   
ref|XP_007899099.1|  PREDICTED: protein EFR3 homolog A isoform X2     58.9    5e-07   
ref|XP_010152803.1|  PREDICTED: protein EFR3 homolog B                58.5    6e-07   
ref|XP_001689991.1|  predicted protein                                58.5    6e-07   
ref|XP_004359079.1|  hypothetical protein DFA_01104                   58.9    6e-07   
ref|XP_007899100.1|  PREDICTED: protein EFR3 homolog A isoform X3     58.9    6e-07   
gb|AAI08668.1|  EFR3A protein                                         58.9    6e-07   
ref|XP_005236710.1|  PREDICTED: protein EFR3 homolog B                58.9    6e-07   
ref|XP_005241441.1|  PREDICTED: LOW QUALITY PROTEIN: protein EFR3...  58.9    6e-07   
ref|XP_006634590.1|  PREDICTED: protein EFR3 homolog A-like           58.9    6e-07   
ref|XP_009581453.1|  PREDICTED: protein EFR3 homolog B                58.9    6e-07   
tpg|DAA24495.1|  TPA: hypothetical protein BOS_11938                  58.9    7e-07   
ref|XP_011484518.1|  PREDICTED: protein EFR3 homolog A isoform X4     58.5    7e-07   
ref|XP_005425765.1|  PREDICTED: protein EFR3 homolog A isoform X2     58.5    7e-07   
ref|XP_009893765.1|  PREDICTED: protein EFR3 homolog B                58.9    7e-07   
ref|XP_006910346.1|  PREDICTED: protein EFR3 homolog B                58.5    7e-07   
ref|XP_008841407.1|  PREDICTED: protein EFR3 homolog A                58.5    7e-07   
ref|XP_009643560.1|  PREDICTED: protein EFR3 homolog B                58.5    7e-07   
ref|XP_010866288.1|  PREDICTED: protein EFR3 homolog B-like           57.4    7e-07   
ref|XP_009465663.1|  PREDICTED: protein EFR3 homolog B                58.5    7e-07   
ref|XP_005400626.1|  PREDICTED: protein EFR3 homolog B                58.5    7e-07   
ref|XP_009814739.1|  PREDICTED: protein EFR3 homolog B                58.5    8e-07   
ref|XP_010012946.1|  PREDICTED: protein EFR3 homolog B                58.5    8e-07   
ref|XP_008286006.1|  PREDICTED: protein EFR3 homolog A                58.5    8e-07   
ref|XP_009987244.1|  PREDICTED: protein EFR3 homolog B                58.5    8e-07   
ref|XP_009562057.1|  PREDICTED: protein EFR3 homolog B                58.5    8e-07   
ref|XP_005146441.1|  PREDICTED: protein EFR3 homolog B                58.5    8e-07   
ref|XP_004464915.1|  PREDICTED: protein EFR3 homolog A isoform 1      58.5    8e-07   
ref|XP_006155594.1|  PREDICTED: protein EFR3 homolog A                58.5    8e-07   
ref|XP_010581479.1|  PREDICTED: protein EFR3 homolog B                58.5    8e-07   
ref|XP_006830773.1|  PREDICTED: protein EFR3 homolog A isoform X1     58.5    8e-07   
ref|XP_010891293.1|  PREDICTED: protein EFR3 homolog A isoform X1     58.5    8e-07   
ref|XP_003204639.2|  PREDICTED: protein EFR3 homolog B isoform X1     58.5    8e-07   



>ref|XP_009783972.1| PREDICTED: uncharacterized protein LOC104232454 [Nicotiana sylvestris]
Length=991

 Score =   293 bits (751),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SRKLFPAC +MCICCPA+RSRSRQPVKRYKKLLA+IFPK+PDGS N RKI+KLCEY
Sbjct  1    MGFISRKLFPACGNMCICCPAMRSRSRQPVKRYKKLLAEIFPKTPDGSPNDRKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKIAK LEERC+KELRS H K +NVIAEVYN+LLCMCKEQMACFA +LL++V
Sbjct  61   AAKNPFRIPKIAKYLEERCHKELRSEHIKFINVIAEVYNKLLCMCKEQMACFAASLLDMV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            VE+LD +K DA++ IGC T T+FIYSQVDGTYTYNIE LV KVCSLAR
Sbjct  121  VELLDDSKRDAIRIIGCQTLTRFIYSQVDGTYTYNIETLVPKVCSLAR  168



>ref|XP_009616023.1| PREDICTED: uncharacterized protein LOC104108647 [Nicotiana tomentosiformis]
Length=993

 Score =   293 bits (750),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SRKLFPAC +MCICCPA+RSRSRQPVKRYKKLLA+IFPK+PDGS N RKI+KLCEY
Sbjct  1    MGFISRKLFPACGNMCICCPAMRSRSRQPVKRYKKLLAEIFPKTPDGSPNDRKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKIAK LEERC+KELRS H K +NVIAEVYN+LLCMCKEQMACFA +LL++V
Sbjct  61   AAKNPFRIPKIAKYLEERCHKELRSEHIKFINVIAEVYNKLLCMCKEQMACFAASLLDMV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            VE+LD +K DA++ IGC T T+FIYSQVDGTYTYNIE LV KVCSLAR
Sbjct  121  VELLDDSKRDAIRIIGCQTLTRFIYSQVDGTYTYNIETLVPKVCSLAR  168



>ref|XP_004230310.1| PREDICTED: uncharacterized protein LOC101249681 [Solanum lycopersicum]
Length=988

 Score =   291 bits (745),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SRKLFPAC +MCICCPA+RSRSRQPVKRYKKLLA+IFPKSPDGS N RKI+KLCEY
Sbjct  1    MGFISRKLFPACGNMCICCPAMRSRSRQPVKRYKKLLAEIFPKSPDGSPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKIAK LEERCYKELRS H K +NVIAEVYN+LLCMCKEQMA FA +LL++V
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRSEHIKFINVIAEVYNKLLCMCKEQMAYFAASLLDMV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            VE+LD +K DAV+  GC T T+FIYSQVDGTYTYNIE LV KVCSLAR
Sbjct  121  VELLDDSKKDAVRITGCQTLTRFIYSQVDGTYTYNIETLVPKVCSLAR  168



>ref|XP_006344767.1| PREDICTED: uncharacterized protein LOC102580046 [Solanum tuberosum]
Length=993

 Score =   291 bits (745),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SRKLFPAC +MCICCPA+RSRSRQPVKRYKKLLA+IFPKSPDGS N RKI+KLCEY
Sbjct  1    MGFISRKLFPACGNMCICCPAMRSRSRQPVKRYKKLLAEIFPKSPDGSPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKIAK LEERCYKELRS H K +NVIAEVYN+LLCMCKEQMA FA +LL++V
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRSEHIKFINVIAEVYNKLLCMCKEQMAYFAASLLDMV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            VE+LD +K DAV+  GC T T+FIYSQVDGTYTYNIE LV KVCSLAR
Sbjct  121  VELLDDSKKDAVRITGCQTLTRFIYSQVDGTYTYNIETLVPKVCSLAR  168



>ref|XP_009373286.1| PREDICTED: uncharacterized protein LOC103962316 [Pyrus x bretschneideri]
Length=997

 Score =   281 bits (718),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRKLFPACESMCICCPA+RSRSRQPVKRYKKLLA+IFPKSPDG  N RKI+KLCEY
Sbjct  1    MGVISRKLFPACESMCICCPAMRSRSRQPVKRYKKLLAEIFPKSPDGPPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKIAK LE+RCYKELR  H K +N++ E YN+LLC+CKEQMACFAV+L++VV
Sbjct  61   AAKNPFRIPKIAKYLEDRCYKELRLEHIKFINIVVEAYNKLLCLCKEQMACFAVSLVHVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+LD +K DA++ +GC T T FIYSQ DGTYT+ IE+LV KVC LAR
Sbjct  121  TELLDNSKQDAMRILGCQTLTNFIYSQTDGTYTHTIESLVHKVCKLAR  168



>gb|KHG26707.1| Efr3b [Gossypium arboreum]
Length=1041

 Score =   281 bits (718),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 152/193 (79%), Gaps = 8/193 (4%)
 Frame = +3

Query  57   SRFCGSSSSPDLSL--------QGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKK  212
            S FCG  SS  LSL        + +MG +SRK+FPAC SMC+CCPALRSRSRQPVKRYKK
Sbjct  17   SEFCGLPSSVSLSLADLPVTAAEQEMGFISRKIFPACGSMCVCCPALRSRSRQPVKRYKK  76

Query  213  LLADIFPKSPDGSANGRKIMKLCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIA  392
            LL++IFPKSPD   N RKI+KLCEYAAKNPFRIPKIAK LEERCYKELR  H K +N++ 
Sbjct  77   LLSEIFPKSPDSPPNERKIVKLCEYAAKNPFRIPKIAKYLEERCYKELRYEHIKFINIVT  136

Query  393  EVYNELLCMCKEQMACFAVNLLNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYN  572
            E YN+LLCMCK QMA FAVNLLNVV E+LD +K DA++ +GC T T FIYSQVDGTYT++
Sbjct  137  EAYNKLLCMCKAQMAYFAVNLLNVVTELLDNSKQDAMRILGCETLTTFIYSQVDGTYTHS  196

Query  573  IENLVQKVCSLAR  611
            IE  V KVC LA 
Sbjct  197  IEKFVHKVCKLAH  209



>gb|KHG26706.1| Protein EFR3 B [Gossypium arboreum]
Length=1050

 Score =   281 bits (718),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 152/193 (79%), Gaps = 8/193 (4%)
 Frame = +3

Query  57   SRFCGSSSSPDLSL--------QGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKK  212
            S FCG  SS  LSL        + +MG +SRK+FPAC SMC+CCPALRSRSRQPVKRYKK
Sbjct  17   SEFCGLPSSVSLSLADLPVTAAEQEMGFISRKIFPACGSMCVCCPALRSRSRQPVKRYKK  76

Query  213  LLADIFPKSPDGSANGRKIMKLCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIA  392
            LL++IFPKSPD   N RKI+KLCEYAAKNPFRIPKIAK LEERCYKELR  H K +N++ 
Sbjct  77   LLSEIFPKSPDSPPNERKIVKLCEYAAKNPFRIPKIAKYLEERCYKELRYEHIKFINIVT  136

Query  393  EVYNELLCMCKEQMACFAVNLLNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYN  572
            E YN+LLCMCK QMA FAVNLLNVV E+LD +K DA++ +GC T T FIYSQVDGTYT++
Sbjct  137  EAYNKLLCMCKAQMAYFAVNLLNVVTELLDNSKQDAMRILGCETLTTFIYSQVDGTYTHS  196

Query  573  IENLVQKVCSLAR  611
            IE  V KVC LA 
Sbjct  197  IEKFVHKVCKLAH  209



>ref|XP_008370375.1| PREDICTED: uncharacterized protein LOC103433867 [Malus domestica]
Length=997

 Score =   279 bits (714),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MGL+SRKLFPACESMCICCPA+RSRSRQPVKRYKKLLA+IFPK+PDG  N RKI+KLCEY
Sbjct  1    MGLISRKLFPACESMCICCPAMRSRSRQPVKRYKKLLAEIFPKAPDGPPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKIAK LE+RCYKELR GH K +N++A+ YN+LLC+CKEQMACFAV+L++VV
Sbjct  61   AAKNPFRIPKIAKYLEDRCYKELRLGHIKFINIVADTYNKLLCLCKEQMACFAVSLVSVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+LD +K D V+ +GC T T FIYSQ D TYT+ IE+LV KVC LAR
Sbjct  121  TELLDNSKQDTVRILGCQTLTNFIYSQTDCTYTHTIESLVHKVCKLAR  168



>ref|XP_007031155.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY11657.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=1019

 Score =   278 bits (711),  Expect = 2e-83, Method: Composition-based stats.
 Identities = 125/168 (74%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SRK+FPAC SMC+CCPALRSRSRQPVKRYKKLL++IFPKSPD   N RKI KLCEY
Sbjct  1    MGFISRKIFPACGSMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPDAPPNERKIAKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKIAK LEERCYKELR  H K +N++ E Y++LLCMCKEQMA FAVNLLNVV
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRHEHIKFINIVTEAYHKLLCMCKEQMAYFAVNLLNVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+LD +K DA++ +GC T TKFIYSQ DGTYT+NIE  V KVC L+R
Sbjct  121  GELLDNSKQDAMRILGCQTLTKFIYSQADGTYTHNIEKFVPKVCKLSR  168



>emb|CDP18254.1| unnamed protein product [Coffea canephora]
Length=1034

 Score =   278 bits (711),  Expect = 2e-83, Method: Composition-based stats.
 Identities = 128/185 (69%), Positives = 153/185 (83%), Gaps = 1/185 (1%)
 Frame = +3

Query  57   SRFCGSSSSPDLSLQG-KMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFP  233
            S FCGS  SP L  Q  KMG +SRK+FPAC +MC+CCPALRSRSRQPVKRYKKLLADIFP
Sbjct  29   SSFCGSFYSPYLVSQARKMGFISRKVFPACGNMCVCCPALRSRSRQPVKRYKKLLADIFP  88

Query  234  KSPDGSANGRKIMKLCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELL  413
            KSPD  +N RK++KLCEYAAKNPFRIPKI K LE+RCYKELRS + K V ++ E YN+LL
Sbjct  89   KSPDSPSNERKVVKLCEYAAKNPFRIPKITKYLEDRCYKELRSQNIKFVEIVVEAYNKLL  148

Query  414  CMCKEQMACFAVNLLNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQK  593
             +CK+QMA FA+NLL++VVE+LD +K DAV+ IGC   T+FIYSQVDGTY+YN+E+LV K
Sbjct  149  SICKDQMAYFAINLLSLVVELLDESKQDAVRIIGCQMLTQFIYSQVDGTYSYNLESLVHK  208

Query  594  VCSLA  608
            V  +A
Sbjct  209  VSIIA  213



>gb|EYU40497.1| hypothetical protein MIMGU_mgv1a000785mg [Erythranthe guttata]
 gb|EYU40498.1| hypothetical protein MIMGU_mgv1a000785mg [Erythranthe guttata]
Length=987

 Score =   276 bits (707),  Expect = 5e-83, Method: Composition-based stats.
 Identities = 123/168 (73%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR +FPACESMC+CCPALRSRSRQPVKRYKKLLA+IFPK+PDG  N RKI+KLCEY
Sbjct  1    MGVISRNIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKTPDGHPNDRKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNPFRIPKIAK LEE+CYKELRSG+ KLV ++AE YN+LLC CK+Q A FAV+L+NVV
Sbjct  61   ASKNPFRIPKIAKYLEEKCYKELRSGNIKLVGIVAEAYNKLLCSCKDQTAYFAVSLVNVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            +E+LD +K D+V+ +GC T T F+Y QVDGTYT+NIEN V KVC LAR
Sbjct  121  IELLDESKQDSVQKMGCDTLTTFVYCQVDGTYTHNIENFVHKVCMLAR  168



>ref|XP_008359849.1| PREDICTED: uncharacterized protein LOC103423542 [Malus domestica]
 ref|XP_008359850.1| PREDICTED: uncharacterized protein LOC103423542 [Malus domestica]
Length=997

 Score =   276 bits (705),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRKLFPACESMCICCPA+RSRSRQPVKRYKKLLA+IFPKSPD   N RKI+KLCEY
Sbjct  1    MGVISRKLFPACESMCICCPAMRSRSRQPVKRYKKLLAEIFPKSPDCPPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKIAK LE+RCYKELR  H K +N++ E YN+LLC+CKEQMACFAV+L++VV
Sbjct  61   AAKNPFRIPKIAKYLEDRCYKELRLEHIKFINIVVEAYNKLLCLCKEQMACFAVSLVHVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+LD +K DA++ +GC T T FIYSQ DGTYT+ IE+LV KVC LAR
Sbjct  121  TELLDNSKQDAMRILGCQTLTNFIYSQTDGTYTHTIESLVHKVCKLAR  168



>gb|KJB81105.1| hypothetical protein B456_013G129500 [Gossypium raimondii]
Length=847

 Score =   274 bits (700),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+FPACESMC+CCPALRSRSRQPVKRYKKLL++IFPKSP    N RKI KLCEY
Sbjct  1    MGIISRKIFPACESMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPGAPPNERKITKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AA+NPFRIPKIAK LEERCYKELR  H K +N++ E YN+LLCMCKEQMA FAVNLLNVV
Sbjct  61   AARNPFRIPKIAKYLEERCYKELRYKHVKFINIVIEAYNKLLCMCKEQMAYFAVNLLNVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+LD +K +A + +GC T TKFIYSQ DGTYT+NIE  V KVC LA 
Sbjct  121  SELLDNSKQEATQILGCQTLTKFIYSQADGTYTHNIEKFVHKVCKLAH  168



>ref|XP_007208429.1| hypothetical protein PRUPE_ppa000798mg [Prunus persica]
 gb|EMJ09628.1| hypothetical protein PRUPE_ppa000798mg [Prunus persica]
Length=1000

 Score =   275 bits (704),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRKLFPACESMCICCPA+RSRSRQPVKRYKKLLA+IFPKSPDG  N RKI+KLCEY
Sbjct  1    MGIISRKLFPACESMCICCPAMRSRSRQPVKRYKKLLAEIFPKSPDGPPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKIAK LE+RCYKELR  H K +N++AE YN+LLC+CKEQMA FAV+LL+VV
Sbjct  61   AAKNPFRIPKIAKYLEDRCYKELRLEHVKFINIVAEAYNKLLCLCKEQMAYFAVSLLSVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+LD  K D ++ +GC T T+FI+SQ DGTYT+ IE+LV +VC LAR
Sbjct  121  TELLDNPKQDPLRILGCQTLTRFIFSQTDGTYTHTIESLVHRVCKLAR  168



>gb|KJB81106.1| hypothetical protein B456_013G129500 [Gossypium raimondii]
Length=870

 Score =   274 bits (700),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+FPACESMC+CCPALRSRSRQPVKRYKKLL++IFPKSP    N RKI KLCEY
Sbjct  1    MGIISRKIFPACESMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPGAPPNERKITKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AA+NPFRIPKIAK LEERCYKELR  H K +N++ E YN+LLCMCKEQMA FAVNLLNVV
Sbjct  61   AARNPFRIPKIAKYLEERCYKELRYKHVKFINIVIEAYNKLLCMCKEQMAYFAVNLLNVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+LD +K +A + +GC T TKFIYSQ DGTYT+NIE  V KVC LA 
Sbjct  121  SELLDNSKQEATQILGCQTLTKFIYSQADGTYTHNIEKFVHKVCKLAH  168



>ref|XP_007031156.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY11658.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=1000

 Score =   275 bits (704),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SRK+FPAC SMC+CCPALRSRSRQPVKRYKKLL++IFPKSPD   N RKI KLCEY
Sbjct  1    MGFISRKIFPACGSMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPDAPPNERKIAKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKIAK LEERCYKELR  H K +N++ E Y++LLCMCKEQMA FAVNLLNVV
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRHEHIKFINIVTEAYHKLLCMCKEQMAYFAVNLLNVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+LD +K DA++ +GC T TKFIYSQ DGTYT+NIE  V KVC L+R
Sbjct  121  GELLDNSKQDAMRILGCQTLTKFIYSQADGTYTHNIEKFVPKVCKLSR  168



>ref|XP_002318950.2| hypothetical protein POPTR_0013s00990g [Populus trichocarpa]
 gb|EEE94873.2| hypothetical protein POPTR_0013s00990g [Populus trichocarpa]
Length=994

 Score =   275 bits (703),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MGL+SR +FPACESMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG  N RKI+KLCEY
Sbjct  1    MGLISRNIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKSLDGHPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKIAK LEERCYKELRSGH K +N++ E YN+LLCMCK+QMA FA++LLNVV
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRSGHVKFINIVTEAYNKLLCMCKDQMAYFAISLLNVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+L+ +K D +  +GC T T+FIYSQ DGTY++NIE  V KVC+LAR
Sbjct  121  NELLEKSKQDPLMILGCQTLTRFIYSQADGTYSHNIEKFVHKVCNLAR  168



>ref|XP_008246002.1| PREDICTED: uncharacterized protein LOC103344152 [Prunus mume]
Length=999

 Score =   275 bits (704),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRKLFPACESMCICCPA+RSRSRQPVKRYKKLLA+IFPKSPDG  N RKI+KLCEY
Sbjct  1    MGIISRKLFPACESMCICCPAMRSRSRQPVKRYKKLLAEIFPKSPDGPPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKIAK LE+RCYKELR  H K +N++AE YN+LLC+CKEQMA FAV+LL+VV
Sbjct  61   AAKNPFRIPKIAKYLEDRCYKELRLEHIKFINIVAEAYNKLLCLCKEQMAYFAVSLLSVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+LD  K D +  +GC T T+FIYSQ DGTYT+ IE+LV +VC LAR
Sbjct  121  TELLDNPKQDPLGILGCQTLTRFIYSQTDGTYTHTIESLVHRVCKLAR  168



>gb|KJB45453.1| hypothetical protein B456_007G306600 [Gossypium raimondii]
 gb|KJB45454.1| hypothetical protein B456_007G306600 [Gossypium raimondii]
Length=1000

 Score =   275 bits (703),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SRK+FPAC SMC+CCPALRSRSRQPVKRYKKLL++IFPKSPD   N RKI+KLCEY
Sbjct  1    MGFISRKIFPACGSMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPDSPPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKIAK LEERCYKELR  H K +N++ E YN+LLCMCK QMA FAVNLLNVV
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRYEHIKFINIVTEAYNKLLCMCKAQMAYFAVNLLNVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+LD +K DA++ +GC T T FIYSQVDGTYT++IE  V KVC LAR
Sbjct  121  TELLDNSKQDAMRILGCETLTSFIYSQVDGTYTHSIEKFVHKVCKLAR  168



>gb|KHG02153.1| Protein EFR3 [Gossypium arboreum]
Length=999

 Score =   275 bits (702),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+FPACESMC+CCPALRSRSRQPVKRYKKLL++IFPKSP    N RKI KLCEY
Sbjct  1    MGIISRKIFPACESMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPGAPPNERKITKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AA+NPFRIPKIAK LEERCYKELR  H K +N++ E YN+LLCMCKEQMA FAVNLLNVV
Sbjct  61   AARNPFRIPKIAKYLEERCYKELRYKHVKFINIVTEAYNKLLCMCKEQMAYFAVNLLNVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+LD +K +A + +GC T TKFIYSQ DGTYT+NIE  V KVC LA 
Sbjct  121  SELLDNSKQEATQILGCQTLTKFIYSQADGTYTHNIEKFVHKVCKLAH  168



>gb|KJB81104.1| hypothetical protein B456_013G129500 [Gossypium raimondii]
Length=996

 Score =   274 bits (701),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+FPACESMC+CCPALRSRSRQPVKRYKKLL++IFPKSP    N RKI KLCEY
Sbjct  1    MGIISRKIFPACESMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPGAPPNERKITKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AA+NPFRIPKIAK LEERCYKELR  H K +N++ E YN+LLCMCKEQMA FAVNLLNVV
Sbjct  61   AARNPFRIPKIAKYLEERCYKELRYKHVKFINIVIEAYNKLLCMCKEQMAYFAVNLLNVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+LD +K +A + +GC T TKFIYSQ DGTYT+NIE  V KVC LA 
Sbjct  121  SELLDNSKQEATQILGCQTLTKFIYSQADGTYTHNIEKFVHKVCKLAH  168



>ref|XP_011023781.1| PREDICTED: uncharacterized protein LOC105125162 [Populus euphratica]
 ref|XP_011023783.1| PREDICTED: uncharacterized protein LOC105125162 [Populus euphratica]
 ref|XP_011023784.1| PREDICTED: uncharacterized protein LOC105125162 [Populus euphratica]
Length=994

 Score =   273 bits (699),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MGL+SR +FPACESMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG  N RKI+KLCEY
Sbjct  1    MGLISRNIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKSLDGHPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKIAK LEERC+KELRSGH K +N++ E YN+LLCMCK+QMA FA++LLNVV
Sbjct  61   AAKNPFRIPKIAKYLEERCFKELRSGHVKFINIVTEAYNKLLCMCKDQMAYFAISLLNVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLA  608
             E+LD +K D +  +GC T T+FIYSQ DGTY++NIE  V KVC+LA
Sbjct  121  NELLDKSKQDPLMILGCQTLTRFIYSQADGTYSHNIEKFVHKVCNLA  167



>ref|XP_011092150.1| PREDICTED: uncharacterized protein LOC105172430 [Sesamum indicum]
Length=995

 Score =   271 bits (694),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+FPACESMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG +N RKI+KLCEY
Sbjct  1    MGVISRKIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKSHDGQSNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKIAK LEERCYKELRSG+ + V+++AE YN+LLC+CKEQMA F+ NLLN+V
Sbjct  61   ASKNPLRIPKIAKYLEERCYKELRSGNIRFVSIVAETYNKLLCICKEQMAYFSFNLLNMV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            +E+LD +K DA+  IGC T T FIY Q+DGTYT NIEN V KVC LAR
Sbjct  121  IELLDDSKQDALLIIGCDTLTTFIYCQMDGTYTRNIENFVDKVCMLAR  168



>ref|XP_004302237.1| PREDICTED: uncharacterized protein LOC101313033 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=1003

 Score =   271 bits (693),  Expect = 4e-81, Method: Composition-based stats.
 Identities = 121/167 (72%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+FPAC +MC+CCPA+RSRSRQPVKRYKKLLA+IFPKSPDG +N RKI+KLCEY
Sbjct  1    MGIISRKIFPACGNMCVCCPAMRSRSRQPVKRYKKLLAEIFPKSPDGPSNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKIAK LE+RCYKELR  H K +N++AE YN+LLC+CK QMA FA ++LNVV
Sbjct  61   AAKNPFRIPKIAKHLEDRCYKELRLEHVKFINIVAEAYNKLLCLCKNQMAYFAGSVLNVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLA  608
             E+LD +K DA++ IGC T T+FI SQ DGTYT+NIE+LV KVC LA
Sbjct  121  TELLDNSKQDALRIIGCQTLTRFISSQTDGTYTHNIESLVHKVCELA  167



>ref|XP_011466140.1| PREDICTED: uncharacterized protein LOC101313033 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=1004

 Score =   271 bits (693),  Expect = 5e-81, Method: Composition-based stats.
 Identities = 121/167 (72%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+FPAC +MC+CCPA+RSRSRQPVKRYKKLLA+IFPKSPDG +N RKI+KLCEY
Sbjct  1    MGIISRKIFPACGNMCVCCPAMRSRSRQPVKRYKKLLAEIFPKSPDGPSNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKIAK LE+RCYKELR  H K +N++AE YN+LLC+CK QMA FA ++LNVV
Sbjct  61   AAKNPFRIPKIAKHLEDRCYKELRLEHVKFINIVAEAYNKLLCLCKNQMAYFAGSVLNVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLA  608
             E+LD +K DA++ IGC T T+FI SQ DGTYT+NIE+LV KVC LA
Sbjct  121  TELLDNSKQDALRIIGCQTLTRFISSQTDGTYTHNIESLVHKVCELA  167



>gb|KDP23388.1| hypothetical protein JCGZ_23221 [Jatropha curcas]
Length=997

 Score =   269 bits (688),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 143/168 (85%), Gaps = 1/168 (1%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MGL+SRK+FPACESMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG  N RKI+KLCEY
Sbjct  1    MGLISRKIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKS-DGPPNERKIVKLCEY  59

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKIAK LEERCYKELRS H K +N++ E Y++LLCMCKEQM  FA++LLNVV
Sbjct  60   AAKNPFRIPKIAKYLEERCYKELRSEHIKFINIVTETYDKLLCMCKEQMVYFAISLLNVV  119

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+LD  + DA+  +GC T T+FI+SQ DGTYT+NIE  V KVC LAR
Sbjct  120  SELLDKPRQDALLILGCQTLTRFIFSQTDGTYTHNIEKFVHKVCKLAR  167



>emb|CAN82509.1| hypothetical protein VITISV_012725 [Vitis vinifera]
Length=1471

 Score =   272 bits (695),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 149/182 (82%), Gaps = 1/182 (1%)
 Frame = +3

Query  69   GSSSSPDLSLQGK-MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPD  245
            G  + PDL  QGK MG +SR++FPAC SMC+CCPALRSRSRQPVKRYKKLLA+IFPKS D
Sbjct  451  GVFAPPDLPPQGKEMGFISRRIFPACGSMCVCCPALRSRSRQPVKRYKKLLAEIFPKSID  510

Query  246  GSANGRKIMKLCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCK  425
            G  N RKI+KLCEYAAKNPFRIPKIAK LEERCYKELR  H K + ++ E YN+LLCMCK
Sbjct  511  GPPNERKIVKLCEYAAKNPFRIPKIAKYLEERCYKELRCEHIKFIAIVTEAYNKLLCMCK  570

Query  426  EQMACFAVNLLNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSL  605
            +QMA FAV+LLNVV E+LD  K DA++ +GC T T+FIY Q D TYT+NIEN V+KVC L
Sbjct  571  DQMAYFAVSLLNVVSELLDKPKKDAMRILGCQTLTRFIYCQADSTYTHNIENFVRKVCML  630

Query  606  AR  611
            AR
Sbjct  631  AR  632



>ref|XP_002512512.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49964.1| conserved hypothetical protein [Ricinus communis]
Length=972

 Score =   268 bits (684),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 143/169 (85%), Gaps = 1/169 (1%)
 Frame = +3

Query  105  KMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCE  284
            +MG +SRK+FPACESMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG  N RKI+KLCE
Sbjct  46   EMGFVSRKIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKS-DGPPNERKIVKLCE  104

Query  285  YAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNV  464
            YAAKNPFRIPKIAK LEERC KELRS H K +N + E YN+LLC+CKEQMA FAV+LLNV
Sbjct  105  YAAKNPFRIPKIAKYLEERCCKELRSEHIKFINTVTETYNKLLCVCKEQMAYFAVSLLNV  164

Query  465  VVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            V E+LD  K DA+  +GC T T+FIYSQ DGTYT+NIE  VQKVC LAR
Sbjct  165  VSELLDKPKQDALLILGCQTLTRFIYSQTDGTYTHNIEKFVQKVCKLAR  213



>ref|XP_010546763.1| PREDICTED: uncharacterized protein LOC104818746 [Tarenaya hassleriana]
Length=989

 Score =   266 bits (681),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SR++FPACESMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG+ N RKI+KLCEY
Sbjct  1    MGFISRRVFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKSLDGAPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AA+NP RIPKIAK LEERCYKELRS   K ++++ E YN++LC+CKEQMA FA ++L+VV
Sbjct  61   AARNPLRIPKIAKFLEERCYKELRSEQIKFISIVTEAYNKMLCLCKEQMAYFATSVLSVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+LD +K D+ K +GC T T+FIYSQVDG+YT+NIEN V KVCSLA 
Sbjct  121  TELLDNSKQDSTKMLGCQTLTRFIYSQVDGSYTHNIENFVHKVCSLAH  168



>ref|XP_006394914.1| hypothetical protein EUTSA_v10003593mg [Eutrema salsugineum]
 gb|ESQ32200.1| hypothetical protein EUTSA_v10003593mg [Eutrema salsugineum]
Length=976

 Score =   265 bits (678),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SR +FPACESMC+CCPALRSRSRQPVKRYKKLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNIFPACESMCVCCPALRSRSRQPVKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+LD +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLAR
Sbjct  121  TELLDNSKQDTPTILGCQTLTRFIYSQVDGTYTHSIEKFAHKVCSLAR  168



>ref|XP_006394915.1| hypothetical protein EUTSA_v10003593mg [Eutrema salsugineum]
 gb|ESQ32201.1| hypothetical protein EUTSA_v10003593mg [Eutrema salsugineum]
Length=983

 Score =   265 bits (678),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SR +FPACESMC+CCPALRSRSRQPVKRYKKLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNIFPACESMCVCCPALRSRSRQPVKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+LD +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLAR
Sbjct  121  TELLDNSKQDTPTILGCQTLTRFIYSQVDGTYTHSIEKFAHKVCSLAR  168



>ref|XP_010024133.1| PREDICTED: uncharacterized protein LOC104414673 [Eucalyptus grandis]
 gb|KCW60561.1| hypothetical protein EUGRSUZ_H03293 [Eucalyptus grandis]
Length=993

 Score =   265 bits (677),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SRK+FPAC SMC+CCPA+RSRSRQPVKRYKKLLADIFPKSPDGS N RKI KLCEY
Sbjct  1    MGFISRKIFPACGSMCVCCPAMRSRSRQPVKRYKKLLADIFPKSPDGSPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKI K LEERCYKELRS H K +N+  E YN+LL MCKEQM  FAV+LL VV
Sbjct  61   AAKNPFRIPKIVKYLEERCYKELRSEHIKFINIAVEAYNKLLSMCKEQMVYFAVSLLTVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+LD  K D+++ +GC T TKFIYSQ D TY +NIE  V KVC LA+
Sbjct  121  SELLDNGKQDSLQILGCQTLTKFIYSQSDSTYAHNIEKFVHKVCILAQ  168



>gb|AAB61061.1| Hypothetical protein F2P16.24 [Arabidopsis thaliana]
Length=907

 Score =   264 bits (674),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 138/168 (82%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SR +FPACESMCICCPALRSRSRQPVKRYKKLL +IFPKSPDG  N RKI+KLCEY
Sbjct  1    MGFISRNVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPDGGPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+LD +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLAR
Sbjct  121  TELLDNSKQDTPTILGCQTLTRFIYSQVDGTYTHSIEKFALKVCSLAR  168



>ref|XP_006433539.1| hypothetical protein CICLE_v10000144mg [Citrus clementina]
 gb|ESR46779.1| hypothetical protein CICLE_v10000144mg [Citrus clementina]
Length=999

 Score =   265 bits (676),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SRK+FPAC SMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG  N RKI+KLCEY
Sbjct  1    MGFISRKIFPACGSMCVCCPALRSRSRQPVKRYKKLLAEIFPKSIDGPPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKIAK LEERCYKELR  H KL+N++ E YN++LCMCK QMA FAV+LLNV 
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRCEHIKLINIVTEAYNKMLCMCKVQMAYFAVSLLNVA  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLA  608
             E+LD +K + V+ +GC T ++FIYSQ DGTYT+NIE  V+KVC LA
Sbjct  121  TELLDNSKQETVQILGCQTLSRFIYSQADGTYTHNIEKFVKKVCKLA  167



>dbj|BAC41892.1| unknown protein [Arabidopsis thaliana]
 gb|AAQ89612.1| At5g26850 [Arabidopsis thaliana]
Length=970

 Score =   264 bits (674),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 138/168 (82%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SR +FPACESMCICCPALRSRSRQPVKRYKKLL +IFPKSPDG  N RKI+KLCEY
Sbjct  1    MGFISRNVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPDGGPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+LD +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLAR
Sbjct  121  TELLDNSKQDTPTILGCQTLTRFIYSQVDGTYTHSIEKFALKVCSLAR  168



>ref|NP_198037.3| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001031947.2| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001031948.2| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001190405.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AED93613.1| uncharacterized protein AT5G26850 [Arabidopsis thaliana]
 gb|AED93614.1| uncharacterized protein AT5G26850 [Arabidopsis thaliana]
 gb|AED93615.1| uncharacterized protein AT5G26850 [Arabidopsis thaliana]
 gb|AED93616.1| uncharacterized protein AT5G26850 [Arabidopsis thaliana]
Length=983

 Score =   264 bits (674),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 138/168 (82%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SR +FPACESMCICCPALRSRSRQPVKRYKKLL +IFPKSPDG  N RKI+KLCEY
Sbjct  1    MGFISRNVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPDGGPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+LD +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLAR
Sbjct  121  TELLDNSKQDTPTILGCQTLTRFIYSQVDGTYTHSIEKFALKVCSLAR  168



>ref|XP_002282109.1| PREDICTED: uncharacterized protein LOC100264846 [Vitis vinifera]
 ref|XP_010659702.1| PREDICTED: uncharacterized protein LOC100264846 [Vitis vinifera]
 emb|CBI39597.3| unnamed protein product [Vitis vinifera]
Length=1002

 Score =   264 bits (674),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SR++FPAC SMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG  N RKI+KLCEY
Sbjct  1    MGFISRRIFPACGSMCVCCPALRSRSRQPVKRYKKLLAEIFPKSIDGPPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKIAK LEERCYKELR  H K + ++ E YN+LLCMCK+QMA FAV+LLNVV
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRCEHIKFIAIVTEAYNKLLCMCKDQMAYFAVSLLNVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+LD  K DA++ +GC T T+FIY Q D TYT+NIEN V+KVC LAR
Sbjct  121  SELLDKPKKDAMRILGCQTLTRFIYCQADSTYTHNIENFVRKVCMLAR  168



>ref|XP_002872241.1| hypothetical protein ARALYDRAFT_489516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48500.1| hypothetical protein ARALYDRAFT_489516 [Arabidopsis lyrata subsp. 
lyrata]
Length=983

 Score =   263 bits (673),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SR +FPACESMC+CCPALRSRSRQPVKRYKKLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNVFPACESMCVCCPALRSRSRQPVKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+LD +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLAR
Sbjct  121  TELLDNSKQDTPTILGCQTLTRFIYSQVDGTYTHSIEKFALKVCSLAR  168



>ref|XP_006472204.1| PREDICTED: uncharacterized protein LOC102623618 [Citrus sinensis]
Length=1000

 Score =   262 bits (670),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SRK+FPAC SMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG  N RKI+KLCEY
Sbjct  1    MGFISRKIFPACGSMCVCCPALRSRSRQPVKRYKKLLAEIFPKSIDGPPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKIAK LEERCYKELR  H KL+N++ E YN++LCMCK QMA FAV+LLNV 
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRCEHIKLINIVTEAYNKMLCMCKVQMAYFAVSLLNVA  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLA  608
             E+LD +K + V+ +GC T ++FIYSQ D TYT+NIE  V+KVC LA
Sbjct  121  TELLDNSKQETVQILGCQTLSRFIYSQADSTYTHNIEKFVKKVCKLA  167



>ref|XP_010493942.1| PREDICTED: protein EFR3 homolog B-like isoform X2 [Camelina sativa]
Length=984

 Score =   261 bits (666),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SR +FPACESMCICCPALRSRSRQPVKRYKKLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+L+ +K D    +GC T T+FIYSQVDGTYT++IE    KVC+LAR
Sbjct  121  TELLENSKLDTPTILGCQTLTRFIYSQVDGTYTHSIEKFALKVCALAR  168



>ref|XP_010455044.1| PREDICTED: uncharacterized protein LOC104736707 [Camelina sativa]
 ref|XP_010455045.1| PREDICTED: uncharacterized protein LOC104736707 [Camelina sativa]
Length=984

 Score =   261 bits (666),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SR +FPACESMCICCPALRSRSRQPVKRYKKLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPDGTPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+L+ +K D    +GC T T+FIYSQVDGTYT++IE    KVC+LAR
Sbjct  121  TELLENSKLDTPTILGCQTLTRFIYSQVDGTYTHSIEKFALKVCALAR  168



>ref|XP_010421542.1| PREDICTED: uncharacterized protein LOC104706999 isoform X2 [Camelina 
sativa]
Length=984

 Score =   260 bits (665),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SR +FPACESMCICCPALRSRSRQPVKRYKKLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+L+ +K D    +GC T T+FIYSQVDGTYT++IE    KVC+LAR
Sbjct  121  TELLENSKLDTPTILGCQTLTRFIYSQVDGTYTHSIEKFTLKVCALAR  168



>gb|KEH43106.1| cyclin-like protein [Medicago truncatula]
Length=997

 Score =   260 bits (664),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+FPACESMC+CCPALRSRSRQPVKRY+KLLADIFPKSPD   N RKI+KLCEY
Sbjct  1    MGVISRKIFPACESMCVCCPALRSRSRQPVKRYRKLLADIFPKSPDELPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKIAK LEERCYKELRS H KLV +IAE +N+LL +CK Q+  FAV++LNV 
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRSEHIKLVKIIAESFNKLLSICKAQITYFAVDVLNVT  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+LD +K +A++ +GC + T+FIY QVD TYT+NIE LV+KVC L++
Sbjct  121  SELLDYSKDEAIQALGCQSLTRFIYCQVDSTYTHNIEKLVRKVCMLSQ  168



>ref|XP_004495652.1| PREDICTED: uncharacterized protein LOC101508441 isoform X1 [Cicer 
arietinum]
 ref|XP_004495653.1| PREDICTED: uncharacterized protein LOC101508441 isoform X2 [Cicer 
arietinum]
 ref|XP_004495654.1| PREDICTED: uncharacterized protein LOC101508441 isoform X3 [Cicer 
arietinum]
 ref|XP_004495655.1| PREDICTED: uncharacterized protein LOC101508441 isoform X4 [Cicer 
arietinum]
Length=994

 Score =   257 bits (656),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+FPAC SMC+CCPALRSRSRQPVKRY+KLL DIFPKSPD   N RKI+KLCEY
Sbjct  1    MGIISRKIFPACGSMCVCCPALRSRSRQPVKRYRKLLVDIFPKSPDELPNERKIIKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKIAK LEERCYKELRS H KLV ++AE +N+LL MCK Q+A FAV++LNV+
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRSEHIKLVKIVAESFNKLLSMCKVQIAYFAVDVLNVI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+L  +K + ++T+GC + T+FIY QVD TYT+NIE LV+KVC L++
Sbjct  121  SELLGYSKDETIQTLGCQSLTRFIYCQVDATYTHNIEKLVRKVCMLSQ  168



>ref|XP_009111721.1| PREDICTED: protein EFR3 homolog B-like [Brassica rapa]
Length=982

 Score =   256 bits (653),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SR +FPACE+MC+CCPALR RS+ P KRYKKLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNVFPACETMCVCCPALRPRSKHPAKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKILEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+L+ +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLAR
Sbjct  121  TELLENSKEDTPTILGCQTLTRFIYSQVDGTYTHSIEKFAHKVCSLAR  168



>ref|XP_010493940.1| PREDICTED: protein EFR3 homolog B-like isoform X1 [Camelina sativa]
 ref|XP_010493941.1| PREDICTED: protein EFR3 homolog B-like isoform X1 [Camelina sativa]
Length=986

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 139/170 (82%), Gaps = 2/170 (1%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSP--DGSANGRKIMKLC  281
            MG +SR +FPACESMCICCPALRSRSRQPVKRYKKLL +IFPKSP  DG+ N RKI+KLC
Sbjct  1    MGFISRNVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPVSDGAPNERKIVKLC  60

Query  282  EYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLN  461
            EYAAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLN
Sbjct  61   EYAAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLN  120

Query  462  VVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            VV E+L+ +K D    +GC T T+FIYSQVDGTYT++IE    KVC+LAR
Sbjct  121  VVTELLENSKLDTPTILGCQTLTRFIYSQVDGTYTHSIEKFALKVCALAR  170



>emb|CDX87029.1| BnaC09g03440D [Brassica napus]
Length=982

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SR +FPACE+MC+CCPALR RS+ P KRYKKLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNVFPACETMCVCCPALRPRSKHPAKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKILEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+L+ +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLAR
Sbjct  121  TELLENSKEDTPTILGCQTLTRFIYSQVDGTYTHSIEKFAHKVCSLAR  168



>ref|XP_010267985.1| PREDICTED: uncharacterized protein LOC104605067 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267986.1| PREDICTED: uncharacterized protein LOC104605067 isoform X1 [Nelumbo 
nucifera]
Length=1001

 Score =   254 bits (649),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SRK+ P C +MC+CCPALRSRSRQP KRYKKLL++IFPKS DG  N RKI+KLCEY
Sbjct  1    MGFISRKVLPVCGNMCVCCPALRSRSRQPTKRYKKLLSEIFPKSLDGPPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A++NP RIPKIAK LE+R YKELRS H K VNVI E YN+LLCMCKEQMA FA++LLNVV
Sbjct  61   ASRNPIRIPKIAKYLEQRIYKELRSEHIKFVNVIMEAYNKLLCMCKEQMAYFALSLLNVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLA  608
            +E+LD  K D V+ +GC    +FIYSQ D TYT+NIE LV KVCSLA
Sbjct  121  IELLDNTKQDVVRILGCQILARFIYSQADSTYTHNIEGLVHKVCSLA  167



>ref|XP_010267987.1| PREDICTED: uncharacterized protein LOC104605067 isoform X2 [Nelumbo 
nucifera]
Length=989

 Score =   254 bits (648),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SRK+ P C +MC+CCPALRSRSRQP KRYKKLL++IFPKS DG  N RKI+KLCEY
Sbjct  1    MGFISRKVLPVCGNMCVCCPALRSRSRQPTKRYKKLLSEIFPKSLDGPPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A++NP RIPKIAK LE+R YKELRS H K VNVI E YN+LLCMCKEQMA FA++LLNVV
Sbjct  61   ASRNPIRIPKIAKYLEQRIYKELRSEHIKFVNVIMEAYNKLLCMCKEQMAYFALSLLNVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLA  608
            +E+LD  K D V+ +GC    +FIYSQ D TYT+NIE LV KVCSLA
Sbjct  121  IELLDNTKQDVVRILGCQILARFIYSQADSTYTHNIEGLVHKVCSLA  167



>emb|CDY19753.1| BnaA09g04060D [Brassica napus]
Length=982

 Score =   253 bits (646),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SR +FPACE+MC+CCPALR RS+ P KRYKKLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNVFPACETMCVCCPALRPRSKHPAKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKIAK LEE+CYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKILEEKCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+L+ +K D    +GC T T+FIY+QVDGTYT++IE    KVCSLAR
Sbjct  121  TELLENSKEDTPTILGCQTLTRFIYNQVDGTYTHSIEKFAHKVCSLAR  168



>gb|KHN23227.1| Protein EFR3 like cmp44E [Glycine soja]
Length=896

 Score =   252 bits (644),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+FPAC +MC+CCPALRSRSRQPVKRY+KLLADIFPKSPD S + RKI KLCEY
Sbjct  1    MGVISRKIFPACGNMCVCCPALRSRSRQPVKRYRKLLADIFPKSPDESPSERKITKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKIAK LEERCYKELR  H KLVN+IAE +N+LL +CK Q+A FAV++LNV+
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRYEHLKLVNIIAESFNKLLSICKVQIAYFAVDVLNVI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            +E+L  +K + ++T+GC   +KFIY Q+D TYT+NIE LV KVC L+R
Sbjct  121  LELLSYSKDETIQTLGCQCLSKFIYCQMDATYTHNIEKLVPKVCMLSR  168



>ref|XP_003555181.1| PREDICTED: uncharacterized protein LOC100788290 [Glycine max]
Length=995

 Score =   253 bits (646),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+FPAC +MC+CCPALRSRSRQPVKRY+KLLADIFPKSPD S + RKI KLCEY
Sbjct  1    MGVISRKIFPACGNMCVCCPALRSRSRQPVKRYRKLLADIFPKSPDESPSERKITKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKIAK LEERCYKELR  H KLVN+IAE +N+LL +CK Q+A FAV++LNV+
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRYEHIKLVNIIAESFNKLLSICKVQIAYFAVDVLNVI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            +E+L  +K + ++T+GC   +KFIY Q+D TYT+NIE LV KVC L+R
Sbjct  121  LELLSYSKDETIQTLGCQCLSKFIYCQMDATYTHNIEKLVPKVCMLSR  168



>ref|XP_006589118.1| PREDICTED: uncharacterized protein LOC100785587 isoform X3 [Glycine 
max]
 gb|KHN16056.1| Protein EFR3 like A [Glycine soja]
Length=996

 Score =   251 bits (642),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+FPAC +MC+CCPALRSRSRQPVKRY+KLLADIFPKSPD   + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGNMCVCCPALRSRSRQPVKRYRKLLADIFPKSPDEPPSERKIIKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKIAK LEERCYKELRS H KLVN+IAE +N+LL +CK Q+A FAV++LNV+
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRSEHIKLVNIIAESFNKLLSICKVQIAYFAVDVLNVI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            +E+L  +K + ++T+GC   ++FIY QVD TYT++IE LV+KVC L++
Sbjct  121  LELLSYSKDETIQTLGCQCLSRFIYCQVDATYTHSIEKLVRKVCMLSQ  168



>ref|XP_003536043.1| PREDICTED: uncharacterized protein LOC100785587 isoform X1 [Glycine 
max]
 ref|XP_006589117.1| PREDICTED: uncharacterized protein LOC100785587 isoform X2 [Glycine 
max]
Length=997

 Score =   251 bits (642),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+FPAC +MC+CCPALRSRSRQPVKRY+KLLADIFPKSPD   + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGNMCVCCPALRSRSRQPVKRYRKLLADIFPKSPDEPPSERKIIKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKIAK LEERCYKELRS H KLVN+IAE +N+LL +CK Q+A FAV++LNV+
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRSEHIKLVNIIAESFNKLLSICKVQIAYFAVDVLNVI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            +E+L  +K + ++T+GC   ++FIY QVD TYT++IE LV+KVC L++
Sbjct  121  LELLSYSKDETIQTLGCQCLSRFIYCQVDATYTHSIEKLVRKVCMLSQ  168



>ref|XP_008778937.1| PREDICTED: protein EFR3 homolog cmp44E-like [Phoenix dactylifera]
Length=352

 Score =   236 bits (602),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 135/167 (81%), Gaps = 0/167 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SRK+ PAC +MC+CCPALR  SR+PVKRYKKLLA+IFPK+ DG+ N RKIMKLCEY
Sbjct  1    MGFMSRKILPACGNMCVCCPALRPSSRRPVKRYKKLLAEIFPKNLDGTPNERKIMKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKIAK LE+R YKELRS H   V +I EVY++LL +CKEQMA FA++LLNV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSYKELRSEHINFVKIITEVYSKLLYICKEQMAYFAISLLNVI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLA  608
            +E+LD  + D+V+ +GC T TKFI SQ D TY  NIE LV+KVC LA
Sbjct  121  IELLDNKQRDSVQILGCQTLTKFICSQADSTYARNIECLVRKVCVLA  167



>ref|XP_010092978.1| hypothetical protein L484_018915 [Morus notabilis]
 gb|EXB53031.1| hypothetical protein L484_018915 [Morus notabilis]
Length=1022

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 144/188 (77%), Gaps = 20/188 (11%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+FPAC SMC+CCPALRS SR+PVKRYKKLLA+IFPKS DG  + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGSMCVCCPALRSSSRKPVKRYKKLLAEIFPKSLDGPPSERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A++NP RIPKIAK LEERCYKELR  H K +N++ + Y++LLC+CKEQMA FAV+LLNV+
Sbjct  61   ASRNPVRIPKIAKYLEERCYKELRCEHIKFINIVTDTYSKLLCLCKEQMAYFAVSLLNVI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQV--------------------DGTYTYNIENLV  587
             E+LD +K DAV+ +GC T T+FIYSQ+                    DGTYT+NIE+ V
Sbjct  121  NELLDNSKQDAVRILGCQTLTRFIYSQIFVVIDFYHELMFNGLMYEQADGTYTHNIESFV  180

Query  588  QKVCSLAR  611
             KVC LAR
Sbjct  181  HKVCLLAR  188



>ref|XP_007145003.1| hypothetical protein PHAVU_007G201500g [Phaseolus vulgaris]
 gb|ESW16997.1| hypothetical protein PHAVU_007G201500g [Phaseolus vulgaris]
Length=999

 Score =   244 bits (623),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+FPAC +MC+CCPALRSRSRQPVKRY+KLLADIFPKSPD   + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGNMCVCCPALRSRSRQPVKRYRKLLADIFPKSPDEPPSDRKIIKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKIAK LEERC +EL+S H K+VN+I E +N+LL +CK Q+A FAV++LNV+
Sbjct  61   AAKNPFRIPKIAKYLEERCSRELKSEHIKMVNIIMESFNKLLSICKVQIAYFAVDVLNVI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+L  +K + ++T+GC   ++FIY QVD TYTYNIE LV+KV  L+R
Sbjct  121  SEILSYSKDETIQTLGCQCLSRFIYCQVDSTYTYNIEKLVRKVSMLSR  168



>ref|XP_009384437.1| PREDICTED: uncharacterized protein LOC103971984 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=997

 Score =   244 bits (623),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SRKL PAC +MC+CCPAL   SR+PVKRYKKLLA++FPK+ DG  N RKIMKLCEY
Sbjct  1    MGFISRKLLPACGNMCVCCPALNPSSRRPVKRYKKLLAEVFPKNLDGLPNERKIMKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AA+NP RIPKIAK LE+RCYKELR+ H   V +I EVY++LL +CKEQMA FA++LL+V+
Sbjct  61   AARNPIRIPKIAKYLEQRCYKELRNEHINFVKIITEVYSKLLYICKEQMAYFAISLLDVI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            +E+LD  + D +K +GC T T+FI SQ D TYT+NIE LVQKVC LAR
Sbjct  121  IELLDSKQQDGIKILGCQTLTRFICSQADNTYTWNIEGLVQKVCMLAR  168



>ref|XP_009384434.1| PREDICTED: uncharacterized protein LOC103971984 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384435.1| PREDICTED: uncharacterized protein LOC103971984 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384436.1| PREDICTED: uncharacterized protein LOC103971984 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=998

 Score =   244 bits (623),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SRKL PAC +MC+CCPAL   SR+PVKRYKKLLA++FPK+ DG  N RKIMKLCEY
Sbjct  1    MGFISRKLLPACGNMCVCCPALNPSSRRPVKRYKKLLAEVFPKNLDGLPNERKIMKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AA+NP RIPKIAK LE+RCYKELR+ H   V +I EVY++LL +CKEQMA FA++LL+V+
Sbjct  61   AARNPIRIPKIAKYLEQRCYKELRNEHINFVKIITEVYSKLLYICKEQMAYFAISLLDVI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            +E+LD  + D +K +GC T T+FI SQ D TYT+NIE LVQKVC LAR
Sbjct  121  IELLDSKQQDGIKILGCQTLTRFICSQADNTYTWNIEGLVQKVCMLAR  168



>ref|XP_008808672.1| PREDICTED: uncharacterized protein LOC103720646 isoform X2 [Phoenix 
dactylifera]
Length=986

 Score =   243 bits (619),  Expect = 6e-71, Method: Composition-based stats.
 Identities = 111/167 (66%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MGL+SRK+ PAC +MC+C PALR  SR+PVKRYKKLLA+IFPK+ DG  N RKI+KLCEY
Sbjct  1    MGLMSRKILPACGNMCVCFPALRPSSRRPVKRYKKLLAEIFPKTLDGPPNERKIIKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKIAK LE+R YKELR  H   V +I EVY++LL +CKEQMA FA++LLNV+
Sbjct  61   AAKNPVRIPKIAKFLEQRSYKELRCAHINFVKIITEVYSKLLYICKEQMAYFAISLLNVI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLA  608
            +E+LD  + D+++ +GC TFTKFIYSQ D TY  NIE+LV+KVC LA
Sbjct  121  IELLDSKQQDSIQILGCQTFTKFIYSQADNTYARNIESLVRKVCMLA  167



>gb|ABF95548.1| cyclin, putative, expressed [Oryza sativa Japonica Group]
Length=729

 Score =   240 bits (612),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 136/168 (81%), Gaps = 1/168 (1%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +S KLFP+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK+PDG  N RKIMKLCEY
Sbjct  1    MGFMSAKLFPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGLPNERKIMKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKIAK LE+R +KELRS H   + +I E Y++LL +CKEQMA FA++L+NV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSHKELRSAHVNFIKIITEAYSKLLFICKEQMAYFAISLVNVL  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+L+ +K + +  +GC T  KFIYSQVD TY  NIE+LV+KVC L+R
Sbjct  121  TELLE-SKQENIHILGCQTLAKFIYSQVDNTYARNIESLVRKVCVLSR  167



>ref|XP_008808671.1| PREDICTED: uncharacterized protein LOC103720646 isoform X1 [Phoenix 
dactylifera]
Length=994

 Score =   242 bits (617),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MGL+SRK+ PAC +MC+C PALR  SR+PVKRYKKLLA+IFPK+ DG  N RKI+KLCEY
Sbjct  1    MGLMSRKILPACGNMCVCFPALRPSSRRPVKRYKKLLAEIFPKTLDGPPNERKIIKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKIAK LE+R YKELR  H   V +I EVY++LL +CKEQMA FA++LLNV+
Sbjct  61   AAKNPVRIPKIAKFLEQRSYKELRCAHINFVKIITEVYSKLLYICKEQMAYFAISLLNVI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            +E+LD  + D+++ +GC TFTKFIYSQ D TY  NIE+LV+KVC LA 
Sbjct  121  IELLDSKQQDSIQILGCQTFTKFIYSQADNTYARNIESLVRKVCMLAH  168



>ref|XP_010674649.1| PREDICTED: protein EFR3 homolog A [Beta vulgaris subsp. vulgaris]
Length=998

 Score =   242 bits (617),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 135/168 (80%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRKLFPAC SMC+CCPALRSRSRQPVKRYKKL+ADIFPKSPDG  N RK++KLCEY
Sbjct  1    MGIISRKLFPACGSMCVCCPALRSRSRQPVKRYKKLIADIFPKSPDGQTNERKLVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKI K LEE+ ++ELR GH K+V ++ E Y++LLCMC +QMA FA +LL + 
Sbjct  61   AAKNPVRIPKITKQLEEKFFRELRYGHLKIVGIVMEAYDKLLCMCGKQMAYFAASLLLLS  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+LD +K  +V+ +GC T T+FIYSQ DGTY  NI   V KVC LA+
Sbjct  121  DEVLDQSKEVSVQVVGCQTLTRFIYSQTDGTYARNIGTFVNKVCMLAK  168



>ref|XP_008781115.1| PREDICTED: uncharacterized protein LOC103700980 isoform X2 [Phoenix 
dactylifera]
Length=993

 Score =   241 bits (616),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 112/167 (67%), Positives = 135/167 (81%), Gaps = 0/167 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SRK+ PAC +MC+CCPALR  SR+PVKRYKKLLA+IFPK+ DG+ N RKIMKLCEY
Sbjct  1    MGFMSRKILPACGNMCVCCPALRPSSRRPVKRYKKLLAEIFPKNLDGTPNERKIMKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKIAK LE+R YKELRS H   V +I EVY++LL +CKEQMA FA++LLNV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSYKELRSEHINFVKIITEVYSKLLYICKEQMAYFAISLLNVI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLA  608
            +E+LD  + D+V+ +GC T TKFI SQ D TY  NIE LV+KVC LA
Sbjct  121  IELLDNKQRDSVQILGCQTLTKFICSQADSTYARNIECLVRKVCVLA  167



>ref|XP_008453377.1| PREDICTED: uncharacterized protein LOC103494111 [Cucumis melo]
 ref|XP_008453385.1| PREDICTED: uncharacterized protein LOC103494111 [Cucumis melo]
 ref|XP_008453393.1| PREDICTED: uncharacterized protein LOC103494111 [Cucumis melo]
 ref|XP_008453402.1| PREDICTED: uncharacterized protein LOC103494111 [Cucumis melo]
Length=995

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+FPAC +MCICCPALRSRSRQPVKRYKKLLADIFPKS DG  + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGNMCICCPALRSRSRQPVKRYKKLLADIFPKSLDGPQSERKIIKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKI K LE+RC KELR+   K + +IA+ YN+LL +CK QMA FA +LL V+
Sbjct  61   AAKNPFRIPKIVKYLEDRCCKELRNEQVKCITIIADAYNKLLSLCKNQMAYFAGSLLKVI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLA  608
            VE+LD AK D ++ +GC T T FI++Q D TY +N+ENLV KVC LA
Sbjct  121  VELLDNAKHDDLRILGCQTLTNFIHNQADSTYMHNVENLVPKVCMLA  167



>ref|XP_010938250.1| PREDICTED: uncharacterized protein LOC105057345 isoform X1 [Elaeis 
guineensis]
Length=1003

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 135/168 (80%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SRK+ PACE+MC+CCPALR  SR+PVKRYKKLL++IFPK+ DG  N RKI+KLCEY
Sbjct  1    MGFISRKILPACENMCVCCPALRPSSRRPVKRYKKLLSEIFPKTLDGPPNERKIIKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AA+NP RIPKIAK LE+R YKELR GH   V +I E Y++LL +CKEQMA FA++LLNV+
Sbjct  61   AARNPVRIPKIAKFLEQRSYKELRCGHINFVKIITEAYSKLLYVCKEQMAYFAISLLNVI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            +E+LD  +   V+ +GC TFTKFIYSQ D TY  NIE+LVQKVC L+ 
Sbjct  121  IELLDSKQQVRVQILGCQTFTKFIYSQADNTYARNIESLVQKVCMLSH  168



>ref|XP_010938251.1| PREDICTED: uncharacterized protein LOC105057345 isoform X2 [Elaeis 
guineensis]
Length=993

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 135/168 (80%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SRK+ PACE+MC+CCPALR  SR+PVKRYKKLL++IFPK+ DG  N RKI+KLCEY
Sbjct  1    MGFISRKILPACENMCVCCPALRPSSRRPVKRYKKLLSEIFPKTLDGPPNERKIIKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AA+NP RIPKIAK LE+R YKELR GH   V +I E Y++LL +CKEQMA FA++LLNV+
Sbjct  61   AARNPVRIPKIAKFLEQRSYKELRCGHINFVKIITEAYSKLLYVCKEQMAYFAISLLNVI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            +E+LD  +   V+ +GC TFTKFIYSQ D TY  NIE+LVQKVC L+ 
Sbjct  121  IELLDSKQQVRVQILGCQTFTKFIYSQADNTYARNIESLVQKVCMLSH  168



>ref|XP_006649970.1| PREDICTED: uncharacterized protein LOC102701065 [Oryza brachyantha]
Length=984

 Score =   241 bits (614),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 137/168 (82%), Gaps = 1/168 (1%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +S KLFP+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK+PDG  N RKIMKLCEY
Sbjct  1    MGFMSAKLFPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGPPNERKIMKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKIAK LE+R +KELR+ H   V +I E Y++LL +CKEQMA FA++L+NV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSHKELRAAHVNFVKIITEAYSKLLFICKEQMAYFAISLVNVL  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+L+ +K + +  +GC T  KFIYSQVD TY  NIE+LV+KVC+L+R
Sbjct  121  TELLE-SKQENIHILGCQTLAKFIYSQVDNTYARNIESLVRKVCALSR  167



>ref|XP_010921489.1| PREDICTED: uncharacterized protein LOC105045026 [Elaeis guineensis]
Length=992

 Score =   240 bits (613),  Expect = 4e-70, Method: Composition-based stats.
 Identities = 110/167 (66%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SRK+ PAC +MC+CCPALR  SR+PVKRYKKLLA+IFPK+ DG  N RKIMKLCEY
Sbjct  1    MGFISRKILPACGNMCVCCPALRPSSRRPVKRYKKLLAEIFPKNLDGPPNERKIMKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKIAK LE+R YKELRS H   V +I E Y++LL +CKEQMA FA+ LLNV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSYKELRSEHINFVKIITETYSKLLYICKEQMAYFAIGLLNVI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLA  608
            +E+LD  + D+V+ +GC T  KFIYSQ D TY  NIE+LV  VC LA
Sbjct  121  IELLDNKQRDSVQILGCQTLAKFIYSQADSTYARNIESLVGNVCVLA  167



>ref|NP_001049903.1| Os03g0308200 [Oryza sativa Japonica Group]
 gb|ABF95547.1| cyclin, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF11817.1| Os03g0308200 [Oryza sativa Japonica Group]
 dbj|BAG93123.1| unnamed protein product [Oryza sativa Japonica Group]
Length=988

 Score =   239 bits (610),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 136/168 (81%), Gaps = 1/168 (1%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +S KLFP+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK+PDG  N RKIMKLCEY
Sbjct  1    MGFMSAKLFPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGLPNERKIMKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKIAK LE+R +KELRS H   + +I E Y++LL +CKEQMA FA++L+NV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSHKELRSAHVNFIKIITEAYSKLLFICKEQMAYFAISLVNVL  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+L+ +K + +  +GC T  KFIYSQVD TY  NIE+LV+KVC L+R
Sbjct  121  TELLE-SKQENIHILGCQTLAKFIYSQVDNTYARNIESLVRKVCVLSR  167



>ref|XP_004165925.1| PREDICTED: uncharacterized LOC101202927 [Cucumis sativus]
Length=995

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 135/167 (81%), Gaps = 0/167 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+FPAC ++CICCPALRSRSRQPVKRYKKLLADIFPKS DG  + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGNICICCPALRSRSRQPVKRYKKLLADIFPKSLDGPQSERKIIKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKI K LE+RC KELRS   K + +IA+ YN+LL +CK QMA FA +LL V+
Sbjct  61   AAKNPFRIPKIVKYLEDRCCKELRSEQVKCITIIADAYNKLLSLCKNQMAYFAGSLLKVI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLA  608
            VE+LD AK D ++ +GC T T FI++Q D TY + +ENLV KVC LA
Sbjct  121  VELLDNAKHDDLRILGCQTLTNFIHNQADSTYMHTVENLVPKVCMLA  167



>ref|XP_004144747.1| PREDICTED: uncharacterized protein LOC101202927 [Cucumis sativus]
 gb|KGN61004.1| hypothetical protein Csa_2G034570 [Cucumis sativus]
Length=995

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 135/167 (81%), Gaps = 0/167 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+FPAC ++CICCPALRSRSRQPVKRYKKLLADIFPKS DG  + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGNICICCPALRSRSRQPVKRYKKLLADIFPKSLDGPQSERKIIKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKI K LE+RC KELRS   K + +IA+ YN+LL +CK QMA FA +LL V+
Sbjct  61   AAKNPFRIPKIVKYLEDRCCKELRSEQVKCITIIADAYNKLLSLCKNQMAYFAGSLLKVI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLA  608
            VE+LD AK D ++ +GC T T FI++Q D TY + +ENLV KVC LA
Sbjct  121  VELLDNAKHDDLRILGCQTLTNFIHNQADSTYMHTVENLVPKVCMLA  167



>ref|XP_008781114.1| PREDICTED: protein EFR3 homolog cmp44E-like isoform X1 [Phoenix 
dactylifera]
Length=1013

 Score =   238 bits (608),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 135/167 (81%), Gaps = 0/167 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SRK+ PAC +MC+CCPALR  SR+PVKRYKKLLA+IFPK+ DG+ N RKIMKLCEY
Sbjct  1    MGFMSRKILPACGNMCVCCPALRPSSRRPVKRYKKLLAEIFPKNLDGTPNERKIMKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKIAK LE+R YKELRS H   V +I EVY++LL +CKEQMA FA++LLNV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSYKELRSEHINFVKIITEVYSKLLYICKEQMAYFAISLLNVI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLA  608
            +E+LD  + D+V+ +GC T TKFI SQ D TY  NIE LV+KVC LA
Sbjct  121  IELLDNKQRDSVQILGCQTLTKFICSQADSTYARNIECLVRKVCVLA  167



>ref|XP_006840435.1| hypothetical protein AMTR_s00045p00164850 [Amborella trichopoda]
 gb|ERN02110.1| hypothetical protein AMTR_s00045p00164850 [Amborella trichopoda]
Length=1003

 Score =   238 bits (606),  Expect = 4e-69, Method: Composition-based stats.
 Identities = 109/168 (65%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SR++FP C S+C+CCPALRSRSRQPVKRYKKLL+DIFPKS DG  N R+I KLCEY
Sbjct  1    MGFISRRVFPVCGSICVCCPALRSRSRQPVKRYKKLLSDIFPKSLDGPPNERRITKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNPFRIPKIAK LE+R +KEL   H K + +I + +N+LL MCKEQM  FA+ LLNV+
Sbjct  61   AAKNPFRIPKIAKFLEQRSHKELHCDHFKYIEIIMQAFNKLLSMCKEQMPYFAIYLLNVI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             + LD ++   ++ +GC T T FIYSQ DGTYT+NIE LV+KVC LAR
Sbjct  121  SDHLDQSRPVTIQILGCQTLTNFIYSQADGTYTHNIEGLVRKVCVLAR  168



>ref|XP_004984608.1| PREDICTED: uncharacterized protein LOC101782956 [Setaria italica]
Length=992

 Score =   236 bits (601),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 134/168 (80%), Gaps = 1/168 (1%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG LS KL P+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK+PDG+ N RKIMKLCEY
Sbjct  1    MGFLSAKLLPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGAPNERKIMKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKIAK LE+R +KELRS H   V +I E Y++LL +CKEQMA FA++L+NV+
Sbjct  61   AAKNPLRIPKIAKFLEQRTHKELRSAHVSFVRIITEAYSKLLFICKEQMAYFAISLMNVL  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+L+ +K + +  +GC T   FI SQVD TY  NIE+LV+KVC L+R
Sbjct  121  TELLE-SKQENIHILGCQTLANFINSQVDNTYARNIESLVRKVCGLSR  167



>ref|XP_002465372.1| hypothetical protein SORBIDRAFT_01g037420 [Sorghum bicolor]
 gb|EER92370.1| hypothetical protein SORBIDRAFT_01g037420 [Sorghum bicolor]
Length=981

 Score =   235 bits (599),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 134/168 (80%), Gaps = 1/168 (1%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG LS KL P+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK+PDG+ N RKI+KLCEY
Sbjct  1    MGFLSAKLLPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGAPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKIAK LE+R +KELRS H   V +I E Y++LL +CKEQMA FA++L+NV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSHKELRSAHVNFVRIITEAYSKLLSICKEQMAYFAISLVNVL  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+L+ +K + +  +GC T   FI SQVD TY  NIE+LV KVC+L+R
Sbjct  121  TELLE-SKQENIHILGCQTLANFINSQVDNTYARNIESLVHKVCALSR  167



>ref|XP_003558072.1| PREDICTED: uncharacterized protein LOC100831072 isoform X2 [Brachypodium 
distachyon]
Length=994

 Score =   234 bits (596),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 133/168 (79%), Gaps = 1/168 (1%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +  KLFP+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK PDG  N RKIMKLCEY
Sbjct  1    MGFMGAKLFPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKMPDGPPNERKIMKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKIAK LE+R  KELR+ H   V +I E Y++LL +CKEQMA FA++L+NV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSRKELRAAHVNYVKIITEAYSKLLFICKEQMAYFAISLVNVL  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             ++L+ +K + +  +GC T  KFIYSQVD TY  N+E+LV KVC+L+R
Sbjct  121  TDLLE-SKQENIHILGCQTLAKFIYSQVDNTYARNVESLVHKVCTLSR  167



>ref|XP_010228707.1| PREDICTED: uncharacterized protein LOC100831072 isoform X1 [Brachypodium 
distachyon]
Length=995

 Score =   234 bits (596),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 133/168 (79%), Gaps = 1/168 (1%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +  KLFP+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK PDG  N RKIMKLCEY
Sbjct  1    MGFMGAKLFPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKMPDGPPNERKIMKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKIAK LE+R  KELR+ H   V +I E Y++LL +CKEQMA FA++L+NV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSRKELRAAHVNYVKIITEAYSKLLFICKEQMAYFAISLVNVL  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             ++L+ +K + +  +GC T  KFIYSQVD TY  N+E+LV KVC+L+R
Sbjct  121  TDLLE-SKQENIHILGCQTLAKFIYSQVDNTYARNVESLVHKVCTLSR  167



>ref|XP_008646153.1| PREDICTED: uncharacterized protein LOC100384293 isoform X2 [Zea 
mays]
 tpg|DAA45028.1| TPA: hypothetical protein ZEAMMB73_794622 [Zea mays]
Length=982

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 134/168 (80%), Gaps = 1/168 (1%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG LS KL P+CES+C+CCPALR  SR+PVKRYKKLLA+IFPK+PDG+ N RKI+KLCEY
Sbjct  1    MGFLSAKLLPSCESVCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGAPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKIAK LE+R +KELRS H   V +I E Y++LL +CKEQMA FA++L+NV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSHKELRSAHVNFVRIITEAYSKLLFICKEQMAYFAISLVNVL  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+L+ +K + V  +GC T   FI SQVD TY  NIE+LV KVC+L+R
Sbjct  121  TELLE-SKQENVHILGCQTLANFINSQVDNTYARNIESLVHKVCALSR  167



>ref|XP_010094723.1| hypothetical protein L484_003597 [Morus notabilis]
 gb|EXB56843.1| hypothetical protein L484_003597 [Morus notabilis]
Length=570

 Score =   226 bits (577),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+FPAC SMC+CCPALRS SR+PVKRYKKLLA+IFPKS DG  + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGSMCVCCPALRSSSRKPVKRYKKLLAEIFPKSLDGPPSERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A++NP RIPKIAK LEERCYKELR  H K +N++ + Y++LLC+CKEQMA FAV+LLNV+
Sbjct  61   ASRNPVRIPKIAKYLEERCYKELRCEHIKFINIVTDTYSKLLCLCKEQMAYFAVSLLNVI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIE  578
             E+LD +K DAV+ +GC T T+FIYSQ+      N E
Sbjct  121  NELLDNSKKDAVRILGCQTLTRFIYSQIVHVILDNYE  157



>ref|XP_008646145.1| PREDICTED: uncharacterized protein LOC100384293 isoform X1 [Zea 
mays]
Length=983

 Score =   228 bits (582),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 134/169 (79%), Gaps = 2/169 (1%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG LS KL P+CES+C+CCPALR  SR+PVKRYKKLLA+IFPK+PDG+ N RKI+KLCEY
Sbjct  1    MGFLSAKLLPSCESVCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGAPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKIAK LE+R +KELRS H   V +I E Y++LL +CKEQMA FA++L+NV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSHKELRSAHVNFVRIITEAYSKLLFICKEQMAYFAISLVNVL  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYS-QVDGTYTYNIENLVQKVCSLAR  611
             E+L+ +K + V  +GC T   FI S QVD TY  NIE+LV KVC+L+R
Sbjct  121  TELLE-SKQENVHILGCQTLANFINSQQVDNTYARNIESLVHKVCALSR  168



>emb|CDX80597.1| BnaC07g28470D [Brassica napus]
Length=951

 Score =   228 bits (580),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 127/168 (76%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SR +FPACE + +CCPA   RS  PVKRYK LL DIFPKSPDG++N RKI+KLCEY
Sbjct  1    MGFISRTVFPACERVFVCCPAYGPRSLHPVKRYKILLLDIFPKSPDGASNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP  IPKIAKCLE  CYK+LRS   K +NV+ E YN +L  CK+ MA FA++LLNVV
Sbjct  61   AAKNPVHIPKIAKCLENMCYKDLRSRQMKFINVVTEAYNNMLFHCKDHMAYFAMSLLNVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+L  +K DA   +GC T T+FIY+QVD TYT++IE    +VCSLAR
Sbjct  121  TELLVNSKQDAPTILGCQTLTRFIYTQVDRTYTHSIEKFAHRVCSLAR  168



>emb|CDX88246.1| BnaA06g28370D [Brassica napus]
Length=963

 Score =   228 bits (580),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 128/168 (76%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SR +FPACE + +CCPAL  RS  PVKRYK LL DIFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRTVFPACERVFVCCPALGPRSLHPVKRYKLLLLDIFPKSPDGAPNERKIIKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP  IPKIAKCLE+ CYK+LRS   K + ++ E YN +L  CK+QM+ FA++LLNVV
Sbjct  61   AAKNPVHIPKIAKCLEKMCYKDLRSHQMKFIIIVTEAYNSMLFHCKDQMSYFAMSLLNVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+L  +K D    +GC T T+FIYSQVDGTYT+++E   +KVCSL R
Sbjct  121  TELLVNSKQDTPTILGCQTLTRFIYSQVDGTYTHSLEKFARKVCSLVR  168



>ref|XP_009151505.1| PREDICTED: uncharacterized protein LOC103874824 [Brassica rapa]
Length=767

 Score =   225 bits (573),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 127/168 (76%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +SR +FPACE + +CCPA   RS  PVKRYK LL DIFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRTVFPACERVFVCCPAYGPRSLHPVKRYKLLLLDIFPKSPDGAPNERKIVKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP  IPKIAKCLE+ CYK+LRS   K + ++ E YN +L  CK+QM+ FA++LLNVV
Sbjct  61   AAKNPVHIPKIAKCLEKMCYKDLRSHQMKFIIIVTEAYNSMLFHCKDQMSYFAMSLLNVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             E+L  +K D    +GC T T+FIYSQVDGTYT+++E   +KVCSL R
Sbjct  121  TELLVNSKQDTPTILGCQTLTRFIYSQVDGTYTHSLEKFARKVCSLVR  168



>ref|XP_009765963.1| PREDICTED: protein EFR3 homolog cmp44E-like [Nicotiana sylvestris]
 ref|XP_009765964.1| PREDICTED: protein EFR3 homolog cmp44E-like [Nicotiana sylvestris]
 ref|XP_009765965.1| PREDICTED: protein EFR3 homolog cmp44E-like [Nicotiana sylvestris]
 ref|XP_009765966.1| PREDICTED: protein EFR3 homolog cmp44E-like [Nicotiana sylvestris]
Length=214

 Score =   204 bits (518),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+ PAC ++C  CP+LR+RSRQPVKRYKKLLA+IFPKS D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGNLCFLCPSLRARSRQPVKRYKKLLAEIFPKSQDAEPNDRKIAKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNPFRIPKI + LE+RCYK+LR+ H   V V+  +Y +LL  CKE M  +A +LL ++
Sbjct  61   ASKNPFRIPKITEYLEQRCYKDLRNEHLGSVKVVTVIYRKLLSSCKEHMPLYATSLLGII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              + +  + D ++ +GC T   FI  Q+DGTY +N+E L+ K+C LAR
Sbjct  121  RTLFEQTQHDEMQILGCNTLVDFINWQMDGTYMFNLEGLIPKMCQLAR  168



>ref|XP_009405043.1| PREDICTED: uncharacterized protein LOC103988214 [Musa acuminata 
subsp. malaccensis]
Length=1022

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 124/168 (74%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+ PAC ++C  CP+LR+RSRQPVKRYKKLLADIFP S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPACGNLCFFCPSLRARSRQPVKRYKKLLADIFPHSQDEEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
             ++NP RIPKI   LE+RCY+ELR+ H   V V+  +Y +LL  C+EQM  FA +LL+++
Sbjct  61   TSRNPLRIPKITNYLEQRCYRELRNEHFGYVKVVMRIYWKLLIACREQMPLFASSLLSII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              + D ++ D ++ IGC T   F+ SQVDGTY +N+E L+ ++CSLA+
Sbjct  121  HTLFDQSRHDEMQIIGCHTLFDFVNSQVDGTYQFNLEGLIPRLCSLAQ  168



>ref|XP_004250744.1| PREDICTED: uncharacterized protein LOC101250362 isoform X2 [Solanum 
lycopersicum]
Length=993

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRYKKLL +IFPKS D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGSLCFFCPSLRARSRQPVKRYKKLLGEIFPKSQDAEPNDRKIAKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A++NP RIPKI + LE+RCYK+LR+ H   V V+  +Y +LL  CKEQM  +A +LL ++
Sbjct  61   ASRNPLRIPKITEYLEQRCYKDLRNEHLGSVKVVTMIYRKLLSSCKEQMPLYAASLLGII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              + +  + D ++ +GC T   FI SQ+DGTY +N+E L+ K+C LAR
Sbjct  121  RTLFEQTQHDEMQILGCNTLVDFINSQMDGTYMFNLEGLIPKLCQLAR  168



>ref|XP_010313082.1| PREDICTED: uncharacterized protein LOC101250362 isoform X1 [Solanum 
lycopersicum]
Length=994

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRYKKLL +IFPKS D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGSLCFFCPSLRARSRQPVKRYKKLLGEIFPKSQDAEPNDRKIAKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A++NP RIPKI + LE+RCYK+LR+ H   V V+  +Y +LL  CKEQM  +A +LL ++
Sbjct  61   ASRNPLRIPKITEYLEQRCYKDLRNEHLGSVKVVTMIYRKLLSSCKEQMPLYAASLLGII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              + +  + D ++ +GC T   FI SQ+DGTY +N+E L+ K+C LAR
Sbjct  121  RTLFEQTQHDEMQILGCNTLVDFINSQMDGTYMFNLEGLIPKLCQLAR  168



>ref|XP_006352099.1| PREDICTED: uncharacterized protein LOC102584417 isoform X2 [Solanum 
tuberosum]
Length=999

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRYKKLL +IFPKS D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGSLCFFCPSLRARSRQPVKRYKKLLGEIFPKSQDAEPNDRKIAKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A++NP RIPKI + LE+RCYK+LR+ H   V V+  +Y +LL  CKEQM  +A +LL ++
Sbjct  61   ASRNPLRIPKITEYLEQRCYKDLRNEHLGSVKVVTMIYRKLLSSCKEQMPLYAASLLGII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              + +  + D ++ +GC T   FI SQ+DGTY +N+E L+ K+C LAR
Sbjct  121  RTLFEQTQHDEMQILGCNTLVDFINSQMDGTYMFNLEGLIPKLCQLAR  168



>ref|XP_006352098.1| PREDICTED: uncharacterized protein LOC102584417 isoform X1 [Solanum 
tuberosum]
Length=1000

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRYKKLL +IFPKS D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGSLCFFCPSLRARSRQPVKRYKKLLGEIFPKSQDAEPNDRKIAKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A++NP RIPKI + LE+RCYK+LR+ H   V V+  +Y +LL  CKEQM  +A +LL ++
Sbjct  61   ASRNPLRIPKITEYLEQRCYKDLRNEHLGSVKVVTMIYRKLLSSCKEQMPLYAASLLGII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              + +  + D ++ +GC T   FI SQ+DGTY +N+E L+ K+C LAR
Sbjct  121  RTLFEQTQHDEMQILGCNTLVDFINSQMDGTYMFNLEGLIPKLCQLAR  168



>ref|XP_009625867.1| PREDICTED: protein EFR3 homolog isoform X2 [Nicotiana tomentosiformis]
Length=924

 Score =   206 bits (523),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+ PAC ++C  CP+LR+RSRQPVKRYKKLLA+IFPKS D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGNLCFFCPSLRARSRQPVKRYKKLLAEIFPKSQDAEPNDRKIAKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNPFRIPKI + LE+RCYK+LR+ H   V V+  +Y +LL  CKE M  +A +LL ++
Sbjct  61   ASKNPFRIPKITEYLEQRCYKDLRNEHLGSVKVVTVIYRKLLSSCKEHMPLYATSLLGII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              + +  + D ++ +GC T   FI  Q+DGTY +N+E L+ K+C LAR
Sbjct  121  RTLFEQTQHDEMQILGCNTLVDFINCQMDGTYMFNLEGLIPKMCQLAR  168



>ref|XP_009625862.1| PREDICTED: protein EFR3 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625864.1| PREDICTED: protein EFR3 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625865.1| PREDICTED: protein EFR3 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625866.1| PREDICTED: protein EFR3 homolog isoform X1 [Nicotiana tomentosiformis]
Length=993

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+ PAC ++C  CP+LR+RSRQPVKRYKKLLA+IFPKS D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGNLCFFCPSLRARSRQPVKRYKKLLAEIFPKSQDAEPNDRKIAKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNPFRIPKI + LE+RCYK+LR+ H   V V+  +Y +LL  CKE M  +A +LL ++
Sbjct  61   ASKNPFRIPKITEYLEQRCYKDLRNEHLGSVKVVTVIYRKLLSSCKEHMPLYATSLLGII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              + +  + D ++ +GC T   FI  Q+DGTY +N+E L+ K+C LAR
Sbjct  121  RTLFEQTQHDEMQILGCNTLVDFINCQMDGTYMFNLEGLIPKMCQLAR  168



>ref|XP_008798151.1| PREDICTED: uncharacterized protein LOC103713119 [Phoenix dactylifera]
Length=1043

 Score =   206 bits (523),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 92/168 (55%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+ PAC  +C  CPALR+RSRQPVKRYKKLL +IFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPACGRLCFFCPALRARSRQPVKRYKKLLVEIFPRTQDEEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A++NP RIPKI   LE+RCY+ELR+ H     +I  +Y++LL  C+EQM  FA +LL+VV
Sbjct  61   ASRNPLRIPKITSYLEQRCYRELRNEHFSFAKIIMCIYHKLLLTCREQMPLFATSLLSVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ IGC T   F+ SQVDGTY +N+E L+ ++C LA+
Sbjct  121  HTLLDQTRQDEMQIIGCQTLFDFVNSQVDGTYQFNLEGLIPRLCHLAQ  168



>ref|XP_010932401.1| PREDICTED: uncharacterized protein LOC105053077 isoform X1 [Elaeis 
guineensis]
Length=797

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 122/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRYKKLL+DIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPACGSLCFFCPSLRARSRQPVKRYKKLLSDIFPRSQDEEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI   LE+RCYKELR  H   V V+  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITNYLEQRCYKELRIEHFGSVKVVMCIYRKLLISCKEQMPLFASSLLTII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ IG  TF  F+ SQ DGTY +N+E ++ K+C LA+
Sbjct  121  CTLLDQTRQDEMRIIGSHTFFDFVNSQRDGTYMFNLEGIIPKLCYLAQ  168



>gb|KDO53678.1| hypothetical protein CISIN_1g0359231mg, partial [Citrus sinensis]
Length=194

 Score =   191 bits (485),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 120/167 (72%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SRK+ PAC  +C  CPA+R+RSRQPVKRYKKL++DIFP++ D   N RKI KLCEYA
Sbjct  6    GVISRKVLPACGRLCFFCPAMRARSRQPVKRYKKLISDIFPRNQDEGPNDRKIGKLCEYA  65

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
             KNP RIPKI   LE+RCYKELR+ + +   ++  +Y +LL  CKEQM  FA +LL ++ 
Sbjct  66   NKNPLRIPKITTSLEQRCYKELRNENFQSAKIVMCIYRKLLISCKEQMPLFASSLLTIIH  125

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD  + D ++ IGC+T   F+ +Q DGTY +N+E  + K+C LA+
Sbjct  126  TLLDQTRQDEIQIIGCMTLFDFVNNQKDGTYMFNLECFIPKLCQLAQ  172



>ref|XP_009393518.1| PREDICTED: uncharacterized protein LOC103979184 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009393521.1| PREDICTED: uncharacterized protein LOC103979184 [Musa acuminata 
subsp. malaccensis]
Length=1021

 Score =   205 bits (521),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 122/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ PAC ++C  CP+LR+RSRQPVKRYKKLL D+FP+SPDG  N R I KLCEY
Sbjct  1    MGVMSRRVLPACGNLCCFCPSLRARSRQPVKRYKKLLTDVFPRSPDGQPNDRMIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI   LE+RCYKELR+G      V+  +Y +LL  CKEQM  +A +LL++V
Sbjct  61   ASKNPMRIPKITNYLEQRCYKELRNGQFNSAKVVPCIYRKLLASCKEQMPLYATSLLSIV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ +GCLT   F+ +QVD TY +N+E  + K+C L +
Sbjct  121  RTLLDQTQQDDMRILGCLTLVDFLNNQVDSTYMFNVEGFIPKLCQLGQ  168



>ref|XP_006838291.1| hypothetical protein AMTR_s00103p00108190 [Amborella trichopoda]
 gb|ERN00860.1| hypothetical protein AMTR_s00103p00108190 [Amborella trichopoda]
Length=1044

 Score =   204 bits (520),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 122/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+ PAC  +C  CP+LR+RSRQPVKRYKKLLADIFPKS D   N RKI KLCEY
Sbjct  1    MGIMSRKVLPACGRLCFFCPSLRARSRQPVKRYKKLLADIFPKSQDEEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP R+PKIA  LE+RCYKELR  H     V+  +Y +LL  CKEQM   A +LL+V+
Sbjct  61   ASKNPLRVPKIADYLEQRCYKELRIEHFGFAKVVMCIYRKLLFSCKEQMPLLASSLLSVI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ +GC T   F+ +Q+DGTY +N+E+ V K+C LA+
Sbjct  121  RTLLDQTRQDDMRVLGCQTLVDFVNNQMDGTYMFNLESFVPKLCQLAQ  168



>ref|XP_006858684.1| hypothetical protein AMTR_s00066p00085830 [Amborella trichopoda]
 gb|ERN20151.1| hypothetical protein AMTR_s00066p00085830 [Amborella trichopoda]
Length=1020

 Score =   203 bits (517),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ P C S+C  CP+LR+RSRQPVKRYKKLLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRRVLPVCGSLCFFCPSLRARSRQPVKRYKKLLADIFPRSQDAEPNDRKICKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKI K LE+RCY+ELR+ H   V V+  +Y +LL   KEQM  FA +LL+++
Sbjct  61   AAKNPLRIPKITKYLEQRCYRELRNEHFGSVKVVLCIYRKLLASSKEQMPLFASSLLSII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + D +  +GC T   FI SQVDGTY +N+E L+ K+C L++
Sbjct  121  RTLLEQTQQDEMLILGCNTLVDFINSQVDGTYMFNLEGLIPKLCQLSQ  168



>ref|XP_011457274.1| PREDICTED: uncharacterized protein LOC101313176 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=984

 Score =   202 bits (515),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 90/168 (54%), Positives = 124/168 (74%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ PAC ++C  CP+LR+RSRQPVKRYKKLL+DIFP+  D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGNLCFFCPSLRARSRQPVKRYKKLLSDIFPRHQDAEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI + LE++CYK+LR+ H   V VI  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITELLEQKCYKDLRNEHFGSVKVILRIYRKLLSSCKEQMPLFASSLLEII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + D ++ +GC T   FI SQ+DGT+ +N+E L+ K+C LA+
Sbjct  121  RILLEQTRHDEMQILGCNTLVDFINSQIDGTHMFNLEGLIPKLCELAQ  168



>ref|XP_009401306.1| PREDICTED: uncharacterized protein LOC103985362 [Musa acuminata 
subsp. malaccensis]
Length=1028

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 124/168 (74%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+ PAC ++C  CP+LR RSRQPVKRYKKLLADIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGALCFLCPSLRERSRQPVKRYKKLLADIFPRAQDEEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A++NP RIPKI   LE+RCYKE+R+     V V+  +Y +LL  C+EQM  FA +LL+++
Sbjct  61   ASRNPLRIPKITTYLEQRCYKEMRNERFGSVKVVMCIYRKLLIACREQMPLFASSLLSII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              + D  + D ++ IGC T   F+ SQVDGTY +N+E++V ++CSLA+
Sbjct  121  HTLFDQTRHDEMQIIGCYTLFDFVNSQVDGTYQFNLESMVPRLCSLAQ  168



>ref|XP_004309822.1| PREDICTED: uncharacterized protein LOC101313176 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457272.1| PREDICTED: uncharacterized protein LOC101313176 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457273.1| PREDICTED: uncharacterized protein LOC101313176 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=998

 Score =   202 bits (515),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 90/168 (54%), Positives = 124/168 (74%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ PAC ++C  CP+LR+RSRQPVKRYKKLL+DIFP+  D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGNLCFFCPSLRARSRQPVKRYKKLLSDIFPRHQDAEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI + LE++CYK+LR+ H   V VI  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITELLEQKCYKDLRNEHFGSVKVILRIYRKLLSSCKEQMPLFASSLLEII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + D ++ +GC T   FI SQ+DGT+ +N+E L+ K+C LA+
Sbjct  121  RILLEQTRHDEMQILGCNTLVDFINSQIDGTHMFNLEGLIPKLCELAQ  168



>ref|XP_006443048.1| hypothetical protein CICLE_v100186802mg, partial [Citrus clementina]
 gb|ESR56288.1| hypothetical protein CICLE_v100186802mg, partial [Citrus clementina]
Length=190

 Score =   188 bits (478),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 120/168 (71%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ P C ++C  CP++R+RSRQPVKRYKK+LADIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVLPVCGNLCFFCPSMRARSRQPVKRYKKMLADIFPRNQDAEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI   LE+RCYK+LR+ +   V V+  +Y + L  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITTLLEQRCYKDLRNENFGSVKVVVCIYKKFLSSCKEQMPLFASSLLGII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + + ++ +GC T   FI SQ D TY +N+E L+ K+C LA+
Sbjct  121  RTLLEQTRQEEMQILGCGTLVNFIDSQTDSTYMFNLEGLIPKLCQLAQ  168



>ref|XP_010257179.1| PREDICTED: uncharacterized protein LOC104597386 isoform X1 [Nelumbo 
nucifera]
Length=1026

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+ P C+ +C  CP++R+RSRQPVKRYKKL+ADIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPICDGLCFLCPSMRTRSRQPVKRYKKLIADIFPRSQDEEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKIA  LE+RCYKELR+   +L  V+  +Y +LL  CK+QM  FA +LL+++
Sbjct  61   ASKNPLRIPKIANSLEQRCYKELRNEQFRLAKVVMCIYRKLLISCKDQMPLFASSLLSII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  +   ++ IGC T   F+ SQ+DGTY +N+E L+ K+C  A+
Sbjct  121  NTLLDQTRQYEMRVIGCQTLFDFVNSQMDGTYMFNLEGLIPKICQTAQ  168



>ref|XP_008231409.1| PREDICTED: uncharacterized protein LOC103330592 [Prunus mume]
Length=1053

 Score =   202 bits (514),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 126/168 (75%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++FP CES+C  CPALR+RSR PVKRYKKLLA+IFP+SPD   N RKI KLCEY
Sbjct  1    MGVISRQVFPVCESLCFFCPALRARSRHPVKRYKKLLAEIFPRSPDEEPNDRKISKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+K P RIPKI   LE+RCYK+LR+ +   V V+  +Y +LL  CKEQM  FA ++L++V
Sbjct  61   ASKTPLRIPKITTTLEQRCYKDLRTENFHSVKVVMCIYRKLLVSCKEQMPLFASSVLSIV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD ++ D ++ +GC T  +F+ +Q DGTY +N++ ++ K+C LA+
Sbjct  121  QILLDQSRHDEIRILGCQTLFEFVNNQKDGTYMFNLDGMIPKLCLLAQ  168



>ref|XP_007218911.1| hypothetical protein PRUPE_ppa000649mg [Prunus persica]
 gb|EMJ20110.1| hypothetical protein PRUPE_ppa000649mg [Prunus persica]
Length=1052

 Score =   202 bits (514),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 126/168 (75%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++FP CES+C  CPALR+RSR PVKRYKKLLA+IFP+SPD   N RKI KLCEY
Sbjct  1    MGVISRQVFPVCESLCFFCPALRARSRHPVKRYKKLLAEIFPRSPDEEPNDRKISKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+K P RIPKI   LE+RCYK+LR+ +   V V+  +Y +LL  CKEQM  FA ++L++V
Sbjct  61   ASKTPLRIPKITTTLEQRCYKDLRTENFHSVKVVMCIYRKLLVSCKEQMPLFASSVLSIV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD ++ D ++ +GC T  +F+ +Q DGTY +N++ ++ K+C LA+
Sbjct  121  QILLDQSRHDDIRILGCQTLFEFVNNQKDGTYMFNLDGMIPKLCLLAQ  168



>ref|XP_004308677.1| PREDICTED: uncharacterized protein LOC101307642 [Fragaria vesca 
subsp. vesca]
Length=1047

 Score =   202 bits (514),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 125/168 (74%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MGL+ R++FP CES+C  CPALR+RSR PVKRYKKLLA+IFP+SPD   N RKI KLCEY
Sbjct  1    MGLIQRQVFPVCESLCFFCPALRARSRHPVKRYKKLLAEIFPRSPDEEPNDRKISKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+K P RIPKI   LE+RCYK+LR+ +   V V+  VY +LL  CK+QM  FA +LL +V
Sbjct  61   ASKTPLRIPKITTTLEQRCYKDLRTENFHSVKVVMCVYRKLLISCKDQMPLFASSLLTIV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD ++ D ++ +GC T  +F+ +Q DGTY +N+++++ K+C +A+
Sbjct  121  QILLDQSRHDEMRILGCQTLFEFVNNQKDGTYMFNLDSMIPKLCQIAQ  168



>ref|XP_010257180.1| PREDICTED: uncharacterized protein LOC104597386 isoform X2 [Nelumbo 
nucifera]
Length=1010

 Score =   202 bits (513),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+ P C+ +C  CP++R+RSRQPVKRYKKL+ADIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPICDGLCFLCPSMRTRSRQPVKRYKKLIADIFPRSQDEEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKIA  LE+RCYKELR+   +L  V+  +Y +LL  CK+QM  FA +LL+++
Sbjct  61   ASKNPLRIPKIANSLEQRCYKELRNEQFRLAKVVMCIYRKLLISCKDQMPLFASSLLSII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  +   ++ IGC T   F+ SQ+DGTY +N+E L+ K+C  A+
Sbjct  121  NTLLDQTRQYEMRVIGCQTLFDFVNSQMDGTYMFNLEGLIPKICQTAQ  168



>ref|XP_009626575.1| PREDICTED: protein EFR3 homolog B-like [Nicotiana tomentosiformis]
Length=204

 Score =   188 bits (478),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 120/168 (71%), Gaps = 1/168 (1%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG+ S ++ PAC+ +C+CCPA+R+RSRQPVKRYKKL++D FP+SPDG  N R I KLCEY
Sbjct  1    MGI-SHRIMPACDQLCVCCPAMRTRSRQPVKRYKKLISDSFPRSPDGEPNDRMINKLCEY  59

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI   LE+RCY+ELR+ +   V V+  +Y +LL  CK+QM  FA + L+++
Sbjct  60   ASKNPLRIPKITSVLEQRCYRELRNENIGSVKVVMCIYRKLLTSCKQQMPLFAGSFLSII  119

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ +GC     FI +Q D TY +N E L+ K+C LA+
Sbjct  120  HILLDQTRHDEMRIVGCQALFDFIINQRDSTYMFNFEGLIPKICLLAQ  167



>ref|XP_008784321.1| PREDICTED: uncharacterized protein LOC103703292 isoform X3 [Phoenix 
dactylifera]
Length=1028

 Score =   202 bits (513),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 121/168 (72%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRYKKLL+DIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPACGSLCFFCPSLRARSRQPVKRYKKLLSDIFPRSQDEEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI   LE+RCYKELR  H   V ++  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITNYLEQRCYKELRIEHFGSVKIVMCIYRKLLISCKEQMPLFASSLLTII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + + ++ IGC TF  F+  Q D TY +N+E ++ K+C LA+
Sbjct  121  RTLLDQTRQEEMRIIGCNTFFDFVNGQRDSTYMFNLEGIIPKLCHLAQ  168



>ref|XP_008784320.1| PREDICTED: uncharacterized protein LOC103703292 isoform X2 [Phoenix 
dactylifera]
Length=1034

 Score =   202 bits (513),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 121/168 (72%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRYKKLL+DIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPACGSLCFFCPSLRARSRQPVKRYKKLLSDIFPRSQDEEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI   LE+RCYKELR  H   V ++  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITNYLEQRCYKELRIEHFGSVKIVMCIYRKLLISCKEQMPLFASSLLTII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + + ++ IGC TF  F+  Q D TY +N+E ++ K+C LA+
Sbjct  121  RTLLDQTRQEEMRIIGCNTFFDFVNGQRDSTYMFNLEGIIPKLCHLAQ  168



>ref|XP_008784316.1| PREDICTED: protein EFR3 homolog isoform X1 [Phoenix dactylifera]
 ref|XP_008784317.1| PREDICTED: protein EFR3 homolog isoform X1 [Phoenix dactylifera]
 ref|XP_008784318.1| PREDICTED: protein EFR3 homolog isoform X1 [Phoenix dactylifera]
 ref|XP_008784319.1| PREDICTED: protein EFR3 homolog isoform X1 [Phoenix dactylifera]
Length=1058

 Score =   202 bits (513),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 121/168 (72%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRYKKLL+DIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPACGSLCFFCPSLRARSRQPVKRYKKLLSDIFPRSQDEEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI   LE+RCYKELR  H   V ++  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITNYLEQRCYKELRIEHFGSVKIVMCIYRKLLISCKEQMPLFASSLLTII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + + ++ IGC TF  F+  Q D TY +N+E ++ K+C LA+
Sbjct  121  RTLLDQTRQEEMRIIGCNTFFDFVNGQRDSTYMFNLEGIIPKLCHLAQ  168



>gb|EAY92960.1| hypothetical protein OsI_14753 [Oryza sativa Indica Group]
Length=279

 Score =   190 bits (483),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 117/168 (70%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+ PAC S+C  CP LR+RSRQPVKRYK +LA+IFPK+ D   N R+I KLCEY
Sbjct  1    MGVISRKVLPACGSLCYFCPGLRARSRQPVKRYKSILAEIFPKTQDEEPNERRIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
             ++NP R+PKI   LE+R YKELRS       V+  +Y  LL  CKEQM  FA +LL++V
Sbjct  61   CSRNPLRVPKITVSLEQRIYKELRSEQYGFAKVVMLIYRRLLVSCKEQMPLFASSLLSIV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ IGC T   F  +QVDGTY +N+E LV ++C L++
Sbjct  121  HTLLDQKRQDDMRIIGCETLFDFAVNQVDGTYQFNLEGLVPRLCELSQ  168



>ref|XP_002264735.1| PREDICTED: uncharacterized protein LOC100264644 isoform X1 [Vitis 
vinifera]
 ref|XP_010650556.1| PREDICTED: uncharacterized protein LOC100264644 isoform X1 [Vitis 
vinifera]
 ref|XP_010650557.1| PREDICTED: uncharacterized protein LOC100264644 isoform X1 [Vitis 
vinifera]
 emb|CBI36655.3| unnamed protein product [Vitis vinifera]
Length=1000

 Score =   201 bits (510),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ PAC ++C  CP+LR+RSRQPVKRYKKLLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGNLCFFCPSLRARSRQPVKRYKKLLADIFPRSQDAEPNERKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KN  RIPKI   LE+RCYK+LR+GH     V+  +Y +LL  CKEQM  +A +LL +V
Sbjct  61   ASKNALRIPKITDYLEQRCYKDLRNGHFGSAKVVLCIYRKLLSSCKEQMPFYASSLLGMV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + D ++ +GC T   FI SQ+DGTY +N+E L+ K+C LA+
Sbjct  121  RILLEQTRHDEMRILGCSTLVDFINSQMDGTYMFNLEGLIPKLCQLAQ  168



>gb|KGN59399.1| hypothetical protein Csa_3G816120 [Cucumis sativus]
Length=870

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 122/167 (73%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SR++ P C S+C  CPALR+RSRQPVKRYKKL+ADIFP++P+   N RKI KLCEYA
Sbjct  9    GVISRQVLPVCGSLCFFCPALRARSRQPVKRYKKLIADIFPRNPEEGPNDRKIGKLCEYA  68

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            AKNP RIPKI   LE+RCYKELR+ + + V V+  +Y +LL  CKEQM  FA +L++++ 
Sbjct  69   AKNPLRIPKITTSLEQRCYKELRNENFQAVKVVMSIYRKLLVSCKEQMPLFASSLISIMQ  128

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             ++D  +   ++ IGC T   F+ SQ DGTY +N+E  + K+C +A+
Sbjct  129  TLMDQTRQKEMQIIGCQTLFSFVNSQSDGTYMFNLEAFIPKLCQIAQ  175



>ref|XP_010241226.1| PREDICTED: uncharacterized protein LOC104585894 isoform X1 [Nelumbo 
nucifera]
Length=1005

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 122/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+ P C S+C  CPALR+RSRQPVKRYKKL+A+IFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPVCGSLCFFCPALRARSRQPVKRYKKLIAEIFPRSQDEEPNDRKISKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI   LE+RCYKELR+    L  V+  +Y +LL  CK+QM  FA +LL+++
Sbjct  61   ASKNPMRIPKITSTLEQRCYKELRNEQFWLAKVVMCIYRKLLISCKDQMPLFASSLLSII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ IGC T   F+ +Q DGTY +N+E ++ K+C L++
Sbjct  121  NILLDQTRQDEIRIIGCQTLFDFVNNQTDGTYMFNLEGMIPKLCMLSQ  168



>ref|XP_004166917.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101224192, 
partial [Cucumis sativus]
Length=986

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 122/167 (73%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SR++ P C S+C  CPALR+RSRQPVKRYKKL+ADIFP++P+   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCFFCPALRARSRQPVKRYKKLIADIFPRNPEEGPNDRKIGKLCEYA  65

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            AKNP RIPKI   LE+RCYKELR+ + + V V+  +Y +LL  CKEQM  FA +L++++ 
Sbjct  66   AKNPLRIPKITTSLEQRCYKELRNENFQAVKVVMSIYRKLLVSCKEQMPLFASSLISIMQ  125

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             ++D  +   ++ IGC T   F+ SQ DGTY +N+E  + K+C +A+
Sbjct  126  TLMDQTRQKEMQIIGCQTLFSFVNSQSDGTYMFNLEAFIPKLCQIAQ  172



>ref|XP_009355500.1| PREDICTED: uncharacterized protein LOC103946512 [Pyrus x bretschneideri]
 ref|XP_009355501.1| PREDICTED: uncharacterized protein LOC103946512 [Pyrus x bretschneideri]
Length=1036

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 123/167 (74%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SR++ PAC S+C  CPALR+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEY 
Sbjct  6    GVISRQVLPACGSLCFFCPALRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYV  65

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            AKNP RIPKI   LE+RCYKELR+ + +   ++  +YN+LL  CKEQM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITTYLEQRCYKELRNENFRSAKIVMCIYNKLLISCKEQMPLFASSLLSIMH  125

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD  + D ++ IGC T   F+ +Q DGTYT+N+E  + K+C +A+
Sbjct  126  TLLDQTRQDEMQIIGCQTLFNFVNNQTDGTYTFNLEGFIPKLCQIAQ  172



>ref|XP_004136762.1| PREDICTED: uncharacterized protein LOC101210251 [Cucumis sativus]
Length=1002

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 122/167 (73%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SR++ P C S+C  CPALR+RSRQPVKRYKKL+ADIFP++P+   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCFFCPALRARSRQPVKRYKKLIADIFPRNPEEGPNDRKIGKLCEYA  65

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            AKNP RIPKI   LE+RCYKELR+ + + V V+  +Y +LL  CKEQM  FA +L++++ 
Sbjct  66   AKNPLRIPKITTSLEQRCYKELRNENFQAVKVVMSIYRKLLVSCKEQMPLFASSLISIMQ  125

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             ++D  +   ++ IGC T   F+ SQ DGTY +N+E  + K+C +A+
Sbjct  126  TLMDQTRQKEMQIIGCQTLFSFVNSQSDGTYMFNLEAFIPKLCQIAQ  172



>ref|XP_011078902.1| PREDICTED: uncharacterized protein LOC105162543 [Sesamum indicum]
Length=1009

 Score =   199 bits (506),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 120/167 (72%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SR++ PAC S+C  CPALR RSRQPVKRYKKL++DIFPKS D   N RKI KLCEYA
Sbjct  7    GVISRQVLPACGSLCFFCPALRERSRQPVKRYKKLISDIFPKSLDEEPNDRKIGKLCEYA  66

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            AKNP RIPKIA  LE+RCYKELR+ + + V V+  +Y + L  CKEQM  FA +LL ++ 
Sbjct  67   AKNPLRIPKIANSLEQRCYKELRNENFRAVKVVMCIYRKFLSACKEQMPLFANSLLTIIN  126

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD    D +  IGC +   F+ +Q DGTY +N+E L+ K+C LA+
Sbjct  127  TLLDQTSQDEMLVIGCHSVFDFVNNQNDGTYMFNLEGLIPKLCQLAQ  173



>dbj|BAK01387.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1055

 Score =   199 bits (507),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 91/168 (54%), Positives = 120/168 (71%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+ PAC ++C  CP LR+RSRQPVKRYKK+LA+IFP++PD   N R+I KLCEY
Sbjct  1    MGVISRKVLPACGALCYFCPGLRARSRQPVKRYKKILAEIFPRTPDEEPNERRIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP R+PKI   LE+R YKELR+       V+  +Y  LL  CKEQM  FA +LL++V
Sbjct  61   AAKNPLRVPKITVYLEQRIYKELRTEQYGFAKVVMLIYRRLLVSCKEQMPLFASSLLSIV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ IGC T   F  +QVDGTY +N+E LV ++C LA+
Sbjct  121  HTLLDQKRQDDMRIIGCETLFDFAVNQVDGTYQFNLEGLVPRLCELAQ  168



>ref|XP_009391228.1| PREDICTED: uncharacterized protein LOC103977445 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391229.1| PREDICTED: uncharacterized protein LOC103977445 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391230.1| PREDICTED: uncharacterized protein LOC103977445 [Musa acuminata 
subsp. malaccensis]
Length=1033

 Score =   199 bits (506),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 120/168 (71%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR + PACES+CI CP+LR+RSRQPVKRYKKLLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRSIMPACESLCIFCPSLRTRSRQPVKRYKKLLADIFPRSQDEEPNDRKISKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
             ++NP RIPKI   LE++ YKELR  H   V V+  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   VSRNPLRIPKITSYLEQKFYKELRLEHFGTVKVVLCIYRKLLVSCKEQMPLFASSLLTII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D +  IGC T   F+  Q+DGTY +N+E L+ K+C LA+
Sbjct  121  CTLLDQRRQDEMCIIGCHTIFDFVICQIDGTYMFNLEGLIPKLCELAQ  168



>ref|XP_010907685.1| PREDICTED: uncharacterized protein LOC105034293 isoform X5 [Elaeis 
guineensis]
Length=930

 Score =   198 bits (503),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 122/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ PAC ++C  CP+LR+RSR PVKRYKKLLA+IFP+S DG  N R I KLCEY
Sbjct  1    MGVMSRRVLPACANLCCFCPSLRARSRLPVKRYKKLLANIFPQSLDGEPNDRMISKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP R+PKI KCLE+R YKELR+ H+ L   +  +Y +LL  CKEQM  FA +LL +V
Sbjct  61   ASKNPMRMPKITKCLEQRFYKELRNEHSCLAKAVPCIYRKLLASCKEQMPLFATSLLGIV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ +GCL    F+ SQVD TY +N+E ++ K+C L +
Sbjct  121  RTLLDQTQEDDMRILGCLMLVDFLNSQVDSTYMFNVEGIIPKLCHLGQ  168



>ref|XP_010907684.1| PREDICTED: uncharacterized protein LOC105034293 isoform X4 [Elaeis 
guineensis]
Length=979

 Score =   198 bits (503),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 122/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ PAC ++C  CP+LR+RSR PVKRYKKLLA+IFP+S DG  N R I KLCEY
Sbjct  1    MGVMSRRVLPACANLCCFCPSLRARSRLPVKRYKKLLANIFPQSLDGEPNDRMISKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP R+PKI KCLE+R YKELR+ H+ L   +  +Y +LL  CKEQM  FA +LL +V
Sbjct  61   ASKNPMRMPKITKCLEQRFYKELRNEHSCLAKAVPCIYRKLLASCKEQMPLFATSLLGIV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ +GCL    F+ SQVD TY +N+E ++ K+C L +
Sbjct  121  RTLLDQTQEDDMRILGCLMLVDFLNSQVDSTYMFNVEGIIPKLCHLGQ  168



>ref|XP_007203221.1| hypothetical protein PRUPE_ppa000725mg [Prunus persica]
 gb|EMJ04420.1| hypothetical protein PRUPE_ppa000725mg [Prunus persica]
Length=1021

 Score =   198 bits (504),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 122/167 (73%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G+LSR++ PAC  +C  CPALR+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GILSRQVLPACGGLCFFCPALRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYA  65

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            AKNP RIPKI   LE+RCYKELR+ + +   ++  +YN+LL  CKEQM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITNFLEQRCYKELRNENFRSTKIVMCIYNKLLISCKEQMRLFASSLLSIMH  125

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD  + D ++ IGC T   F+ +Q DGTY +N+E  + K+C +A+
Sbjct  126  TLLDQTRQDEMQIIGCQTLFNFVNNQKDGTYMFNLEGFIPKLCQIAQ  172



>ref|XP_008443197.1| PREDICTED: uncharacterized protein LOC103486854 isoform X1 [Cucumis 
melo]
 ref|XP_008443199.1| PREDICTED: uncharacterized protein LOC103486854 isoform X1 [Cucumis 
melo]
 ref|XP_008443200.1| PREDICTED: uncharacterized protein LOC103486854 isoform X1 [Cucumis 
melo]
 ref|XP_008443201.1| PREDICTED: uncharacterized protein LOC103486854 isoform X1 [Cucumis 
melo]
Length=1003

 Score =   198 bits (503),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 121/167 (72%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SR++ P C S+C  CPALR+RSRQPVKRYKKL+ADIFP++P+   N RKI KLCEYA
Sbjct  9    GVISRQVLPVCGSLCFFCPALRARSRQPVKRYKKLIADIFPRNPEEGPNDRKIGKLCEYA  68

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
             KNP RIPKI   LE+RCYKELR+ + + V V+  +Y +LL  CKEQM  FA +L++++ 
Sbjct  69   GKNPLRIPKITTSLEQRCYKELRNENFQAVKVVMSIYRKLLVSCKEQMPLFASSLISIMQ  128

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             ++D  +   ++ IGC T   F+ SQ DGTY +N+E  + K+C +A+
Sbjct  129  TLMDQTRQKEMQIIGCQTLFSFVNSQSDGTYMFNLEAFIPKLCQIAQ  175



>ref|XP_010907683.1| PREDICTED: uncharacterized protein LOC105034293 isoform X3 [Elaeis 
guineensis]
Length=1011

 Score =   198 bits (503),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 122/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ PAC ++C  CP+LR+RSR PVKRYKKLLA+IFP+S DG  N R I KLCEY
Sbjct  1    MGVMSRRVLPACANLCCFCPSLRARSRLPVKRYKKLLANIFPQSLDGEPNDRMISKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP R+PKI KCLE+R YKELR+ H+ L   +  +Y +LL  CKEQM  FA +LL +V
Sbjct  61   ASKNPMRMPKITKCLEQRFYKELRNEHSCLAKAVPCIYRKLLASCKEQMPLFATSLLGIV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ +GCL    F+ SQVD TY +N+E ++ K+C L +
Sbjct  121  RTLLDQTQEDDMRILGCLMLVDFLNSQVDSTYMFNVEGIIPKLCHLGQ  168



>ref|XP_010907681.1| PREDICTED: uncharacterized protein LOC105034293 isoform X1 [Elaeis 
guineensis]
Length=1023

 Score =   198 bits (503),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 122/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ PAC ++C  CP+LR+RSR PVKRYKKLLA+IFP+S DG  N R I KLCEY
Sbjct  1    MGVMSRRVLPACANLCCFCPSLRARSRLPVKRYKKLLANIFPQSLDGEPNDRMISKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP R+PKI KCLE+R YKELR+ H+ L   +  +Y +LL  CKEQM  FA +LL +V
Sbjct  61   ASKNPMRMPKITKCLEQRFYKELRNEHSCLAKAVPCIYRKLLASCKEQMPLFATSLLGIV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ +GCL    F+ SQVD TY +N+E ++ K+C L +
Sbjct  121  RTLLDQTQEDDMRILGCLMLVDFLNSQVDSTYMFNVEGIIPKLCHLGQ  168



>ref|XP_010907682.1| PREDICTED: uncharacterized protein LOC105034293 isoform X2 [Elaeis 
guineensis]
Length=1021

 Score =   198 bits (503),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 122/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ PAC ++C  CP+LR+RSR PVKRYKKLLA+IFP+S DG  N R I KLCEY
Sbjct  1    MGVMSRRVLPACANLCCFCPSLRARSRLPVKRYKKLLANIFPQSLDGEPNDRMISKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP R+PKI KCLE+R YKELR+ H+ L   +  +Y +LL  CKEQM  FA +LL +V
Sbjct  61   ASKNPMRMPKITKCLEQRFYKELRNEHSCLAKAVPCIYRKLLASCKEQMPLFATSLLGIV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ +GCL    F+ SQVD TY +N+E ++ K+C L +
Sbjct  121  RTLLDQTQEDDMRILGCLMLVDFLNSQVDSTYMFNVEGIIPKLCHLGQ  168



>ref|XP_003591099.1| EFR3-like protein [Medicago truncatula]
Length=210

 Score =   184 bits (468),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 119/165 (72%), Gaps = 19/165 (12%)
 Frame = +3

Query  117  LSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAK  296
            +S +L  AC      CPALRSRSRQPVK Y+KLLADIFPKSP    N RKI+KLCEYAAK
Sbjct  14   ISSQLVRAC---VFTCPALRSRSRQPVKCYRKLLADIFPKSP--LPNERKIVKLCEYAAK  68

Query  297  NPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVVEM  476
            NP RIPKIAK LEERCYKELRS H KLV +IAE +N+LL +CK Q+  FAV++LNV  E+
Sbjct  69   NPLRIPKIAKYLEERCYKELRSEHIKLVKIIAESFNKLLSICKAQITYFAVDVLNVTSEL  128

Query  477  LDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            LD +K +A+              QVD TYT+NIE LV+KVC L++
Sbjct  129  LDYSKDEAI--------------QVDSTYTHNIEKLVRKVCMLSQ  159



>emb|CDP16550.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 123/177 (69%), Gaps = 9/177 (5%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+ PAC ++C  CP++R+RSRQPVKRYKKLLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGNLCFFCPSMRARSRQPVKRYKKLLADIFPRSQDAEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPK---------IAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMAC  440
            A+KNP RIPK         I + LE++ YK+LR+ H   V V+  +Y +LL  CKEQM  
Sbjct  61   ASKNPLRIPKASLIHLFALITEYLEQKFYKDLRNEHFGSVKVVLRIYRKLLSSCKEQMPL  120

Query  441  FAVNLLNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            FA +LL +V  +LD  + D ++ +GC T   FI  Q+DGTY +N+E L+ K+C LAR
Sbjct  121  FASSLLGMVRTLLDLPQYDELQILGCNTLVDFINGQLDGTYMFNLEGLIPKLCQLAR  177



>ref|XP_010241507.1| PREDICTED: uncharacterized protein LOC104586087 isoform X2 [Nelumbo 
nucifera]
Length=997

 Score =   197 bits (501),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ P C ++C  CP++R+RSRQPVKRYKKLL+DIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPVCGNLCFFCPSMRARSRQPVKRYKKLLSDIFPRSQDAEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI K LE+RCYK+LR+ H   V V+  +Y +LL  CK+QM  FA ++L +V
Sbjct  61   ASKNPLRIPKITKYLEQRCYKDLRNEHFGSVKVVLCIYRKLLSSCKDQMPLFASSILCIV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+ ++ D ++ +GC T   FI SQ D TY +N+E L+ K+C LA+
Sbjct  121  RTLLEQSRQDEMRILGCQTLVDFINSQTDSTYMFNLEGLIPKLCELAQ  168



>ref|XP_010241506.1| PREDICTED: uncharacterized protein LOC104586087 isoform X1 [Nelumbo 
nucifera]
Length=998

 Score =   197 bits (501),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ P C ++C  CP++R+RSRQPVKRYKKLL+DIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPVCGNLCFFCPSMRARSRQPVKRYKKLLSDIFPRSQDAEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI K LE+RCYK+LR+ H   V V+  +Y +LL  CK+QM  FA ++L +V
Sbjct  61   ASKNPLRIPKITKYLEQRCYKDLRNEHFGSVKVVLCIYRKLLSSCKDQMPLFASSILCIV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+ ++ D ++ +GC T   FI SQ D TY +N+E L+ K+C LA+
Sbjct  121  RTLLEQSRQDEMRILGCQTLVDFINSQTDSTYMFNLEGLIPKLCELAQ  168



>ref|XP_004304390.1| PREDICTED: uncharacterized protein LOC101298629 [Fragaria vesca 
subsp. vesca]
Length=1028

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 122/167 (73%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SR++ PAC S+C  CP LR+RSRQPVKRYKKL+ADIFPK+ +   N RKI KLCEYA
Sbjct  6    GVVSRQVLPACGSLCFFCPGLRARSRQPVKRYKKLIADIFPKNQEEGPNDRKIGKLCEYA  65

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            +KNP RIPKI   LE+RCYKELR+ + +   ++  +Y +LL  CKEQM  FA +LL+++ 
Sbjct  66   SKNPLRIPKITTSLEQRCYKELRNENFRSTKIVMCIYKKLLITCKEQMPLFASSLLSIMH  125

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD  + D ++ IGC T   F+ +QVDGTY +N+E  + K+C +A+
Sbjct  126  TLLDQTRQDEMQIIGCQTLFDFVNNQVDGTYMFNLEGFIPKLCQIAQ  172



>ref|XP_010420957.1| PREDICTED: uncharacterized protein LOC104706460 [Camelina sativa]
Length=1024

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 116/168 (69%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR +FP CES+C  CPALR+RSR PVKRYK LLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRTMFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSQDEQPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKI   LE+RCYKELR      V ++  +Y +LL  C EQM+ FA + L ++
Sbjct  61   AAKNPLRIPKITTSLEQRCYKELRMEQFHSVKIVMSIYKKLLVSCNEQMSLFASSYLGLI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ +GC     F+ SQ +GTY +N++ L+ K+C LA 
Sbjct  121  HILLDQTRYDEMRMLGCEALYDFVTSQTEGTYMFNLDGLIPKICPLAH  168



>ref|XP_009379628.1| PREDICTED: uncharacterized protein LOC103968023 isoform X2 [Pyrus 
x bretschneideri]
Length=1036

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 122/167 (73%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SR++ PAC S+C  CPALR+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEY 
Sbjct  6    GVISRQVLPACGSLCFFCPALRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYV  65

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            AKNP RIPKI   LE+RCYKELR+ + +   ++  +YN+LL  CKEQM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITTYLEQRCYKELRNENFRSAKIVMCIYNKLLISCKEQMPLFASSLLSIMH  125

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD  + D ++ IGC T   F+ +Q+DGTY +N+E  + K C +A+
Sbjct  126  TLLDQTRQDEMQIIGCQTLFNFVNNQMDGTYMFNLEGFIPKFCQIAQ  172



>ref|XP_009379627.1| PREDICTED: uncharacterized protein LOC103968023 isoform X1 [Pyrus 
x bretschneideri]
Length=1040

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 122/167 (73%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SR++ PAC S+C  CPALR+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEY 
Sbjct  6    GVISRQVLPACGSLCFFCPALRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYV  65

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            AKNP RIPKI   LE+RCYKELR+ + +   ++  +YN+LL  CKEQM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITTYLEQRCYKELRNENFRSAKIVMCIYNKLLISCKEQMPLFASSLLSIMH  125

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD  + D ++ IGC T   F+ +Q+DGTY +N+E  + K C +A+
Sbjct  126  TLLDQTRQDEMQIIGCQTLFNFVNNQMDGTYMFNLEGFIPKFCQIAQ  172



>ref|XP_010493228.1| PREDICTED: uncharacterized protein LOC104770495 [Camelina sativa]
Length=1024

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 116/168 (69%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR +FP CES+C  CPALR+RSR PVKRYK LLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRTMFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSQDEQPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKI   LE+RCYKELR      V ++  +Y +LL  C EQM+ FA + L ++
Sbjct  61   AAKNPLRIPKITTSLEQRCYKELRMEQFHSVKIVMSIYKKLLVSCNEQMSLFASSYLGLI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ +GC     F+ SQ +GTY +N++ L+ K+C LA 
Sbjct  121  HILLDQTRYDEMRMLGCEALYDFVTSQTEGTYMFNLDGLIPKICPLAH  168



>ref|XP_006286974.1| hypothetical protein CARUB_v10000121mg [Capsella rubella]
 gb|EOA19872.1| hypothetical protein CARUB_v10000121mg [Capsella rubella]
Length=1026

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 116/168 (69%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR +FP CES+C  CPALR+RSR PVKRYK LLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRTVFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSQDEQPNDRKISKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKI   LE+RCYKELR      V ++  +Y +LL  C EQM+ FA + L ++
Sbjct  61   AAKNPLRIPKITTSLEQRCYKELRMEQFHSVKIVMSIYKKLLVSCNEQMSLFASSYLGLI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ +GC     F+ SQ +GTY +N++ L+ K+C LA 
Sbjct  121  HILLDQTRYDEMRILGCEALYDFVTSQAEGTYMFNLDGLIPKICPLAH  168



>gb|EPS68493.1| hypothetical protein M569_06272 [Genlisea aurea]
Length=1007

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SR++ PACES+C  CP LR+RSRQPVKRYKKL+ADIFP+S D   N RKI KLCEYA
Sbjct  6    GVISRQILPACESLCFFCPGLRTRSRQPVKRYKKLIADIFPRSQDEEPNYRKIEKLCEYA  65

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            +KNP RIPKI   LE+RCYKELR  + + V ++  +Y +LL  CKEQM  FA +LL+++ 
Sbjct  66   SKNPMRIPKIESSLEQRCYKELRVENIRSVKIVMSIYKKLLFTCKEQMPLFANSLLSIIY  125

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD    D +   GC T   F+ +Q D TY +N+E L+ K+C +A+
Sbjct  126  VLLDQTNHDEMLISGCQTLFDFVNNQNDSTYMFNLEGLIPKLCQIAQ  172



>ref|XP_010069300.1| PREDICTED: protein EFR3 homolog B isoform X1 [Eucalyptus grandis]
 ref|XP_010069301.1| PREDICTED: protein EFR3 homolog B isoform X1 [Eucalyptus grandis]
 gb|KCW57603.1| hypothetical protein EUGRSUZ_H00374 [Eucalyptus grandis]
 gb|KCW57604.1| hypothetical protein EUGRSUZ_H00374 [Eucalyptus grandis]
 gb|KCW57605.1| hypothetical protein EUGRSUZ_H00374 [Eucalyptus grandis]
Length=995

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 124/168 (74%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ P C ++C  CP++R+RSRQPVKRYKKLLA+IFPK+ +   N RKI KLCEY
Sbjct  1    MGVVSRRVVPVCGNLCFMCPSMRARSRQPVKRYKKLLANIFPKNQEAEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A KNP RIPKI   LEERCYK+LR+ +   V V+  +Y +LL  CKEQM+ FA +LL +V
Sbjct  61   ALKNPLRIPKITNYLEERCYKDLRNENYGSVKVVLCIYRKLLSSCKEQMSLFAGSLLGIV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + D ++ +GC+T  +F+ +QVDGTY +N+E L+ K+C +A 
Sbjct  121  RTLLEQTQQDELRILGCMTLVEFMNNQVDGTYMFNLEGLIPKLCQMAE  168



>ref|XP_006421414.1| hypothetical protein CICLE_v10006843mg [Citrus clementina]
 gb|ESR34654.1| hypothetical protein CICLE_v10006843mg [Citrus clementina]
Length=1027

 Score =   196 bits (498),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 120/167 (72%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SRK+ PAC  +C  CPA+R+RSRQPVKRYKKL++DIFP++ D   N RKI KLCEYA
Sbjct  6    GVISRKVLPACGRLCFFCPAMRARSRQPVKRYKKLISDIFPRNQDEGPNDRKIGKLCEYA  65

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
             KNP RIPKI   LE+RCYKELR+ + +   ++  +Y +LL  CKEQM  FA +LL ++ 
Sbjct  66   NKNPLRIPKITTSLEQRCYKELRNENFQFAKIVMCIYRKLLISCKEQMPLFASSLLTIIH  125

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD  + D ++ IGC+T   F+ +Q DGTY +N+E  + K+C LA+
Sbjct  126  TLLDQTRQDEIQIIGCMTLFDFVNNQKDGTYMFNLECFIPKLCQLAQ  172



>ref|XP_009124331.1| PREDICTED: uncharacterized protein LOC103849280 [Brassica rapa]
Length=1024

 Score =   196 bits (497),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 117/168 (70%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG ++R +FP CES+C  CPALR+RSR PVKRYK+LLADIFP+SPD   N RKI KLCEY
Sbjct  1    MGAVARTVFPVCESLCCFCPALRARSRHPVKRYKQLLADIFPRSPDEQPNDRKISKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKI   LE+RCYKELR      V  +  +Y +LL  C EQM+ FA + L ++
Sbjct  61   AAKNPLRIPKITTYLEQRCYKELRLEQFHSVKTVMCIYKKLLVACNEQMSLFASSYLGLI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD ++ D ++ +GC     F+ SQ +GTY +N++ L+ K+C LA 
Sbjct  121  HILLDQSRHDEMRVLGCEAIYDFVTSQTEGTYMFNLDGLIPKICPLAH  168



>emb|CDY09095.1| BnaA02g05210D [Brassica napus]
Length=996

 Score =   195 bits (496),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 117/168 (70%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG ++R +FP CES+C  CPALR+RSR PVKRYK+LLADIFP+SPD   N RKI KLCEY
Sbjct  1    MGAVARTVFPVCESLCCFCPALRARSRHPVKRYKQLLADIFPRSPDEQPNDRKISKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKI   LE+RCYKELR      V  +  +Y +LL  C EQM+ FA + L ++
Sbjct  61   AAKNPLRIPKITTYLEQRCYKELRLEQFHSVKTVMCIYKKLLVACNEQMSLFASSYLGLI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD ++ D ++ +GC     F+ SQ +GTY +N++ L+ K+C LA 
Sbjct  121  HILLDQSRHDEMRVLGCEAIYDFVTSQTEGTYMFNLDGLIPKICPLAH  168



>gb|KCW57602.1| hypothetical protein EUGRSUZ_H00374 [Eucalyptus grandis]
Length=1017

 Score =   196 bits (497),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 124/168 (74%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ P C ++C  CP++R+RSRQPVKRYKKLLA+IFPK+ +   N RKI KLCEY
Sbjct  1    MGVVSRRVVPVCGNLCFMCPSMRARSRQPVKRYKKLLANIFPKNQEAEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A KNP RIPKI   LEERCYK+LR+ +   V V+  +Y +LL  CKEQM+ FA +LL +V
Sbjct  61   ALKNPLRIPKITNYLEERCYKDLRNENYGSVKVVLCIYRKLLSSCKEQMSLFAGSLLGIV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + D ++ +GC+T  +F+ +QVDGTY +N+E L+ K+C +A 
Sbjct  121  RTLLEQTQQDELRILGCMTLVEFMNNQVDGTYMFNLEGLIPKLCQMAE  168



>ref|XP_003605757.1| EFR3-like protein [Medicago truncatula]
 gb|AES87954.1| cyclin-like protein [Medicago truncatula]
Length=1028

 Score =   196 bits (497),  Expect = 6e-54, Method: Composition-based stats.
 Identities = 85/168 (51%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            M ++SR ++P C S+C  CPALR RSR P+KRYKKLLADIFP++P+   N RKI KLCEY
Sbjct  1    MSVISRNIWPVCGSLCCFCPALRERSRHPIKRYKKLLADIFPRTPEEEPNDRKISKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP R+PKI   LE+RCYKELR+ + + V V+  +Y +LL  C++QM  FA +LL+++
Sbjct  61   ASKNPLRVPKITSYLEQRCYKELRTENYQAVKVVICIYRKLLVSCRDQMPLFASSLLSII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD ++ D V+ +GC T   F+ +Q DGTY +N+++ + K+C LA+
Sbjct  121  QILLDQSRQDEVQILGCQTLFDFVNNQRDGTYMFNLDSFILKLCHLAQ  168



>gb|EYU27043.1| hypothetical protein MIMGU_mgv1a000818mg [Erythranthe guttata]
Length=974

 Score =   195 bits (496),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 119/168 (71%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG +S+++ P C+S+CICCPA+R RSR PVKRYKKLLADIFP++     N R+I KLCEY
Sbjct  1    MGAMSKRMMPFCDSLCICCPAMRPRSRHPVKRYKKLLADIFPRNMGDEPNDRQISKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
             +KNP R+PKI   LEERCY+ELR+ +   V VI  +Y +L+  C++QM  FA + LNV+
Sbjct  61   VSKNPLRVPKITSLLEERCYRELRNANVNRVKVIMCIYRKLIISCQQQMPLFAGSFLNVI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ IGC     FI +Q DGTY +N+E L+ K+C LA+
Sbjct  121  NTLLDQTRNDEMRIIGCQALFDFINNQRDGTYMFNLEGLIPKLCLLAQ  168



>ref|NP_197607.5| uncharacterized protein [Arabidopsis thaliana]
 gb|AED92929.1| uncharacterized protein AT5G21080 [Arabidopsis thaliana]
Length=1025

 Score =   195 bits (496),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 115/168 (68%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR +FP CES+C  CPALR+RSR PVKRYK LLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRTVFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSQDEQPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKI   LE+RCYKELR      V ++  +Y +LL  C EQM  FA + L ++
Sbjct  61   AAKNPLRIPKITTSLEQRCYKELRMEQFHSVKIVMSIYKKLLVSCNEQMLLFASSYLGLI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ +GC     F+ SQ +GTY +N++ L+ K+C LA 
Sbjct  121  HILLDQTRYDEMRILGCEALYDFVTSQAEGTYMFNLDGLIPKICPLAH  168



>gb|KDO47318.1| hypothetical protein CISIN_1g001882mg [Citrus sinensis]
Length=979

 Score =   195 bits (495),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 121/168 (72%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ P C ++C  CP++R+RSRQPVKRYKK+LADIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVLPVCGNLCFFCPSMRARSRQPVKRYKKMLADIFPRNQDAEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI   LE+RCYK+LR+ +   V V+  +Y + L  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITTLLEQRCYKDLRNENFGSVKVVVCIYKKFLSSCKEQMPLFASSLLGII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + + ++ +GC T   FI SQ DGTY +N+E L+ K+C LA+
Sbjct  121  RTLLEQTRQEEMQILGCGTLVNFIDSQTDGTYMFNLEGLIPKLCQLAQ  168



>gb|KDO47320.1| hypothetical protein CISIN_1g001882mg [Citrus sinensis]
 gb|KDO47321.1| hypothetical protein CISIN_1g001882mg [Citrus sinensis]
 gb|KDO47322.1| hypothetical protein CISIN_1g001882mg [Citrus sinensis]
Length=1000

 Score =   195 bits (495),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 121/168 (72%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ P C ++C  CP++R+RSRQPVKRYKK+LADIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVLPVCGNLCFFCPSMRARSRQPVKRYKKMLADIFPRNQDAEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI   LE+RCYK+LR+ +   V V+  +Y + L  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITTLLEQRCYKDLRNENFGSVKVVVCIYKKFLSSCKEQMPLFASSLLGII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + + ++ +GC T   FI SQ DGTY +N+E L+ K+C LA+
Sbjct  121  RTLLEQTRQEEMQILGCGTLVNFIDSQTDGTYMFNLEGLIPKLCQLAQ  168



>ref|XP_010653791.1| PREDICTED: uncharacterized protein LOC100255472 isoform X2 [Vitis 
vinifera]
Length=993

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 120/167 (72%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SRK+ PAC ++C  CPA+R RSRQP+KRYKKL++DIFP++ D   N RKI KLCEYA
Sbjct  6    GVISRKVLPACGNLCFLCPAMRPRSRQPLKRYKKLISDIFPRAQDEEPNDRKIGKLCEYA  65

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            AKNP RIPKI   LE+RCYKELRS + +   V+  +Y + L  CKEQM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITNSLEQRCYKELRSENFRSAKVVMCIYRKFLVSCKEQMPLFASSLLSIIH  125

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD A+ D ++ IGC T   F+ +Q DGTY  N+E  + K+C LA+
Sbjct  126  TLLDQARQDEMQIIGCQTLFDFVNNQRDGTYMCNLEGFIPKLCQLAQ  172



>gb|KDO47319.1| hypothetical protein CISIN_1g001882mg [Citrus sinensis]
Length=985

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 121/168 (72%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ P C ++C  CP++R+RSRQPVKRYKK+LADIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVLPVCGNLCFFCPSMRARSRQPVKRYKKMLADIFPRNQDAEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI   LE+RCYK+LR+ +   V V+  +Y + L  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITTLLEQRCYKDLRNENFGSVKVVVCIYKKFLSSCKEQMPLFASSLLGII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + + ++ +GC T   FI SQ DGTY +N+E L+ K+C LA+
Sbjct  121  RTLLEQTRQEEMQILGCGTLVNFIDSQTDGTYMFNLEGLIPKLCQLAQ  168



>ref|XP_007028783.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY09285.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=706

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 124/167 (74%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SR++ PAC S+C  CPA+R+RSRQPVKRYKKL+A+IFP++ +  AN RKI KLC+YA
Sbjct  6    GVISRQVLPACGSLCFFCPAMRARSRQPVKRYKKLIAEIFPRNQEEGANDRKIGKLCDYA  65

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            +KNP RIPKI+  LE+RCYKELR+ + +   ++  +Y +LL  CKEQM  FA +LL+++ 
Sbjct  66   SKNPLRIPKISNSLEQRCYKELRNENFQSAKIVMCIYRKLLVSCKEQMTLFASSLLSIIQ  125

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD  + D ++ +GC T   F+ +Q DGT+ +N+E  + K+C LA+
Sbjct  126  TLLDQTRQDEMRIMGCQTLFDFVNNQKDGTFMFNLEGFIPKLCQLAQ  172



>gb|KCW90195.1| hypothetical protein EUGRSUZ_A02368 [Eucalyptus grandis]
Length=1010

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 120/167 (72%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SR++ P C S+C  CPA+R+RSRQPVKRYKKL++DIFPK+ D   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCFFCPAMRARSRQPVKRYKKLISDIFPKNQDEEPNDRKIGKLCEYA  65

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            AKNP RIPKI   LE+RCYKELR+ + +   ++  +Y +LL  CK+QM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITSTLEQRCYKELRTENFRSAKIVMCIYRKLLVSCKDQMPLFASSLLSIIS  125

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD  + D ++ IGC     F+ +Q DGTY +N+E  + K+C LA+
Sbjct  126  TLLDQTRQDEMQLIGCQNLFDFVNNQGDGTYMFNLEGFIPKLCQLAQ  172



>gb|EPS68833.1| hypothetical protein M569_05934, partial [Genlisea aurea]
Length=579

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 122/170 (72%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  GKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLC  281
            G+MG +S+++ P C+S+C+CCPAL  RSR PVKRYK+LLAD+FP++ +   N RK+ KLC
Sbjct  42   GEMGAMSKQMMPVCDSLCVCCPALLPRSRHPVKRYKRLLADVFPRNMEEEPNDRKVSKLC  101

Query  282  EYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLN  461
            EYA+KNP R+PKI   LEERCY+E+R+ +   V V+  +Y +L+  C+ QM  FA + L+
Sbjct  102  EYASKNPLRVPKITSLLEERCYREVRNENLGRVKVVMYIYRKLIISCQRQMPLFAGSFLS  161

Query  462  VVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            ++  +LD AK D ++ IGC     FI +Q D TY +N+E L+ K+CSLA+
Sbjct  162  IINVLLDQAKHDNMRIIGCQALFDFINNQGDSTYMFNLEGLIPKLCSLAQ  211



>ref|XP_002277870.1| PREDICTED: uncharacterized protein LOC100255472 isoform X1 [Vitis 
vinifera]
Length=1017

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 120/167 (72%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SRK+ PAC ++C  CPA+R RSRQP+KRYKKL++DIFP++ D   N RKI KLCEYA
Sbjct  6    GVISRKVLPACGNLCFLCPAMRPRSRQPLKRYKKLISDIFPRAQDEEPNDRKIGKLCEYA  65

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            AKNP RIPKI   LE+RCYKELRS + +   V+  +Y + L  CKEQM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITNSLEQRCYKELRSENFRSAKVVMCIYRKFLVSCKEQMPLFASSLLSIIH  125

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD A+ D ++ IGC T   F+ +Q DGTY  N+E  + K+C LA+
Sbjct  126  TLLDQARQDEMQIIGCQTLFDFVNNQRDGTYMCNLEGFIPKLCQLAQ  172



>ref|XP_004236620.1| PREDICTED: protein EFR3 homolog B isoform X2 [Solanum lycopersicum]
Length=1008

 Score =   194 bits (494),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 86/172 (50%), Positives = 125/172 (73%), Gaps = 0/172 (0%)
 Frame = +3

Query  96   LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  275
            + G  G++SR++ PAC S+C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVMSRQVLPACGSLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  276  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  455
            LCEYAAKNPFRIPKI K LEE+CYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEEKCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  456  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            L+V+  +LD ++ + +  +GC +   F+ +Q DGTY ++++  + K+C LA+
Sbjct  121  LSVLQTLLDQSRENDMLIVGCESLFDFVNNQKDGTYMFHLDGFIPKLCQLAQ  172



>ref|XP_010057221.1| PREDICTED: uncharacterized protein LOC104445096 isoform X2 [Eucalyptus 
grandis]
Length=1036

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 120/167 (72%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SR++ P C S+C  CPA+R+RSRQPVKRYKKL++DIFPK+ D   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCFFCPAMRARSRQPVKRYKKLISDIFPKNQDEEPNDRKIGKLCEYA  65

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            AKNP RIPKI   LE+RCYKELR+ + +   ++  +Y +LL  CK+QM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITSTLEQRCYKELRTENFRSAKIVMCIYRKLLVSCKDQMPLFASSLLSIIS  125

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD  + D ++ IGC     F+ +Q DGTY +N+E  + K+C LA+
Sbjct  126  TLLDQTRQDEMQLIGCQNLFDFVNNQGDGTYMFNLEGFIPKLCQLAQ  172



>ref|XP_007033975.1| ARM repeat superfamily protein isoform 5 [Theobroma cacao]
 gb|EOY04901.1| ARM repeat superfamily protein isoform 5 [Theobroma cacao]
Length=984

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 122/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ P C ++C  CP++R+RSRQPVKRYKKLLADIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPVCGNLCFFCPSMRARSRQPVKRYKKLLADIFPRNQDAEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A +NP RIPKI   LE+RCYK+LR+ +   V V+  +Y +LL  CKEQ+  FA +LL ++
Sbjct  61   ALRNPLRIPKITGQLEQRCYKDLRNENFGSVKVVLCIYRKLLSACKEQIPLFASSLLGII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + D ++ +GC    +FI SQVDGTY +N+E L+ K+C LA+
Sbjct  121  RTLLEQTRQDEMQILGCNALVEFINSQVDGTYMFNLEGLIPKLCQLAQ  168



>ref|XP_010319191.1| PREDICTED: protein EFR3 homolog B isoform X1 [Solanum lycopersicum]
 ref|XP_010319192.1| PREDICTED: protein EFR3 homolog B isoform X1 [Solanum lycopersicum]
Length=1012

 Score =   194 bits (494),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 86/172 (50%), Positives = 125/172 (73%), Gaps = 0/172 (0%)
 Frame = +3

Query  96   LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  275
            + G  G++SR++ PAC S+C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVMSRQVLPACGSLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  276  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  455
            LCEYAAKNPFRIPKI K LEE+CYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEEKCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  456  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            L+V+  +LD ++ + +  +GC +   F+ +Q DGTY ++++  + K+C LA+
Sbjct  121  LSVLQTLLDQSRENDMLIVGCESLFDFVNNQKDGTYMFHLDGFIPKLCQLAQ  172



>ref|XP_010057214.1| PREDICTED: uncharacterized protein LOC104445096 isoform X1 [Eucalyptus 
grandis]
Length=1045

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 120/167 (72%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SR++ P C S+C  CPA+R+RSRQPVKRYKKL++DIFPK+ D   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCFFCPAMRARSRQPVKRYKKLISDIFPKNQDEEPNDRKIGKLCEYA  65

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            AKNP RIPKI   LE+RCYKELR+ + +   ++  +Y +LL  CK+QM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITSTLEQRCYKELRTENFRSAKIVMCIYRKLLVSCKDQMPLFASSLLSIIS  125

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD  + D ++ IGC     F+ +Q DGTY +N+E  + K+C LA+
Sbjct  126  TLLDQTRQDEMQLIGCQNLFDFVNNQGDGTYMFNLEGFIPKLCQLAQ  172



>ref|XP_007033971.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007033972.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007033973.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007033974.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY04897.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY04898.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY04899.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY04900.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
Length=985

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 122/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ P C ++C  CP++R+RSRQPVKRYKKLLADIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPVCGNLCFFCPSMRARSRQPVKRYKKLLADIFPRNQDAEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A +NP RIPKI   LE+RCYK+LR+ +   V V+  +Y +LL  CKEQ+  FA +LL ++
Sbjct  61   ALRNPLRIPKITGQLEQRCYKDLRNENFGSVKVVLCIYRKLLSACKEQIPLFASSLLGII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + D ++ +GC    +FI SQVDGTY +N+E L+ K+C LA+
Sbjct  121  RTLLEQTRQDEMQILGCNALVEFINSQVDGTYMFNLEGLIPKLCQLAQ  168



>ref|XP_002322714.1| cyclin-related family protein [Populus trichocarpa]
 gb|EEF04475.1| cyclin-related family protein [Populus trichocarpa]
Length=1020

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            GL+SR++ PAC S+C  CPA+R+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GLVSRQVMPACGSLCFFCPAMRARSRQPVKRYKKLMADIFPRNQEEGPNDRKIGKLCEYA  65

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            AKNP RIPKI   LE+RCYKELR  + +   ++  +Y +LL  CKEQM  FA +LL ++ 
Sbjct  66   AKNPLRIPKITCSLEQRCYKELRIENFQSAKIVMCIYRKLLVTCKEQMTLFASSLLGIIN  125

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD  + D ++ IGC T   F+ +Q DGTY +N+E  + K+C  A+
Sbjct  126  TLLDQTRQDDIQVIGCETLFDFVNNQKDGTYMFNLEGFIPKLCQFAQ  172



>ref|XP_011075238.1| PREDICTED: uncharacterized protein LOC105159750 isoform X1 [Sesamum 
indicum]
 ref|XP_011075239.1| PREDICTED: uncharacterized protein LOC105159750 isoform X1 [Sesamum 
indicum]
Length=1012

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 121/167 (72%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SR++ PAC S+C  CPALRSRSRQPVKRYKKL++DIFP+S +   N RKI KLCEYA
Sbjct  6    GVISRQVLPACGSLCFFCPALRSRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGKLCEYA  65

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            AKNP RIPKIA  LE+RCYKELR+ + + V ++  +Y ++L  CKEQM  FA +++ ++ 
Sbjct  66   AKNPMRIPKIATSLEQRCYKELRNENFRSVKIVMCIYRKMLSSCKEQMPLFANSVMTIIQ  125

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD A  D +  IGC +   F+ +Q D TY +N+E  + K+C LA+
Sbjct  126  TLLDQANQDEMLIIGCESLFDFVNNQNDATYMFNLEGFITKLCQLAQ  172



>ref|XP_007225374.1| hypothetical protein PRUPE_ppa000810mg [Prunus persica]
 gb|EMJ26573.1| hypothetical protein PRUPE_ppa000810mg [Prunus persica]
Length=997

 Score =   194 bits (493),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 87/168 (52%), Positives = 121/168 (72%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ PAC ++C  CP++R+RSRQPVKRYKKLL DIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRIVPACGNLCFFCPSMRARSRQPVKRYKKLLTDIFPRNQDAEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A KNP RIPKI   LE+RCYK+LR+ H   V V+  +Y +LL  CKEQM  FA +LL +V
Sbjct  61   ALKNPLRIPKITDSLEQRCYKDLRNEHFGSVKVVLCIYRKLLSSCKEQMPLFASSLLGIV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + D ++ +GC T   FI SQ+D T+ +++E L+ K+C +A+
Sbjct  121  RILLEQNRHDEMRILGCNTLVDFINSQIDSTHMFSLEGLIPKLCQMAQ  168



>ref|XP_010319193.1| PREDICTED: protein EFR3 homolog B isoform X3 [Solanum lycopersicum]
Length=973

 Score =   194 bits (493),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 86/172 (50%), Positives = 125/172 (73%), Gaps = 0/172 (0%)
 Frame = +3

Query  96   LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  275
            + G  G++SR++ PAC S+C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVMSRQVLPACGSLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  276  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  455
            LCEYAAKNPFRIPKI K LEE+CYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEEKCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  456  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            L+V+  +LD ++ + +  +GC +   F+ +Q DGTY ++++  + K+C LA+
Sbjct  121  LSVLQTLLDQSRENDMLIVGCESLFDFVNNQKDGTYMFHLDGFIPKLCQLAQ  172



>ref|XP_008222533.1| PREDICTED: uncharacterized protein LOC103322398 [Prunus mume]
Length=997

 Score =   194 bits (493),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 87/168 (52%), Positives = 121/168 (72%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ PAC ++C  CP++R+RSRQPVKRYKKLL DIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRIVPACGNLCFFCPSMRARSRQPVKRYKKLLTDIFPRNQDAEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A KNP RIPKI   LE+RCYK+LR+ H   V V+  +Y +LL  CKEQM  FA +LL +V
Sbjct  61   ALKNPLRIPKITGSLEQRCYKDLRNEHFGSVKVVLCIYRKLLSSCKEQMPLFASSLLGIV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + D ++ +GC T   FI SQ+D T+ +++E L+ K+C +A+
Sbjct  121  RILLEQNRHDEMRILGCNTLVDFINSQIDSTHMFSLEGLIPKLCQMAQ  168



>ref|XP_011075240.1| PREDICTED: uncharacterized protein LOC105159750 isoform X2 [Sesamum 
indicum]
Length=1011

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 121/167 (72%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SR++ PAC S+C  CPALRSRSRQPVKRYKKL++DIFP+S +   N RKI KLCEYA
Sbjct  6    GVISRQVLPACGSLCFFCPALRSRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGKLCEYA  65

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            AKNP RIPKIA  LE+RCYKELR+ + + V ++  +Y ++L  CKEQM  FA +++ ++ 
Sbjct  66   AKNPMRIPKIATSLEQRCYKELRNENFRSVKIVMCIYRKMLSSCKEQMPLFANSVMTIIQ  125

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD A  D +  IGC +   F+ +Q D TY +N+E  + K+C LA+
Sbjct  126  TLLDQANQDEMLIIGCESLFDFVNNQNDATYMFNLEGFITKLCQLAQ  172



>ref|XP_006350204.1| PREDICTED: protein EFR3 homolog B-like isoform X1 [Solanum tuberosum]
Length=1008

 Score =   194 bits (493),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 86/172 (50%), Positives = 125/172 (73%), Gaps = 0/172 (0%)
 Frame = +3

Query  96   LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  275
            + G  G++SR++ PAC S+C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVMSRQVLPACGSLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  276  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  455
            LCEYAAKNPFRIPKI K LEE+CYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEEKCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  456  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            L+V+  +LD ++ + +  +GC +   F+ +Q DGTY ++++  + K+C LA+
Sbjct  121  LSVLQTLLDQSRENDMLIVGCESLFDFVNNQKDGTYMFHLDGFIPKLCQLAQ  172



>ref|XP_010523668.1| PREDICTED: protein EFR3 homolog isoform X2 [Tarenaya hassleriana]
Length=1019

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 118/168 (70%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR +FP CES+C  CPALR+RSR PVKRYKKLL+DIFP+SPD   N RKI KLCEY
Sbjct  1    MGVVSRTVFPVCESLCCFCPALRARSRHPVKRYKKLLSDIFPRSPDEQPNDRKISKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKN  RIPKI + LE+RCY++LR      V ++  +Y +LL  CKEQM+ FA + L ++
Sbjct  61   AAKNSLRIPKITRSLEQRCYRDLRMEQFHSVKIVMCIYKKLLVSCKEQMSLFASSYLGLI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ +GC     F+ +Q DGT+ +N++ L+  +C LA 
Sbjct  121  HILLDQTRHDEIRILGCEALYDFVNNQTDGTHMFNLDGLIPNICPLAH  168



>ref|XP_006345431.1| PREDICTED: uncharacterized protein LOC102584593 [Solanum tuberosum]
Length=1017

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 121/168 (72%), Gaps = 1/168 (1%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG+ S ++ PAC+ +C+CCPA+R+RSRQPVKRYKKL++D FP+SPDG  N R I KLCEY
Sbjct  1    MGI-SHQIMPACDQLCVCCPAMRTRSRQPVKRYKKLISDSFPRSPDGEPNERMINKLCEY  59

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI   LE+RCY+ELR+ +   V V+  +Y +LL  CK+QM  FA + L+++
Sbjct  60   ASKNPLRIPKITTVLEQRCYRELRNENLGSVKVVMCIYRKLLTSCKQQMPLFAGSFLSII  119

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++T+GC     FI +Q D TY +N E L+ K+C LA+
Sbjct  120  HILLDQMRHDEMRTVGCQALFDFIINQRDSTYMFNFEGLIPKICLLAQ  167



>gb|KEH23652.1| cyclin-like protein [Medicago truncatula]
Length=990

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 120/167 (72%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SR++ PAC S+C CCP+LR+RSRQPVKRYKKL+ADIFP++ +   N RKI KLC+Y 
Sbjct  6    GVVSRQVLPACGSLCFCCPSLRTRSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCDYV  65

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            AKNP RIPKI   LE+RCYKELR+ +     ++  +Y + L  CKEQM  FA ++L+++ 
Sbjct  66   AKNPLRIPKIVTALEQRCYKELRNENIHSTRIVMCIYKKFLSSCKEQMPLFASSILSIIQ  125

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD  + D ++ IGC     F+ +QVDGTY +N+E ++ K+C L +
Sbjct  126  ALLDQTRQDEMRVIGCNILFDFVNNQVDGTYLFNLEGVIPKLCQLTQ  172



>ref|XP_006350206.1| PREDICTED: protein EFR3 homolog B-like isoform X3 [Solanum tuberosum]
Length=969

 Score =   193 bits (491),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 86/172 (50%), Positives = 125/172 (73%), Gaps = 0/172 (0%)
 Frame = +3

Query  96   LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  275
            + G  G++SR++ PAC S+C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVMSRQVLPACGSLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  276  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  455
            LCEYAAKNPFRIPKI K LEE+CYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEEKCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  456  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            L+V+  +LD ++ + +  +GC +   F+ +Q DGTY ++++  + K+C LA+
Sbjct  121  LSVLQTLLDQSRENDMLIVGCESLFDFVNNQKDGTYMFHLDGFIPKLCQLAQ  172



>ref|XP_004229640.1| PREDICTED: protein EFR3 homolog B-like [Solanum lycopersicum]
Length=1018

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 121/168 (72%), Gaps = 1/168 (1%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG+ S ++ PAC+ +C+CCPA+R+RSRQPVKRYKKL++D FP+SPDG  N R I KLCEY
Sbjct  1    MGI-SHQIMPACDQLCVCCPAMRTRSRQPVKRYKKLISDSFPRSPDGEPNERMINKLCEY  59

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI   LE+RCY+ELR+ +   V V+  +Y +LL  CK+QM  FA + L+++
Sbjct  60   ASKNPLRIPKITTVLEQRCYRELRNENLGSVKVVMCIYRKLLTSCKQQMPLFAGSFLSII  119

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++T+GC     FI +Q D TY +N E L+ K+C LA+
Sbjct  120  HILLDQMRHDEMRTVGCQALFDFIINQRDSTYMFNFEGLIPKICLLAQ  167



>ref|XP_006657548.1| PREDICTED: uncharacterized protein LOC102712271 [Oryza brachyantha]
Length=1071

 Score =   194 bits (493),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 89/168 (53%), Positives = 118/168 (70%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+ PAC S+C  CPALR+RSRQPVKRYK +LA+IFPK+ D   N R+I KLCEY
Sbjct  1    MGVISRKVLPACGSLCYFCPALRARSRQPVKRYKTILAEIFPKTQDEEPNERRIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
             ++NP R+PKI   LE+R YKELR+       V+  +Y  LL  CKEQM  FA +LL++V
Sbjct  61   CSRNPLRVPKITVFLEQRIYKELRTEQYGFAKVVMLIYRRLLVSCKEQMPLFASSLLSIV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ IGC T   F  +QVDGTY +N+E LV ++C LA+
Sbjct  121  HTLLDQKRQDDMRIIGCETLFDFAVNQVDGTYQFNLEGLVPRLCELAQ  168



>ref|XP_010523667.1| PREDICTED: protein EFR3 homolog isoform X1 [Tarenaya hassleriana]
Length=1028

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 118/168 (70%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR +FP CES+C  CPALR+RSR PVKRYKKLL+DIFP+SPD   N RKI KLCEY
Sbjct  1    MGVVSRTVFPVCESLCCFCPALRARSRHPVKRYKKLLSDIFPRSPDEQPNDRKISKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKN  RIPKI + LE+RCY++LR      V ++  +Y +LL  CKEQM+ FA + L ++
Sbjct  61   AAKNSLRIPKITRSLEQRCYRDLRMEQFHSVKIVMCIYKKLLVSCKEQMSLFASSYLGLI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ +GC     F+ +Q DGT+ +N++ L+  +C LA 
Sbjct  121  HILLDQTRHDEIRILGCEALYDFVNNQTDGTHMFNLDGLIPNICPLAH  168



>ref|XP_006597228.1| PREDICTED: uncharacterized protein LOC100811354 isoform X1 [Glycine 
max]
 ref|XP_006597229.1| PREDICTED: uncharacterized protein LOC100811354 isoform X2 [Glycine 
max]
Length=967

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 121/168 (72%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ P C ++C+ CP+LR+RSRQPVKRYKK +ADIFP++     N RKI KLCEY
Sbjct  1    MGVMSRRVVPVCGNLCVFCPSLRARSRQPVKRYKKFIADIFPRNQAAEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI   LE+RCYK+LR+ +   V V+  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITDNLEQRCYKDLRNENYGSVKVVLCIYRKLLSTCKEQMPLFANSLLGII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + D ++ +GC T  +FI SQ DGTY +N+E  + K+C LA+
Sbjct  121  RTLLEQTRADEMQILGCNTLVEFIDSQTDGTYMFNLEGFIPKLCQLAQ  168



>ref|XP_002874031.1| hypothetical protein ARALYDRAFT_489019 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50290.1| hypothetical protein ARALYDRAFT_489019 [Arabidopsis lyrata subsp. 
lyrata]
Length=1027

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 116/168 (69%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR +FP CES+C  CPALR+RSR PVKRYK LLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRTVFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSQDEQPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKI   LE+RCYKELR      V ++  +Y +LL  C EQM+ FA + L ++
Sbjct  61   AAKNPLRIPKITTYLEQRCYKELRMEQFHSVKIVMSIYKKLLVSCNEQMSLFASSYLGLI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ +GC     F+ +Q +GTY +N++ L+ K+C LA 
Sbjct  121  HILLDQNRYDEMRILGCEALYDFVTNQAEGTYMFNLDGLIPKICPLAH  168



>ref|XP_009789122.1| PREDICTED: protein EFR3 homolog B isoform X2 [Nicotiana sylvestris]
Length=1010

 Score =   193 bits (491),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 85/172 (49%), Positives = 124/172 (72%), Gaps = 0/172 (0%)
 Frame = +3

Query  96   LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  275
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  276  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  455
            LCEYAAKNPFRIPKI K LEERCYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  456  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            L+++  +LD ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA+
Sbjct  121  LSIIQTLLDQSRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQ  172



>ref|XP_002975992.1| hypothetical protein SELMODRAFT_443103 [Selaginella moellendorffii]
 gb|EFJ22897.1| hypothetical protein SELMODRAFT_443103 [Selaginella moellendorffii]
Length=950

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 119/168 (71%), Gaps = 1/168 (1%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ P C  +C+CCP LR+RSRQPVKRYKKLL+D+FPKS     N RKI KL +Y
Sbjct  1    MGIISRRVLPLCGHLCVCCPGLRARSRQPVKRYKKLLSDLFPKSQAEQPNDRKISKLTDY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A KNPFRIPKIAK LE R YKELR  H   V VI   + +L   CK+QM   AV+ LN++
Sbjct  61   AVKNPFRIPKIAKNLELRGYKELRHEHHGSVRVIMRTFFKLFSTCKDQMPLLAVSALNMI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + D ++ +GC+T  +FIY QVD TY +N+++ + K C+LAR
Sbjct  121  HVLLE-QQNDEMRVLGCVTVVEFIYQQVDTTYMHNLDSFIPKFCALAR  167



>ref|XP_002968494.1| hypothetical protein SELMODRAFT_90004 [Selaginella moellendorffii]
 gb|EFJ30748.1| hypothetical protein SELMODRAFT_90004 [Selaginella moellendorffii]
Length=875

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 119/168 (71%), Gaps = 1/168 (1%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ P C  +C+CCP LR+RSRQPVKRYKKLL+D+FPKS     N RKI KL +Y
Sbjct  1    MGIISRRVLPLCGHLCVCCPGLRARSRQPVKRYKKLLSDLFPKSQAEQPNDRKISKLTDY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A KNPFRIPKIAK LE R YKELR  H   V VI   + +L   CK+QM   AV+ LN++
Sbjct  61   AVKNPFRIPKIAKNLELRGYKELRHEHYGSVRVIMRTFFKLFSTCKDQMPLLAVSALNMI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + D ++ +GC+T  +FIY QVD TY +N+++ + K C+LAR
Sbjct  121  HVLLE-QQNDEMRVLGCVTVVEFIYQQVDTTYMHNLDSFIPKFCALAR  167



>ref|XP_009789120.1| PREDICTED: protein EFR3 homolog B isoform X1 [Nicotiana sylvestris]
 ref|XP_009789121.1| PREDICTED: protein EFR3 homolog B isoform X1 [Nicotiana sylvestris]
Length=1012

 Score =   193 bits (491),  Expect = 4e-53, Method: Composition-based stats.
 Identities = 85/172 (49%), Positives = 124/172 (72%), Gaps = 0/172 (0%)
 Frame = +3

Query  96   LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  275
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  276  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  455
            LCEYAAKNPFRIPKI K LEERCYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  456  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            L+++  +LD ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA+
Sbjct  121  LSIIQTLLDQSRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQ  172



>ref|XP_009789124.1| PREDICTED: protein EFR3 homolog B isoform X3 [Nicotiana sylvestris]
Length=1008

 Score =   193 bits (491),  Expect = 4e-53, Method: Composition-based stats.
 Identities = 85/172 (49%), Positives = 124/172 (72%), Gaps = 0/172 (0%)
 Frame = +3

Query  96   LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  275
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  276  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  455
            LCEYAAKNPFRIPKI K LEERCYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  456  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            L+++  +LD ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA+
Sbjct  121  LSIIQTLLDQSRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQ  172



>ref|XP_006489936.1| PREDICTED: uncharacterized protein LOC102624456 [Citrus sinensis]
Length=1039

 Score =   193 bits (491),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 120/167 (72%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SRK+ PAC  +C  CPA+R+RSRQPVKRYKKL++DIFP++ D   N RKI KLCEYA
Sbjct  6    GVISRKVLPACGRLCFFCPAMRARSRQPVKRYKKLISDIFPRNQDEGPNDRKIGKLCEYA  65

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
             KNP RIPKI   LE+RCYKELR+ + +   ++  +Y +LL  CKEQM  FA +LL ++ 
Sbjct  66   NKNPLRIPKITTSLEQRCYKELRNENFQSAKIVMCIYRKLLISCKEQMPLFASSLLTIIH  125

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD  + D ++ IGC+T   F+ +Q DGTY +N+E  + K+C L++
Sbjct  126  TLLDQTRQDEIQIIGCMTLFDFVNNQKDGTYMFNLECFIPKLCQLSQ  172



>ref|XP_009789125.1| PREDICTED: protein EFR3 homolog B isoform X4 [Nicotiana sylvestris]
Length=973

 Score =   193 bits (490),  Expect = 4e-53, Method: Composition-based stats.
 Identities = 85/172 (49%), Positives = 124/172 (72%), Gaps = 0/172 (0%)
 Frame = +3

Query  96   LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  275
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  276  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  455
            LCEYAAKNPFRIPKI K LEERCYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  456  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            L+++  +LD ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA+
Sbjct  121  LSIIQTLLDQSRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQ  172



>ref|XP_003540587.1| PREDICTED: uncharacterized protein LOC100816475 [Glycine max]
Length=1037

 Score =   193 bits (491),  Expect = 5e-53, Method: Composition-based stats.
 Identities = 85/168 (51%), Positives = 121/168 (72%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            M ++SR ++P C S+C  CPALR RSR P+KRYKKLLADIFP++PD   N R I KLCEY
Sbjct  1    MSVISRNIWPVCGSLCCFCPALRERSRHPIKRYKKLLADIFPRTPDEEPNERMISKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP R+PKI   LE+RCY+ELR+ + + V V+  +Y +LL  CK+QM  FA +LL+++
Sbjct  61   ASKNPLRVPKITSYLEQRCYRELRTENYQSVKVVICIYRKLLISCKDQMPLFASSLLSII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D V+ +GC T   F+ +Q DGTY +N++  + K+C+LA+
Sbjct  121  QILLDQPRQDEVQILGCQTLFDFVNNQRDGTYMFNLDGFILKLCNLAQ  168



>ref|XP_009610943.1| PREDICTED: protein EFR3 homolog B isoform X3 [Nicotiana tomentosiformis]
Length=1010

 Score =   193 bits (490),  Expect = 5e-53, Method: Composition-based stats.
 Identities = 85/172 (49%), Positives = 124/172 (72%), Gaps = 0/172 (0%)
 Frame = +3

Query  96   LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  275
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  276  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  455
            LCEYAAKNPFRIPKI K LEERCYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  456  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            L+++  +LD ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA+
Sbjct  121  LSIIQTLLDQSRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQ  172



>ref|XP_010930207.1| PREDICTED: uncharacterized protein LOC105051451 [Elaeis guineensis]
Length=1016

 Score =   193 bits (490),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 119/168 (71%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ PAC ++C  CP++R+RSRQPVKRYKKL+AD FPK+P+G  N R I KLCEY
Sbjct  1    MGMVSRQVLPACGNLCFLCPSMRARSRQPVKRYKKLIADSFPKTPEGEPNNRMIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A KNP RIPKI +CLE++ YK LR+ H  L  V+  +Y  LL  CKEQM  FA +LL+V+
Sbjct  61   ACKNPMRIPKITECLEQKFYKALRNEHFSLAKVVPCIYRTLLASCKEQMPLFAPSLLSVI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              + D  + D ++ +GC T   F+ SQ D T+ +N+E L+ K+C L +
Sbjct  121  RTLFDQTRQDDMRILGCHTVVDFLNSQKDSTFMFNLEGLIPKLCQLGQ  168



>ref|XP_009610919.1| PREDICTED: protein EFR3 homolog B isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009610926.1| PREDICTED: protein EFR3 homolog B isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009610931.1| PREDICTED: protein EFR3 homolog B isoform X1 [Nicotiana tomentosiformis]
Length=1014

 Score =   193 bits (490),  Expect = 5e-53, Method: Composition-based stats.
 Identities = 85/172 (49%), Positives = 124/172 (72%), Gaps = 0/172 (0%)
 Frame = +3

Query  96   LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  275
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  276  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  455
            LCEYAAKNPFRIPKI K LEERCYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  456  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            L+++  +LD ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA+
Sbjct  121  LSIIQTLLDQSRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQ  172



>ref|XP_004951914.1| PREDICTED: uncharacterized protein LOC101783143 isoform X1 [Setaria 
italica]
Length=1032

 Score =   193 bits (490),  Expect = 5e-53, Method: Composition-based stats.
 Identities = 85/167 (51%), Positives = 117/167 (70%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SRK+ PAC  +C  CP+LR RSRQPVKRYKK++ADIFP S +   N R+I KLCEY 
Sbjct  9    GMVSRKVLPACGGLCYLCPSLRPRSRQPVKRYKKIIADIFPSSQEDEPNERRIGKLCEYV  68

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            A+NP R+PKI   LE+RCYKELRS H     V+  +Y  LL  CKEQ+   A +LL+++ 
Sbjct  69   ARNPQRVPKITDYLEQRCYKELRSEHYGYAKVVVLIYRRLLVSCKEQIPLLASSLLSIIQ  128

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD ++ D ++ IGC     F+ +QVDGTY +N+E LV ++C L++
Sbjct  129  TLLDQSRQDDMRIIGCEALFDFVVTQVDGTYQFNLEELVPRLCKLSQ  175



>ref|XP_009789839.1| PREDICTED: protein EFR3 homolog B-like isoform X1 [Nicotiana 
sylvestris]
Length=1029

 Score =   193 bits (490),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 120/168 (71%), Gaps = 1/168 (1%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG+ S ++ PAC+ +C+CCPA+R+RSRQPVKRYKKL++D FP+SPDG  N R I KLCEY
Sbjct  1    MGI-SHRIMPACDQLCVCCPAMRTRSRQPVKRYKKLISDSFPRSPDGEPNDRMINKLCEY  59

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI   LE+RCY+ELR+ +   V V+  +Y +LL  CK+QM  FA + L+++
Sbjct  60   ASKNPLRIPKITSVLEQRCYRELRNENIGSVKVVMCIYRKLLTSCKQQMPLFAGSFLSII  119

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ +GC     FI +Q D TY +N E L+ K+C LA+
Sbjct  120  HILLDQTRHDEMRIVGCQALFDFIINQRDSTYMFNFEGLIPKICLLAQ  167



>ref|XP_002308951.2| cyclin-related family protein [Populus trichocarpa]
 gb|EEE92474.2| cyclin-related family protein [Populus trichocarpa]
Length=901

 Score =   192 bits (488),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SR++ PAC S+C  CPA+R+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GVISRQVMPACGSLCFFCPAMRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYA  65

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            AKNP RIPKI   LE+RCYKELR  + +   ++  +Y +LL  CKEQM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITSSLEQRCYKELRIENFQSAKIVMCIYRKLLITCKEQMPLFASSLLSIIS  125

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD  + D ++ IGC T   F+ +Q DGT+ +N+E  + K+C   +
Sbjct  126  TLLDQTRQDDIQVIGCETLFDFVNNQNDGTFMFNLEGFIPKLCQFTQ  172



>ref|XP_009610937.1| PREDICTED: protein EFR3 homolog B isoform X2 [Nicotiana tomentosiformis]
Length=1012

 Score =   193 bits (490),  Expect = 5e-53, Method: Composition-based stats.
 Identities = 85/172 (49%), Positives = 124/172 (72%), Gaps = 0/172 (0%)
 Frame = +3

Query  96   LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  275
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  276  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  455
            LCEYAAKNPFRIPKI K LEERCYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  456  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            L+++  +LD ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA+
Sbjct  121  LSIIQTLLDQSRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQ  172



>ref|XP_006400678.1| hypothetical protein EUTSA_v10012553mg [Eutrema salsugineum]
 gb|ESQ42131.1| hypothetical protein EUTSA_v10012553mg [Eutrema salsugineum]
Length=1020

 Score =   193 bits (490),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 118/168 (70%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR +FP CES+C  CPALR+RSR PVKRYK LLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRTVFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSLDEQPNDRKISKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKI   LE+RCY+ELR+     V ++  +Y +LL  C EQM+ FA + L ++
Sbjct  61   AAKNPLRIPKITTSLEQRCYRELRTEQFHSVKIVMCIYKKLLVSCNEQMSLFASSYLGLI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD ++ D ++ +GC     F+ +Q +GTY +N++ L+ K+C LA 
Sbjct  121  HILLDQSRHDEMRVLGCEALYDFVTNQTEGTYMFNLDALIPKICPLAH  168



>ref|XP_009610957.1| PREDICTED: protein EFR3 homolog B isoform X5 [Nicotiana tomentosiformis]
Length=975

 Score =   192 bits (489),  Expect = 5e-53, Method: Composition-based stats.
 Identities = 85/172 (49%), Positives = 124/172 (72%), Gaps = 0/172 (0%)
 Frame = +3

Query  96   LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  275
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  276  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  455
            LCEYAAKNPFRIPKI K LEERCYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  456  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            L+++  +LD ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA+
Sbjct  121  LSIIQTLLDQSRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQ  172



>ref|XP_009610949.1| PREDICTED: protein EFR3 homolog B isoform X4 [Nicotiana tomentosiformis]
Length=1008

 Score =   193 bits (490),  Expect = 5e-53, Method: Composition-based stats.
 Identities = 85/172 (49%), Positives = 124/172 (72%), Gaps = 0/172 (0%)
 Frame = +3

Query  96   LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  275
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  276  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  455
            LCEYAAKNPFRIPKI K LEERCYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  456  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
            L+++  +LD ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA+
Sbjct  121  LSIIQTLLDQSRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQ  172



>ref|XP_001767624.1| predicted protein [Physcomitrella patens]
 gb|EDQ67583.1| predicted protein [Physcomitrella patens]
Length=790

 Score =   191 bits (485),  Expect = 6e-53, Method: Composition-based stats.
 Identities = 87/168 (52%), Positives = 116/168 (69%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MGL+SR++ P C SMC+CCPALR+RSRQPVKRY  LLADI+PKS D + N RKI KL EY
Sbjct  1    MGLISRRVLPICGSMCVCCPALRARSRQPVKRYNMLLADIYPKSQDEAPNDRKIGKLVEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKIA  LE++ YKEL++ H   V  +   +++L   C+++M+ FA N LN++
Sbjct  61   AAKNPLRIPKIAGALEQKGYKELKADHFGTVTTVMRAFSKLFIDCRDEMSLFANNALNLI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD      ++ +GCLT   FI  Q D TY  N++ L   +C+LAR
Sbjct  121  KVLLDQVAHGNMRIVGCLTLVDFIRVQTDATYMRNLDGLTLPLCALAR  168



>ref|XP_009789840.1| PREDICTED: protein EFR3 homolog B-like isoform X2 [Nicotiana 
sylvestris]
Length=1028

 Score =   193 bits (490),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 120/168 (71%), Gaps = 1/168 (1%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG+ S ++ PAC+ +C+CCPA+R+RSRQPVKRYKKL++D FP+SPDG  N R I KLCEY
Sbjct  1    MGI-SHRIMPACDQLCVCCPAMRTRSRQPVKRYKKLISDSFPRSPDGEPNDRMINKLCEY  59

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI   LE+RCY+ELR+ +   V V+  +Y +LL  CK+QM  FA + L+++
Sbjct  60   ASKNPLRIPKITSVLEQRCYRELRNENIGSVKVVMCIYRKLLTSCKQQMPLFAGSFLSII  119

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ +GC     FI +Q D TY +N E L+ K+C LA+
Sbjct  120  HILLDQTRHDEMRIVGCQALFDFIINQRDSTYMFNFEGLIPKICLLAQ  167



>ref|XP_007028781.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY09283.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=1023

 Score =   192 bits (489),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 124/167 (74%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SR++ PAC S+C  CPA+R+RSRQPVKRYKKL+A+IFP++ +  AN RKI KLC+YA
Sbjct  6    GVISRQVLPACGSLCFFCPAMRARSRQPVKRYKKLIAEIFPRNQEEGANDRKIGKLCDYA  65

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            +KNP RIPKI+  LE+RCYKELR+ + +   ++  +Y +LL  CKEQM  FA +LL+++ 
Sbjct  66   SKNPLRIPKISNSLEQRCYKELRNENFQSAKIVMCIYRKLLVSCKEQMTLFASSLLSIIQ  125

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD  + D ++ +GC T   F+ +Q DGT+ +N+E  + K+C LA+
Sbjct  126  TLLDQTRQDEMRIMGCQTLFDFVNNQKDGTFMFNLEGFIPKLCQLAQ  172



>ref|XP_011048039.1| PREDICTED: uncharacterized protein LOC105142218 [Populus euphratica]
Length=1022

 Score =   192 bits (489),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SR++ PAC S+C  CPA+R+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GVISRQVMPACGSLCFFCPAMRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYA  65

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            AKNP RIPKI   LE+RCYKELR  + +   ++  +Y +LL  CKEQM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITSSLEQRCYKELRIENFQSAKIVMCIYRKLLITCKEQMPLFASSLLSIIS  125

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD  + D ++ IGC T   F+ +Q DGT+ +N+E  + K+C   +
Sbjct  126  TLLDQTRQDDIQVIGCETLFDFVNNQNDGTFMFNLEGFIPKLCQFTQ  172



>ref|XP_011033324.1| PREDICTED: protein EFR3 homolog B-like isoform X2 [Populus euphratica]
Length=1010

 Score =   192 bits (488),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 118/167 (71%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            GL+SR++ PAC S+C  CPA+R+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GLVSRQVMPACGSLCFFCPAMRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYA  65

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            AKNP RIPKI   LE+RCYKELR  + +   ++  +Y +LL  CKE M  FA +LL ++ 
Sbjct  66   AKNPLRIPKITCSLEQRCYKELRIENFQSAKIVMCIYRKLLVTCKEHMTLFASSLLGIIN  125

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD  + D ++ IGC T   F+ +Q DGTY +N+E  + K+C  A+
Sbjct  126  TLLDQTRQDDIQVIGCETLFDFVNNQKDGTYMFNLEGFIPKLCQFAQ  172



>ref|XP_006478683.1| PREDICTED: uncharacterized protein LOC102614635 isoform X1 [Citrus 
sinensis]
 ref|XP_006478684.1| PREDICTED: uncharacterized protein LOC102614635 isoform X2 [Citrus 
sinensis]
 ref|XP_006478685.1| PREDICTED: uncharacterized protein LOC102614635 isoform X3 [Citrus 
sinensis]
Length=1000

 Score =   192 bits (488),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 120/168 (71%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ P C ++C  CP++R+RSRQPVKRYKK+LADIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVLPVCGNLCFFCPSMRARSRQPVKRYKKMLADIFPRNQDAEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI   LE+RCYK+LR+ +   V V+  +Y + L  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITTLLEQRCYKDLRNENFGSVKVVVCIYKKFLSSCKEQMPLFASSLLGII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + + ++ +GC T   FI SQ D TY +N+E L+ K+C LA+
Sbjct  121  RTLLEQTRQEEMQILGCGTLVNFIDSQTDSTYMFNLEGLIPKLCQLAQ  168



>ref|XP_011033323.1| PREDICTED: uncharacterized protein LOC105131844 isoform X1 [Populus 
euphratica]
Length=1018

 Score =   192 bits (488),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 118/167 (71%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            GL+SR++ PAC S+C  CPA+R+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GLVSRQVMPACGSLCFFCPAMRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYA  65

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            AKNP RIPKI   LE+RCYKELR  + +   ++  +Y +LL  CKE M  FA +LL ++ 
Sbjct  66   AKNPLRIPKITCSLEQRCYKELRIENFQSAKIVMCIYRKLLVTCKEHMTLFASSLLGIIN  125

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD  + D ++ IGC T   F+ +Q DGTY +N+E  + K+C  A+
Sbjct  126  TLLDQTRQDDIQVIGCETLFDFVNNQKDGTYMFNLEGFIPKLCQFAQ  172



>gb|KJB71806.1| hypothetical protein B456_011G143200 [Gossypium raimondii]
Length=778

 Score =   191 bits (484),  Expect = 9e-53, Method: Composition-based stats.
 Identities = 83/168 (49%), Positives = 121/168 (72%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ PAC ++C  CP++R+RSRQPVKRYKKLLA+IFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGNLCFFCPSMRARSRQPVKRYKKLLAEIFPRNQDAEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A++NP RIPKI   LE+RC+K+LR+ +   V  +  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ASRNPLRIPKITSNLEQRCFKDLRNENFGCVKAVLCIYRKLLSSCKEQMPLFASSLLGII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + D ++ +GC     FI SQ+DGT+ + +E L+ K+C LA+
Sbjct  121  RALLEQNRQDEMRILGCNALVDFINSQMDGTHMFQLEGLIPKLCQLAQ  168



>ref|XP_006648302.1| PREDICTED: uncharacterized protein LOC102704216 [Oryza brachyantha]
Length=1039

 Score =   192 bits (489),  Expect = 9e-53, Method: Composition-based stats.
 Identities = 87/167 (52%), Positives = 117/167 (70%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SRK+ PAC  +C  CP LR+RSRQPVKRYKK+LADIFP + +   N R+I KLCEY 
Sbjct  12   GVVSRKVLPACGGLCYLCPGLRARSRQPVKRYKKILADIFPATQEEEPNVRRIGKLCEYV  71

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            AKNP R+PKI   LE+RCYKELR+     V V+  +Y +LL  CK+QM   A ++L+++ 
Sbjct  72   AKNPHRVPKITAYLEQRCYKELRNEQYGFVKVVVLIYRKLLVSCKDQMPLLASSVLSIIS  131

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD  + D ++ IGC T   F  SQVDGTY +N+E LV ++C LA+
Sbjct  132  TLLDQTRRDDLRIIGCETLFDFTVSQVDGTYQFNLEELVPRICELAQ  178



>gb|EEC81712.1| hypothetical protein OsI_25322 [Oryza sativa Indica Group]
Length=1066

 Score =   192 bits (489),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 88/168 (52%), Positives = 117/168 (70%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+ PAC S+C  CP LR+RSRQPVKRYK +LA+IFPK+ D   N R+I KLCEY
Sbjct  1    MGVISRKVLPACGSLCYFCPGLRARSRQPVKRYKSILAEIFPKTQDEEPNERRIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
             ++NP R+PKI   LE+R YKELRS       V+  +Y  LL  CKEQM  FA +LL++V
Sbjct  61   CSRNPLRVPKITVSLEQRIYKELRSEQYGFAKVVMLIYRRLLVSCKEQMPLFASSLLSIV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ IGC T   F  +QVDGTY +N+E LV ++C L++
Sbjct  121  HTLLDQKRQDDMRIIGCETLFDFAVNQVDGTYQFNLEGLVPRLCELSQ  168



>ref|NP_001059150.1| Os07g0205900 [Oryza sativa Japonica Group]
 dbj|BAC83231.1| cyclin-like protein [Oryza sativa Japonica Group]
 dbj|BAF21064.1| Os07g0205900 [Oryza sativa Japonica Group]
 dbj|BAG91832.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66774.1| hypothetical protein OsJ_23500 [Oryza sativa Japonica Group]
Length=1066

 Score =   192 bits (489),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 88/168 (52%), Positives = 117/168 (70%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+ PAC S+C  CP LR+RSRQPVKRYK +LA+IFPK+ D   N R+I KLCEY
Sbjct  1    MGVISRKVLPACGSLCYFCPGLRARSRQPVKRYKSILAEIFPKTQDEEPNERRIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
             ++NP R+PKI   LE+R YKELRS       V+  +Y  LL  CKEQM  FA +LL++V
Sbjct  61   CSRNPLRVPKITVSLEQRIYKELRSEQYGFAKVVMLIYRRLLVSCKEQMPLFASSLLSIV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ IGC T   F  +QVDGTY +N+E LV ++C L++
Sbjct  121  HTLLDQKRQDDMRIIGCETLFDFAVNQVDGTYQFNLEGLVPRLCELSQ  168



>ref|XP_002517810.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44617.1| conserved hypothetical protein [Ricinus communis]
Length=1025

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 120/166 (72%), Gaps = 2/166 (1%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSA--NGRKIMKLC  281
            M ++S ++ PAC+S+C  CPALR+RSRQP+KRYKKLLADIFP++P G    N RKI KLC
Sbjct  1    MSVISTQVMPACDSLCFFCPALRTRSRQPIKRYKKLLADIFPRAPVGEEQLNDRKIGKLC  60

Query  282  EYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLN  461
            EYAAKNP RIPKI   LE+RCYK+LRS   + V ++  +Y +LL  CKEQM  FA +LL+
Sbjct  61   EYAAKNPLRIPKITSSLEQRCYKDLRSEQFQSVKIVMCIYRKLLISCKEQMPLFASSLLS  120

Query  462  VVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVC  599
            ++  +LD  + D ++ +GC     F+ +Q DGTY +N++ L+ K+C
Sbjct  121  IIHILLDQTRHDDIRILGCQVLFDFVNNQRDGTYVFNLDGLIPKLC  166



>emb|CDP18636.1| unnamed protein product [Coffea canephora]
Length=1027

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 120/167 (72%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SR++ PAC S+C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI KLCEYA
Sbjct  6    GVISRQVLPACGSLCFFCPAMRARSRQPVKRYKKLISDIFPRSQEEEPNERKISKLCEYA  65

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            AKNP RIPKI   LE+RCYKE+R+ + + V ++  +Y +LL  CKEQM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITTSLEQRCYKEIRNENFRSVKIVMSIYRKLLISCKEQMPLFANSLLSIIH  125

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +L+  + D +   GC +   F+ +Q DGTY +N+E  + K+C  A+
Sbjct  126  TLLEQTRQDDILITGCQSLFDFVNNQKDGTYMFNLEGFIPKLCQFAQ  172



>gb|KFK26320.1| hypothetical protein AALP_AA8G232400 [Arabis alpina]
Length=1061

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 116/168 (69%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR +FP CES+C  CPALR+RSR PVKRYK LLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRTVFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSVDEQPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKI   LE+RCY+ELR      V ++  +Y +LL  C EQM+ FA + L ++
Sbjct  61   AAKNPLRIPKITTSLEQRCYRELRMEQFHSVKIVMCIYKKLLVACNEQMSLFASSYLGLI  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ +GC     F+ +Q +GTY +N++ L+ K+C LA 
Sbjct  121  HILLDQTRHDEMRILGCEALYDFVTNQAEGTYMFNLDGLIPKICPLAH  168



>ref|XP_009363645.1| PREDICTED: uncharacterized protein LOC103953608 [Pyrus x bretschneideri]
 ref|XP_009363646.1| PREDICTED: uncharacterized protein LOC103953608 [Pyrus x bretschneideri]
Length=997

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 118/168 (70%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ PAC ++C  CP++R+RSRQPVKRYKKLL DI P++ D   N RKI KLC+Y
Sbjct  1    MGVMSRRIVPACGNLCFFCPSMRARSRQPVKRYKKLLTDILPRNQDAEPNDRKIGKLCDY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A KNP RIPKI   LE+RCYK+LR+ H   V V+  +Y +LL  CKEQM  FA +LL +V
Sbjct  61   AMKNPLRIPKITDSLEQRCYKDLRNEHFGSVKVVLCIYRKLLSSCKEQMPLFASSLLGIV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + D ++ +GC T   FI SQ D T+ +++E L+ KVC +A 
Sbjct  121  RILLEQTRHDEMRILGCNTLVDFIQSQTDSTHMFSLEGLIPKVCQMAE  168



>dbj|BAK04246.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1037

 Score =   191 bits (486),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 85/167 (51%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SRK+ PAC  +C  CP+LR+RSRQPVKRYKK+LA+IFP + +   N R+I KLC+Y 
Sbjct  27   GVVSRKVLPACGGLCYFCPSLRARSRQPVKRYKKILAEIFPATQEEEPNERRIGKLCDYV  86

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            A+NP R+PKI + LE+RCYKELR      V V+  +Y +LL  CK+QM   A +LL+++ 
Sbjct  87   ARNPHRVPKITEYLEQRCYKELRKEQYGFVKVVVLIYRKLLVSCKDQMPLLASSLLSIIC  146

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD  + D ++ IGC T   F+ +QVDGTY +N+E LV K+C LA+
Sbjct  147  TLLDRMRHDDMRIIGCETLFDFVVTQVDGTYQFNLEELVPKLCELAQ  193



>ref|XP_006648006.1| PREDICTED: protein EFR3 homolog B-like isoform X1 [Oryza brachyantha]
Length=997

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 122/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ PACE +C  CP+LR+RSR PVKRYKKLL++IFPKS D   N RKI KLCEY
Sbjct  3    MGVVSREVLPACERLCFLCPSLRTRSRHPVKRYKKLLSEIFPKSQDEEPNDRKIGKLCEY  62

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
             ++NP R+PKI   LE++ YKELR+ H   V V+  +Y +++C C+EQ+  FA +LLN++
Sbjct  63   ISRNPLRVPKITVYLEQKFYKELRAEHFGSVKVVMAIYRKVICSCQEQLPLFANSLLNII  122

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + D ++TI C T   F+ +QVD TY +N+E+ + K+C LA+
Sbjct  123  EALLEQNRHDDLRTIACQTLFYFVNNQVDSTYMFNLESQIPKLCHLAQ  170



>ref|XP_006587694.1| PREDICTED: uncharacterized protein LOC100808352 [Glycine max]
Length=1036

 Score =   191 bits (485),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 84/168 (50%), Positives = 120/168 (71%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            M ++SR ++P C S+C  CPALR RSR P+KRYKK LADIFP++PD   N R I KLCEY
Sbjct  1    MSVISRNIWPVCGSLCCFCPALRERSRHPIKRYKKFLADIFPRTPDEEPNERMIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP R+PKI   LE+RCY+ELR+ + + V V+  +Y +LL  CK+QM  FA +LL+++
Sbjct  61   ASKNPLRVPKITSYLEQRCYRELRTENYQSVKVVICIYRKLLISCKDQMPLFASSLLSII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D V+ +GC T   F+ +Q DGTY +N++  + K+C+LA+
Sbjct  121  QILLDQPRHDEVQILGCQTLFDFVNNQRDGTYMFNLDGFILKLCNLAQ  168



>ref|XP_011087843.1| PREDICTED: uncharacterized protein LOC105169196 [Sesamum indicum]
Length=1011

 Score =   191 bits (484),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 121/168 (72%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++S+++ P C+S+CICCP +R RSR PVKRYKKLLADI+PK+ +   N RKI KLCEY
Sbjct  1    MGVMSKRMMPVCDSLCICCPGMRPRSRHPVKRYKKLLADIYPKNMEEEPNDRKISKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP R+PKI   LEERCY+ELR+ +   V V+  +Y +L+  C++QM  FA + L+++
Sbjct  61   ASKNPLRVPKITSLLEERCYRELRNENINCVKVVMCIYRKLVVSCQQQMPLFAGSFLSII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ IGC     FI +Q DGTY +N+E L+ K+C +A+
Sbjct  121  HILLDQTRHDEMRIIGCHALFDFINNQRDGTYMFNLEGLIPKLCLIAQ  168



>ref|XP_008790619.1| PREDICTED: uncharacterized protein LOC103707766 isoform X2 [Phoenix 
dactylifera]
Length=1021

 Score =   191 bits (484),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 117/168 (70%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ PAC S+C  CP+LR+RSR PVKRYKKLLA+I P+  DG  N R I KLCEY
Sbjct  1    MGVMSRRVLPACASLCCFCPSLRARSRLPVKRYKKLLANILPQFLDGEPNDRMISKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
             +KNP RIPKI KCLE+R YKELR+ H  L   +  +Y  LL  CKEQM+ FA +LL +V
Sbjct  61   TSKNPMRIPKITKCLEQRFYKELRNEHFCLAKAVPCIYRRLLASCKEQMSLFAPSLLGIV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D +  +GCL    F+ SQVDGTY  N+E L+ K+C L +
Sbjct  121  RTLLDQTQEDDMCILGCLMLVDFLNSQVDGTYMANVEGLIPKLCHLGQ  168



>ref|NP_001048304.1| Os02g0780500 [Oryza sativa Japonica Group]
 dbj|BAD19529.1| cyclin-like protein [Oryza sativa Japonica Group]
 dbj|BAF10218.1| Os02g0780500 [Oryza sativa Japonica Group]
 dbj|BAH00340.1| unnamed protein product [Oryza sativa Japonica Group]
Length=997

 Score =   190 bits (483),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 121/168 (72%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ PACE +C  CP+LR+RSR PVKRYKKLL++IFPKS D   N RKI KLCEY
Sbjct  3    MGVVSREVLPACERLCFLCPSLRTRSRHPVKRYKKLLSEIFPKSQDEEPNDRKIGKLCEY  62

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
             ++NP R+PKI   LE++ YKELR  H   V V+  +Y +++C C+EQ+  FA +LLN+V
Sbjct  63   ISRNPLRVPKITVYLEQKFYKELRVEHFGSVKVVMAIYRKVICSCQEQLPLFANSLLNIV  122

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + D ++TI C T   F+ +QVD TY +N+E+ + K+C LA+
Sbjct  123  EALLEQNRQDDLRTIACRTLFYFVNNQVDSTYMFNLESQIPKLCQLAQ  170



>gb|EMS53000.1| Protein EFR3-like protein B [Triticum urartu]
Length=1041

 Score =   190 bits (483),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 88/168 (52%), Positives = 117/168 (70%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+ PAC ++C  CP LR+RSRQPVKRYKK+LA+IFP++ D   N R+I KLCEY
Sbjct  1    MGVISRKVLPACGALCYFCPGLRARSRQPVKRYKKILAEIFPRTQDEEPNERRIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP R+PKI   LE+R YKELR+       V+  +Y  LL  CKEQM   A +LL++V
Sbjct  61   AAKNPLRVPKITVYLEQRIYKELRAEQYGFAKVVMLIYRRLLVSCKEQMPLLASSLLSIV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ I C T   F  +QVDGTY +N+E LV ++C LA+
Sbjct  121  HTLLDQKRQDDMRIIACETLFDFAVNQVDGTYQFNLEGLVPRLCELAQ  168



>ref|XP_002529611.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32756.1| conserved hypothetical protein [Ricinus communis]
Length=985

 Score =   190 bits (482),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 121/167 (72%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SR++ PAC S+C  CPA+R+RSRQP+KRYKKL+A+IFP++PD   N R I +LCEYA
Sbjct  6    GVVSRQVLPACGSLCFFCPAMRARSRQPIKRYKKLIANIFPRNPDDGPNDRMIGRLCEYA  65

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            AKNP RIPKI   LE+RCYKELR+ + +   ++  +Y +LL  C+EQM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITNSLEQRCYKELRNENFQSAKIVMCIYRKLLISCREQMPLFASSLLSIMH  125

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD  + D ++ +GC T   F+ +Q DGTY +N++  + K+C  A+
Sbjct  126  TLLDQTRQDELQIVGCETLFDFVTNQKDGTYLFNLDGFIPKLCQSAQ  172



>ref|XP_004493504.1| PREDICTED: uncharacterized protein LOC101511203 isoform X1 [Cicer 
arietinum]
Length=1013

 Score =   190 bits (483),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 122/167 (73%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SR++ PAC S+C  CPALR+RSRQPVKRYKKL+A+IFP++ +   N RKI KLC+YA
Sbjct  7    GVVSRQVLPACGSLCFFCPALRARSRQPVKRYKKLIAEIFPRNQEEGLNDRKIGKLCDYA  66

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            AKNP RIPKI   LE+RCYKELR+ + +   ++  +Y + L  CKEQM  FA +LL+++ 
Sbjct  67   AKNPLRIPKIVNALEQRCYKELRNENFRSTRIVMCIYKKFLSSCKEQMPLFASSLLSIIH  126

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD  + D ++ IGC     F+ +QVDG+Y +++E ++ K+C LA+
Sbjct  127  TLLDQTRQDEMRVIGCNILFDFVNNQVDGSYLFSLEGVIPKLCQLAQ  173



>ref|XP_004493505.1| PREDICTED: uncharacterized protein LOC101511203 isoform X2 [Cicer 
arietinum]
Length=1012

 Score =   190 bits (482),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 122/167 (73%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SR++ PAC S+C  CPALR+RSRQPVKRYKKL+A+IFP++ +   N RKI KLC+YA
Sbjct  7    GVVSRQVLPACGSLCFFCPALRARSRQPVKRYKKLIAEIFPRNQEEGLNDRKIGKLCDYA  66

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            AKNP RIPKI   LE+RCYKELR+ + +   ++  +Y + L  CKEQM  FA +LL+++ 
Sbjct  67   AKNPLRIPKIVNALEQRCYKELRNENFRSTRIVMCIYKKFLSSCKEQMPLFASSLLSIIH  126

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD  + D ++ IGC     F+ +QVDG+Y +++E ++ K+C LA+
Sbjct  127  TLLDQTRQDEMRVIGCNILFDFVNNQVDGSYLFSLEGVIPKLCQLAQ  173



>ref|XP_004140882.1| PREDICTED: uncharacterized protein LOC101203725 [Cucumis sativus]
Length=955

 Score =   189 bits (481),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 121/167 (72%), Gaps = 0/167 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ PAC ++C  CP++R+RSRQPVKRYKK LADIFP++ D   N RKI KLC+Y
Sbjct  1    MGVMSRRVVPACGNLCFFCPSMRARSRQPVKRYKKFLADIFPRNQDAEPNDRKICKLCDY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI + LE+RCYK+LR+ +   V V+  +Y +LL MCK+QM  FA +L+ + 
Sbjct  61   ASKNPLRIPKITELLEQRCYKDLRNENFGSVKVVICIYRKLLLMCKDQMPLFASSLIGIS  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLA  608
              +L+  + D ++ +GC    +FI SQ D TY +N+E ++ K+C LA
Sbjct  121  RTLLEQTRHDDMQILGCNILVEFISSQTDSTYMFNLEGIIPKLCQLA  167



>gb|EMT11310.1| hypothetical protein F775_16040 [Aegilops tauschii]
Length=1041

 Score =   190 bits (482),  Expect = 7e-52, Method: Composition-based stats.
 Identities = 88/168 (52%), Positives = 116/168 (69%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+ P C ++C  CP LR+RSRQPVKRYKK+LA+IFP+S D   N R+I KLCEY
Sbjct  1    MGVISRKVLPVCGALCYFCPGLRARSRQPVKRYKKILAEIFPRSQDEEPNERRIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP R+PKI   LE+R YKELR+       V+  +Y  LL  CKEQM   A +LL++V
Sbjct  61   AAKNPLRVPKITVYLEQRIYKELRAEQYGFAKVVMLIYRRLLVSCKEQMPLLASSLLSIV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ I C T   F  +QVDGTY +N+E LV ++C LA+
Sbjct  121  HTLLDQKRQDDMRIIACETLFDFAVNQVDGTYQFNLEGLVPRLCELAQ  168



>ref|XP_008445731.1| PREDICTED: uncharacterized protein LOC103488670 isoform X1 [Cucumis 
melo]
Length=991

 Score =   190 bits (482),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 121/167 (72%), Gaps = 0/167 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ PAC ++C  CP++R+RSRQPVKRYKK LADIFP++ D   N RKI KLC+Y
Sbjct  1    MGVMSRRVVPACGNLCFFCPSMRARSRQPVKRYKKFLADIFPRNQDAEPNDRKICKLCDY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI + LE+RCYK+LR+ +   V V+  +Y +LL MCK+QM  FA +L+ + 
Sbjct  61   ASKNPLRIPKITELLEQRCYKDLRNENFGSVKVVICIYRKLLLMCKDQMPLFASSLIGIS  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLA  608
              +L+  + D ++ +GC    +FI SQ D TY +N+E ++ K+C LA
Sbjct  121  RTLLEQTRHDDMQILGCNILVEFISSQTDSTYMFNLEGIIPKLCQLA  167



>ref|XP_008445732.1| PREDICTED: uncharacterized protein LOC103488670 isoform X2 [Cucumis 
melo]
Length=954

 Score =   189 bits (481),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 121/167 (72%), Gaps = 0/167 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ PAC ++C  CP++R+RSRQPVKRYKK LADIFP++ D   N RKI KLC+Y
Sbjct  1    MGVMSRRVVPACGNLCFFCPSMRARSRQPVKRYKKFLADIFPRNQDAEPNDRKICKLCDY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI + LE+RCYK+LR+ +   V V+  +Y +LL MCK+QM  FA +L+ + 
Sbjct  61   ASKNPLRIPKITELLEQRCYKDLRNENFGSVKVVICIYRKLLLMCKDQMPLFASSLIGIS  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLA  608
              +L+  + D ++ +GC    +FI SQ D TY +N+E ++ K+C LA
Sbjct  121  RTLLEQTRHDDMQILGCNILVEFISSQTDSTYMFNLEGIIPKLCQLA  167



>ref|XP_006595061.1| PREDICTED: uncharacterized protein LOC100806860 isoform X2 [Glycine 
max]
 ref|XP_003542058.2| PREDICTED: uncharacterized protein LOC100806860 isoform X1 [Glycine 
max]
Length=965

 Score =   189 bits (480),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 120/168 (71%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ P C ++C+ CP+LR+RSRQPVKRYKK +ADIFP++     N RKI KLCEY
Sbjct  1    MGVMSRRVVPVCGNLCVFCPSLRARSRQPVKRYKKFIADIFPRNQVAEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI   LE+RCYK+LR+ +   V V+  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITDNLEQRCYKDLRNENFGSVKVVLCIYRKLLSTCKEQMPLFANSLLGII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + D ++ +GC T  +FI  Q DGTY +N+E  + K+C LA+
Sbjct  121  RTLLEQTRADEMQILGCNTLVEFIDCQTDGTYMFNLEGFIPKLCQLAQ  168



>ref|XP_010666756.1| PREDICTED: uncharacterized protein LOC104883885 [Beta vulgaris 
subsp. vulgaris]
Length=1011

 Score =   189 bits (481),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 118/167 (71%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SR++ PAC S+C  CP LR+RSRQPVKRYKKL+ADIFPK+ D   N R I KLCEYA
Sbjct  6    GVISRQVLPACGSLCFFCPGLRARSRQPVKRYKKLIADIFPKTQDEGPNDRMIGKLCEYA  65

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            A+NP R+PKI   LE+RCYKELR+ +   V ++  +Y  LL  CK+QM  FA +L++++ 
Sbjct  66   ARNPLRVPKITNNLEQRCYKELRNQNFNAVKIVMSIYRRLLVSCKDQMPLFASSLVSIMH  125

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD    D ++ IGC     F+ +Q DGT+ +N+E+ + K+C LA+
Sbjct  126  ILLDQTGQDELRVIGCQALFVFVNNQKDGTFIFNLEDFIPKLCLLAQ  172



>gb|KHN11694.1| Protein EFR3 like B [Glycine soja]
Length=1010

 Score =   189 bits (481),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 83/168 (49%), Positives = 120/168 (71%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            M ++SR ++P C S+C  CPAL+ RSR P+KRYKK LADIFP++PD   N R I KLCEY
Sbjct  1    MSVISRNIWPVCGSLCCFCPALQERSRHPIKRYKKFLADIFPRTPDEEPNERMIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP R+PKI   LE+RCY+ELR+ + + V V+  +Y +LL  CK+QM  FA +LL+++
Sbjct  61   ASKNPLRVPKITSYLEQRCYRELRTENYQSVKVVICIYRKLLISCKDQMPLFASSLLSII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D V+ +GC T   F+ +Q DGTY +N++  + K+C+LA+
Sbjct  121  QILLDQPRHDEVQILGCQTLFDFVNNQRDGTYMFNLDGFILKLCNLAQ  168



>gb|KEH39475.1| cyclin-like protein [Medicago truncatula]
Length=949

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 120/168 (71%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ PAC ++CI CP+LR+RSRQPVKRYKKL+A+I P++     N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGNLCIFCPSLRARSRQPVKRYKKLIAEILPRNKVAELNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI + LE+RCYK+LR+     V VI  +Y +LL  C+EQ+  FA +LL ++
Sbjct  61   ASKNPLRIPKITENLEQRCYKDLRNESFGSVKVILCIYRKLLSSCREQIPLFASSLLGII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + D V+ +GC T   FI  Q DGTY +N+E  + K+C LA+
Sbjct  121  RTLLEQTRADEVRILGCNTLVDFIIFQTDGTYMFNLEGFIPKLCQLAQ  168



>ref|XP_002277709.2| PREDICTED: uncharacterized protein LOC100265428 [Vitis vinifera]
Length=1012

 Score =   189 bits (480),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 120/168 (71%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SRK+ P C S+C  CP++RSRSRQPVKRYKKLLA+IFP+S +   N RKI KLCEY
Sbjct  1    MGIISRKVMPVCGSLCFFCPSMRSRSRQPVKRYKKLLAEIFPRSREEEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A++NP RIPKI   LE+RCYKELR+     V V+  +Y +LL  CKEQM  FA +LL+++
Sbjct  61   ASRNPLRIPKITTYLEQRCYKELRTERFHHVKVVMCIYRKLLISCKEQMPLFAGSLLSII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D ++ IGC     F+ +Q D TY +N++ L+ K+C +A+
Sbjct  121  HILLDQTRQDELRIIGCQALFDFVNNQGDSTYMFNLDGLIPKLCLVAQ  168



>ref|XP_003597513.1| EFR3-like protein [Medicago truncatula]
 gb|AES67764.1| cyclin-like protein [Medicago truncatula]
Length=969

 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 120/168 (71%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ PAC ++CI CP+LR+RSRQPVKRYKKL+A+I P++     N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGNLCIFCPSLRARSRQPVKRYKKLIAEILPRNKVAELNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI + LE+RCYK+LR+     V VI  +Y +LL  C+EQ+  FA +LL ++
Sbjct  61   ASKNPLRIPKITENLEQRCYKDLRNESFGSVKVILCIYRKLLSSCREQIPLFASSLLGII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + D V+ +GC T   FI  Q DGTY +N+E  + K+C LA+
Sbjct  121  RTLLEQTRADEVRILGCNTLVDFIIFQTDGTYMFNLEGFIPKLCQLAQ  168



>ref|XP_009118564.1| PREDICTED: protein EFR3 homolog [Brassica rapa]
Length=933

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 124/168 (74%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ PAC ++C  CP+LR+RSR PVKRYKK+LA+IFP++ +  AN RKI KLCEY
Sbjct  1    MGVMSRRVLPACGNLCFFCPSLRARSRHPVKRYKKMLAEIFPRNQEAEANDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A++NP RIPKI + LE++CYKELR+G+   V V+  +Y +LL  CKEQM  F+ +LL+VV
Sbjct  61   ASRNPLRIPKITEYLEQKCYKELRNGNIGSVKVVLCIYKKLLSSCKEQMPLFSCSLLSVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + + V+ +GC T   FI  Q + ++ +N+E L+ K+C LA+
Sbjct  121  RTLLEQTRDEEVQILGCNTLVDFISLQTENSHMFNLEGLIPKLCQLAQ  168



>emb|CDY06190.1| BnaA09g50130D [Brassica napus]
Length=936

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 124/168 (74%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ PAC ++C  CP+LR+RSR PVKRYKK+LA+IFP++ +  AN RKI KLCEY
Sbjct  1    MGVMSRRVLPACGNLCFFCPSLRARSRHPVKRYKKMLAEIFPRNQEAEANDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A++NP RIPKI + LE++CYKELR+G+   V V+  +Y +LL  CKEQM  F+ +LL+VV
Sbjct  61   ASRNPLRIPKITEYLEQKCYKELRNGNIGSVKVVLCIYKKLLSSCKEQMPLFSCSLLSVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + + V+ +GC T   FI  Q + ++ +N+E L+ K+C LA+
Sbjct  121  RTLLEQTRDEEVQILGCNTLVDFISLQTENSHMFNLEGLIPKLCQLAQ  168



>ref|XP_007131432.1| hypothetical protein PHAVU_011G013000g [Phaseolus vulgaris]
 gb|ESW03426.1| hypothetical protein PHAVU_011G013000g [Phaseolus vulgaris]
Length=1037

 Score =   189 bits (479),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 83/168 (49%), Positives = 119/168 (71%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            M ++SR ++P C S+C  CPALR RSR P+KRYKK LADIFP++P    N R I KLCEY
Sbjct  1    MSVISRNIWPVCGSLCCFCPALRERSRHPIKRYKKFLADIFPRTPGEEPNERMIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AA+NP R+PKI   LE+RCY+ELR+ + + V V+  +Y +LL  CK+QM  FA +LL ++
Sbjct  61   AARNPLRVPKITSYLEQRCYRELRTENYQSVKVVILIYRKLLISCKDQMPLFASSLLGII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD ++ D V+ +GC T   F+ +Q DGTY +N++  + K+C+LA+
Sbjct  121  QILLDQSRHDEVQILGCQTLFDFVNNQKDGTYMFNLDAFIVKLCNLAQ  168



>emb|CDY09999.1| BnaC08g44520D [Brassica napus]
Length=942

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 124/168 (74%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ PAC ++C  CP+LR+RSR PVKRYKK+LA+IFP++ +  AN RKI KLCEY
Sbjct  1    MGVMSRRVLPACGNLCFFCPSLRARSRHPVKRYKKMLAEIFPRNQEAEANDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A++NP RIPKI + LE++CYKELR+G+   V V+  +Y +LL  CKEQM  F+ +LL+VV
Sbjct  61   ASRNPLRIPKITEYLEQKCYKELRNGNIGSVKVVLCIYKKLLSSCKEQMPLFSCSLLSVV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + + V+ +GC T   FI  Q + ++ +N+E L+ K+C LA+
Sbjct  121  RTLLEQTRDEEVQILGCNTLVDFISLQTENSHMFNLEGLIPKLCQLAQ  168



>ref|XP_002309810.1| hypothetical protein POPTR_0007s02020g [Populus trichocarpa]
 gb|EEE90260.1| hypothetical protein POPTR_0007s02020g [Populus trichocarpa]
Length=988

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 118/168 (70%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ PAC S+C  CP+LR+RSRQPVKRYKKLLADI P++ +   N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGSLCFFCPSLRARSRQPVKRYKKLLADILPRNQEAEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI   LE+R YKELR  +   V V+  +Y +LL  CKEQM  FA +LL++V
Sbjct  61   ASKNPLRIPKITDTLEQRFYKELRHENFGSVKVVVCIYRKLLSSCKEQMPLFASSLLSIV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+    D ++ + C     FI  Q+DGTY +N+E L+ K+C LA+
Sbjct  121  RTLLEQTGKDDLRLLACDVLVDFISCQMDGTYMFNLEGLIPKLCQLAQ  168



>gb|KJB49179.1| hypothetical protein B456_008G105100 [Gossypium raimondii]
Length=906

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 114/168 (68%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR + P C S+C  CPAL +RSR PVKRYKK LADIFP+SPD   N R I KLCEY
Sbjct  1    MGMISRGVMPVCGSLCFFCPALSTRSRHPVKRYKKFLADIFPRSPDEQPNERMIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI   LE++ YK+LR+     V VI  VY +L+  CKEQM  FA + L ++
Sbjct  61   ASKNPLRIPKITSALEQKFYKDLRTEQFHSVKVIMLVYKKLIISCKEQMPLFASSFLTII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D  + +GC   + F+ +Q DGTY +N++ L+ K+C LA+
Sbjct  121  QVLLDQTRMDDTRVLGCQALSVFVNNQRDGTYMFNLDGLIPKLCLLAQ  168



>ref|XP_011026408.1| PREDICTED: uncharacterized protein LOC105127024 isoform X1 [Populus 
euphratica]
 ref|XP_011026409.1| PREDICTED: uncharacterized protein LOC105127024 isoform X1 [Populus 
euphratica]
 ref|XP_011026410.1| PREDICTED: uncharacterized protein LOC105127024 isoform X1 [Populus 
euphratica]
Length=988

 Score =   188 bits (477),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 118/168 (70%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ PAC S+C  CP+LR+RSRQPVKRYKKLLADI P++ +   N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGSLCFFCPSLRARSRQPVKRYKKLLADILPRNQEAEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI   LE+R YKELR  +   V V+  +Y +LL  CKEQM  FA +LL++V
Sbjct  61   ASKNPLRIPKITDTLEQRFYKELRHENFGSVKVVVCIYRKLLSSCKEQMPLFASSLLSIV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+    D ++ + C     FI  Q+DGTY +N+E L+ K+C LA+
Sbjct  121  RTLLEQTGKDDLRLLACDVLVDFISCQMDGTYMFNLEGLIPKLCQLAQ  168



>ref|XP_011026411.1| PREDICTED: uncharacterized protein LOC105127024 isoform X2 [Populus 
euphratica]
Length=987

 Score =   188 bits (477),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 118/168 (70%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ PAC S+C  CP+LR+RSRQPVKRYKKLLADI P++ +   N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGSLCFFCPSLRARSRQPVKRYKKLLADILPRNQEAEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI   LE+R YKELR  +   V V+  +Y +LL  CKEQM  FA +LL++V
Sbjct  61   ASKNPLRIPKITDTLEQRFYKELRHENFGSVKVVVCIYRKLLSSCKEQMPLFASSLLSIV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+    D ++ + C     FI  Q+DGTY +N+E L+ K+C LA+
Sbjct  121  RTLLEQTGKDDLRLLACDVLVDFISCQMDGTYMFNLEGLIPKLCQLAQ  168



>gb|KHN30101.1| Protein EFR3 like B [Glycine soja]
Length=967

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 119/168 (71%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ P C ++C+ CP+LR+RSRQPVKRYKK +ADIFP++     N RK  KLCEY
Sbjct  1    MGVMSRRVVPVCGNLCVFCPSLRARSRQPVKRYKKFIADIFPRNQVAEPNDRKFGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI   LE+RCYK+LR+ +   V V+  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITDNLEQRCYKDLRNENFGSVKVVLCIYRKLLSTCKEQMPLFANSLLGII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + D ++ +GC T  +FI  Q DGTY +N+E  + K+C LA+
Sbjct  121  RTLLEQTRADEMQILGCNTLVEFIDCQTDGTYMFNLEGFIPKLCQLAQ  168



>gb|KHG10450.1| Protein EFR3 [Gossypium arboreum]
Length=955

 Score =   187 bits (476),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 114/168 (68%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR + P C S+C  CPAL +RSR PVKRYKK LADIFP+SPD   N R I KLCEY
Sbjct  1    MGMISRGVMPVCGSLCFFCPALSTRSRHPVKRYKKFLADIFPRSPDEQPNERMIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI   LE++ YK+LR+     V VI  VY +L+  CKEQM  FA + L ++
Sbjct  61   ASKNPLRIPKITSALEQKFYKDLRTEQFHSVKVIMLVYKKLIISCKEQMPLFASSFLTII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D  + +GC   + F+ +Q DGTY +N++ L+ K+C LA+
Sbjct  121  QVLLDQTRMDDTRVLGCQALSVFVNNQRDGTYMFNLDGLIPKLCLLAQ  168



>ref|XP_004506319.1| PREDICTED: uncharacterized protein LOC101489771 [Cicer arietinum]
Length=1032

 Score =   188 bits (477),  Expect = 4e-51, Method: Composition-based stats.
 Identities = 82/168 (49%), Positives = 120/168 (71%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            M ++SR ++P C S+C  CPALR RSR P+KRYKKLLA+IFP++ +   N RKI KLCEY
Sbjct  1    MSVISRNIWPVCGSLCCFCPALRERSRHPIKRYKKLLAEIFPRTQEEEPNDRKISKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A++NP R+PKI   LE+RCY+ELRS + + V V+  +Y +LL  C++QM  FA +LL+++
Sbjct  61   ASRNPLRVPKITSYLEQRCYRELRSENYQAVKVVICIYRKLLVSCRDQMPLFASSLLSII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D V+ +GC T   F+ +Q DGTY +N++  + K+C LA+
Sbjct  121  QILLDQTRHDEVQILGCQTLFDFVNNQRDGTYMFNLDMFILKLCQLAQ  168



>gb|KJB49180.1| hypothetical protein B456_008G105100 [Gossypium raimondii]
 gb|KJB49181.1| hypothetical protein B456_008G105100 [Gossypium raimondii]
Length=996

 Score =   187 bits (476),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 114/168 (68%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR + P C S+C  CPAL +RSR PVKRYKK LADIFP+SPD   N R I KLCEY
Sbjct  1    MGMISRGVMPVCGSLCFFCPALSTRSRHPVKRYKKFLADIFPRSPDEQPNERMIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A+KNP RIPKI   LE++ YK+LR+     V VI  VY +L+  CKEQM  FA + L ++
Sbjct  61   ASKNPLRIPKITSALEQKFYKDLRTEQFHSVKVIMLVYKKLIISCKEQMPLFASSFLTII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +LD  + D  + +GC   + F+ +Q DGTY +N++ L+ K+C LA+
Sbjct  121  QVLLDQTRMDDTRVLGCQALSVFVNNQRDGTYMFNLDGLIPKLCLLAQ  168



>ref|NP_001045867.1| Os02g0143200 [Oryza sativa Japonica Group]
 dbj|BAD13233.1| cyclin-like protein [Oryza sativa Japonica Group]
 dbj|BAF07781.1| Os02g0143200 [Oryza sativa Japonica Group]
Length=1035

 Score =   187 bits (476),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 115/167 (69%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SRK+ PAC  +C  CP LR+RSRQPVKRYKK++ADIFP + D   N R+I KLCEY 
Sbjct  12   GVVSRKVLPACGGLCYFCPGLRARSRQPVKRYKKIIADIFPATQDEEPNERRIGKLCEYV  71

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            A+N  R+PKI   LE+RCYKELR+     V V+  +Y +LL  CK+QM   A + L+++ 
Sbjct  72   ARNHHRVPKITAYLEQRCYKELRNEQYGFVKVVVLIYRKLLVSCKKQMPLLASSALSIIC  131

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD  + D ++ IGC T   F  SQVDGTY +N+E LV K+C LA+
Sbjct  132  TLLDQTRRDDMRIIGCETLFDFTVSQVDGTYQFNLEELVPKLCELAQ  178



>ref|XP_006417969.1| hypothetical protein EUTSA_v10006704mg [Eutrema salsugineum]
 gb|ESQ36322.1| hypothetical protein EUTSA_v10006704mg [Eutrema salsugineum]
Length=965

 Score =   187 bits (475),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ PAC ++C  CP+LR+RSR PVKRYK++LA+IFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVLPACGNLCFFCPSLRARSRHPVKRYKQMLAEIFPRNQDAEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A++NP RIPKI + LE++CYKELR+G+   V V+  +Y +LL  CKEQM  F+ +LL++V
Sbjct  61   ASRNPLRIPKITEYLEQKCYKELRNGNIGSVKVVLCIYKKLLSSCKEQMPLFSCSLLSIV  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + + V+ +GC T   FI  Q + ++ +N+E L+ K+C LA+
Sbjct  121  RTLLEQTREEEVQILGCSTLVDFISLQTENSHMFNLEGLIAKLCQLAQ  168



>gb|KJB71809.1| hypothetical protein B456_011G143200 [Gossypium raimondii]
Length=926

 Score =   187 bits (474),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 121/168 (72%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ PAC ++C  CP++R+RSRQPVKRYKKLLA+IFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGNLCFFCPSMRARSRQPVKRYKKLLAEIFPRNQDAEPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            A++NP RIPKI   LE+RC+K+LR+ +   V  +  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ASRNPLRIPKITSNLEQRCFKDLRNENFGCVKAVLCIYRKLLSSCKEQMPLFASSLLGII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
              +L+  + D ++ +GC     FI SQ+DGT+ + +E L+ K+C LA+
Sbjct  121  RALLEQNRQDEMRILGCNALVDFINSQMDGTHMFQLEGLIPKLCQLAQ  168



>gb|KJB37960.1| hypothetical protein B456_006G228200 [Gossypium raimondii]
Length=778

 Score =   185 bits (470),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 118/167 (71%), Gaps = 0/167 (0%)
 Frame = +3

Query  108  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  287
            MG++SR++ P C ++C  CP+LR+RSRQPVKRYKKLL+DIFP++ +   N RKI KLCEY
Sbjct  1    MGVMSRRVLPVCGNLCFFCPSLRARSRQPVKRYKKLLSDIFPRNQEPVPNDRKIGKLCEY  60

Query  288  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  467
            AAKNP RIPKI   LE+RC+K LR+     V VI  VY +LL  CKEQMA FA +LL ++
Sbjct  61   AAKNPLRIPKITSNLEQRCFKGLRNEKFGCVKVILCVYTKLLSTCKEQMALFASSLLGII  120

Query  468  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLA  608
              +L+  + D +  IGC    +F+ SQ+D T+ + +E L+ K+C LA
Sbjct  121  QTLLEQTRLDEMLIIGCDALAEFVNSQMDSTHMFQLEGLIPKLCQLA  167



>ref|XP_007162228.1| hypothetical protein PHAVU_001G134800g [Phaseolus vulgaris]
 gb|ESW34222.1| hypothetical protein PHAVU_001G134800g [Phaseolus vulgaris]
Length=1021

 Score =   187 bits (475),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 123/167 (74%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SR++ P C ++C  CP+LR+RSRQPVKRYKKL+ADIFP++ +  AN R+I KLC+YA
Sbjct  7    GVISRQVLPVCGNLCFFCPSLRARSRQPVKRYKKLIADIFPRNQEDGANDRQIGKLCDYA  66

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            A+NP RIPKI + LE+RCY+ELR+ + +   ++  +Y + L  CKEQM  FA +LL+++ 
Sbjct  67   ARNPLRIPKIMQALEQRCYRELRNENIRSAKIVMCIYKKFLFSCKEQMPLFANSLLSIIH  126

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD ++ D ++ IGC     F+ +Q DG+Y +N+E ++ K+C LA+
Sbjct  127  TLLDQSRQDEMRIIGCQILFDFVNNQSDGSYLFNLEAVIPKLCQLAQ  173



>gb|EEE56284.1| hypothetical protein OsJ_05346 [Oryza sativa Japonica Group]
Length=1056

 Score =   187 bits (476),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 115/167 (69%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SRK+ PAC  +C  CP LR+RSRQPVKRYKK++ADIFP + D   N R+I KLCEY 
Sbjct  12   GVVSRKVLPACGGLCYFCPGLRARSRQPVKRYKKIIADIFPATQDEEPNERRIGKLCEYV  71

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            A+N  R+PKI   LE+RCYKELR+     V V+  +Y +LL  CK+QM   A + L+++ 
Sbjct  72   ARNHHRVPKITAYLEQRCYKELRNEQYGFVKVVVLIYRKLLVSCKKQMPLLASSALSIIC  131

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD  + D ++ IGC T   F  SQVDGTY +N+E LV K+C LA+
Sbjct  132  TLLDQTRRDDMRIIGCETLFDFTVSQVDGTYQFNLEELVPKLCELAQ  178



>ref|XP_007162229.1| hypothetical protein PHAVU_001G134800g [Phaseolus vulgaris]
 gb|ESW34223.1| hypothetical protein PHAVU_001G134800g [Phaseolus vulgaris]
Length=978

 Score =   187 bits (474),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 123/167 (74%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SR++ P C ++C  CP+LR+RSRQPVKRYKKL+ADIFP++ +  AN R+I KLC+YA
Sbjct  7    GVISRQVLPVCGNLCFFCPSLRARSRQPVKRYKKLIADIFPRNQEDGANDRQIGKLCDYA  66

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            A+NP RIPKI + LE+RCY+ELR+ + +   ++  +Y + L  CKEQM  FA +LL+++ 
Sbjct  67   ARNPLRIPKIMQALEQRCYRELRNENIRSAKIVMCIYKKFLFSCKEQMPLFANSLLSIIH  126

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD ++ D ++ IGC     F+ +Q DG+Y +N+E ++ K+C LA+
Sbjct  127  TLLDQSRQDEMRIIGCQILFDFVNNQSDGSYLFNLEAVIPKLCQLAQ  173



>gb|EEC72466.1| hypothetical protein OsI_05818 [Oryza sativa Indica Group]
Length=1056

 Score =   187 bits (475),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 115/167 (69%), Gaps = 0/167 (0%)
 Frame = +3

Query  111  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  290
            G++SRK+ PAC  +C  CP LR+RSRQPVKRYKK++ADIFP + D   N R+I KLCEY 
Sbjct  12   GVVSRKVLPACGGLCYFCPGLRARSRQPVKRYKKIIADIFPATQDEEPNERRIGKLCEYV  71

Query  291  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  470
            A+N  R+PKI   LE+RCYKELR+     V V+  +Y +LL  CK+QM   A + L+++ 
Sbjct  72   ARNHHRVPKITAYLEQRCYKELRNEQYGFVKVVVLIYRKLLVSCKKQMPLLASSALSIIC  131

Query  471  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  611
             +LD  + D ++ IGC T   F  SQVDGTY +N+E LV K+C LA+
Sbjct  132  TLLDQTRRDDMRIIGCETLFDFTVSQVDGTYQFNLEELVPKLCELAQ  178



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660