BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS009D12

Length=610
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009771911.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    322   2e-105   Nicotiana sylvestris
ref|XP_009758663.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    320   7e-105   Nicotiana sylvestris
ref|XP_009624283.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    320   2e-104   Nicotiana tomentosiformis
ref|XP_002515525.1|  dead box ATP-dependent RNA helicase, putative      313   3e-104   
ref|XP_009783372.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    318   3e-104   Nicotiana sylvestris
ref|XP_009606356.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    318   4e-104   Nicotiana tomentosiformis
ref|XP_002285072.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    318   6e-104   Vitis vinifera
ref|XP_011070464.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    318   8e-104   Sesamum indicum [beniseed]
ref|XP_011081570.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    317   1e-103   Sesamum indicum [beniseed]
gb|EPS57760.1|  hypothetical protein M569_17057                         309   2e-103   Genlisea aurea
ref|XP_006361727.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    316   4e-103   Solanum tuberosum [potatoes]
ref|XP_009758660.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    319   6e-103   Nicotiana sylvestris
ref|XP_010254382.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    315   6e-103   Nelumbo nucifera [Indian lotus]
gb|KDP33603.1|  hypothetical protein JCGZ_07174                         315   6e-103   Jatropha curcas
gb|KJB65812.1|  hypothetical protein B456_010G114300                    310   7e-103   Gossypium raimondii
ref|XP_009595644.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    315   8e-103   Nicotiana tomentosiformis
ref|XP_010924921.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    315   1e-102   Elaeis guineensis
ref|XP_008806594.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    315   1e-102   Phoenix dactylifera
gb|KDP37097.1|  hypothetical protein JCGZ_06153                         314   2e-102   Jatropha curcas
ref|XP_007011880.1|  DEAD/DEAH box RNA helicase family protein is...    314   2e-102   
ref|XP_007011879.1|  DEAD/DEAH box RNA helicase family protein is...    314   2e-102   Theobroma cacao [chocolate]
ref|XP_004241774.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    314   2e-102   Solanum lycopersicum
ref|XP_006353691.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    314   2e-102   Solanum tuberosum [potatoes]
ref|XP_006346265.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    313   3e-102   Solanum tuberosum [potatoes]
ref|XP_004245029.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    313   4e-102   Solanum lycopersicum
dbj|BAJ53224.1|  JHL06P13.3                                             314   5e-102   Jatropha curcas
gb|KCW80390.1|  hypothetical protein EUGRSUZ_C01749                     313   7e-102   Eucalyptus grandis [rose gum]
gb|KJB54996.1|  hypothetical protein B456_009G057600                    311   7e-102   Gossypium raimondii
ref|XP_010267037.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    312   1e-101   Nelumbo nucifera [Indian lotus]
ref|XP_010048208.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    312   1e-101   Eucalyptus grandis [rose gum]
gb|KHG04363.1|  DEAD-box ATP-dependent RNA helicase 56                  307   1e-101   Gossypium arboreum [tree cotton]
ref|XP_002268833.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    312   1e-101   Vitis vinifera
gb|KJB27350.1|  hypothetical protein B456_004G292500                    312   1e-101   Gossypium raimondii
ref|XP_007023165.1|  DEAD/DEAH box RNA helicase family protein is...    307   2e-101   
gb|KJB54999.1|  hypothetical protein B456_009G057600                    311   2e-101   Gossypium raimondii
gb|KJB65811.1|  hypothetical protein B456_010G114300                    311   3e-101   Gossypium raimondii
ref|XP_009392978.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    310   7e-101   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB82814.1|  hypothetical protein B456_013G215200                    310   9e-101   Gossypium raimondii
ref|XP_010250100.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    310   9e-101   
ref|XP_009412246.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    309   2e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002324856.1|  hypothetical protein POPTR_0018s01620g             309   2e-100   Populus trichocarpa [western balsam poplar]
ref|XP_008797870.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    309   2e-100   Phoenix dactylifera
ref|XP_002309623.1|  hypothetical protein POPTR_0006s26940g             309   3e-100   Populus trichocarpa [western balsam poplar]
gb|ABK93079.1|  unknown                                                 308   3e-100   Populus trichocarpa [western balsam poplar]
ref|XP_007023164.1|  DEAD/DEAH box RNA helicase family protein is...    307   7e-100   
ref|XP_007023163.1|  DEAD/DEAH box RNA helicase family protein is...    307   8e-100   Theobroma cacao [chocolate]
ref|XP_004171175.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    307   9e-100   
ref|XP_010696045.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    307   9e-100   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW81408.1|  hypothetical protein EUGRSUZ_C02784                     306   9e-100   Eucalyptus grandis [rose gum]
gb|KJB70602.1|  hypothetical protein B456_011G082500                    305   6e-99    Gossypium raimondii
ref|XP_010048977.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    305   1e-98    Eucalyptus grandis [rose gum]
ref|XP_010519944.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    305   1e-98    Tarenaya hassleriana [spider flower]
ref|XP_010912069.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    304   2e-98    Elaeis guineensis
gb|KCW81407.1|  hypothetical protein EUGRSUZ_C02784                     308   2e-98    Eucalyptus grandis [rose gum]
ref|XP_007137031.1|  hypothetical protein PHAVU_009G093800g             304   2e-98    Phaseolus vulgaris [French bean]
gb|AGV54235.1|  DEAD-box ATP-dependent RNA helicase 56                  303   3e-98    Phaseolus vulgaris [French bean]
ref|XP_003522620.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    303   3e-98    Glycine max [soybeans]
ref|XP_003526412.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    303   3e-98    Glycine max [soybeans]
ref|XP_004303319.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    303   4e-98    Fragaria vesca subsp. vesca
ref|XP_010519138.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    302   6e-98    
ref|XP_009365409.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    302   1e-97    Pyrus x bretschneideri [bai li]
ref|XP_011459186.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    302   1e-97    Fragaria vesca subsp. vesca
ref|XP_006853982.1|  hypothetical protein AMTR_s00036p00225190          302   1e-97    Amborella trichopoda
ref|XP_008243728.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    302   1e-97    Prunus mume [ume]
ref|XP_007222437.1|  hypothetical protein PRUPE_ppa006122mg             301   1e-97    Prunus persica
ref|XP_007215422.1|  hypothetical protein PRUPE_ppa006077mg             301   2e-97    Prunus persica
ref|XP_009334641.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    301   3e-97    Pyrus x bretschneideri [bai li]
ref|XP_003588757.1|  DEAD-box ATP-dependent RNA helicase                300   5e-97    Medicago truncatula
gb|AFV30230.1|  ATP-dependent RNA helicase                              300   5e-97    Medicago sativa [alfalfa]
ref|XP_011459188.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    301   6e-97    Fragaria vesca subsp. vesca
ref|XP_006450447.1|  hypothetical protein CICLE_v10008383mg             297   6e-97    
gb|KEH35921.1|  DEAD-box ATP-dependent RNA helicase-like protein        296   8e-97    Medicago truncatula
ref|XP_006450448.1|  hypothetical protein CICLE_v10008383mg             300   9e-97    Citrus clementina [clementine]
ref|XP_004498731.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    300   9e-97    Cicer arietinum [garbanzo]
ref|XP_009376926.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    300   9e-97    Pyrus x bretschneideri [bai li]
ref|XP_008394071.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    299   1e-96    Malus domestica [apple tree]
ref|XP_006450446.1|  hypothetical protein CICLE_v10008383mg             299   2e-96    
gb|EYU24648.1|  hypothetical protein MIMGU_mgv1a006871mg                299   2e-96    Erythranthe guttata [common monkey flower]
ref|XP_008362046.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    298   4e-96    Malus domestica [apple tree]
gb|AGV54745.1|  DEAD-box ATP-dependent RNA helicase 56-like protein     298   4e-96    Phaseolus vulgaris [French bean]
emb|CAN76234.1|  hypothetical protein VITISV_030204                     296   5e-96    Vitis vinifera
ref|XP_004501320.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    298   6e-96    
ref|XP_004501319.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    298   6e-96    Cicer arietinum [garbanzo]
gb|EYU32343.1|  hypothetical protein MIMGU_mgv1a006879mg                297   6e-96    Erythranthe guttata [common monkey flower]
ref|XP_003603412.1|  DEAD-box ATP-dependent RNA helicase                297   7e-96    Medicago truncatula
ref|XP_004498730.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    299   8e-96    
ref|XP_004501318.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    298   8e-96    
gb|AFK41905.1|  unknown                                                 297   1e-95    Medicago truncatula
ref|XP_006483351.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    296   3e-95    Citrus sinensis [apfelsine]
gb|ACU23008.1|  unknown                                                 291   3e-95    Glycine max [soybeans]
ref|XP_002517619.1|  dead box ATP-dependent RNA helicase, putative      295   5e-95    Ricinus communis
ref|XP_006585633.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    293   6e-95    
emb|CAA09205.1|  RNA helicase                                           294   2e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873498.1|  hypothetical protein ARALYDRAFT_909079             293   2e-94    Arabidopsis lyrata subsp. lyrata
ref|XP_003528338.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    293   4e-94    Glycine max [soybeans]
ref|XP_010419672.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    293   5e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010453161.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    292   6e-94    Camelina sativa [gold-of-pleasure]
ref|XP_002871462.1|  hypothetical protein ARALYDRAFT_487950             292   6e-94    Arabidopsis lyrata subsp. lyrata
ref|NP_568245.1|  DEAD-box ATP-dependent RNA helicase 56                292   6e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003531708.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    292   7e-94    Glycine max [soybeans]
ref|XP_006585632.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    293   7e-94    
emb|CAB96655.1|  DEAD BOX RNA helicase RH15                             292   7e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287808.1|  hypothetical protein CARUB_v10001023mg             292   1e-93    Capsella rubella
emb|CAB96652.1|  DEAD BOX RNA helicase RH15-like protein                292   1e-93    Arabidopsis thaliana [mouse-ear cress]
gb|KHN47769.1|  DEAD-box ATP-dependent RNA helicase 56                  292   1e-93    Glycine soja [wild soybean]
gb|ACK38186.1|  unknown                                                 286   1e-93    Medicago truncatula
ref|XP_006399618.1|  hypothetical protein EUTSA_v10013628mg             291   1e-93    Eutrema salsugineum [saltwater cress]
ref|XP_010453157.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    291   2e-93    Camelina sativa [gold-of-pleasure]
ref|NP_001154706.1|  DEAD-box ATP-dependent RNA helicase 56             293   2e-93    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001154707.1|  DEAD-box ATP-dependent RNA helicase 56             291   4e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006409182.1|  hypothetical protein EUTSA_v10022698mg             290   5e-93    Eutrema salsugineum [saltwater cress]
ref|XP_001781775.1|  predicted protein                                  290   7e-93    
ref|XP_010491834.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    290   8e-93    Camelina sativa [gold-of-pleasure]
gb|KHN01339.1|  DEAD-box ATP-dependent RNA helicase 56                  291   9e-93    Glycine soja [wild soybean]
gb|ADE76139.1|  unknown                                                 289   9e-93    Picea sitchensis
ref|XP_001770294.1|  predicted protein                                  288   3e-92    
ref|XP_010097240.1|  DEAD-box ATP-dependent RNA helicase 56             291   3e-92    
ref|XP_010419674.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    288   4e-92    Camelina sativa [gold-of-pleasure]
gb|KEH28678.1|  DEAD-box ATP-dependent RNA helicase-like protein        290   5e-92    Medicago truncatula
ref|XP_004960988.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    286   1e-91    
gb|AFW81342.1|  spliceosome RNA helicase BAT1 isoform 1                 286   1e-91    
ref|NP_001141599.1|  uncharacterized protein LOC100273717               286   1e-91    
ref|XP_007161216.1|  hypothetical protein PHAVU_001G051700g             286   2e-91    Phaseolus vulgaris [French bean]
ref|NP_001149406.1|  spliceosome RNA helicase BAT1                      285   2e-91    
ref|XP_007135742.1|  hypothetical protein PHAVU_010G154700g             286   2e-91    Phaseolus vulgaris [French bean]
ref|XP_004506912.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    286   2e-91    
ref|XP_004960987.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    286   3e-91    
ref|XP_009125794.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    285   5e-91    Brassica rapa
ref|XP_009125790.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    283   2e-90    Brassica rapa
ref|XP_009121980.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    283   2e-90    Brassica rapa
ref|XP_002969825.1|  hypothetical protein SELMODRAFT_146823             283   2e-90    Selaginella moellendorffii
ref|XP_002985161.1|  hypothetical protein SELMODRAFT_446187             284   4e-90    
ref|XP_009121981.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    283   5e-90    Brassica rapa
emb|CDX85725.1|  BnaA02g00880D                                          281   1e-89    
ref|XP_009131197.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    280   8e-89    Brassica rapa
emb|CDY51112.1|  BnaCnng20150D                                          279   2e-88    Brassica napus [oilseed rape]
ref|XP_010231899.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    277   6e-88    Brachypodium distachyon [annual false brome]
ref|XP_009121982.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    275   2e-87    Brassica rapa
ref|XP_009121985.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    276   2e-87    Brassica rapa
ref|XP_003569187.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    275   3e-87    Brachypodium distachyon [annual false brome]
ref|XP_003569186.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    275   6e-87    Brachypodium distachyon [annual false brome]
ref|XP_004968948.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    274   8e-87    
ref|NP_001170610.1|  uncharacterized protein LOC100384654               274   9e-87    Zea mays [maize]
gb|AFW82994.1|  hypothetical protein ZEAMMB73_566534                    274   1e-86    
gb|KDO61715.1|  hypothetical protein CISIN_1g014314mg                   273   2e-86    Citrus sinensis [apfelsine]
ref|XP_004968947.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    274   3e-86    
emb|CDM83038.1|  unnamed protein product                                269   5e-86    Triticum aestivum [Canadian hard winter wheat]
emb|CDX85726.1|  BnaA02g00870D                                          273   1e-85    
emb|CDX70383.1|  BnaC03g04670D                                          270   4e-85    
ref|XP_006644282.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    270   5e-85    Oryza brachyantha
ref|XP_006644281.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    270   6e-85    Oryza brachyantha
emb|CDX78412.1|  BnaA03g03240D                                          270   1e-84    
sp|Q0JM17.2|RH56_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA ...    266   1e-83    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001043298.1|  Os01g0550000                                       266   1e-83    
emb|CDX69778.1|  BnaA10g21270D                                          267   3e-83    
emb|CDX69777.1|  BnaA10g21260D                                          267   4e-83    
ref|NP_001043297.1|  Os01g0549700                                       266   8e-83    
gb|EEE54779.1|  hypothetical protein OsJ_02176                          262   5e-82    Oryza sativa Japonica Group [Japonica rice]
gb|EMS68248.1|  DEAD-box ATP-dependent RNA helicase 56                  250   3e-75    Triticum urartu
gb|EMS64048.1|  DEAD-box ATP-dependent RNA helicase 56                  245   4e-75    Triticum urartu
gb|EMT33323.1|  DEAD-box ATP-dependent RNA helicase 56                  245   7e-75    
pdb|1T6N|A  Chain A, Crystal Structure Of The N-Terminal Domain O...    234   6e-74    Homo sapiens [man]
gb|KHG15649.1|  DEAD-box ATP-dependent RNA helicase 56 -like protein    240   8e-74    Gossypium arboreum [tree cotton]
ref|NP_998142.1|  ATP-dependent RNA helicase DDX39                      240   1e-73    Danio rerio [leopard danio]
gb|EDL10915.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 39, isofor...    233   2e-73    Mus musculus [mouse]
ref|XP_008314982.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       238   5e-73    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_011399824.1|  DEAD-box ATP-dependent RNA helicase 56             238   5e-73    Auxenochlorella protothecoides
ref|XP_001516247.2|  PREDICTED: spliceosome RNA helicase DDX39B         234   6e-73    
ref|XP_005470227.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    231   8e-73    
gb|EGV95298.1|  Spliceosome RNA helicase BAT1                           233   1e-72    Cricetulus griseus [Chinese hamsters]
ref|XP_002505759.1|  predicted protein                                  238   1e-72    Micromonas commoda
ref|XP_007231785.1|  PREDICTED: spliceosome RNA helicase DDX39B-like    238   1e-72    Astyanax mexicanus [blind cave fish]
ref|NP_001133398.1|  Spliceosome RNA helicase BAT1                      237   1e-72    Salmo salar
ref|NP_001134851.1|  ATP-dependent RNA helicase DDX39                   237   2e-72    Salmo salar
ref|XP_010744288.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    236   2e-72    
ref|XP_005643776.1|  nuclear RNA helicase-like protein Bat1             237   2e-72    Coccomyxa subellipsoidea C-169
gb|EAX03412.1|  hCG2005638, isoform CRA_d                               233   2e-72    Homo sapiens [man]
ref|XP_003515868.2|  PREDICTED: spliceosome RNA helicase DDX39B-like    231   2e-72    Cricetulus griseus [Chinese hamsters]
dbj|BAE42496.1|  unnamed protein product                                234   2e-72    Mus musculus [mouse]
ref|XP_006080887.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD (Asp-Gl...    232   3e-72    
ref|XP_008853627.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       236   3e-72    Nannospalax galili
ref|XP_007612851.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    231   3e-72    
ref|XP_001178866.1|  PREDICTED: spliceosome RNA helicase DDX39B-like    236   3e-72    
ref|XP_006631613.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    236   3e-72    Lepisosteus oculatus
ref|XP_005515740.1|  PREDICTED: spliceosome RNA helicase DDX39B-like    229   3e-72    Columba livia [carrier pigeon]
ref|XP_007647292.1|  PREDICTED: LOW QUALITY PROTEIN: spliceosome ...    232   4e-72    Cricetulus griseus [Chinese hamsters]
ref|XP_010535309.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    227   4e-72    Tarenaya hassleriana [spider flower]
emb|CDQ90161.1|  unnamed protein product                                236   4e-72    Oncorhynchus mykiss
ref|XP_006993135.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    236   4e-72    Peromyscus maniculatus bairdii
ref|XP_010744287.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    236   4e-72    Larimichthys crocea [croceine croaker]
ref|NP_001133080.1|  ATP-dependent RNA helicase DDX39                   236   4e-72    Salmo salar
ref|XP_004872546.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    238   6e-72    
dbj|BAD92454.1|  HLA-B associated transcript 1 variant                  232   6e-72    Homo sapiens [man]
ref|XP_004628303.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    236   6e-72    
dbj|BAE23239.1|  unnamed protein product                                236   7e-72    Mus musculus [mouse]
ref|NP_932099.2|  ATP-dependent RNA helicase DDX39A                     236   7e-72    Mus musculus [mouse]
ref|XP_009827129.1|  DEAD-box ATP-dependent RNA helicase 15             235   7e-72    Aphanomyces astaci
ref|XP_010871406.1|  PREDICTED: spliceosome RNA helicase DDX39B         236   7e-72    
ref|XP_004748289.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    237   8e-72    Mustela putorius furo [black ferret]
ref|XP_004073639.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       235   8e-72    
ref|XP_004711745.1|  PREDICTED: spliceosome RNA helicase DDX39B         235   9e-72    Echinops telfairi [lesser hedgehog tenrec]
dbj|BAE31182.1|  unnamed protein product                                235   9e-72    Mus musculus [mouse]
ref|XP_004635679.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       235   1e-71    Octodon degus
ref|XP_004715629.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       231   1e-71    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_002738626.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    235   1e-71    Saccoglossus kowalevskii
gb|AAA41787.1|  liver nuclear protein p47                               234   1e-71    Rattus norvegicus [brown rat]
dbj|BAG16272.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 39 transc...    230   1e-71    Homo sapiens [man]
ref|XP_010599849.1|  PREDICTED: spliceosome RNA helicase DDX39B         235   1e-71    
gb|ACM09195.1|  ATP-dependent RNA helicase DDX39                        235   1e-71    Salmo salar
gb|EGW00654.1|  ATP-dependent RNA helicase DDX39                        235   1e-71    Cricetulus griseus [Chinese hamsters]
ref|XP_006904735.1|  PREDICTED: spliceosome RNA helicase DDX39B         235   1e-71    Pteropus alecto
dbj|BAE43010.1|  unnamed protein product                                235   1e-71    Mus musculus [mouse]
ref|XP_005381156.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    235   1e-71    Chinchilla lanigera
ref|XP_003972140.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    235   1e-71    Takifugu rubripes [tiger puffer]
emb|CAA84355.1|  BAT1                                                   235   1e-71    Sus scrofa [pigs]
ref|XP_006874383.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       235   1e-71    Chrysochloris asiatica
ref|XP_006178881.1|  PREDICTED: spliceosome RNA helicase DDX39B         234   1e-71    
ref|XP_001366378.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    235   1e-71    Monodelphis domestica
ref|NP_062667.1|  spliceosome RNA helicase Ddx39b                       235   1e-71    Mus musculus [mouse]
ref|XP_004277466.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       234   1e-71    Orcinus orca [Orca]
ref|XP_003501931.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       234   1e-71    Cricetulus griseus [Chinese hamsters]
gb|EPY85364.1|  v-type proton ATPase subunit G 2 isoform 1              234   1e-71    Camelus ferus
gb|ELK18937.1|  Spliceosome RNA helicase BAT1                           234   2e-71    Pteropus alecto
ref|NP_001014399.1|  spliceosome RNA helicase DDX39B                    234   2e-71    Canis lupus familiaris [dogs]
ref|XP_006154309.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    234   2e-71    Tupaia chinensis
ref|XP_008992391.1|  PREDICTED: LOW QUALITY PROTEIN: spliceosome ...    234   2e-71    Callithrix jacchus [common marmoset]
gb|EFB18180.1|  hypothetical protein PANDA_020423                       234   2e-71    Ailuropoda melanoleuca
gb|EHH52904.1|  hypothetical protein EGM_13439                          234   2e-71    Macaca fascicularis [crab eating macaque]
gb|EHH18152.1|  hypothetical protein EGK_14701                          234   2e-71    Macaca mulatta [rhesus macaque]
ref|XP_006896266.1|  PREDICTED: spliceosome RNA helicase DDX39B         234   2e-71    Elephantulus edwardii [Cape long-eared elephant shrew]
gb|AAP36788.1|  Homo sapiens HLA-B associated transcript 1              234   2e-71    synthetic construct
ref|XP_010611745.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    234   2e-71    Fukomys damarensis [Damara mole rat]
ref|XP_004060213.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    231   2e-71    
ref|XP_007537232.1|  PREDICTED: spliceosome RNA helicase DDX39B         234   2e-71    
ref|XP_006738543.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    234   2e-71    
ref|XP_004621320.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    234   2e-71    Sorex araneus [Eurasian shrew]
dbj|BAD96632.1|  HLA-B associated transcript 1 variant                  234   2e-71    Homo sapiens [man]
ref|NP_004631.1|  spliceosome RNA helicase DDX39B                       234   2e-71    Homo sapiens [man]
gb|ACN58701.1|  ATP-dependent RNA helicase DDX39                        234   2e-71    Salmo salar
ref|XP_006821292.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    235   2e-71    Saccoglossus kowalevskii
ref|XP_006875676.1|  PREDICTED: spliceosome RNA helicase DDX39B         234   2e-71    Chrysochloris asiatica
ref|XP_003985959.1|  PREDICTED: spliceosome RNA helicase DDX39B         234   2e-71    Felis catus [cat]
ref|XP_004624380.1|  PREDICTED: spliceosome RNA helicase DDX39B         234   2e-71    Octodon degus
gb|AIC55357.1|  hypothetical protein                                    234   2e-71    synthetic construct
ref|XP_003474035.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    234   2e-71    Cavia porcellus [guinea pig]
gb|AAL98920.1|  Bat1                                                    234   2e-71    Rattus norvegicus [brown rat]
ref|XP_003443119.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    234   2e-71    Oreochromis niloticus
ref|XP_006161075.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       234   2e-71    Tupaia chinensis
ref|XP_005339077.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    234   2e-71    Ictidomys tridecemlineatus
ref|XP_010744670.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    234   2e-71    
ref|XP_005370902.1|  PREDICTED: spliceosome RNA helicase DDX39B         234   2e-71    Microtus ochrogaster [prairie voles]
ref|XP_004415272.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    234   2e-71    Odobenus rosmarus divergens
ref|XP_005802856.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    234   2e-71    Xiphophorus maculatus
ref|XP_008535724.1|  PREDICTED: spliceosome RNA helicase DDX39B         234   2e-71    Equus przewalskii [Przewalski horse]
ref|XP_004748290.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    234   2e-71    Mustela putorius furo [black ferret]
ref|XP_006995295.1|  PREDICTED: spliceosome RNA helicase Ddx39b         234   2e-71    
ref|XP_005086851.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    234   2e-71    Mesocricetus auratus [Syrian golden hamster]
ref|XP_006738542.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    234   2e-71    Leptonychotes weddellii
dbj|BAE39902.1|  unnamed protein product                                234   2e-71    Mus musculus [mouse]
ref|XP_010744669.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    233   2e-71    
gb|EPQ03753.1|  Spliceosome RNA helicase DDX39B                         234   2e-71    Myotis brandtii
ref|XP_008303441.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       234   3e-71    Stegastes partitus
gb|ABU86917.1|  Bat1                                                    235   3e-71    Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_008054817.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       234   3e-71    Carlito syrichta
ref|XP_004442630.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       234   3e-71    Ceratotherium simum simum [southern square-lipped rhinoceros]
emb|CCA18117.1|  predicted protein putative                             234   3e-71    Albugo laibachii Nc14
ref|XP_007569619.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    234   3e-71    Poecilia formosa
emb|CDQ82873.1|  unnamed protein product                                234   3e-71    Oncorhynchus mykiss
ref|XP_007229864.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    234   3e-71    Astyanax mexicanus [blind cave fish]
ref|XP_008508629.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    234   3e-71    Equus przewalskii [Przewalski horse]
ref|XP_007098876.1|  PREDICTED: spliceosome RNA helicase DDX39B         234   3e-71    Panthera tigris altaica
ref|XP_005696668.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    234   3e-71    
ref|XP_006052355.1|  PREDICTED: spliceosome RNA helicase DDX39B-like    234   3e-71    
ref|XP_008868859.1|  DEAD-box ATP-dependent RNA helicase 56             234   3e-71    Aphanomyces invadans
ref|NP_001087845.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B         234   3e-71    Xenopus laevis [clawed frog]
ref|XP_009239916.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    234   3e-71    Pongo abelii [orang utan]
dbj|BAE37719.1|  unnamed protein product                                234   3e-71    Mus musculus [mouse]
ref|NP_446015.2|  ATP-dependent RNA helicase DDX39A                     234   3e-71    Rattus norvegicus [brown rat]
ref|NP_989072.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B            234   3e-71    Xenopus tropicalis [western clawed frog]
gb|ERE79092.1|  ATP-dependent RNA helicase DDX39A                       234   3e-71    
ref|XP_003760703.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       234   3e-71    
ref|XP_004671945.1|  PREDICTED: spliceosome RNA helicase DDX39B         234   3e-71    
ref|XP_003218034.1|  PREDICTED: spliceosome RNA helicase DDX39B         234   3e-71    
ref|XP_010738714.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    234   3e-71    
ref|XP_006036655.1|  PREDICTED: spliceosome RNA helicase DDX39B-like    234   3e-71    
ref|XP_005696667.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    234   3e-71    
ref|NP_957237.1|  HLA-B associated transcript 1                         234   3e-71    
ref|XP_010611743.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    234   4e-71    
emb|CDQ66513.1|  unnamed protein product                                234   4e-71    
ref|XP_004999904.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    234   4e-71    
ref|XP_010611744.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    234   4e-71    
ref|NP_001080733.1|  nuclear RNA helicase                               234   4e-71    
ref|NP_001028801.1|  spliceosome RNA helicase DDX39B                    234   4e-71    
ref|XP_002921018.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       233   4e-71    
gb|ETM48634.1|  ATP-dependent RNA helicase uap56                        233   4e-71    
ref|XP_008903594.1|  ATP-dependent RNA helicase uap56                   233   4e-71    
ref|XP_004539320.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    233   4e-71    
ref|XP_007576497.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       233   5e-71    
ref|XP_005627100.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    234   5e-71    
gb|AAC16391.1|  nuclear RNA helicase                                    233   5e-71    
ref|NP_001079623.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 39A         233   5e-71    
ref|XP_010976510.1|  PREDICTED: LOW QUALITY PROTEIN: spliceosome ...    234   5e-71    
ref|XP_008955196.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    234   5e-71    
ref|XP_005995919.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    233   5e-71    
gb|EFB28644.1|  hypothetical protein PANDA_009904                       233   5e-71    
ref|XP_009239915.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    234   5e-71    
ref|XP_010899336.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    233   6e-71    
ref|XP_008289807.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       233   6e-71    
ref|XP_004065549.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       233   6e-71    
ref|XP_004389822.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       233   6e-71    
ref|XP_007182118.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    233   7e-71    
ref|XP_007489116.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    236   7e-71    
ref|NP_001016000.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 39A         233   8e-71    
ref|XP_008328948.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       233   8e-71    
ref|XP_005665849.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    234   8e-71    
ref|XP_005463663.1|  PREDICTED: spliceosome RNA helicase DDX39B-l...    232   8e-71    
ref|XP_004748288.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    234   9e-71    
ref|XP_005632846.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    233   9e-71    
ref|XP_008260767.1|  PREDICTED: LOW QUALITY PROTEIN: spliceosome ...    233   9e-71    
ref|XP_008709919.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       234   9e-71    
ref|XP_003461865.2|  PREDICTED: ATP-dependent RNA helicase DDX39A...    233   1e-70    
gb|AAH32128.1|  DDX39 protein                                           229   1e-70    
ref|XP_007069230.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       232   1e-70    
ref|XP_533895.2|  PREDICTED: ATP-dependent RNA helicase DDX39A is...    233   1e-70    
ref|XP_004688293.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       233   1e-70    
ref|XP_010330591.1|  PREDICTED: LOW QUALITY PROTEIN: spliceosome ...    233   1e-70    
ref|XP_006918833.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       233   1e-70    
ref|XP_004673033.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       233   1e-70    
ref|XP_005661286.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    233   1e-70    
ref|XP_005953207.1|  PREDICTED: spliceosome RNA helicase DDX39B-like    228   1e-70    
ref|XP_003063800.1|  predicted protein                                  232   1e-70    
ref|XP_006173093.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       232   1e-70    
ref|XP_005661287.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    232   1e-70    
ref|XP_006100393.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    232   1e-70    
ref|XP_003941746.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    232   2e-70    
ref|XP_008412609.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       232   2e-70    
ref|XP_009449127.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    232   2e-70    
ref|XP_004008522.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       232   2e-70    
sp|Q5ZHZ0.1|DX39B_CHICK  RecName: Full=Spliceosome RNA helicase D...    232   2e-70    
ref|NP_001029924.1|  ATP-dependent RNA helicase DDX39A                  232   2e-70    
gb|KFM82349.1|  Spliceosome RNA helicase DDX39B                         232   2e-70    
ref|XP_005797553.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    232   2e-70    
ref|NP_005795.2|  ATP-dependent RNA helicase DDX39A                     232   2e-70    
gb|EAW84415.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 39, isofor...    228   2e-70    
ref|XP_004905482.1|  PREDICTED: spliceosome RNA helicase Ddx39b i...    233   2e-70    
ref|XP_006100392.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    232   2e-70    
gb|ADB44901.1|  DEAD(Asp-Glu-Ala-Asp) box polypeptide 39                232   2e-70    
gb|ACO09904.1|  ATP-dependent RNA helicase DDX39                        232   2e-70    
ref|XP_003123418.3|  PREDICTED: ATP-dependent RNA helicase DDX39A...    233   2e-70    
ref|XP_007129491.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    232   2e-70    
gb|EHH29721.1|  ATP-dependent RNA helicase DDX39                        233   2e-70    
ref|XP_006779616.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD (Asp-Gl...    232   2e-70    
ref|XP_010350778.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    233   2e-70    
ref|XP_010350775.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    233   3e-70    
ref|XP_003413378.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       231   3e-70    
ref|XP_004595622.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    231   3e-70    
ref|XP_002127634.2|  PREDICTED: spliceosome RNA helicase DDX39B         231   3e-70    
ref|XP_008171663.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       231   3e-70    
ref|XP_005086850.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    233   3e-70    
ref|XP_010871251.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       231   3e-70    
gb|ELK26087.1|  ATP-dependent RNA helicase DDX39A                       231   3e-70    
ref|XP_007459648.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    234   3e-70    
ref|XP_009449126.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    232   3e-70    
ref|XP_004286664.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    234   3e-70    
ref|XP_007952615.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       231   3e-70    
ref|XP_005865907.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    231   3e-70    
ref|XP_005888083.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       232   3e-70    
ref|XP_005463661.1|  PREDICTED: spliceosome RNA helicase DDX39B-l...    231   4e-70    
ref|XP_003787565.1|  PREDICTED: spliceosome RNA helicase DDX39B-l...    231   4e-70    
ref|XP_005160298.1|  PREDICTED: DEAD (Asp-Glu-Ala-Asp) box polype...    231   5e-70    
ref|XP_007532506.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       231   5e-70    
ref|XP_008613771.1|  DEAD-box ATP-dependent RNA helicase 15             231   5e-70    
ref|XP_004781072.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    233   5e-70    
gb|EMP26984.1|  ATP-dependent RNA helicase DDX39A                       234   6e-70    
ref|XP_008985661.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    231   6e-70    
ref|XP_008564250.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       231   6e-70    
ref|XP_009449125.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    231   6e-70    
gb|ACO09679.1|  ATP-dependent RNA helicase DDX39                        231   6e-70    
ref|XP_010853738.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    231   7e-70    
ref|XP_003972172.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    230   8e-70    
ref|XP_005389371.1|  PREDICTED: spliceosome RNA helicase DDX39B         233   8e-70    
ref|XP_004573690.1|  PREDICTED: spliceosome RNA helicase DDX39B-l...    230   9e-70    
ref|XP_007253188.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    231   9e-70    
gb|ELK06762.1|  ATP-dependent RNA helicase DDX39                        231   1e-69    
ref|XP_006066605.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    231   1e-69    
dbj|BAG63290.1|  unnamed protein product                                231   1e-69    
ref|XP_007436162.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       230   1e-69    
ref|XP_003217350.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    230   1e-69    
gb|EYC23928.1|  hypothetical protein Y032_0014g2222                     225   1e-69    
ref|XP_006066604.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    231   1e-69    
ref|XP_010853737.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    231   1e-69    
ref|XP_005208677.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    231   1e-69    
emb|CDQ80585.1|  unnamed protein product                                241   1e-69    
ref|XP_004467949.1|  PREDICTED: spliceosome RNA helicase DDX39B         232   1e-69    
gb|EHH59286.1|  ATP-dependent RNA helicase DDX39                        231   1e-69    
ref|XP_004616874.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       229   1e-69    
ref|XP_005865906.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    231   1e-69    
gb|AAM18861.1|AF391287_2  unknown                                       229   1e-69    
gb|EYC23929.1|  hypothetical protein Y032_0014g2222                     226   2e-69    
ref|XP_007907581.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       229   2e-69    
ref|XP_006106715.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    229   2e-69    
gb|ELT91951.1|  hypothetical protein CAPTEDRAFT_165082                  229   2e-69    
ref|XP_008065870.1|  PREDICTED: spliceosome RNA helicase DDX39B         233   2e-69    
ref|XP_003148938.1|  hypothetical protein LOAG_13381                    225   2e-69    
gb|AAH71505.1|  Ddx39a protein                                          229   2e-69    
ref|XP_001635457.1|  predicted protein                                  229   2e-69    
ref|XP_006086100.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    229   3e-69    
gb|KIH42433.1|  DEAD/DEAH box helicase                                  222   3e-69    
emb|CDJ83122.1|  DNA RNA helicase domain containing protein             229   3e-69    
ref|XP_002164853.1|  PREDICTED: spliceosome RNA helicase DDX39B-like    229   3e-69    
ref|XP_006902690.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    228   3e-69    
ref|XP_005661285.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    231   3e-69    
ref|XP_002185552.1|  predicted protein                                  228   4e-69    
emb|CEG02049.1|  Helicase, C-terminal                                   230   4e-69    
ref|XP_002296387.1|  dead box family RNA helicase                       229   4e-69    
gb|AAB50231.1|  nuclear RNA helicase                                    228   4e-69    
ref|XP_010853736.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    230   5e-69    
ref|XP_006066602.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    230   5e-69    
dbj|BAB15509.1|  unnamed protein product                                229   5e-69    
ref|XP_009048437.1|  hypothetical protein LOTGIDRAFT_225638             228   6e-69    
gb|KFO21034.1|  Spliceosome RNA helicase DDX39B                         235   6e-69    
ref|XP_006886475.1|  PREDICTED: spliceosome RNA helicase DDX39B-like    228   8e-69    
ref|XP_003747488.1|  PREDICTED: spliceosome RNA helicase DDX39B-like    228   9e-69    
ref|XP_006096516.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    228   9e-69    
ref|XP_002109407.1|  conserved hypothetical protein                     227   1e-68    
ref|XP_006085397.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    227   1e-68    
ref|XP_007129489.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    230   1e-68    
ref|XP_974045.1|  PREDICTED: ATP-dependent RNA helicase WM6             227   1e-68    
ref|XP_011414939.1|  PREDICTED: spliceosome RNA helicase DDX39B         227   1e-68    
gb|ETN83397.1|  spliceosome RNA helicase BAT1                           227   1e-68    
ref|XP_007534285.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    227   2e-68    
ref|XP_005845689.1|  hypothetical protein CHLNCDRAFT_136793             229   2e-68    
ref|XP_003082939.1|  putative HLA-B associated transcript 1 (ISS)       229   3e-68    
pdb|1XTK|A  Chain A, Structure Of Decd To Dead Mutation Of Human ...    225   3e-68    
pdb|1XTJ|A  Chain A, Structure Of Human Uap56 In Complex With Adp       225   3e-68    
pdb|1XTI|A  Chain A, Structure Of Wildtype Human Uap56                  225   3e-68    
gb|KHN85147.1|  Spliceosome RNA helicase DDX39B -like protein           226   3e-68    
ref|XP_006107502.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    226   3e-68    
gb|EHB16049.1|  Spliceosome RNA helicase Bat1                           226   5e-68    
gb|EMS20830.1|  ATP-dependent rna helicase sub2                         226   5e-68    
ref|XP_006132079.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    226   6e-68    
gb|EJK56348.1|  hypothetical protein THAOC_23784                        225   6e-68    
ref|XP_005710441.1|  Putative ATP-dependent RNA helicase, Uap56         226   6e-68    
gb|EJW87829.1|  spliceosome RNA helicase BAT1                           225   6e-68    
gb|EKC20273.1|  Spliceosome RNA helicase BAT1                           227   6e-68    
ref|XP_006108869.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    225   6e-68    
emb|CDQ03226.1|  Protein BM-HEL-1, isoform a                            225   7e-68    
gb|EJD74236.1|  spliceosome RNA helicase BAT1                           225   7e-68    
gb|KDD77120.1|  DEAD/DEAH box helicase                                  225   8e-68    
ref|XP_001942765.1|  PREDICTED: ATP-dependent RNA helicase WM6          225   8e-68    
ref|NP_001021986.1|  Protein HEL-1, isoform b                           220   9e-68    
gb|EIE84435.1|  ATP-dependent RNA helicase uap56                        225   1e-67    
gb|AGM32791.1|  DEAD box ATP-dependent RNA helicase-like protein        219   1e-67    
ref|XP_001515366.2|  PREDICTED: ATP-dependent RNA helicase DDX39A       225   1e-67    
ref|XP_007410654.1|  hypothetical protein MELLADRAFT_48571              224   1e-67    
gb|EIE79315.1|  ATP-dependent RNA helicase uap56                        224   2e-67    
ref|XP_010101269.1|  DEAD-box ATP-dependent RNA helicase 56             226   2e-67    
dbj|BAF31287.1|  BAT1 protein                                           224   2e-67    
gb|ELR50186.1|  Spliceosome RNA helicase BAT1                           224   3e-67    
gb|EIF49828.1|  atp-dependent rna helicase sub2                         224   3e-67    
ref|XP_002906628.1|  DEAD/DEAH box RNA helicase, putative               224   3e-67    
ref|XP_001893112.1|  Probable ATP-dependent RNA helicase p47 homolog    230   3e-67    
gb|AEE63533.1|  unknown                                                 223   3e-67    
ref|XP_003326361.1|  ATP-dependent RNA helicase uap56                   223   4e-67    
emb|CBY38854.1|  unnamed protein product                                223   4e-67    
gb|EFX64849.1|  hypothetical protein DAPPUDRAFT_219465                  223   5e-67    
ref|XP_003791455.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    223   6e-67    
gb|ACO11252.1|  ATP-dependent RNA helicase DDX39                        223   7e-67    
gb|ACO10850.1|  ATP-dependent RNA helicase DDX39                        223   7e-67    
ref|XP_006107135.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    223   7e-67    
ref|XP_003117300.1|  CRE-HEL-1 protein                                  222   8e-67    
ref|XP_006956118.1|  P-loop containing nucleoside triphosphate hy...    222   9e-67    
gb|EGT52318.1|  CBN-HEL-1 protein                                       222   1e-66    
gb|ADD24298.1|  Spliceosome RNA helicase BAT1                           222   1e-66    
ref|XP_002630267.1|  C. briggsae CBR-HEL-1 protein                      222   1e-66    
ref|NP_001021985.1|  Protein HEL-1, isoform a                           222   1e-66    
ref|XP_009020730.1|  hypothetical protein HELRODRAFT_112849             222   1e-66    
gb|AAB65852.1|  putative RNA helicase                                   221   1e-66    
ref|XP_007878578.1|  hypothetical protein PFL1_02874                    223   2e-66    
emb|CEP12723.1|  hypothetical protein                                   221   2e-66    
ref|XP_004872545.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    223   2e-66    
ref|XP_011502327.1|  PREDICTED: ATP-dependent RNA helicase WM6          221   2e-66    
gb|KDE09298.1|  hypothetical protein MVLG_00616                         230   2e-66    
ref|XP_004872544.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    223   3e-66    
ref|NP_594261.1|  ATP-dependent RNA helicase Uap56                      221   3e-66    
gb|EKD02297.1|  ATP dependent RNA helicase                              220   3e-66    
ref|XP_009033759.1|  hypothetical protein AURANDRAFT_52520              222   3e-66    
emb|CEI95093.1|  Putative ATP dependent RNA helicase                    221   3e-66    
emb|CEI88988.1|  Putative ATP-dependent RNA helicase                    221   3e-66    
gb|KDR23694.1|  ATP-dependent RNA helicase WM6                          221   3e-66    
emb|CEG73344.1|  Putative ATP dependent RNA helicase                    221   3e-66    
ref|XP_004872547.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    222   4e-66    
ref|XP_004872541.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    223   4e-66    
ref|XP_008545539.1|  PREDICTED: ATP-dependent RNA helicase WM6          220   4e-66    
ref|XP_002175680.1|  ATP-dependent RNA helicase Uap56                   221   5e-66    
emb|CDO70924.1|  hypothetical protein BN946_scf184829.g32               214   6e-66    
emb|CDQ82872.1|  unnamed protein product                                213   7e-66    
gb|EPY52787.1|  ATP-dependent RNA helicase Uap56                        220   7e-66    
ref|XP_001606676.1|  PREDICTED: ATP-dependent RNA helicase WM6-like     220   7e-66    
ref|XP_001606735.1|  PREDICTED: ATP-dependent RNA helicase WM6-like     220   7e-66    



>ref|XP_009771911.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nicotiana 
sylvestris]
 ref|XP_009771912.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nicotiana 
sylvestris]
Length=428

 Score =   322 bits (825),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 167/174 (96%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGENKENDAYEEELLDYEE+DEKAPDSV  KVNGESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGENKENDAYEEELLDYEEDDEKAPDSVNGKVNGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HK+LLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKLHKELLKNECPHIVVGT  174



>ref|XP_009758663.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X3 [Nicotiana sylvestris]
Length=428

 Score =   320 bits (821),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 172/174 (99%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ KENDAYEEELLDYEE+DEKAPDS++AKVNGESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDTKENDAYEEELLDYEEDDEKAPDSISAKVNGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAA+V
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAMV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HK+LLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKLHKELLKNECPHIVVGT  174



>ref|XP_009624283.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nicotiana 
tomentosiformis]
Length=428

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 166/174 (95%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGENKENDAYEEELLDYEE+DEKAPD V  KVNGESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGENKENDAYEEELLDYEEDDEKAPDLVNGKVNGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HK+LLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKLHKELLKNECPHIVVGT  174



>ref|XP_002515525.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF46974.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=275

 Score =   313 bits (803),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++NDAYEEELLDYEEE+EKAPDSVAAKVNGESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDAYEEELLDYEEEEEKAPDSVAAKVNGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP +GQV ALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPTSGQVIALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPD KVAVFYGGV+I IHKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDTKVAVFYGGVHIKIHKDLLKNECPHIVVGT  174



>ref|XP_009783372.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Nicotiana 
sylvestris]
 ref|XP_009783373.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Nicotiana 
sylvestris]
Length=428

 Score =   318 bits (816),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGENKENDAYEEELLDYEE+DEK PDSV  KVNG+SAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGENKENDAYEEELLDYEEDDEKLPDSVTGKVNGDSAKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL+
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALI  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HK+LLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKLHKELLKNECPHIVVGT  174



>ref|XP_009606356.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009606362.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Nicotiana tomentosiformis]
Length=428

 Score =   318 bits (816),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 173/174 (99%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG++KENDAYEEELLDYEE+DEKAPDS++AKV+GESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDSKENDAYEEELLDYEEDDEKAPDSISAKVSGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAA+V
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAMV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HK+LLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKLHKELLKNECPHIVVGT  174



>ref|XP_002285072.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Vitis vinifera]
Length=428

 Score =   318 bits (815),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++NDAYEEELLDYEEE++KAPDSV  KVNGE+AKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDAYEEELLDYEEEEDKAPDSVTGKVNGEAAKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPV GQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVTGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI IHKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKIHKDLLKNECPHIVVGT  174



>ref|XP_011070464.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Sesamum indicum]
Length=428

 Score =   318 bits (814),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 166/174 (95%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ KENDAYEEELLDYEEEDEKAPDSV AKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDTKENDAYEEELLDYEEEDEKAPDSVNAKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV+I IHKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVSIKIHKDLLKNECPHIVVGT  174



>ref|XP_011081570.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Sesamum indicum]
Length=428

 Score =   317 bits (813),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K+NDAYEEELLDYEEEDEKAPDSV AKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETKDNDAYEEELLDYEEEDEKAPDSVGAKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTY+P+IKVAVFYGGVNI IHKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYIPEIKVAVFYGGVNIKIHKDLLKNECPHIVVGT  174



>gb|EPS57760.1| hypothetical protein M569_17057, partial [Genlisea aurea]
Length=206

 Score =   309 bits (791),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ KEN+AYEEELLDYEEE+EK PDS AAK NGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDTKENEAYEEELLDYEEEEEKVPDSAAAKTNGEAGKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            +IVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   SIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI IHKDLLKNECP IVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKIHKDLLKNECPQIVVGT  174



>ref|XP_006361727.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006361728.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X2 [Solanum tuberosum]
Length=427

 Score =   316 bits (809),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 166/174 (95%), Positives = 170/174 (98%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGENKENDAYEEELLDYEE+DEK PDS A KVNGESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGENKENDAYEEELLDYEEDDEKIPDS-ATKVNGESAKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HK+LLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKLHKELLKNECPHIVVGT  173



>ref|XP_009758660.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009758661.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Nicotiana sylvestris]
Length=534

 Score =   319 bits (817),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 172/174 (99%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ KENDAYEEELLDYEE+DEKAPDS++AKVNGESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDTKENDAYEEELLDYEEDDEKAPDSISAKVNGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAA+V
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAMV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HK+LLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKLHKELLKNECPHIVVGT  174



>ref|XP_010254382.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Nelumbo nucifera]
Length=428

 Score =   315 bits (808),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE +ENDAYEEELLDYEEE+EKAPDSVAAK  GE+AKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEVRENDAYEEELLDYEEEEEKAPDSVAAKGTGEAAKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI  HKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKTHKDLLKNECPHIVVGT  174



>gb|KDP33603.1| hypothetical protein JCGZ_07174 [Jatropha curcas]
Length=428

 Score =   315 bits (808),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++NDAYEEELLDYEEE+EKAPDSVAAKVNGESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDAYEEELLDYEEEEEKAPDSVAAKVNGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV ALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPTTGQVIALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPD KVAVFYGGVNI  HKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDTKVAVFYGGVNIKTHKDLLKNECPHIVVGT  174



>gb|KJB65812.1| hypothetical protein B456_010G114300 [Gossypium raimondii]
Length=273

 Score =   310 bits (793),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++NDAYEEELLDYEEE+EKAPDSV AKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDAYEEELLDYEEEEEKAPDSVTAKVNGEAGKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQIEP  GQV ALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIEPTPGQVIALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVN+ +HKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNVKVHKDLLKNECPHIVVGT  174



>ref|XP_009595644.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nicotiana 
tomentosiformis]
 ref|XP_009595645.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nicotiana 
tomentosiformis]
Length=428

 Score =   315 bits (807),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGENKENDAYEEELLDYEE+DEK  DS + KVNGESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGENKENDAYEEELLDYEEDDEKLHDSFSGKVNGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HK+LLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKLHKELLKNECPHIVVGT  174



>ref|XP_010924921.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Elaeis guineensis]
 ref|XP_010924922.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Elaeis guineensis]
Length=428

 Score =   315 bits (807),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE +ENDAYEEELLDYEE++EKAPDSVAAK N ESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEARENDAYEEELLDYEEDEEKAPDSVAAKANNESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV+I  HKD+LKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVHIAKHKDILKNECPHIVVGT  174



>ref|XP_008806594.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Phoenix dactylifera]
 ref|XP_008806602.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Phoenix dactylifera]
Length=428

 Score =   315 bits (807),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE +ENDAYEEELLDYEE++EKAPDSVAAK N ESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEARENDAYEEELLDYEEDEEKAPDSVAAKANNESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV+I  HKD+LKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVHIAKHKDILKNECPHIVVGT  174



>gb|KDP37097.1| hypothetical protein JCGZ_06153 [Jatropha curcas]
Length=428

 Score =   314 bits (805),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K+NDAYEEELLDYEEEDEKAPDSV+AK   ESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEVKDNDAYEEELLDYEEEDEKAPDSVSAKAGAESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HKD+LKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKVHKDILKNECPHIVVGT  174



>ref|XP_007011880.1| DEAD/DEAH box RNA helicase family protein isoform 3 [Theobroma 
cacao]
 gb|EOY29499.1| DEAD/DEAH box RNA helicase family protein isoform 3 [Theobroma 
cacao]
Length=429

 Score =   314 bits (805),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++NDAYEEELLDYEEE+EKAPDSV AKVNGESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDAYEEELLDYEEEEEKAPDSVTAKVNGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQIEP  GQV ALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIEPSPGQVIALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKVHKDLLKNECPHIVVGT  174



>ref|XP_007011879.1| DEAD/DEAH box RNA helicase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY29498.1| DEAD/DEAH box RNA helicase family protein isoform 2 [Theobroma 
cacao]
Length=428

 Score =   314 bits (805),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++NDAYEEELLDYEEE+EKAPDSV AKVNGESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDAYEEELLDYEEEEEKAPDSVTAKVNGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQIEP  GQV ALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIEPSPGQVIALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKVHKDLLKNECPHIVVGT  174



>ref|XP_004241774.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Solanum lycopersicum]
Length=428

 Score =   314 bits (804),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ KEN+AYEEELLDYEE+DEKAPDSV  KVNGESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDTKENEAYEEELLDYEEDDEKAPDSVNGKVNGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPV GQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVPGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HK+LLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKLHKELLKNECPHIVVGT  174



>ref|XP_006353691.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like [Solanum 
tuberosum]
Length=428

 Score =   314 bits (804),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ KEN+AYEEELLDYEE+DEKAPDSV  KVNGESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDTKENEAYEEELLDYEEDDEKAPDSVNGKVNGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPV GQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVPGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HK+LLKNECPH+VVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKLHKELLKNECPHVVVGT  174



>ref|XP_006346265.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006346266.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X2 [Solanum tuberosum]
Length=428

 Score =   313 bits (803),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            M + KENDAYEEELLDYEE+DEKAPDS++ K+NGESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MEDTKENDAYEEELLDYEEDDEKAPDSISGKINGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDV+CQAKSGMGKTAVFVLSTLQQIEPVAGQVAA+V
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLSTLQQIEPVAGQVAAIV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HK+LLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKLHKELLKNECPHIVVGT  174



>ref|XP_004245029.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Solanum lycopersicum]
 ref|XP_010324987.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Solanum lycopersicum]
Length=427

 Score =   313 bits (803),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 169/174 (97%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGENKENDAYEEELLDYEE+DEK PDS   KVNGES+KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGENKENDAYEEELLDYEEDDEKIPDS-TTKVNGESSKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HK+LLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKLHKELLKNECPHIVVGT  173



>dbj|BAJ53224.1| JHL06P13.3 [Jatropha curcas]
Length=455

 Score =   314 bits (804),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K+NDAYEEELLDYEEEDEKAPDSV+AK   ESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEVKDNDAYEEELLDYEEEDEKAPDSVSAKAGAESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HKD+LKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKVHKDILKNECPHIVVGT  174



>gb|KCW80390.1| hypothetical protein EUGRSUZ_C01749 [Eucalyptus grandis]
Length=430

 Score =   313 bits (801),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ ++NDAYEEELLDYEEE++KAPDSV AK NGE+AK+GY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNDAYEEELLDYEEEEDKAPDSVNAKANGEAAKRGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFS YLPDIKVAVFYGGVNI IHK+LLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSVYLPDIKVAVFYGGVNIKIHKELLKNECPHIVVGT  174



>gb|KJB54996.1| hypothetical protein B456_009G057600 [Gossypium raimondii]
Length=382

 Score =   311 bits (797),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++NDAYEEELLDYEEE+EKAPDSV AKVNGE  KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDAYEEELLDYEEEEEKAPDSVTAKVNGEGGKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV ALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVIALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKVHKDLLKNECPHIVVGT  174



>ref|XP_010267037.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nelumbo 
nucifera]
Length=428

 Score =   312 bits (800),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE +EN+AYEEELLDYEEE+EKAPDS+ AK  GESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRENEAYEEELLDYEEEEEKAPDSIGAKGTGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPD+KVAVFYGGVNI IHK++LKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDLKVAVFYGGVNIKIHKEMLKNECPHIVVGT  174



>ref|XP_010048208.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Eucalyptus grandis]
 ref|XP_010048209.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Eucalyptus grandis]
 gb|KCW80388.1| hypothetical protein EUGRSUZ_C01749 [Eucalyptus grandis]
 gb|KCW80389.1| hypothetical protein EUGRSUZ_C01749 [Eucalyptus grandis]
Length=427

 Score =   312 bits (800),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ ++NDAYEEELLDYEEE++KAPDSV AK NGE+AK+GY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNDAYEEELLDYEEEEDKAPDSVNAKANGEAAKRGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFS YLPDIKVAVFYGGVNI IHK+LLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSVYLPDIKVAVFYGGVNIKIHKELLKNECPHIVVGT  174



>gb|KHG04363.1| DEAD-box ATP-dependent RNA helicase 56 [Gossypium arboreum]
Length=290

 Score =   307 bits (787),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++NDAYEEELLDYEEE+EK PDSV AKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDAYEEELLDYEEEEEKVPDSVTAKVNGEAGKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQIEP  GQV ALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIEPTPGQVIALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVN+ +HKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNVKVHKDLLKNECPHIVVGT  174



>ref|XP_002268833.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Vitis vinifera]
 emb|CBI36308.3| unnamed protein product [Vitis vinifera]
Length=428

 Score =   312 bits (799),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++NDAYEEELLDYEEEDEKAPDSVA+K  GESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEARDNDAYEEELLDYEEEDEKAPDSVASKAAGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            +IVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   SIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV+I  HKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVSIKTHKDLLKNECPHIVVGT  174



>gb|KJB27350.1| hypothetical protein B456_004G292500 [Gossypium raimondii]
Length=428

 Score =   312 bits (799),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++NDAYEEELLDYEEE+EKAPDSV AKVNG++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDAYEEELLDYEEEEEKAPDSVTAKVNGDAGKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV ALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPTPGQVVALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HKDLLKNECPH+VVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKVHKDLLKNECPHVVVGT  174



>ref|XP_007023165.1| DEAD/DEAH box RNA helicase family protein isoform 3 [Theobroma 
cacao]
 gb|EOY25787.1| DEAD/DEAH box RNA helicase family protein isoform 3 [Theobroma 
cacao]
Length=290

 Score =   307 bits (786),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 169/174 (97%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K+NDAYEEELLDYEEEDEKAPDSV+AK   +SAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEIKDNDAYEEELLDYEEEDEKAPDSVSAKA-ADSAKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            +IVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  60   SIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKV+VFYGGVNI +HKDLLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICHEFERFSTYLPDIKVSVFYGGVNIKVHKDLLKNECPHIVVGT  173



>gb|KJB54999.1| hypothetical protein B456_009G057600 [Gossypium raimondii]
Length=428

 Score =   311 bits (798),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++NDAYEEELLDYEEE+EKAPDSV AKVNGE  KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDAYEEELLDYEEEEEKAPDSVTAKVNGEGGKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV ALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVIALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKVHKDLLKNECPHIVVGT  174



>gb|KJB65811.1| hypothetical protein B456_010G114300 [Gossypium raimondii]
Length=428

 Score =   311 bits (797),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++NDAYEEELLDYEEE+EKAPDSV AKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDAYEEELLDYEEEEEKAPDSVTAKVNGEAGKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQIEP  GQV ALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIEPTPGQVIALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVN+ +HKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNVKVHKDLLKNECPHIVVGT  174



>ref|XP_009392978.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=428

 Score =   310 bits (794),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++NDAYEEELLDY+E++EKAPDS AAK +GES KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEARDNDAYEEELLDYDEDEEKAPDSAAAKASGESVKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AI+DSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIIDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV+I  HKD+LKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVHILKHKDILKNECPHIVVGT  174



>gb|KJB82814.1| hypothetical protein B456_013G215200 [Gossypium raimondii]
Length=428

 Score =   310 bits (794),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++ND YEE+LLDY+EE+EKAPDSV AKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDVYEEDLLDYDEEEEKAPDSVTAKVNGEAGKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQIEP  GQV ALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIEPSPGQVIALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKVHKDLLKNECPHIVVGT  174



>ref|XP_010250100.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nelumbo 
nucifera]
 ref|XP_010250101.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nelumbo 
nucifera]
Length=428

 Score =   310 bits (794),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++NDAYEEELLDYEEE+EKA DSVAAK  GE AKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDAYEEELLDYEEEEEKALDSVAAKGAGEVAKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI  HKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKTHKDLLKNECPHIVVGT  174



>ref|XP_009412246.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Musa acuminata subsp. malaccensis]
Length=428

 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++NDAYEEELLDYEEE+EKAPDS AAK +GE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEARDNDAYEEELLDYEEEEEKAPDSAAAKASGEAVKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV+I  HKD+LKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVHIMKHKDILKNECPHIVVGT  174



>ref|XP_002324856.1| hypothetical protein POPTR_0018s01620g [Populus trichocarpa]
 gb|EEF03421.1| hypothetical protein POPTR_0018s01620g [Populus trichocarpa]
Length=428

 Score =   309 bits (791),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++NDAYEEELLDYEEED+KAPDSV AKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDAYEEELLDYEEEDDKAPDSVGAKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            +IVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP +GQV ALV
Sbjct  61   SIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPTSGQVIALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPD KVAVFYGGVN+  HKDLLKNECPH+VVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDTKVAVFYGGVNVKTHKDLLKNECPHVVVGT  174



>ref|XP_008797870.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008797871.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Phoenix dactylifera]
Length=428

 Score =   309 bits (791),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE +ENDAYEEELLDYEE++EKAPD+VAAK + E+AKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEARENDAYEEELLDYEEDEEKAPDAVAAKASNETAKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPV+GQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVSGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV++  HKD+LKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVHVAKHKDILKNECPHIVVGT  174



>ref|XP_002309623.1| hypothetical protein POPTR_0006s26940g [Populus trichocarpa]
 ref|XP_011039701.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Populus euphratica]
 gb|EEE93146.1| hypothetical protein POPTR_0006s26940g [Populus trichocarpa]
Length=428

 Score =   309 bits (791),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++ND YEEELLDYEEEDEKAPDSV AKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDTYEEELLDYEEEDEKAPDSVGAKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            +IVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP +GQV ALV
Sbjct  61   SIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPTSGQVIALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPD KVAVFYGGVNI  HKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDTKVAVFYGGVNIKTHKDLLKNECPHIVVGT  174



>gb|ABK93079.1| unknown [Populus trichocarpa]
Length=428

 Score =   308 bits (790),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++ND YEEELLDYEEEDEKAPDSV AKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDTYEEELLDYEEEDEKAPDSVGAKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            +IVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP +GQV ALV
Sbjct  61   SIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPTSGQVIALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPD KVAVFYGGVNI  HKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDTKVAVFYGGVNIKTHKDLLKNECPHIVVGT  174



>ref|XP_007023164.1| DEAD/DEAH box RNA helicase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY25786.1| DEAD/DEAH box RNA helicase family protein isoform 2 [Theobroma 
cacao]
Length=406

 Score =   307 bits (786),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 169/174 (97%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K+NDAYEEELLDYEEEDEKAPDSV+AK   +SAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEIKDNDAYEEELLDYEEEDEKAPDSVSAKA-ADSAKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            +IVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  60   SIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKV+VFYGGVNI +HKDLLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICHEFERFSTYLPDIKVSVFYGGVNIKVHKDLLKNECPHIVVGT  173



>ref|XP_007023163.1| DEAD/DEAH box RNA helicase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY25785.1| DEAD/DEAH box RNA helicase family protein isoform 1 [Theobroma 
cacao]
Length=427

 Score =   307 bits (787),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 169/174 (97%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K+NDAYEEELLDYEEEDEKAPDSV+AK   +SAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEIKDNDAYEEELLDYEEEDEKAPDSVSAKA-ADSAKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            +IVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  60   SIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKV+VFYGGVNI +HKDLLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICHEFERFSTYLPDIKVSVFYGGVNIKVHKDLLKNECPHIVVGT  173



>ref|XP_004171175.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Cucumis 
sativus]
 ref|XP_008445205.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Cucumis melo]
 ref|XP_008445206.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Cucumis melo]
 gb|KGN62946.1| hypothetical protein Csa_2G381720 [Cucumis sativus]
Length=427

 Score =   307 bits (787),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 168/174 (97%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++N  YEEELLDYEEE+EKAPDSV AKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDN-EYEEELLDYEEEEEKAPDSVGAKVNGEAGKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVSALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPD+KVAVFYGGVNI IHKDLLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICHEFERFSTYLPDLKVAVFYGGVNIKIHKDLLKNECPHIVVGT  173



>ref|XP_010696045.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=428

 Score =   307 bits (787),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE +ENDAYEEELLDY+EE+EK PDS   K NGE+ KKGY+GI+SSGFRDFLLKPELLR
Sbjct  1    MGETRENDAYEEELLDYDEEEEKVPDSAVTKTNGEAGKKGYVGIYSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLP +KVAVFYGGVNI IHKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPGVKVAVFYGGVNIKIHKDLLKNECPHIVVGT  174



>gb|KCW81408.1| hypothetical protein EUGRSUZ_C02784 [Eucalyptus grandis]
Length=383

 Score =   306 bits (783),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +3

Query  78   KQQMGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPE  257
            +Q MGE ++NDAYEEELLDYEEE++KA DS +AKVNGE+ KKGY+GIHSSGFRDFLLKPE
Sbjct  114  RQAMGETRDNDAYEEELLDYEEEEDKAMDSASAKVNGEATKKGYVGIHSSGFRDFLLKPE  173

Query  258  LLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVA  437
            LLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIE VAGQVA
Sbjct  174  LLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIETVAGQVA  233

Query  438  ALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            ALVLCHTRELAYQICHEFERFS YLP+IK+AVFYGGVN+ IHK+LLKNECPHIVVGT
Sbjct  234  ALVLCHTRELAYQICHEFERFSKYLPEIKIAVFYGGVNVRIHKELLKNECPHIVVGT  290



>gb|KJB70602.1| hypothetical protein B456_011G082500 [Gossypium raimondii]
Length=427

 Score =   305 bits (782),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 167/174 (96%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K+NDAYEEELLDYEEEDEKAPDS + K   +SAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEIKDNDAYEEELLDYEEEDEKAPDSASTKA-ADSAKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            +IVDSGFEHPSEVQHECIPQAILGMDV+CQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  60   SIVDSGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HKDLLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKVHKDLLKNECPHIVVGT  173



>ref|XP_010048977.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Eucalyptus 
grandis]
Length=427

 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++NDAYEEELLDYEEE++KA DS +AKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDAYEEELLDYEEEEDKAMDSASAKVNGEATKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIE VAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIETVAGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFS YLP+IK+AVFYGGVN+ IHK+LLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSKYLPEIKIAVFYGGVNVRIHKELLKNECPHIVVGT  174



>ref|XP_010519944.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Tarenaya hassleriana]
Length=428

 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            M + ++N+AYEEELLDYEEED+K PDS   KVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MADTRDNEAYEEELLDYEEEDDKVPDSAGNKVNGENGKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPTPGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVN+ IHKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNVKIHKDLLKNECPHIVVGT  174



>ref|XP_010912069.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Elaeis 
guineensis]
 ref|XP_010912075.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Elaeis 
guineensis]
Length=428

 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE +ENDAYEEELLDYEE++EKA D+VAAK   E+AKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEARENDAYEEELLDYEEDEEKASDAVAAKGANETAKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPV+GQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVSGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV+I  HKD+LKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVHIAKHKDILKNECPHIVVGT  174



>gb|KCW81407.1| hypothetical protein EUGRSUZ_C02784 [Eucalyptus grandis]
Length=543

 Score =   308 bits (788),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +3

Query  78   KQQMGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPE  257
            +Q MGE ++NDAYEEELLDYEEE++KA DS +AKVNGE+ KKGY+GIHSSGFRDFLLKPE
Sbjct  114  RQAMGETRDNDAYEEELLDYEEEEDKAMDSASAKVNGEATKKGYVGIHSSGFRDFLLKPE  173

Query  258  LLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVA  437
            LLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIE VAGQVA
Sbjct  174  LLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIETVAGQVA  233

Query  438  ALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            ALVLCHTRELAYQICHEFERFS YLP+IK+AVFYGGVN+ IHK+LLKNECPHIVVGT
Sbjct  234  ALVLCHTRELAYQICHEFERFSKYLPEIKIAVFYGGVNVRIHKELLKNECPHIVVGT  290



>ref|XP_007137031.1| hypothetical protein PHAVU_009G093800g [Phaseolus vulgaris]
 gb|ESW09025.1| hypothetical protein PHAVU_009G093800g [Phaseolus vulgaris]
Length=427

 Score =   304 bits (778),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = +3

Query  153  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  332
            KAPDSV AKVNGE+ KKGY+GIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI
Sbjct  22   KAPDSVGAKVNGEATKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  81

Query  333  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  512
            LGMDVICQAKSGMGKTAVFVLSTLQQI+PV GQV+ALVLCHTRELAYQICHEFERFSTYL
Sbjct  82   LGMDVICQAKSGMGKTAVFVLSTLQQIDPVPGQVSALVLCHTRELAYQICHEFERFSTYL  141

Query  513  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            PD+KVAVFYGGVNI +HKDLLKNECPHIVVGT
Sbjct  142  PDLKVAVFYGGVNIKVHKDLLKNECPHIVVGT  173



>gb|AGV54235.1| DEAD-box ATP-dependent RNA helicase 56 [Phaseolus vulgaris]
Length=427

 Score =   303 bits (777),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = +3

Query  153  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  332
            KAPDSV AKVNGE+ KKGY+GIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI
Sbjct  22   KAPDSVGAKVNGEATKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  81

Query  333  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  512
            LGMDVICQAKSGMGKTAVFVLSTLQQI+PV GQV+ALVLCHTRELAYQICHEFERFSTYL
Sbjct  82   LGMDVICQAKSGMGKTAVFVLSTLQQIDPVPGQVSALVLCHTRELAYQICHEFERFSTYL  141

Query  513  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            PD+KVAVFYGGVNI +HKDLLKNECPHIVVGT
Sbjct  142  PDLKVAVFYGGVNIKVHKDLLKNECPHIVVGT  173



>ref|XP_003522620.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Glycine max]
 gb|KHN08125.1| DEAD-box ATP-dependent RNA helicase 56 [Glycine soja]
Length=427

 Score =   303 bits (777),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 167/174 (96%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K ++AYEEELLDYEEED+KAPDS  AKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETK-DEAYEEELLDYEEEDDKAPDSAGAKVNGEATKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PV GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVPGQVSALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPD+KVAVFYGGVNI +HKDLLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICHEFERFSTYLPDLKVAVFYGGVNIKVHKDLLKNECPHIVVGT  173



>ref|XP_003526412.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoformX1 [Glycine 
max]
 ref|XP_003526413.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoformX2 [Glycine 
max]
 ref|XP_006581360.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X3 
[Glycine max]
 gb|KHN07085.1| DEAD-box ATP-dependent RNA helicase 56 [Glycine soja]
Length=427

 Score =   303 bits (777),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 167/174 (96%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K ++AYEEELLDYEEEDEKAPDS  AKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETK-DEAYEEELLDYEEEDEKAPDSAGAKVNGEATKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PV GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVPGQVSALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPD+KVAVFYGGVNI +HKDLLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICHEFERFSTYLPDLKVAVFYGGVNIKVHKDLLKNECPHIVVGT  173



>ref|XP_004303319.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Fragaria 
vesca subsp. vesca]
Length=428

 Score =   303 bits (776),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++ND YEEEL+DY+EE++ AP+SV+ K NGES KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEIRDNDGYEEELVDYDEEEQNAPNSVSGKPNGESVKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDV+CQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL+
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLSTLQQIEPVAGQVAALI  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLP++KVAVFYGGV+I +H+DLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPELKVAVFYGGVSIKVHRDLLKNECPHIVVGT  174



>ref|XP_010519138.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Tarenaya 
hassleriana]
Length=415

 Score =   302 bits (774),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ ++N+AYEEELLDYEEEDEK PDS   K NGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDTRDNEAYEEELLDYEEEDEKVPDSAGNKTNGENGKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPD KVAVFYGGVNI IHKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDSKVAVFYGGVNIKIHKDLLKNECPHIVVGT  174



>ref|XP_009365409.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Pyrus 
x bretschneideri]
 ref|XP_009348326.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Pyrus 
x bretschneideri]
Length=428

 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++ND YEEEL+DYEEED+ AP+SV+AK +G++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEVRDNDGYEEELVDYEEEDQNAPNSVSAKPSGDTVKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQVAAL+
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVAALI  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPD+KVAVFYGGV+I +HKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDLKVAVFYGGVSIKVHKDLLKNECPHIVVGT  174



>ref|XP_011459186.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Fragaria vesca subsp. vesca]
 ref|XP_011459187.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Fragaria vesca subsp. vesca]
Length=426

 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 167/174 (96%), Gaps = 2/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE +E D Y+EEL+DYEE+DEKAPDS AAKVNGESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRE-DVYDEELVDYEEDDEKAPDS-AAKVNGESAKKGYVGIHSSGFRDFLLKPELLR  58

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQV+AL+
Sbjct  59   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVSALI  118

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPD+KVAVFYGGV I  HKDLLKNECPHIVVGT
Sbjct  119  LCHTRELAYQICHEFERFSTYLPDLKVAVFYGGVTIKNHKDLLKNECPHIVVGT  172



>ref|XP_006853982.1| hypothetical protein AMTR_s00036p00225190 [Amborella trichopoda]
 gb|ERN15449.1| hypothetical protein AMTR_s00036p00225190 [Amborella trichopoda]
Length=428

 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K+ND Y+EELLDYEEE+E APDS+ AK   ES KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEAKDNDTYQEELLDYEEEEEIAPDSITAKGASESVKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPV GQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVTGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI  HK+LLKNECPH+VVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKTHKELLKNECPHVVVGT  174



>ref|XP_008243728.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Prunus 
mume]
Length=428

 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++ND YEEEL+DYEEED+ AP+SV+AK +G++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEIRDNDGYEEELVDYEEEDQNAPNSVSAKPSGDTVKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQVAAL+
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVAALI  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPD+KVAVFYGGV+I +HKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDLKVAVFYGGVSIKVHKDLLKNECPHIVVGT  174



>ref|XP_007222437.1| hypothetical protein PRUPE_ppa006122mg [Prunus persica]
 ref|XP_007222438.1| hypothetical protein PRUPE_ppa006122mg [Prunus persica]
 ref|XP_007222439.1| hypothetical protein PRUPE_ppa006122mg [Prunus persica]
 ref|XP_008219486.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Prunus mume]
 gb|EMJ23636.1| hypothetical protein PRUPE_ppa006122mg [Prunus persica]
 gb|EMJ23637.1| hypothetical protein PRUPE_ppa006122mg [Prunus persica]
 gb|EMJ23638.1| hypothetical protein PRUPE_ppa006122mg [Prunus persica]
Length=426

 Score =   301 bits (772),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 168/174 (97%), Gaps = 2/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE + +D YEEEL+DYEEE+EKAPDS AAKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETR-DDVYEEELVDYEEEEEKAPDS-AAKVNGEAPKKGYVGIHSSGFRDFLLKPELLR  58

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQV+ALV
Sbjct  59   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVSALV  118

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPD+KVAVFYGGVNI +HKDLLKNECPHIVVGT
Sbjct  119  LCHTRELAYQICHEFERFSTYLPDLKVAVFYGGVNIKLHKDLLKNECPHIVVGT  172



>ref|XP_007215422.1| hypothetical protein PRUPE_ppa006077mg [Prunus persica]
 gb|EMJ16621.1| hypothetical protein PRUPE_ppa006077mg [Prunus persica]
Length=428

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++ND YEEEL+DYEEED+ AP+SV+AK +G++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEIRDNDGYEEELVDYEEEDQNAPNSVSAKPSGDTVKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+P+AGQVAAL+
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPIAGQVAALI  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPD+KVAVFYGGV+I +HKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDLKVAVFYGGVSIKVHKDLLKNECPHIVVGT  174



>ref|XP_009334641.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Pyrus x bretschneideri]
Length=428

 Score =   301 bits (770),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ ++ND YEEEL+DYEEED+ AP+SV+AK +G++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDVRDNDGYEEELVDYEEEDQNAPNSVSAKPSGDTVKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PV GQVAAL+
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVPGQVAALI  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPD+KVAVFYGGVNI +HKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDLKVAVFYGGVNIKVHKDLLKNECPHIVVGT  174



>ref|XP_003588757.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|AES59008.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=427

 Score =   300 bits (769),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +3

Query  153  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  332
            KAPDSV AKVNGES KKGY+GIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI
Sbjct  22   KAPDSVGAKVNGESGKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  81

Query  333  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  512
            LGMDV+CQAKSGMGKTAVFVLSTLQQI+PV GQV+AL+LCHTRELAYQICHEFERFSTYL
Sbjct  82   LGMDVLCQAKSGMGKTAVFVLSTLQQIDPVPGQVSALILCHTRELAYQICHEFERFSTYL  141

Query  513  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
             D+KVAVFYGGVNI +HKDLLKNECPHIVVGT
Sbjct  142  ADLKVAVFYGGVNIKVHKDLLKNECPHIVVGT  173



>gb|AFV30230.1| ATP-dependent RNA helicase [Medicago sativa]
Length=427

 Score =   300 bits (768),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +3

Query  153  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  332
            KAPDSV AKVNGES KKGY+GIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI
Sbjct  22   KAPDSVGAKVNGESGKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  81

Query  333  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  512
            LGMDV+CQAKSGMGKTAVFVLSTLQQI+PV GQV+AL+LCHTRELAYQICHEFERFSTYL
Sbjct  82   LGMDVLCQAKSGMGKTAVFVLSTLQQIDPVPGQVSALILCHTRELAYQICHEFERFSTYL  141

Query  513  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
             D+KVAVFYGGVNI +HKDLLKNECPHIVVGT
Sbjct  142  ADLKVAVFYGGVNIKVHKDLLKNECPHIVVGT  173



>ref|XP_011459188.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X2 
[Fragaria vesca subsp. vesca]
Length=462

 Score =   301 bits (771),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 167/174 (96%), Gaps = 2/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE +E D Y+EEL+DYEE+DEKAPDS AAKVNGESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRE-DVYDEELVDYEEDDEKAPDS-AAKVNGESAKKGYVGIHSSGFRDFLLKPELLR  58

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQV+AL+
Sbjct  59   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVSALI  118

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPD+KVAVFYGGV I  HKDLLKNECPHIVVGT
Sbjct  119  LCHTRELAYQICHEFERFSTYLPDLKVAVFYGGVTIKNHKDLLKNECPHIVVGT  172



>ref|XP_006450447.1| hypothetical protein CICLE_v10008383mg [Citrus clementina]
 gb|ESR63687.1| hypothetical protein CICLE_v10008383mg [Citrus clementina]
Length=343

 Score =   297 bits (761),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 162/174 (93%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++N  YE+ELLDYEEED +APDSVA K NGE+AKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDN-EYEDELLDYEEEDAQAPDSVATKANGEAAKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ EP  GQV ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQTEPNPGQVTALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI IHKDLLKNECP IVVGT
Sbjct  120  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKIHKDLLKNECPQIVVGT  173



>gb|KEH35921.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=314

 Score =   296 bits (757),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +3

Query  153  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  332
            KAPD+  AKVNGE+ KKGY+GIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI
Sbjct  22   KAPDTNGAKVNGEATKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  81

Query  333  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  512
            LGMDVICQAKSGMGKTAVFVLSTLQQI+PV GQV+ALVLCHTRELAYQICHEFERFSTYL
Sbjct  82   LGMDVICQAKSGMGKTAVFVLSTLQQIDPVPGQVSALVLCHTRELAYQICHEFERFSTYL  141

Query  513  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            PD+KVAVFYGGVNI +HKDLLKNECP IVVGT
Sbjct  142  PDLKVAVFYGGVNIKVHKDLLKNECPQIVVGT  173



>ref|XP_006450448.1| hypothetical protein CICLE_v10008383mg [Citrus clementina]
 gb|ESR63688.1| hypothetical protein CICLE_v10008383mg [Citrus clementina]
 gb|KDO61714.1| hypothetical protein CISIN_1g014314mg [Citrus sinensis]
Length=427

 Score =   300 bits (767),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 162/174 (93%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++N  YE+ELLDYEEED +APDSVA K NGE+AKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDN-EYEDELLDYEEEDAQAPDSVATKANGEAAKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ EP  GQV ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQTEPNPGQVTALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI IHKDLLKNECP IVVGT
Sbjct  120  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKIHKDLLKNECPQIVVGT  173



>ref|XP_004498731.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Cicer arietinum]
Length=427

 Score =   300 bits (767),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 165/174 (95%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K ++AYEEELLDYEEED+KAPDS   KVNGES KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETK-DEAYEEELLDYEEEDDKAPDSAGTKVNGESGKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PV GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVPGQVSALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYL D+KVAVFYGGVNI +HKDLLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICHEFERFSTYLSDLKVAVFYGGVNIKVHKDLLKNECPHIVVGT  173



>ref|XP_009376926.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Pyrus 
x bretschneideri]
 ref|XP_009376927.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Pyrus 
x bretschneideri]
Length=426

 Score =   300 bits (767),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 168/174 (97%), Gaps = 2/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE + +D Y+EEL+DYEEE+EKAPDS AAKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETR-DDVYDEELVDYEEEEEKAPDS-AAKVNGEAPKKGYVGIHSSGFRDFLLKPELLR  58

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQV+ALV
Sbjct  59   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVSALV  118

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPD+KVAVFYGGV+I +HKDLLKNECPHIVVGT
Sbjct  119  LCHTRELAYQICHEFERFSTYLPDLKVAVFYGGVSIKLHKDLLKNECPHIVVGT  172



>ref|XP_008394071.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Malus domestica]
 ref|XP_008394072.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Malus domestica]
 ref|XP_009355726.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Pyrus x bretschneideri]
 ref|XP_009355727.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Pyrus x bretschneideri]
 ref|XP_009355728.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Pyrus x bretschneideri]
Length=426

 Score =   299 bits (766),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 168/174 (97%), Gaps = 2/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE + +D Y+EEL+DYEEE+EKAPDS AAKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETR-DDVYDEELVDYEEEEEKAPDS-AAKVNGEAPKKGYVGIHSSGFRDFLLKPELLR  58

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            +IVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQI+PVAGQV+ALV
Sbjct  59   SIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIDPVAGQVSALV  118

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPD+KVAVFYGGVNI +HKDLLKNECPHIVVGT
Sbjct  119  LCHTRELAYQICHEFERFSTYLPDLKVAVFYGGVNIKLHKDLLKNECPHIVVGT  172



>ref|XP_006450446.1| hypothetical protein CICLE_v10008383mg [Citrus clementina]
 gb|ESR63686.1| hypothetical protein CICLE_v10008383mg [Citrus clementina]
 gb|KDO61717.1| hypothetical protein CISIN_1g014314mg [Citrus sinensis]
Length=423

 Score =   299 bits (765),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 162/174 (93%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++N  YE+ELLDYEEED +APDSVA K NGE+AKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDN-EYEDELLDYEEEDAQAPDSVATKANGEAAKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ EP  GQV ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQTEPNPGQVTALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI IHKDLLKNECP IVVGT
Sbjct  120  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKIHKDLLKNECPQIVVGT  173



>gb|EYU24648.1| hypothetical protein MIMGU_mgv1a006871mg [Erythranthe guttata]
 gb|EYU24649.1| hypothetical protein MIMGU_mgv1a006871mg [Erythranthe guttata]
Length=428

 Score =   299 bits (765),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE +EN+AYEEELLDYEEE+EKAPDSV  K   ES KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEVRENEAYEEELLDYEEEEEKAPDSVNGKPAVESVKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPV+GQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVSGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQIC+EFERF+TYLPD+KVAVFYGGV I IHKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICNEFERFNTYLPDVKVAVFYGGVGIKIHKDLLKNECPHIVVGT  174



>ref|XP_008362046.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Malus domestica]
Length=428

 Score =   298 bits (763),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ ++ND YEEEL+DYEEED+ AP+SV+AK +G++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDVRDNDGYEEELVDYEEEDQNAPNSVSAKPSGDTVKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PV GQVAAL+
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVPGQVAALI  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPD+KVAVFYGGV I +HKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDLKVAVFYGGVGIKVHKDLLKNECPHIVVGT  174



>gb|AGV54745.1| DEAD-box ATP-dependent RNA helicase 56-like protein [Phaseolus 
vulgaris]
Length=427

 Score =   298 bits (763),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +3

Query  153  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  332
            KAPDSV AKVNGE+ KKGY+GIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI
Sbjct  22   KAPDSVGAKVNGEATKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  81

Query  333  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  512
            LGMDVICQAKSGMGKTAVFVLSTLQQI+PV GQV+ALVLCHTRELAYQICHEFERFSTYL
Sbjct  82   LGMDVICQAKSGMGKTAVFVLSTLQQIDPVPGQVSALVLCHTRELAYQICHEFERFSTYL  141

Query  513  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            PD+KVAVFYGGVNI +HKDLLK ECPHIVV T
Sbjct  142  PDLKVAVFYGGVNIQVHKDLLKKECPHIVVRT  173



>emb|CAN76234.1| hypothetical protein VITISV_030204 [Vitis vinifera]
Length=383

 Score =   296 bits (758),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 166/174 (95%), Gaps = 2/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++NDAYEEELLDYEEEDEKAPDSVA+K  GESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEARDNDAYEEELLDYEEEDEKAPDSVASKAAGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            +IVDSGFEHPSE   +CIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   SIVDSGFEHPSE--GKCIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  118

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV+I  HKDLLKNECPHIVVGT
Sbjct  119  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVSIKTHKDLLKNECPHIVVGT  172



>ref|XP_004501320.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X3 [Cicer arietinum]
Length=431

 Score =   298 bits (762),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 166/174 (95%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K ++AYEEELLDYEEED+KAPDS+ AKVNGE  KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEPK-DEAYEEELLDYEEEDDKAPDSIGAKVNGEVTKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDV+CQAKSGMGKTAVFVLSTLQQI+PV GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLSTLQQIDPVPGQVSALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYL D+KVAVFYGGVNI +HKDLLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICHEFERFSTYLSDLKVAVFYGGVNIKVHKDLLKNECPHIVVGT  173



>ref|XP_004501319.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Cicer arietinum]
Length=451

 Score =   298 bits (763),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 166/174 (95%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K ++AYEEELLDYEEED+KAPDS+ AKVNGE  KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEPK-DEAYEEELLDYEEEDDKAPDSIGAKVNGEVTKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDV+CQAKSGMGKTAVFVLSTLQQI+PV GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLSTLQQIDPVPGQVSALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYL D+KVAVFYGGVNI +HKDLLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICHEFERFSTYLSDLKVAVFYGGVNIKVHKDLLKNECPHIVVGT  173



>gb|EYU32343.1| hypothetical protein MIMGU_mgv1a006879mg [Erythranthe guttata]
Length=428

 Score =   297 bits (761),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ KEN+AYEEELLDYEEE+EKAPDSV AK NGES KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDTKENEAYEEELLDYEEEEEKAPDSVTAKANGESGKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLST+QQIEP+AGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTMQQIEPIAGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQIC EF+RFSTYLP  K AVFYGGV+I  HKD+LKNECP IVVGT
Sbjct  121  LCHTRELAYQICSEFDRFSTYLPGTKAAVFYGGVSIKNHKDILKNECPQIVVGT  174



>ref|XP_003603412.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|AES73663.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=427

 Score =   297 bits (761),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +3

Query  153  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  332
            KAPD+  AKVNGE+ KKGY+GIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI
Sbjct  22   KAPDTNGAKVNGEATKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  81

Query  333  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  512
            LGMDVICQAKSGMGKTAVFVLSTLQQI+PV GQV+ALVLCHTRELAYQICHEFERFSTYL
Sbjct  82   LGMDVICQAKSGMGKTAVFVLSTLQQIDPVPGQVSALVLCHTRELAYQICHEFERFSTYL  141

Query  513  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            PD+KVAVFYGGVNI +HKDLLKNECP IVVGT
Sbjct  142  PDLKVAVFYGGVNIKVHKDLLKNECPQIVVGT  173



>ref|XP_004498730.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Cicer arietinum]
Length=487

 Score =   299 bits (766),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 165/174 (95%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K+ +AYEEELLDYEEED+KAPDS   KVNGES KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETKD-EAYEEELLDYEEEDDKAPDSAGTKVNGESGKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PV GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVPGQVSALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYL D+KVAVFYGGVNI +HKDLLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICHEFERFSTYLSDLKVAVFYGGVNIKVHKDLLKNECPHIVVGT  173



>ref|XP_004501318.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Cicer arietinum]
Length=455

 Score =   298 bits (763),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 166/174 (95%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K ++AYEEELLDYEEED+KAPDS+ AKVNGE  KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEPK-DEAYEEELLDYEEEDDKAPDSIGAKVNGEVTKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDV+CQAKSGMGKTAVFVLSTLQQI+PV GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLSTLQQIDPVPGQVSALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYL D+KVAVFYGGVNI +HKDLLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICHEFERFSTYLSDLKVAVFYGGVNIKVHKDLLKNECPHIVVGT  173



>gb|AFK41905.1| unknown [Medicago truncatula]
Length=427

 Score =   297 bits (760),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +3

Query  153  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  332
            KAPDSV AKVNGES KKGY+GIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI
Sbjct  22   KAPDSVGAKVNGESGKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  81

Query  333  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  512
            LGMDV+CQAKSGMGKTAVFVLSTLQQI+PV GQV+AL+LCHTRELAYQICHEFE FSTYL
Sbjct  82   LGMDVLCQAKSGMGKTAVFVLSTLQQIDPVPGQVSALILCHTRELAYQICHEFEGFSTYL  141

Query  513  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
             D+KVAVFYGGVNI +HKDLLKNECPHIVVGT
Sbjct  142  ADLKVAVFYGGVNIKVHKDLLKNECPHIVVGT  173



>ref|XP_006483351.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Citrus 
sinensis]
Length=427

 Score =   296 bits (757),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 161/174 (93%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++N  YE+ELLDYEEED +APDSVA K NGE+AKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDN-EYEDELLDYEEEDAQAPDSVATKANGEAAKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ E   GQV ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQTELNPGQVTALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI IHKDLLKNECP IVVGT
Sbjct  120  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKIHKDLLKNECPQIVVGT  173



>gb|ACU23008.1| unknown [Glycine max]
Length=310

 Score =   291 bits (746),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 163/174 (94%), Gaps = 2/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K+ +AYEEEL+DYEEE+EKAPDS  AK   ES KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGELKDTEAYEEELIDYEEEEEKAPDS--AKPVAESGKKGYVGIHSSGFRDFLLKPELLR  58

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ++PV GQVAALV
Sbjct  59   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQVDPVPGQVAALV  118

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIK AVFYGGVNI +HK+LLKNECPHIVVGT
Sbjct  119  LCHTRELAYQICHEFERFSTYLPDIKAAVFYGGVNIKVHKELLKNECPHIVVGT  172



>ref|XP_002517619.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF44783.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=427

 Score =   295 bits (756),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 166/174 (95%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            M E K+ +AYEEELLDYEEE+EKAPDSV+AK   ++AKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MEEVKDTEAYEEELLDYEEEEEKAPDSVSAKA-ADTAKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AI+DSGFEHPSEVQHECIPQAILGM VICQAKSGMGKTAVFVLSTLQQI+PVAGQVAALV
Sbjct  60   AIIDSGFEHPSEVQHECIPQAILGMHVICQAKSGMGKTAVFVLSTLQQIDPVAGQVAALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPD+KV+VFYGGVNI IHKDLLKNECPH+VVGT
Sbjct  120  LCHTRELAYQICHEFERFSTYLPDLKVSVFYGGVNIKIHKDLLKNECPHVVVGT  173



>ref|XP_006585633.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X3 
[Glycine max]
Length=361

 Score =   293 bits (749),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 163/174 (94%), Gaps = 2/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K+ +AYEEEL+DYEEE+EKAPDS  AK   ES KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGELKDTEAYEEELIDYEEEEEKAPDS--AKPVTESGKKGYVGIHSSGFRDFLLKPELLR  58

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ++PV GQVAALV
Sbjct  59   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQVDPVPGQVAALV  118

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIK AVFYGGVNI +HK+LLKNECPHIVVGT
Sbjct  119  LCHTRELAYQICHEFERFSTYLPDIKAAVFYGGVNIKVHKELLKNECPHIVVGT  172



>emb|CAA09205.1| RNA helicase [Arabidopsis thaliana]
Length=451

 Score =   294 bits (753),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 165/178 (93%), Gaps = 1/178 (1%)
 Frame = +3

Query  75   NKQQMGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKP  254
            N + MG+ ++N+AYEEELLDYEEEDEK PDS   KVNGE+ KKGY+GIHSSGFRDFLLKP
Sbjct  21   NLRSMGDARDNEAYEEELLDYEEEDEKVPDS-GNKVNGEAVKKGYVGIHSSGFRDFLLKP  79

Query  255  ELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQV  434
            ELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV
Sbjct  80   ELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQV  139

Query  435  AALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            +ALVLCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI IHKDLLKNECPHIVVGT
Sbjct  140  SALVLCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIVVGT  197



>ref|XP_002873498.1| hypothetical protein ARALYDRAFT_909079 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49757.1| hypothetical protein ARALYDRAFT_909079 [Arabidopsis lyrata subsp. 
lyrata]
Length=427

 Score =   293 bits (751),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 164/174 (94%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ ++N+AYEEELLDYEEEDEK PDS  +KVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVPDS-GSKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI IHKDLLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIVVGT  173



>ref|XP_003528338.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Glycine max]
Length=426

 Score =   293 bits (749),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 163/174 (94%), Gaps = 2/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K+ +AYEEEL+DYEEE+EKAPDS  AK   ES KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGELKDTEAYEEELIDYEEEEEKAPDS--AKPVAESGKKGYVGIHSSGFRDFLLKPELLR  58

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ++PV GQVAALV
Sbjct  59   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQVDPVPGQVAALV  118

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIK AVFYGGVNI +HK+LLKNECPHIVVGT
Sbjct  119  LCHTRELAYQICHEFERFSTYLPDIKAAVFYGGVNIKVHKELLKNECPHIVVGT  172



>ref|XP_010419672.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Camelina sativa]
Length=427

 Score =   293 bits (749),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 163/174 (94%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ ++N+AYEEELLDYEEEDEK PDS   KVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVPDS-GTKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI IHKDLLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIVVGT  173



>ref|XP_010453161.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Camelina sativa]
Length=427

 Score =   292 bits (748),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 163/174 (94%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ ++N+AYEEELLDYEEEDEK PDS   KVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVPDS-GNKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI IHKDLLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIVVGT  173



>ref|XP_002871462.1| hypothetical protein ARALYDRAFT_487950 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47721.1| hypothetical protein ARALYDRAFT_487950 [Arabidopsis lyrata subsp. 
lyrata]
Length=427

 Score =   292 bits (748),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 163/174 (94%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ ++N+AYEEELLDYEEEDEK PDS   KVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVPDS-GNKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI IHKDLLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIVVGT  173



>ref|NP_568245.1| DEAD-box ATP-dependent RNA helicase 56 [Arabidopsis thaliana]
 ref|NP_568244.2| DEAD-box ATP-dependent RNA helicase 15 [Arabidopsis thaliana]
 sp|Q9LFN6.2|RH56_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 56; AltName: 
Full=UAP56 homolog B [Arabidopsis thaliana]
 sp|Q56XG6.3|RH15_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 15; AltName: 
Full=UAP56 homolog A [Arabidopsis thaliana]
 gb|AAK55671.1|AF378868_1 AT5g11200/F2I11_90 [Arabidopsis thaliana]
 gb|AAK96496.1| AT5g11170/F2I11_60 [Arabidopsis thaliana]
 gb|AAL15393.1| AT5g11200/F2I11_90 [Arabidopsis thaliana]
 gb|AAN46806.1| At5g11170/F2I11_60 [Arabidopsis thaliana]
 dbj|BAE98572.1| DEAD BOX RNA helicase RH15 - like protein [Arabidopsis thaliana]
 gb|AED91642.1| DEAD-box ATP-dependent RNA helicase 15 [Arabidopsis thaliana]
 gb|AED91645.1| DEAD-box ATP-dependent RNA helicase 56 [Arabidopsis thaliana]
Length=427

 Score =   292 bits (748),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 163/174 (94%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ ++N+AYEEELLDYEEEDEK PDS   KVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVPDS-GNKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI IHKDLLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIVVGT  173



>ref|XP_003531708.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Glycine max]
Length=426

 Score =   292 bits (748),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 163/174 (94%), Gaps = 2/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K+ +AYEEEL+DYEEE+EKAPDS  AK   ES KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGELKDTEAYEEELIDYEEEEEKAPDS--AKPVTESGKKGYVGIHSSGFRDFLLKPELLR  58

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ++PV GQVAALV
Sbjct  59   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQVDPVPGQVAALV  118

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIK AVFYGGVNI +HK+LLKNECPHIVVGT
Sbjct  119  LCHTRELAYQICHEFERFSTYLPDIKAAVFYGGVNIKVHKELLKNECPHIVVGT  172



>ref|XP_006585632.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X2 
[Glycine max]
Length=440

 Score =   293 bits (749),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 163/174 (94%), Gaps = 2/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K+ +AYEEEL+DYEEE+EKAPDS  AK   ES KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGELKDTEAYEEELIDYEEEEEKAPDS--AKPVTESGKKGYVGIHSSGFRDFLLKPELLR  58

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ++PV GQVAALV
Sbjct  59   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQVDPVPGQVAALV  118

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIK AVFYGGVNI +HK+LLKNECPHIVVGT
Sbjct  119  LCHTRELAYQICHEFERFSTYLPDIKAAVFYGGVNIKVHKELLKNECPHIVVGT  172



>emb|CAB96655.1| DEAD BOX RNA helicase RH15 [Arabidopsis thaliana]
Length=427

 Score =   292 bits (748),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 163/174 (94%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ ++N+AYEEELLDYEEEDEK PDS   KVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVPDS-GNKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI IHKDLLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIVVGT  173



>ref|XP_006287808.1| hypothetical protein CARUB_v10001023mg [Capsella rubella]
 ref|XP_006289730.1| hypothetical protein CARUB_v10003298mg [Capsella rubella]
 gb|EOA20706.1| hypothetical protein CARUB_v10001023mg [Capsella rubella]
 gb|EOA22628.1| hypothetical protein CARUB_v10003298mg [Capsella rubella]
Length=427

 Score =   292 bits (747),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 163/174 (94%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ ++N+AYEEELLDYEEEDEK PDS   KVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVPDS-GNKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+AL+
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALI  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI IHKDLLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIVVGT  173



>emb|CAB96652.1| DEAD BOX RNA helicase RH15-like protein [Arabidopsis thaliana]
Length=435

 Score =   292 bits (747),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 163/174 (94%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ ++N+AYEEELLDYEEEDEK PDS   KVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVPDS-GNKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI IHKDLLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIVVGT  173



>gb|KHN47769.1| DEAD-box ATP-dependent RNA helicase 56 [Glycine soja]
Length=450

 Score =   292 bits (748),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 163/174 (94%), Gaps = 2/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K+ +AYEEEL+DYEEE+EKAPDS  AK   ES KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGELKDTEAYEEELIDYEEEEEKAPDS--AKPVTESGKKGYVGIHSSGFRDFLLKPELLR  58

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ++PV GQVAALV
Sbjct  59   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQVDPVPGQVAALV  118

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIK AVFYGGVNI +HK+LLKNECPHIVVGT
Sbjct  119  LCHTRELAYQICHEFERFSTYLPDIKAAVFYGGVNIKVHKELLKNECPHIVVGT  172



>gb|ACK38186.1| unknown [Medicago truncatula]
 gb|ACK77675.1| unknown, partial [Medicago truncatula]
Length=278

 Score =   286 bits (733),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 160/174 (92%), Gaps = 2/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K+ + YEEEL+DYEEEDEKA DS   K   ES KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGELKDTEVYEEELIDYEEEDEKALDS--TKPTTESVKKGYVGIHSSGFRDFLLKPELLR  58

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PV GQVAALV
Sbjct  59   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVPGQVAALV  118

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHE ERFSTYLPDIKVAVFYGGVNI +HKDLLKNECPHIVVGT
Sbjct  119  LCHTRELAYQICHEVERFSTYLPDIKVAVFYGGVNIKVHKDLLKNECPHIVVGT  172



>ref|XP_006399618.1| hypothetical protein EUTSA_v10013628mg [Eutrema salsugineum]
 gb|ESQ41071.1| hypothetical protein EUTSA_v10013628mg [Eutrema salsugineum]
Length=427

 Score =   291 bits (746),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 164/174 (94%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ ++N+AYEEELLDYEEEDEK PDS  +KVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKIPDS-GSKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI IH+DLLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHRDLLKNECPHIVVGT  173



>ref|XP_010453157.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Camelina 
sativa]
Length=427

 Score =   291 bits (745),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 163/174 (94%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ + N+AYEEELLDYEEEDEK PDS  +KVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARGNEAYEEELLDYEEEDEKVPDS-GSKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI IHKDLLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIVVGT  173



>ref|NP_001154706.1| DEAD-box ATP-dependent RNA helicase 56 [Arabidopsis thaliana]
 gb|AED91646.1| DEAD-box ATP-dependent RNA helicase 56 [Arabidopsis thaliana]
Length=486

 Score =   293 bits (750),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 163/174 (94%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ ++N+AYEEELLDYEEEDEK PDS   KVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVPDS-GNKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI IHKDLLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIVVGT  173



>ref|NP_001154707.1| DEAD-box ATP-dependent RNA helicase 56 [Arabidopsis thaliana]
 gb|AED91647.1| DEAD-box ATP-dependent RNA helicase 56 [Arabidopsis thaliana]
Length=468

 Score =   291 bits (746),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 163/174 (94%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ ++N+AYEEELLDYEEEDEK PDS   KVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVPDS-GNKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI IHKDLLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIVVGT  173



>ref|XP_006409182.1| hypothetical protein EUTSA_v10022698mg [Eutrema salsugineum]
 gb|ESQ50635.1| hypothetical protein EUTSA_v10022698mg [Eutrema salsugineum]
Length=427

 Score =   290 bits (742),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 163/174 (94%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ ++N+AYEEELLDYEEEDEK  DS A KVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVLDS-ATKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI +HKDLLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICNEFMRFSTYLPDTKVSVFYGGVNIKVHKDLLKNECPHIVVGT  173



>ref|XP_001781775.1| predicted protein [Physcomitrella patens]
 gb|EDQ53423.1| predicted protein [Physcomitrella patens]
Length=432

 Score =   290 bits (741),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 137/144 (95%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  177  KVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQ  356
            K NGE+ KKGY+GIHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDVICQ
Sbjct  28   KTNGETVKKGYVGIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVICQ  87

Query  357  AKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVF  536
            AKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVF
Sbjct  88   AKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVF  147

Query  537  YGGVNITIHKDLLKNECPHIVVGT  608
            YGGVNI  HKDLLKNECPHIVVGT
Sbjct  148  YGGVNIKTHKDLLKNECPHIVVGT  171



>ref|XP_010491834.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Camelina sativa]
 ref|XP_010491835.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Camelina sativa]
Length=427

 Score =   290 bits (741),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 163/174 (94%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ ++N+AYEEELLDYEEEDEK  DS  +KVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVLDS-GSKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI IHKDLLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIVVGT  173



>gb|KHN01339.1| DEAD-box ATP-dependent RNA helicase 56 [Glycine soja]
Length=473

 Score =   291 bits (744),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 164/177 (93%), Gaps = 2/177 (1%)
 Frame = +3

Query  78   KQQMGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPE  257
            + +MGE K+ +AYEEEL+DYEEE+EKAPDS  AK   ES KKGY+GIHSSGFRDFLLKPE
Sbjct  45   RNRMGELKDTEAYEEELIDYEEEEEKAPDS--AKPVAESGKKGYVGIHSSGFRDFLLKPE  102

Query  258  LLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVA  437
            LLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ++PV GQVA
Sbjct  103  LLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQVDPVPGQVA  162

Query  438  ALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            ALVLCHTRELAYQICHEFERFSTYLPDIK AVF GGVNI +HK+LLKNECPHIVVGT
Sbjct  163  ALVLCHTRELAYQICHEFERFSTYLPDIKAAVFCGGVNIKVHKELLKNECPHIVVGT  219



>gb|ADE76139.1| unknown [Picea sitchensis]
Length=427

 Score =   289 bits (740),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 161/174 (93%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE KE+D Y+EELLDYEEED  A +SVAA+  GE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGELKESDTYQEELLDYEEEDV-AQESVAARGAGETVKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERF TYL D+KVAVFYGGVNI  HK LLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICHEFERFITYLTDLKVAVFYGGVNIKTHKSLLKNECPHIVVGT  173



>ref|XP_001770294.1| predicted protein [Physcomitrella patens]
 gb|EDQ64969.1| predicted protein [Physcomitrella patens]
Length=425

 Score =   288 bits (737),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  177  KVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQ  356
            K NGE+ KKGY+GIHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDVICQ
Sbjct  28   KTNGETVKKGYVGIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVICQ  87

Query  357  AKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVF  536
            AKSGMGKTAVFVLSTLQQIEPV GQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVF
Sbjct  88   AKSGMGKTAVFVLSTLQQIEPVTGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVF  147

Query  537  YGGVNITIHKDLLKNECPHIVVGT  608
            YGGVNI  HKDLLKNECPHIVVGT
Sbjct  148  YGGVNIKTHKDLLKNECPHIVVGT  171



>ref|XP_010097240.1| DEAD-box ATP-dependent RNA helicase 56 [Morus notabilis]
 gb|EXB67307.1| DEAD-box ATP-dependent RNA helicase 56 [Morus notabilis]
Length=525

 Score =   291 bits (744),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 169/206 (82%), Gaps = 31/206 (15%)
 Frame = +3

Query  84   QMGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELL  263
            +MGE ++ND YEEEL+DYEEED+ AP+S +AK +G+SAKKGY+GIHSSGFRDFLLKPELL
Sbjct  3    RMGEVRDNDGYEEELVDYEEEDQNAPNSASAKPSGDSAKKGYVGIHSSGFRDFLLKPELL  62

Query  264  RAIVDSGFEHPSE-------------------------------VQHECIPQAILGMDVI  350
            RAIVDSGFEHPSE                               VQHECIPQAILGMDVI
Sbjct  63   RAIVDSGFEHPSEGNVINTVSFYVSLVLNLCNHYFHIHDSGKKTVQHECIPQAILGMDVI  122

Query  351  CQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVA  530
            CQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIK+A
Sbjct  123  CQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKIA  182

Query  531  VFYGGVNITIHKDLLKNECPHIVVGT  608
            VFYGGV+I IHKDLLKNECPHIVVGT
Sbjct  183  VFYGGVSIKIHKDLLKNECPHIVVGT  208



>ref|XP_010419674.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Camelina 
sativa]
Length=427

 Score =   288 bits (736),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 162/174 (93%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ ++N+AYEEELLDYEEEDEK  DS  +KVN E+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVLDS-GSKVNAEAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALV  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI IHKDLLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIVVGT  173



>gb|KEH28678.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=504

 Score =   290 bits (741),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 167/196 (85%), Gaps = 14/196 (7%)
 Frame = +3

Query  21   NPSSFQKA*LVFIVRFD*NKQQMGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAK  200
            N S FQ+            ++ MGE K+ + YEEEL+DYEEEDEKA DS   K   ES K
Sbjct  69   NSSRFQR------------EENMGELKDTEVYEEELIDYEEEDEKALDS--TKPTTESVK  114

Query  201  KGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKT  380
            KGY+GIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKT
Sbjct  115  KGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKT  174

Query  381  AVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITI  560
            AVFVLSTLQQI+PV GQVAALVLCHTRELAYQICHE ERFSTYLPDIKVAVFYGGVNI +
Sbjct  175  AVFVLSTLQQIDPVPGQVAALVLCHTRELAYQICHEVERFSTYLPDIKVAVFYGGVNIKV  234

Query  561  HKDLLKNECPHIVVGT  608
            HKDLLKNECPHIVVGT
Sbjct  235  HKDLLKNECPHIVVGT  250



>ref|XP_004960988.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Setaria italica]
Length=429

 Score =   286 bits (733),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE KEND YEEELLDYEE+D+K  D  AAK  GE AKKGY+GIHSSGFRDFLLKPELLR
Sbjct  2    MGEAKENDVYEEELLDYEEDDDKTVDGSAAKPTGEVAKKGYVGIHSSGFRDFLLKPELLR  61

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQI+PVAGQVAALV
Sbjct  62   AIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIDPVAGQVAALV  121

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFS YL ++KVAVFYGGV+I  HKDLLKNECPHIVVGT
Sbjct  122  LCHTRELAYQICHEFERFSKYLSEVKVAVFYGGVHIRKHKDLLKNECPHIVVGT  175



>gb|AFW81342.1| spliceosome RNA helicase BAT1 isoform 1 [Zea mays]
 gb|AFW81343.1| spliceosome RNA helicase BAT1 isoform 2 [Zea mays]
 gb|AFW81344.1| spliceosome RNA helicase BAT1 isoform 3 [Zea mays]
Length=429

 Score =   286 bits (733),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE KEND YEEELLDYEE+D+K  D  AAK  GE AKKGY+GIHSSGFRDFLLKPELLR
Sbjct  2    MGEAKENDVYEEELLDYEEDDDKTVDGSAAKPTGEVAKKGYVGIHSSGFRDFLLKPELLR  61

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQI+PVAGQVAALV
Sbjct  62   AIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIDPVAGQVAALV  121

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFS YL ++KVAVFYGGV+I  HKDLLKNECPHIVVGT
Sbjct  122  LCHTRELAYQICHEFERFSKYLTEVKVAVFYGGVHIRKHKDLLKNECPHIVVGT  175



>ref|NP_001141599.1| uncharacterized protein LOC100273717 [Zea mays]
 gb|ACN35192.1| unknown [Zea mays]
Length=429

 Score =   286 bits (733),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE KEND YEEELLDYEE+D+K  D  AAK  GE AKKGY+GIHSSGFRDFLLKPELLR
Sbjct  2    MGEAKENDVYEEELLDYEEDDDKTVDGSAAKPTGEVAKKGYVGIHSSGFRDFLLKPELLR  61

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQI+PVAGQVAALV
Sbjct  62   AIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIDPVAGQVAALV  121

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFS YL ++KVAVFYGGV+I  HKDLLKNECPHIVVGT
Sbjct  122  LCHTRELAYQICHEFERFSKYLTEVKVAVFYGGVHIRKHKDLLKNECPHIVVGT  175



>ref|XP_007161216.1| hypothetical protein PHAVU_001G051700g [Phaseolus vulgaris]
 gb|ESW33210.1| hypothetical protein PHAVU_001G051700g [Phaseolus vulgaris]
Length=426

 Score =   286 bits (732),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = +3

Query  171  AAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVI  350
            A KVNGE+ KKGY+GIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVI
Sbjct  27   ANKVNGEAVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVI  86

Query  351  CQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVA  530
            CQAKSGMGKTAVFVLSTLQQI+PVAGQV+ALVLCHTRELAYQIC+EFERFSTYLP++KVA
Sbjct  87   CQAKSGMGKTAVFVLSTLQQIDPVAGQVSALVLCHTRELAYQICNEFERFSTYLPELKVA  146

Query  531  VFYGGVNITIHKDLLKNECPHIVVGT  608
            VFYGGVNI +HKDLLKNECP IVVGT
Sbjct  147  VFYGGVNIKVHKDLLKNECPSIVVGT  172



>ref|NP_001149406.1| spliceosome RNA helicase BAT1 [Zea mays]
 gb|ACG35346.1| spliceosome RNA helicase BAT1 [Zea mays]
Length=399

 Score =   285 bits (729),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE KEND YEEELLDYEE+D+K  D  AAK  GE AKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEAKENDVYEEELLDYEEDDDKTVDGSAAKPTGEVAKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQI+PVAGQVAALV
Sbjct  61   AIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIDPVAGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFS YL ++KVAVFYGGV+I  HKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSKYLTEVKVAVFYGGVHIRKHKDLLKNECPHIVVGT  174



>ref|XP_007135742.1| hypothetical protein PHAVU_010G154700g [Phaseolus vulgaris]
 gb|ESW07736.1| hypothetical protein PHAVU_010G154700g [Phaseolus vulgaris]
Length=425

 Score =   286 bits (731),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 159/174 (91%), Gaps = 3/174 (2%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K+ + YEEELLDYEEEDEKAPDS       ES KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGELKDTETYEEELLDYEEEDEKAPDSAKP---AESGKKGYVGIHSSGFRDFLLKPELLR  57

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ++PV GQVAALV
Sbjct  58   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQVDPVPGQVAALV  117

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYL DIK AVFYGGVNI +HK+LLKNECPHIVVGT
Sbjct  118  LCHTRELAYQICHEFERFSTYLSDIKAAVFYGGVNIKVHKELLKNECPHIVVGT  171



>ref|XP_004506912.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Cicer arietinum]
Length=435

 Score =   286 bits (732),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 161/174 (93%), Gaps = 2/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K+ +AYEEEL+DYEEEDEK  DS   K   E+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGELKDTEAYEEELIDYEEEDEKTLDS--TKPASETVKKGYVGIHSSGFRDFLLKPELLR  58

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQI+PV GQVAALV
Sbjct  59   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIDPVPGQVAALV  118

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HK+LLKNECPHIVVGT
Sbjct  119  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKVHKELLKNECPHIVVGT  172



>ref|XP_004960987.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Setaria italica]
Length=456

 Score =   286 bits (733),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE KEND YEEELLDYEE+D+K  D  AAK  GE AKKGY+GIHSSGFRDFLLKPELLR
Sbjct  2    MGEAKENDVYEEELLDYEEDDDKTVDGSAAKPTGEVAKKGYVGIHSSGFRDFLLKPELLR  61

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQI+PVAGQVAALV
Sbjct  62   AIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIDPVAGQVAALV  121

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFS YL ++KVAVFYGGV+I  HKDLLKNECPHIVVGT
Sbjct  122  LCHTRELAYQICHEFERFSKYLSEVKVAVFYGGVHIRKHKDLLKNECPHIVVGT  175



>ref|XP_009125794.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Brassica 
rapa]
Length=427

 Score =   285 bits (729),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 162/174 (93%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            M + ++N+AYEEELLDYEEEDEKAPDS A KVNG++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MEDPRDNEAYEEELLDYEEEDEKAPDS-ANKVNGDAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+AL+
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPTPGQVSALI  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVN  IHK LLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNNKIHKALLKNECPHIVVGT  173



>ref|XP_009125790.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Brassica 
rapa]
 ref|XP_009125791.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Brassica 
rapa]
Length=427

 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 161/174 (93%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ ++N+AYEEELLDYEEEDEK  DS   KVNG++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDVRDNEAYEEELLDYEEEDEKVLDS-GNKVNGDAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+AL+
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPTPGQVSALI  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVN  IHKDLLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNNKIHKDLLKNECPHIVVGT  173



>ref|XP_009121980.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Brassica rapa]
Length=408

 Score =   283 bits (723),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 161/174 (93%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ ++N+AYEEELLDYEEEDEK  DS   KVNG++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVLDS-GNKVNGDAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+AL+
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALI  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQIC+EF RFSTYLPD +V+VFYGGVN  IHKDLLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTRVSVFYGGVNNKIHKDLLKNECPHIVVGT  173



>ref|XP_002969825.1| hypothetical protein SELMODRAFT_146823 [Selaginella moellendorffii]
 gb|EFJ28949.1| hypothetical protein SELMODRAFT_146823 [Selaginella moellendorffii]
Length=428

 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE KEND Y+EELLDYEEE+E APD+VAAK   E+ KKGY+GIHSSGFRDFLLKPEL+R
Sbjct  1    MGEAKENDTYQEELLDYEEEEEAAPDAVAAKGAAETVKKGYVGIHSSGFRDFLLKPELVR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVD GFEHPSEVQ ECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP+ GQVAALV
Sbjct  61   AIVDCGFEHPSEVQFECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPLKGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI  HKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKTHKDLLKNECPHIVVGT  174



>ref|XP_002985161.1| hypothetical protein SELMODRAFT_446187 [Selaginella moellendorffii]
 gb|EFJ13655.1| hypothetical protein SELMODRAFT_446187 [Selaginella moellendorffii]
Length=473

 Score =   284 bits (727),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE KEND Y+EELLDYEEE+E APD+VAAK   E+ KKGY+GIHSSGFRDFLLKPEL+R
Sbjct  1    MGEAKENDTYQEELLDYEEEEEAAPDAVAAKGAAETVKKGYVGIHSSGFRDFLLKPELVR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVD GFEHPSEVQ ECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP+ GQVAALV
Sbjct  61   AIVDCGFEHPSEVQFECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPLKGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI  HKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKTHKDLLKNECPHIVVGT  174



>ref|XP_009121981.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Brassica rapa]
Length=430

 Score =   283 bits (723),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 161/174 (93%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ ++N+AYEEELLDYEEEDEK  DS   KVNG++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVLDS-GNKVNGDAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+AL+
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALI  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQIC+EF RFSTYLPD +V+VFYGGVN  IHKDLLKNECPHIVVGT
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTRVSVFYGGVNNKIHKDLLKNECPHIVVGT  173



>emb|CDX85725.1| BnaA02g00880D [Brassica napus]
Length=442

 Score =   281 bits (720),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 163/178 (92%), Gaps = 5/178 (3%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            M + ++N+AYEEELLDYEEEDEKAPDS A KVNG++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MEDPRDNEAYEEELLDYEEEDEKAPDS-ANKVNGDAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSE----VQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQV  434
            AIVDSGFEHPSE    VQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV
Sbjct  60   AIVDSGFEHPSEGKYGVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPTPGQV  119

Query  435  AALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            +AL+LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVN  IHKDLLKNECPHIVVGT
Sbjct  120  SALILCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNNKIHKDLLKNECPHIVVGT  177



>ref|XP_009131197.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
56-like [Brassica rapa]
Length=458

 Score =   280 bits (716),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 160/174 (92%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ ++N+AYEEELLDYEEEDEK  DS   KVNG++ KKGY+GIH SGFRDFLLKPELLR
Sbjct  32   MGDARDNEAYEEELLDYEEEDEKVLDS-GNKVNGDAVKKGYVGIHRSGFRDFLLKPELLR  90

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+AL+
Sbjct  91   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPTPGQVSALI  150

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVN  IHK+LLKNECPHIVVGT
Sbjct  151  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNNKIHKELLKNECPHIVVGT  204



>emb|CDY51112.1| BnaCnng20150D [Brassica napus]
Length=440

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 162/180 (90%), Gaps = 7/180 (4%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            M + ++N+AYEEELLDYEEE+EKAPDS A K NG++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MEDPRDNEAYEEELLDYEEEEEKAPDS-ATKANGDAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSE------VQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAG  428
            AIVDSGFEHPSE      +QHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  G
Sbjct  60   AIVDSGFEHPSEGKCFSLLQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPAPG  119

Query  429  QVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            QV+AL+LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVN  IHKDLLKNECPHIVVGT
Sbjct  120  QVSALILCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNNKIHKDLLKNECPHIVVGT  179



>ref|XP_010231899.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X1 [Brachypodium distachyon]
 ref|XP_010231901.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X1 [Brachypodium distachyon]
Length=428

 Score =   277 bits (708),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K+N+ YE++L+DYEEE E   D+ AA  + +  KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEAKDNEVYEDDLVDYEEEVENVVDAAAANPSVDVVKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQVAALV
Sbjct  61   AIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFS YL + KVAVFYGGVNI  HKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSKYLSETKVAVFYGGVNIKNHKDLLKNECPHIVVGT  174



>ref|XP_009121982.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Brassica rapa]
 ref|XP_009121983.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Brassica rapa]
Length=408

 Score =   275 bits (704),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 160/174 (92%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ +E++AYEEELLDYEEEDEK  DS A K NG++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDVRESEAYEEELLDYEEEDEKLLDS-ATKTNGDAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+AL+
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALI  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQIC+EF RFSTYLPD +V+VFYGGVN  IHK+LLKNE PHIVVGT
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTRVSVFYGGVNNKIHKELLKNEYPHIVVGT  173



>ref|XP_009121985.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X3 [Brassica rapa]
Length=430

 Score =   276 bits (705),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 160/174 (92%), Gaps = 1/174 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ +E++AYEEELLDYEEEDEK  DS A K NG++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDVRESEAYEEELLDYEEEDEKLLDS-ATKTNGDAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+AL+
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALI  119

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQIC+EF RFSTYLPD +V+VFYGGVN  IHK+LLKNE PHIVVGT
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTRVSVFYGGVNNKIHKELLKNEYPHIVVGT  173



>ref|XP_003569187.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X1 [Brachypodium distachyon]
Length=428

 Score =   275 bits (703),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K+N+ YEE+L+DYEEE E A D  AA  + E  KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEAKDNEVYEEDLVDYEEEVENAVDGTAANASVEVVKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQVAALV
Sbjct  61   AIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQIC+EFERFS YL + +VAVFYGGV+I  HKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICNEFERFSKYLSETRVAVFYGGVHIKKHKDLLKNECPHIVVGT  174



>ref|XP_003569186.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15 isoform X1 
[Brachypodium distachyon]
 ref|XP_010231904.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15 isoform X1 
[Brachypodium distachyon]
Length=429

 Score =   275 bits (702),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K+N+ YEE+L+DYEEE E A D  AA  + +  KKGY+GIHSSGFRDFLLKPELLR
Sbjct  2    MGEAKDNEVYEEDLVDYEEEVENAVDGAAANASVDVVKKGYVGIHSSGFRDFLLKPELLR  61

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQVAALV
Sbjct  62   AIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVAALV  121

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQIC+EFERFS YL + KVAVFYGGV+I  HKDLLKNECPHIVVGT
Sbjct  122  LCHTRELAYQICNEFERFSKYLSETKVAVFYGGVHIKKHKDLLKNECPHIVVGT  175



>ref|XP_004968948.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X2 [Setaria italica]
Length=429

 Score =   274 bits (701),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            M E K+N+ YEE+L+DYEEE E   D      + +  KKGY+GIHSSGFRDFLLKPELLR
Sbjct  2    MVEAKDNEVYEEDLVDYEEEVENVADGAPTNGSADVVKKGYVGIHSSGFRDFLLKPELLR  61

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQVAALV
Sbjct  62   AIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVAALV  121

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFS YLP+++VAVFYGGVNI  HKDLLKNECPHIVVGT
Sbjct  122  LCHTRELAYQICHEFERFSKYLPELRVAVFYGGVNIKNHKDLLKNECPHIVVGT  175



>ref|NP_001170610.1| uncharacterized protein LOC100384654 [Zea mays]
 ref|XP_008655336.1| PREDICTED: uncharacterized protein LOC100384654 isoform X1 [Zea 
mays]
 gb|ACR34212.1| unknown [Zea mays]
 gb|AFW82992.1| hypothetical protein ZEAMMB73_566534 [Zea mays]
 gb|AFW82993.1| hypothetical protein ZEAMMB73_566534 [Zea mays]
Length=427

 Score =   274 bits (700),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K+N+ YEE+L+DYEEE E   D      + +  KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEAKDNEVYEEDLVDYEEEVENVIDGAPTNGSSDVVKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQVAALV
Sbjct  61   AIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFS YLP+++VAVFYGGV+I  HKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICHEFERFSKYLPELRVAVFYGGVHIKNHKDLLKNECPHIVVGT  174



>gb|AFW82994.1| hypothetical protein ZEAMMB73_566534 [Zea mays]
Length=446

 Score =   274 bits (701),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K+N+ YEE+L+DYEEE E   D      + +  KKGY+GIHSSGFRDFLLKPELLR
Sbjct  20   MGEAKDNEVYEEDLVDYEEEVENVIDGAPTNGSSDVVKKGYVGIHSSGFRDFLLKPELLR  79

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQVAALV
Sbjct  80   AIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVAALV  139

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFS YLP+++VAVFYGGV+I  HKDLLKNECPHIVVGT
Sbjct  140  LCHTRELAYQICHEFERFSKYLPELRVAVFYGGVHIKNHKDLLKNECPHIVVGT  193



>gb|KDO61715.1| hypothetical protein CISIN_1g014314mg [Citrus sinensis]
Length=418

 Score =   273 bits (697),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 130/136 (96%), Gaps = 0/136 (0%)
 Frame = +3

Query  201  KGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKT  380
            +GY+GIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKT
Sbjct  29   QGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKT  88

Query  381  AVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITI  560
            AVFVLSTLQQ EP  GQV ALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI I
Sbjct  89   AVFVLSTLQQTEPNPGQVTALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKI  148

Query  561  HKDLLKNECPHIVVGT  608
            HKDLLKNECP IVVGT
Sbjct  149  HKDLLKNECPQIVVGT  164



>ref|XP_004968947.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X1 [Setaria italica]
Length=457

 Score =   274 bits (700),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            M E K+N+ YEE+L+DYEEE E   D      + +  KKGY+GIHSSGFRDFLLKPELLR
Sbjct  2    MVEAKDNEVYEEDLVDYEEEVENVADGAPTNGSADVVKKGYVGIHSSGFRDFLLKPELLR  61

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQVAALV
Sbjct  62   AIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVAALV  121

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFS YLP+++VAVFYGGVNI  HKDLLKNECPHIVVGT
Sbjct  122  LCHTRELAYQICHEFERFSKYLPELRVAVFYGGVNIKNHKDLLKNECPHIVVGT  175



>emb|CDM83038.1| unnamed protein product [Triticum aestivum]
Length=337

 Score =   269 bits (688),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K+ + YEE+L+DY+EE E A D  AA  + +  KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEAKDAEVYEEDLVDYDEEVENAVDGAAANPSVDVVKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQVAALV
Sbjct  61   AIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVAALV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQIC+EFERFS YL + KVAVFYGGV+I  HKDLLKNECPHIVVGT
Sbjct  121  LCHTRELAYQICNEFERFSKYLSETKVAVFYGGVHIKKHKDLLKNECPHIVVGT  174



>emb|CDX85726.1| BnaA02g00870D [Brassica napus]
Length=490

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 161/185 (87%), Gaps = 12/185 (6%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ ++N+AYEEELLDYEEEDEK  DS   KVNG++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDVRDNEAYEEELLDYEEEDEKVLDS-GNKVNGDAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSE-----------VQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI  413
            AIVDSGFEHPSE           +QHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI
Sbjct  60   AIVDSGFEHPSEGKCFSLHFLAFLQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI  119

Query  414  EPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPH  593
            EP  GQV+AL+LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVN  IHKDLLKNECPH
Sbjct  120  EPAPGQVSALILCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNNKIHKDLLKNECPH  179

Query  594  IVVGT  608
            IVVGT
Sbjct  180  IVVGT  184



>emb|CDX70383.1| BnaC03g04670D [Brassica napus]
Length=447

 Score =   270 bits (691),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 161/194 (83%), Gaps = 21/194 (11%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ ++N+AYEEELLDYEEEDEK  DS   KVNG++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDTRDNEAYEEELLDYEEEDEKVLDS-GNKVNGDAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSE--------------------VQHECIPQAILGMDVICQAKSGMGKTAV  386
            AIVDSGFEHPSE                    VQHECIPQAILGMDVICQAKSGMGKTAV
Sbjct  60   AIVDSGFEHPSEGKILYASFFVLCLSPMFDKIVQHECIPQAILGMDVICQAKSGMGKTAV  119

Query  387  FVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHK  566
            FVLSTLQQIEP  GQV+AL+LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVN  IHK
Sbjct  120  FVLSTLQQIEPTPGQVSALILCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNNKIHK  179

Query  567  DLLKNECPHIVVGT  608
            +LLKNECPHIVVGT
Sbjct  180  ELLKNECPHIVVGT  193



>ref|XP_006644282.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like [Oryza 
brachyantha]
Length=433

 Score =   270 bits (689),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  156  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  335
            A  + AA  + + AKKGY+GIHSSGFRDFLLKPELLRAI D GFEHPSEVQHECIPQAIL
Sbjct  29   ADGASAANASADVAKKGYVGIHSSGFRDFLLKPELLRAIQDCGFEHPSEVQHECIPQAIL  88

Query  336  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  515
            GMDVICQAKSGMGKTAVFVLS+LQQI+PVAGQV ALVLCHTRELAYQICHEFERFS YL 
Sbjct  89   GMDVICQAKSGMGKTAVFVLSSLQQIDPVAGQVGALVLCHTRELAYQICHEFERFSKYLS  148

Query  516  DIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            +IKVAVFYGGV+I  HKDLLKN+CPHIVVGT
Sbjct  149  EIKVAVFYGGVHIKKHKDLLKNDCPHIVVGT  179



>ref|XP_006644281.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like [Oryza 
brachyantha]
Length=433

 Score =   270 bits (689),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  156  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  335
            A  + AA  + + AKKGY+GIHSSGFRDFLLKPELLRAI D GFEHPSEVQHECIPQAIL
Sbjct  29   ADGASAANASADVAKKGYVGIHSSGFRDFLLKPELLRAIQDCGFEHPSEVQHECIPQAIL  88

Query  336  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  515
            GMDVICQAKSGMGKTAVFVLS+LQQI+PVAGQV ALVLCHTRELAYQICHEFERFS YL 
Sbjct  89   GMDVICQAKSGMGKTAVFVLSSLQQIDPVAGQVGALVLCHTRELAYQICHEFERFSKYLS  148

Query  516  DIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            +IKVAVFYGGV+I  HKDLLKN+CPHIVVGT
Sbjct  149  EIKVAVFYGGVHIKKHKDLLKNDCPHIVVGT  179



>emb|CDX78412.1| BnaA03g03240D [Brassica napus]
Length=497

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 149/192 (78%), Positives = 161/192 (84%), Gaps = 19/192 (10%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ ++N+AYEEELLDYEEEDEK  DS   KVNG++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVLDS-GNKVNGDAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSE------------------VQHECIPQAILGMDVICQAKSGMGKTAVFV  392
            AIVDSGFEHPSE                  VQHECIPQAILGMDVICQAKSGMGKTAVFV
Sbjct  60   AIVDSGFEHPSEGKYLSVFFELYSTYKRFFVQHECIPQAILGMDVICQAKSGMGKTAVFV  119

Query  393  LSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDL  572
            LSTLQQIEP  GQV+AL+LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVN  IHK+L
Sbjct  120  LSTLQQIEPTPGQVSALILCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNNKIHKEL  179

Query  573  LKNECPHIVVGT  608
            LKNECPHIVVGT
Sbjct  180  LKNECPHIVVGT  191



>sp|Q0JM17.2|RH56_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 56 [Oryza sativa 
Japonica Group]
 dbj|BAD88053.1| putative HLA-B associated transcript 1 [Oryza sativa Japonica 
Group]
 dbj|BAG90417.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ACV83946.1| DExD box helicase protein HLA-B associated transcript 1 [Oryza 
sativa Japonica Group]
Length=432

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  198  KKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGK  377
            KKGY+GIHSSGFRDFLLKPELLRAI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGK
Sbjct  42   KKGYVGIHSSGFRDFLLKPELLRAIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGK  101

Query  378  TAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIT  557
            TAVFVLS+LQQI+PVAGQV ALVLCHTRELAYQICHEFERFS YLP++KVAVFYGGV+I 
Sbjct  102  TAVFVLSSLQQIDPVAGQVGALVLCHTRELAYQICHEFERFSKYLPEVKVAVFYGGVHIK  161

Query  558  IHKDLLKNECPHIVVGT  608
             HKDLLKN+CPHIVVGT
Sbjct  162  KHKDLLKNDCPHIVVGT  178



>ref|NP_001043298.1| Os01g0550000 [Oryza sativa Japonica Group]
 sp|Q5JK84.1|RH15_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 15 [Oryza sativa 
Japonica Group]
 dbj|BAD88055.1| putative HLA-B associated transcript 1 [Oryza sativa Japonica 
Group]
 dbj|BAD88115.1| putative HLA-B associated transcript 1 [Oryza sativa Japonica 
Group]
 dbj|BAF05212.1| Os01g0550000 [Oryza sativa Japonica Group]
 dbj|BAH00768.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70861.1| hypothetical protein OsI_02373 [Oryza sativa Indica Group]
Length=432

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  198  KKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGK  377
            KKGY+GIHSSGFRDFLLKPELLRAI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGK
Sbjct  42   KKGYVGIHSSGFRDFLLKPELLRAIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGK  101

Query  378  TAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIT  557
            TAVFVLS+LQQI+PVAGQV ALVLCHTRELAYQICHEFERFS YLP++KVAVFYGGV+I 
Sbjct  102  TAVFVLSSLQQIDPVAGQVGALVLCHTRELAYQICHEFERFSKYLPEVKVAVFYGGVHIK  161

Query  558  IHKDLLKNECPHIVVGT  608
             HKDLLKN+CPHIVVGT
Sbjct  162  KHKDLLKNDCPHIVVGT  178



>emb|CDX69778.1| BnaA10g21270D [Brassica napus]
Length=495

 Score =   267 bits (682),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 161/201 (80%), Gaps = 28/201 (14%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ ++N+ YEEELLDYEEEDEK  DS A KVNG++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDVRDNEVYEEELLDYEEEDEKLLDS-ATKVNGDAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSE---------------------------VQHECIPQAILGMDVICQAKS  365
            AIVDSGFEHPSE                           +QHECIPQAILGMDVICQAKS
Sbjct  60   AIVDSGFEHPSEGKFISLLALFLSLHLDFFVPTTYIIAMLQHECIPQAILGMDVICQAKS  119

Query  366  GMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGG  545
            GMGKTAVFVLSTLQQIEP  GQV+AL+LCHTRELAYQIC+EF RFSTYLPD KV+VFYGG
Sbjct  120  GMGKTAVFVLSTLQQIEPSPGQVSALILCHTRELAYQICNEFVRFSTYLPDTKVSVFYGG  179

Query  546  VNITIHKDLLKNECPHIVVGT  608
            VN  IHKDLLKNECPHIVVGT
Sbjct  180  VNNKIHKDLLKNECPHIVVGT  200



>emb|CDX69777.1| BnaA10g21260D [Brassica napus]
Length=523

 Score =   267 bits (683),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 161/201 (80%), Gaps = 28/201 (14%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ ++N+AYEEELLDYEEEDEK  DS   KVNG++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVLDS-GNKVNGDAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  267  AIVDSGFEHPSE---------------------------VQHECIPQAILGMDVICQAKS  365
            AIVDSGFEHPSE                           +QHECIPQAILGMDVICQAKS
Sbjct  60   AIVDSGFEHPSEGKFISLLALFLSLHLDFFVPTTYIIAMLQHECIPQAILGMDVICQAKS  119

Query  366  GMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGG  545
            GMGKTAVFVLSTLQQIEP  GQV+AL+LCHTRELAYQIC+EF RFSTYLPD KV+VFYGG
Sbjct  120  GMGKTAVFVLSTLQQIEPSPGQVSALILCHTRELAYQICNEFVRFSTYLPDTKVSVFYGG  179

Query  546  VNITIHKDLLKNECPHIVVGT  608
            VN  IHKDLLKNECPHIVVGT
Sbjct  180  VNNKIHKDLLKNECPHIVVGT  200



>ref|NP_001043297.1| Os01g0549700 [Oryza sativa Japonica Group]
 dbj|BAF05211.1| Os01g0549700, partial [Oryza sativa Japonica Group]
Length=495

 Score =   266 bits (679),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  198  KKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGK  377
            KKGY+GIHSSGFRDFLLKPELLRAI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGK
Sbjct  105  KKGYVGIHSSGFRDFLLKPELLRAIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGK  164

Query  378  TAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIT  557
            TAVFVLS+LQQI+PVAGQV ALVLCHTRELAYQICHEFERFS YLP++KVAVFYGGV+I 
Sbjct  165  TAVFVLSSLQQIDPVAGQVGALVLCHTRELAYQICHEFERFSKYLPEVKVAVFYGGVHIK  224

Query  558  IHKDLLKNECPHIVVGT  608
             HKDLLKN+CPHIVVGT
Sbjct  225  KHKDLLKNDCPHIVVGT  241



>gb|EEE54779.1| hypothetical protein OsJ_02176 [Oryza sativa Japonica Group]
Length=429

 Score =   262 bits (669),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = +3

Query  204  GYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTA  383
            GY+GIHSSGFRDFLLKPELLRAI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTA
Sbjct  41   GYVGIHSSGFRDFLLKPELLRAIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTA  100

Query  384  VFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIH  563
            VFVLS+LQQI+PVAGQV ALVLCHTRELAYQICHEFERFS YLP++KVAVFYGGV+I  H
Sbjct  101  VFVLSSLQQIDPVAGQVGALVLCHTRELAYQICHEFERFSKYLPEVKVAVFYGGVHIKKH  160

Query  564  KDLLKNECPHIVVGT  608
            KDLLKN+CPHIVVGT
Sbjct  161  KDLLKNDCPHIVVGT  175



>gb|EMS68248.1| DEAD-box ATP-dependent RNA helicase 56 [Triticum urartu]
Length=657

 Score =   250 bits (639),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 159/211 (75%), Gaps = 38/211 (18%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESA------KKGYIGIHSSGFRDFLL  248
            MGE KEND YEEELLDYEE+D+KA D+ ++  N + A      KKGY+GIHSSGFRDFLL
Sbjct  1    MGEAKENDVYEEELLDYEEDDDKALDA-SSNANAKPAADASQPKKGYVGIHSSGFRDFLL  59

Query  249  KPELLRAIVDSGFEHPSE-------------------------------VQHECIPQAIL  335
            KPELLRAI D GFEHPSE                               VQHECIPQAIL
Sbjct  60   KPELLRAIQDCGFEHPSEGKPPHIYFFFLDFSRLGTVYFLLTFPVGGKYVQHECIPQAIL  119

Query  336  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  515
            GMDVICQAKSGMGKTAVFVLS+LQQI+P AGQV ALVLCHTRELAYQIC+EFERFS +LP
Sbjct  120  GMDVICQAKSGMGKTAVFVLSSLQQIDPTAGQVTALVLCHTRELAYQICNEFERFSKFLP  179

Query  516  DIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            ++KVAVFYGGV+I  H+DLLKN+CPHIVVGT
Sbjct  180  ELKVAVFYGGVHIKKHQDLLKNDCPHIVVGT  210



>gb|EMS64048.1| DEAD-box ATP-dependent RNA helicase 56 [Triticum urartu]
Length=456

 Score =   245 bits (625),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 147/180 (82%), Gaps = 6/180 (3%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K+ + YEE+L+DY+EE E A D  AA  + +  KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEAKDAEVYEEDLVDYDEEVENAVDGAAANPSVDVVKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGF------EHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAG  428
            AI D              VQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAG
Sbjct  61   AIQDCIISSDIFSRRRGYVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAG  120

Query  429  QVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            QVAALVLCHTRELAYQIC+EFERFS YL + KVAVFYGGV+I  HKDLLKNECPHIVVGT
Sbjct  121  QVAALVLCHTRELAYQICNEFERFSKYLSETKVAVFYGGVHIKKHKDLLKNECPHIVVGT  180



>gb|EMT33323.1| DEAD-box ATP-dependent RNA helicase 56 [Aegilops tauschii]
Length=501

 Score =   245 bits (626),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 146/175 (83%), Gaps = 1/175 (1%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE K+ + YEE+L+DY+EE E A D  AA  + +  KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEAKDAEVYEEDLVDYDEEVENAVDGAAANPSVDVVKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGF-EHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL  443
             I    F      VQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQVAAL
Sbjct  61   IISSDIFGRRRGYVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVAAL  120

Query  444  VLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            VLCHTRELAYQIC+EFERFS YL + KVAVFYGGV+I  HKDLLKNECPHIVVGT
Sbjct  121  VLCHTRELAYQICNEFERFSKYLSETKVAVFYGGVHIKKHKDLLKNECPHIVVGT  175



>pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human 
Uap56
 pdb|1T6N|B Chain B, Crystal Structure Of The N-Terminal Domain Of Human 
Uap56
Length=220

 Score =   234 bits (597),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +3

Query  186  GESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKS  365
            G   K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKS
Sbjct  1    GSDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKS  60

Query  366  GMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGG  545
            GMGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG
Sbjct  61   GMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGG  120

Query  546  VNITIHKDLLKNECPHIVVGT  608
            ++I   +++LK  CPHIVVGT
Sbjct  121  LSIKKDEEVLKKNCPHIVVGT  141



>gb|KHG15649.1| DEAD-box ATP-dependent RNA helicase 56 -like protein [Gossypium 
arboreum]
Length=401

 Score =   240 bits (612),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 140/174 (80%), Gaps = 27/174 (16%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MGE ++NDAYEEELLDYEEE+EKAPDSV AKVNGE+ KKGY+GIH               
Sbjct  1    MGETRDNDAYEEELLDYEEEEEKAPDSVTAKVNGEAGKKGYVGIH---------------  45

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
                        +QHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQIEP  GQV ALV
Sbjct  46   ------------MQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIEPSPGQVIALV  93

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HKDLLKNECPHIVVGT
Sbjct  94   LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKVHKDLLKNECPHIVVGT  147



>ref|NP_998142.1| ATP-dependent RNA helicase DDX39 [Danio rerio]
 gb|AAH44169.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 39b [Danio rerio]
 gb|AAH67555.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 39b [Danio rerio]
 gb|AAI28805.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 39b [Danio rerio]
 emb|CAQ13699.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 39b [Danio rerio]
 gb|AAI65847.1| Ddx39b protein [Danio rerio]
Length=427

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 130/151 (86%), Gaps = 1/151 (1%)
 Frame = +3

Query  156  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  335
            AP+S AA V  +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAIL
Sbjct  22   APES-AAPVGKKEVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAIL  80

Query  336  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  515
            GMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P
Sbjct  81   GMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTRELAFQISKEYERFSKYMP  140

Query  516  DIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
             +KVAVF+GG++I   +D+LK  CPHIVVGT
Sbjct  141  TVKVAVFFGGMSIKKDEDVLKKSCPHIVVGT  171



>gb|EDL10915.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 39, isoform CRA_a [Mus 
musculus]
Length=225

 Score =   233 bits (594),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +3

Query  153  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  332
            +AP         +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  37   QAPQESTPAPPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  96

Query  333  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  512
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+
Sbjct  97   LGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVSVLVMCHTRELAFQISKEYERFSKYM  156

Query  513  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            P +KV+VF+GG++I   +D+LK  CPH+VVGT
Sbjct  157  PSVKVSVFFGGLSIKKDEDVLKKNCPHVVVGT  188



>ref|XP_008314982.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Cynoglossus semilaevis]
Length=424

 Score =   238 bits (608),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +3

Query  183  NGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAK  362
            N +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMD++CQAK
Sbjct  27   NKKEVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDILCQAK  86

Query  363  SGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYG  542
            SGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P +KV+VF+G
Sbjct  87   SGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFG  146

Query  543  GVNITIHKDLLKNECPHIVVGT  608
            G+ I   +D+LKN CPHIVVGT
Sbjct  147  GMAIKNDEDVLKNNCPHIVVGT  168



>ref|XP_011399824.1| DEAD-box ATP-dependent RNA helicase 56 [Auxenochlorella protothecoides]
 gb|KFM26876.1| DEAD-box ATP-dependent RNA helicase 56 [Auxenochlorella protothecoides]
Length=419

 Score =   238 bits (608),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 128/143 (90%), Gaps = 2/143 (1%)
 Frame = +3

Query  186  GESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKS  365
            GE+ KKGY+GIHSSGF+DFLLKPELLRAI D GFEHPSEVQHECIPQAILGMDVICQAKS
Sbjct  23   GETVKKGYVGIHSSGFKDFLLKPELLRAIQDCGFEHPSEVQHECIPQAILGMDVICQAKS  82

Query  366  GMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGG  545
            GMGKTAVFV+STLQQ+EPV GQV+ LVLCHTRELA+QI HEFERF+TYL  +++A F+GG
Sbjct  83   GMGKTAVFVISTLQQLEPVDGQVSVLVLCHTRELAFQITHEFERFTTYLKSVRLANFFGG  142

Query  546  VNITIHKDLLKN--ECPHIVVGT  608
            + I  H+DLLK+  + PHI++GT
Sbjct  143  LPIKAHRDLLKDGEKAPHILIGT  165



>ref|XP_001516247.2| PREDICTED: spliceosome RNA helicase DDX39B, partial [Ornithorhynchus 
anatinus]
Length=296

 Score =   234 bits (597),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>ref|XP_005470227.1| PREDICTED: ATP-dependent RNA helicase DDX39A-like [Oreochromis 
niloticus]
Length=206

 Score =   231 bits (589),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +3

Query  183  NGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAK  362
            N +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMD++CQAK
Sbjct  30   NKKEVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDILCQAK  89

Query  363  SGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYG  542
            SGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P +KV+VF+G
Sbjct  90   SGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTRELAFQISKEYERFSKYMPTVKVSVFFG  149

Query  543  GVNITIHKDLLKNECPHIVVGT  608
            G+ I   +++LK  CPHIVVGT
Sbjct  150  GMAIKKDEEVLKKNCPHIVVGT  171



>gb|EGV95298.1| Spliceosome RNA helicase BAT1 [Cricetulus griseus]
Length=288

 Score =   233 bits (595),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EP+ GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPITGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>ref|XP_002505759.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67017.1| predicted protein [Micromonas sp. RCC299]
Length=426

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 126/151 (83%), Gaps = 0/151 (0%)
 Frame = +3

Query  156  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  335
            A D  A   +GE+ KKGY+GIHS+GFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAIL
Sbjct  22   AADEGAGAKSGEAVKKGYVGIHSTGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAIL  81

Query  336  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  515
            GMDVICQAKSGMGKTAVFVL+ LQQ+EPV G+V AL+LCHTRELAYQI HEFERFS YLP
Sbjct  82   GMDVICQAKSGMGKTAVFVLAVLQQLEPVPGEVGALILCHTRELAYQIKHEFERFSAYLP  141

Query  516  DIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
             + VAV +GGVNI   K  LK + P I+V T
Sbjct  142  AVNVAVIFGGVNIKQQKAELKEKPPSIIVAT  172



>ref|XP_007231785.1| PREDICTED: spliceosome RNA helicase DDX39B-like [Astyanax mexicanus]
Length=436

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = +3

Query  156  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  335
            A DS A  +  E  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAIL
Sbjct  30   AGDSGAMTIRKEGVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAIL  89

Query  336  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  515
            GMDV+CQAKSGMGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P
Sbjct  90   GMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMP  149

Query  516  DIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
             +KVAVF+GG++I   +++LK E PH+VVGT
Sbjct  150  AVKVAVFFGGLSIKKDEEVLKRESPHVVVGT  180



>ref|NP_001133398.1| Spliceosome RNA helicase BAT1 [Salmo salar]
 gb|ACI33160.1| Spliceosome RNA helicase BAT1 [Salmo salar]
Length=428

 Score =   237 bits (605),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  VNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQA  359
            +  E  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQA
Sbjct  30   IKKERVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQA  89

Query  360  KSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFY  539
            KSGMGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P IKVAVF+
Sbjct  90   KSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPTIKVAVFF  149

Query  540  GGVNITIHKDLLKNECPHIVVGT  608
            GG++I   +++LK ECPH+VVGT
Sbjct  150  GGLSIKKDEEVLKKECPHVVVGT  172



>ref|NP_001134851.1| ATP-dependent RNA helicase DDX39 [Salmo salar]
 gb|ACI69146.1| ATP-dependent RNA helicase DDX39 [Salmo salar]
Length=427

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 135/169 (80%), Gaps = 0/169 (0%)
 Frame = +3

Query  102  ENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDS  281
            ENDA  E L   E+E+ +     AA    +  K  Y+ IHSSGFRDFLLKPELLRAIVD 
Sbjct  3    ENDADNELLDYEEDEEPQGAPETAAPAGKKEVKGSYVSIHSSGFRDFLLKPELLRAIVDC  62

Query  282  GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTR  461
            GFEHPSEVQHECIPQAILGMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTR
Sbjct  63   GFEHPSEVQHECIPQAILGMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTR  122

Query  462  ELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            ELA+QI  E+ERFS Y+P +K AVF+GG++I   +D+LK  CPHIVVGT
Sbjct  123  ELAFQISKEYERFSKYMPTVKAAVFFGGLSIKKDEDVLKKNCPHIVVGT  171



>ref|XP_010744288.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2 [Larimichthys 
crocea]
Length=388

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  VNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQA  359
            +  E  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQA
Sbjct  34   IRKEGVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQA  93

Query  360  KSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFY  539
            KSGMGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P +KVAVF+
Sbjct  94   KSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPTVKVAVFF  153

Query  540  GGVNITIHKDLLKNECPHIVVGT  608
            GG++I   +++LK +CPHIVVGT
Sbjct  154  GGLSIKKDEEVLKKDCPHIVVGT  176



>ref|XP_005643776.1| nuclear RNA helicase-like protein Bat1 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19232.1| nuclear RNA helicase-like protein Bat1 [Coccomyxa subellipsoidea 
C-169]
Length=435

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = +3

Query  195  AKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMG  374
            AKKGY+GIHS+GF+DFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDVICQAKSGMG
Sbjct  37   AKKGYVGIHSTGFKDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVICQAKSGMG  96

Query  375  KTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI  554
            KTAVFVLS LQQ+EPV  +VAAL++CHTRELAYQICHEFERFSTY+P+++VA F+GG  I
Sbjct  97   KTAVFVLSVLQQLEPVENEVAALIICHTRELAYQICHEFERFSTYMPNVRVANFFGGFPI  156

Query  555  TIHKDLLKNECPHIVVGT  608
                + LK   PH VVGT
Sbjct  157  KQQIEQLKTNTPHAVVGT  174



>gb|EAX03412.1| hCG2005638, isoform CRA_d [Homo sapiens]
Length=290

 Score =   233 bits (593),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>ref|XP_003515868.2| PREDICTED: spliceosome RNA helicase DDX39B-like [Cricetulus griseus]
 gb|EGW15305.1| Spliceosome RNA helicase Bat1 [Cricetulus griseus]
Length=229

 Score =   231 bits (588),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKT VFVL+TLQQ+EP+ GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTVVFVLATLQQLEPITGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>dbj|BAE42496.1| unnamed protein product [Mus musculus]
Length=324

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>ref|XP_006080887.1| PREDICTED: LOW QUALITY PROTEIN: DEAD (Asp-Glu-Ala-Asp) box polypeptide 
39B [Bubalus bubalis]
Length=290

 Score =   232 bits (592),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P +KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPSVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>ref|XP_008853627.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Nannospalax galili]
Length=427

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +3

Query  153  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  332
            +AP         +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPQETTPAPPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  333  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  512
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEP++GQV+ LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDVLCQAKSGMGKTAVFVLATLQQIEPISGQVSVLVMCHTRELAFQISKEYERFSKYM  139

Query  513  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            P +KV+VF+GG++I   +D+LK  CPH+VVGT
Sbjct  140  PSVKVSVFFGGLSIKKDEDVLKKNCPHVVVGT  171



>ref|XP_007612851.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2, partial 
[Cricetulus griseus]
Length=245

 Score =   231 bits (588),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKT VFVL+TLQQ+EP+ GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTVVFVLATLQQLEPITGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>ref|XP_001178866.1| PREDICTED: spliceosome RNA helicase DDX39B-like [Strongylocentrotus 
purpuratus]
Length=429

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 135/174 (78%), Gaps = 0/174 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            M +N EN+    +  D E ++       A K   E+  KGY+ IHSSGFRDFLLKPELLR
Sbjct  1    MADNDENEQELLDYEDEEAQETADAGGDAVKQQKETKAKGYVSIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVD GFEHPSEVQHECIPQAILGMDV+CQAKSGMGKTAVFVL+TLQQ++PV GQV+ LV
Sbjct  61   AIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLDPVDGQVSVLV  120

Query  447  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            +CHTRELA+QI  E+ERFS Y+P +KV VF+GG++I   +  +K  CPHIVVGT
Sbjct  121  MCHTRELAFQIAKEYERFSKYMPTVKVGVFFGGLSIKKDEQTIKTNCPHIVVGT  174



>ref|XP_006631613.1| PREDICTED: ATP-dependent RNA helicase DDX39A-like [Lepisosteus 
oculatus]
Length=427

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 128/151 (85%), Gaps = 1/151 (1%)
 Frame = +3

Query  156  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  335
            AP+S AA    +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAIL
Sbjct  22   APES-AAPAGKKEVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAIL  80

Query  336  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  515
            GMD++CQAKSGMGKTAVFVL+TLQQIEPV GQVA LV+CHTRELA+QI  E+ERFS Y+P
Sbjct  81   GMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVAVLVMCHTRELAFQISKEYERFSKYMP  140

Query  516  DIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
             +K AVF+GG++I   +++LK  CPHIVVGT
Sbjct  141  TVKAAVFFGGLSIKKDEEVLKKNCPHIVVGT  171



>ref|XP_005515740.1| PREDICTED: spliceosome RNA helicase DDX39B-like, partial [Columba 
livia]
Length=202

 Score =   229 bits (584),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P +KV+VF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPH+VVGT
Sbjct  153  SIKKDEEVLKKNCPHVVVGT  172



>ref|XP_007647292.1| PREDICTED: LOW QUALITY PROTEIN: spliceosome RNA helicase DDX39B 
isoform X1 [Cricetulus griseus]
Length=290

 Score =   232 bits (591),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EP+ GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPITGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>ref|XP_010535309.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like, partial 
[Tarenaya hassleriana]
Length=137

 Score =   227 bits (578),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  87   MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  266
            MG+ ++N+AYEEELLDYEEEDEK PDS   K NGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDTRDNEAYEEELLDYEEEDEKVPDSAGNKANGENGKKGYVGIHSSGFRDFLLKPELLR  60

Query  267  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  446
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVAALV  120

Query  447  LCHTRELAYQICHEFER  497
            LCHTRELAYQICHEFER
Sbjct  121  LCHTRELAYQICHEFER  137



>emb|CDQ90161.1| unnamed protein product [Oncorhynchus mykiss]
Length=427

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 135/169 (80%), Gaps = 0/169 (0%)
 Frame = +3

Query  102  ENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDS  281
            ENDA  E L   E+E+ +     +A    +  K  Y+ IHSSGFRDFLLKPELLRAIVD 
Sbjct  3    ENDAENELLDYEEDEEPQGAPETSAPAGKKEVKGSYVSIHSSGFRDFLLKPELLRAIVDC  62

Query  282  GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTR  461
            GFEHPSEVQHECIPQAILGMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTR
Sbjct  63   GFEHPSEVQHECIPQAILGMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTR  122

Query  462  ELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            ELA+QI  E+ERFS Y+P +K AVF+GG++I   +D+LK  CPHIVVGT
Sbjct  123  ELAFQISKEYERFSKYMPTVKAAVFFGGLSIKKDEDVLKKNCPHIVVGT  171



>ref|XP_006993135.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X1 [Peromyscus 
maniculatus bairdii]
 ref|XP_006993136.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X2 [Peromyscus 
maniculatus bairdii]
Length=427

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +3

Query  153  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  332
            +AP         +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPQESTPAPQKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  333  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  512
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEP+ GQV+ LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDVLCQAKSGMGKTAVFVLATLQQIEPINGQVSVLVMCHTRELAFQISKEYERFSKYM  139

Query  513  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            P +KV+VF+GG++I   +D+LK  CPH+VVGT
Sbjct  140  PSVKVSVFFGGLSIKKDEDVLKKNCPHVVVGT  171



>ref|XP_010744287.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X1 [Larimichthys 
crocea]
Length=432

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  VNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQA  359
            +  E  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQA
Sbjct  34   IRKEGVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQA  93

Query  360  KSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFY  539
            KSGMGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P +KVAVF+
Sbjct  94   KSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPTVKVAVFF  153

Query  540  GGVNITIHKDLLKNECPHIVVGT  608
            GG++I   +++LK +CPHIVVGT
Sbjct  154  GGLSIKKDEEVLKKDCPHIVVGT  176



>ref|NP_001133080.1| ATP-dependent RNA helicase DDX39 [Salmo salar]
 gb|ACH70654.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 39 [Salmo salar]
Length=427

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 128/151 (85%), Gaps = 1/151 (1%)
 Frame = +3

Query  156  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  335
            AP++ AA    +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAIL
Sbjct  22   APET-AAPAGKKEVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAIL  80

Query  336  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  515
            GMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P
Sbjct  81   GMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTRELAFQISKEYERFSKYMP  140

Query  516  DIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
             +K AVF+GG++I   +D+LK  CPHIVVGT
Sbjct  141  TVKAAVFFGGLSIKKDEDVLKKNCPHIVVGT  171



>ref|XP_004872546.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X6 [Heterocephalus 
glaber]
Length=501

 Score =   238 bits (607),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +3

Query  153  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  332
            +AP      +  +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  69   QAPPESTPTLPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  128

Query  333  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  512
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+
Sbjct  129  LGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVSVLVMCHTRELAFQISKEYERFSKYM  188

Query  513  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            P++KV+VF+GG++I   +D+LK  CPH+VVGT
Sbjct  189  PNVKVSVFFGGLSIKKDEDVLKRNCPHVVVGT  220



>dbj|BAD92454.1| HLA-B associated transcript 1 variant [Homo sapiens]
Length=310

 Score =   232 bits (592),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  53   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  112

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  113  MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  172

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  173  SIKKDEEVLKKNCPHIVVGT  192



>ref|XP_004628303.1| PREDICTED: ATP-dependent RNA helicase DDX39A-like [Octodon degus]
Length=427

 Score =   236 bits (601),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +3

Query  153  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  332
            +AP      +  +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPAESTPALPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  333  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  512
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEPV GQVA LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVAVLVMCHTRELAFQISKEYERFSKYM  139

Query  513  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            P IKV+VF+GG++I   +++LK  CPH+VVGT
Sbjct  140  PSIKVSVFFGGLSIKKDEEVLKRNCPHVVVGT  171



>dbj|BAE23239.1| unnamed protein product [Mus musculus]
Length=427

 Score =   236 bits (601),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +3

Query  153  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  332
            +AP         +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPQESTPAPPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  333  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  512
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVSVLVMCHTRELAFQISKEYERFSKYM  139

Query  513  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            P +KV+VF+GG++I   +D+LK  CPH+VVGT
Sbjct  140  PSVKVSVFFGGLSIKKDEDVLKKNCPHVVVGT  171



>ref|NP_932099.2| ATP-dependent RNA helicase DDX39A [Mus musculus]
 ref|XP_006531395.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X1 [Mus 
musculus]
 sp|Q8VDW0.1|DX39A_MOUSE RecName: Full=ATP-dependent RNA helicase DDX39A; AltName: Full=DEAD 
box protein 39 [Mus musculus]
 gb|AAH20134.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 39 [Mus musculus]
 dbj|BAE30021.1| unnamed protein product [Mus musculus]
 dbj|BAE37049.1| unnamed protein product [Mus musculus]
 dbj|BAE40052.1| unnamed protein product [Mus musculus]
 dbj|BAE26758.1| unnamed protein product [Mus musculus]
 dbj|BAE27051.1| unnamed protein product [Mus musculus]
 gb|EDL10916.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 39, isoform CRA_b [Mus 
musculus]
Length=427

 Score =   236 bits (601),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +3

Query  153  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  332
            +AP         +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPQESTPAPPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  333  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  512
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVSVLVMCHTRELAFQISKEYERFSKYM  139

Query  513  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            P +KV+VF+GG++I   +D+LK  CPH+VVGT
Sbjct  140  PSVKVSVFFGGLSIKKDEDVLKKNCPHVVVGT  171



>ref|XP_009827129.1| DEAD-box ATP-dependent RNA helicase 15 [Aphanomyces astaci]
 gb|ETV83699.1| DEAD-box ATP-dependent RNA helicase 15 [Aphanomyces astaci]
Length=419

 Score =   235 bits (600),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 127/149 (85%), Gaps = 1/149 (1%)
 Frame = +3

Query  165  SVAAKVNGESAKKG-YIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGM  341
            +V  K N +  KKG Y+GIHS+GF+DFLLKPE LRA+VD GFEHPSEVQHECIPQA+LGM
Sbjct  17   AVDNKANAKETKKGHYVGIHSAGFKDFLLKPEALRAVVDCGFEHPSEVQHECIPQAVLGM  76

Query  342  DVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDI  521
            D+ICQAKSGMGKTAVFVL+TL Q+EPV  Q++ +VLCHTRELA+QI HE+ERFS YLPD+
Sbjct  77   DIICQAKSGMGKTAVFVLATLHQLEPVENQISVVVLCHTRELAFQIAHEYERFSKYLPDV  136

Query  522  KVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            K AVFYGGV I  +++ LKN  PHIVVGT
Sbjct  137  KTAVFYGGVPIVQNRETLKNNPPHIVVGT  165



>ref|XP_010871406.1| PREDICTED: spliceosome RNA helicase DDX39B [Esox lucius]
Length=430

 Score =   236 bits (601),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 131/156 (84%), Gaps = 7/156 (4%)
 Frame = +3

Query  162  DSVAAKVNGE--SAKKG-----YIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECI  320
            D+V     G+  S KKG     Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECI
Sbjct  19   DAVGDLAGGDVLSVKKGGVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECI  78

Query  321  PQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERF  500
            PQAILGMDV+CQAKSGMGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERF
Sbjct  79   PQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERF  138

Query  501  STYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            S Y+P IKVAVF+GG++I   +++LK ECPH+VVGT
Sbjct  139  SKYMPTIKVAVFFGGLSIKKDEEVLKRECPHVVVGT  174



>ref|XP_004748289.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X2 [Mustela 
putorius furo]
 ref|XP_004824161.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X2 [Mustela 
putorius furo]
Length=495

 Score =   237 bits (605),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = +3

Query  81   QQMGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPEL  260
            QQ G   E D   E L   E+E+ +AP         +  K  Y+ IHSSGFRDFLLKPEL
Sbjct  64   QQQGHMAEQDVENELLDYEEDEEPQAPPESTPAPPKKDVKGSYVSIHSSGFRDFLLKPEL  123

Query  261  LRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAA  440
            LRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSGMGKTAVFVL+TLQQIEPV+GQV+ 
Sbjct  124  LRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQIEPVSGQVSV  183

Query  441  LVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            LV+CHTRELA+QI  E+ERFS Y+P +KV+VF+GG++I   +++LK  CPH+VVGT
Sbjct  184  LVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLSIKKDEEILKKNCPHVVVGT  239



>ref|XP_004073639.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Oryzias latipes]
Length=427

 Score =   235 bits (600),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 126/151 (83%), Gaps = 1/151 (1%)
 Frame = +3

Query  156  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  335
            AP+S AA    +  K  Y+ IHSSGFRDFLLKPELLRAI+D GFEHPSEVQHECIPQAIL
Sbjct  22   APES-AAPTGKKEVKGSYVSIHSSGFRDFLLKPELLRAIIDCGFEHPSEVQHECIPQAIL  80

Query  336  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  515
            GMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV  LV+CHTRELA+QI  E+ERFS Y+P
Sbjct  81   GMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVTVLVMCHTRELAFQISKEYERFSKYMP  140

Query  516  DIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
             +K AVF+GG+ I   +D+LK  CPHIVVGT
Sbjct  141  TVKAAVFFGGMAIKNDEDVLKKNCPHIVVGT  171



>ref|XP_004711745.1| PREDICTED: spliceosome RNA helicase DDX39B [Echinops telfairi]
Length=428

 Score =   235 bits (600),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 128/157 (82%), Gaps = 8/157 (5%)
 Frame = +3

Query  162  DSVAAKVNGESA--------KKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHEC  317
            D V     GE A        K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHEC
Sbjct  16   DEVETAAGGEGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHEC  75

Query  318  IPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFER  497
            IPQAILGMDV+CQAKSGMGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ER
Sbjct  76   IPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYER  135

Query  498  FSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            FS Y+P++KVAVF+GG++I   +++LK  CPHIVVGT
Sbjct  136  FSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGT  172



>dbj|BAE31182.1| unnamed protein product [Mus musculus]
Length=427

 Score =   235 bits (600),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +3

Query  153  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  332
            +AP         +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPQESTPAPPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  333  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  512
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVSVLVMCHTRELAFQISKEYERFSKYM  139

Query  513  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            P +KV+VF+GG++I   +D+LK  CPH+VVGT
Sbjct  140  PSVKVSVFFGGLSIKKDEDVLKKNCPHVVVGT  171



>ref|XP_004635679.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Octodon degus]
Length=427

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +3

Query  153  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  332
            +AP      +  +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPAESTPTLPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  333  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  512
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEPV GQVA LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVAVLVMCHTRELAFQISKEYERFSKYM  139

Query  513  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            P +KV+VF+GG++I   +++LK  CPH+VVGT
Sbjct  140  PSVKVSVFFGGLSIKKDEEVLKRNCPHVVVGT  171



>ref|XP_004715629.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Echinops telfairi]
Length=279

 Score =   231 bits (588),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +3

Query  153  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  332
            +AP         +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPPESTPVPPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  333  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  512
            LGMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV  LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDILCQAKSGMGKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYM  139

Query  513  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            P +KV+VF+GG++I   +++LK  CPH+VVGT
Sbjct  140  PSVKVSVFFGGLSIKKDEEVLKKNCPHVVVGT  171



>ref|XP_002738626.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X1 [Saccoglossus 
kowalevskii]
Length=429

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAIL MDV+CQAKSG
Sbjct  35   KDVKGNYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILSMDVLCQAKSG  94

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQIEPV GQV+ LVLCHTRELA+QI  E+ERFS Y+P IKV VF+GG+
Sbjct  95   MGKTAVFVLATLQQIEPVDGQVSVLVLCHTRELAFQIAKEYERFSKYMPTIKVGVFFGGI  154

Query  549  NITIHKDLLKNECPHIVVGT  608
            NI   +  LKN CPHIVVGT
Sbjct  155  NIKKDEQTLKNNCPHIVVGT  174



>gb|AAA41787.1| liver nuclear protein p47 [Rattus norvegicus]
Length=399

 Score =   234 bits (597),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>dbj|BAG16272.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 39 transcript variant 
[Homo sapiens]
Length=267

 Score =   230 bits (586),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  198  KKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGK  377
            K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSGMGK
Sbjct  35   KGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK  94

Query  378  TAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIT  557
            TAVFVL+TLQQIEPV GQV  LV+CHTRELA+QI  E+ERFS Y+P +KV+VF+GG++I 
Sbjct  95   TAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLSIK  154

Query  558  IHKDLLKNECPHIVVGT  608
              +++LK  CPH+VVGT
Sbjct  155  KDEEVLKKNCPHVVVGT  171



>ref|XP_010599849.1| PREDICTED: spliceosome RNA helicase DDX39B [Loxodonta africana]
Length=428

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>gb|ACM09195.1| ATP-dependent RNA helicase DDX39 [Salmo salar]
 gb|ACN10290.1| ATP-dependent RNA helicase DDX39 [Salmo salar]
 gb|ACN12648.1| ATP-dependent RNA helicase DDX39 [Salmo salar]
Length=427

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 127/151 (84%), Gaps = 1/151 (1%)
 Frame = +3

Query  156  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  335
            AP++ A     +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAIL
Sbjct  22   APET-ATPAGKKEVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAIL  80

Query  336  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  515
            GMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P
Sbjct  81   GMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTRELAFQISKEYERFSKYMP  140

Query  516  DIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
             +K AVF+GG++I   +D+LK  CPHIVVGT
Sbjct  141  TVKAAVFFGGLSIKKDEDVLKKNCPHIVVGT  171



>gb|EGW00654.1| ATP-dependent RNA helicase DDX39 [Cricetulus griseus]
Length=424

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +3

Query  153  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  332
            +AP         +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPQESTPAPPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  333  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  512
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEP+ GQV+ LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDVLCQAKSGMGKTAVFVLATLQQIEPINGQVSVLVMCHTRELAFQISKEYERFSKYM  139

Query  513  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            P +KV+VF+GG++I   +D+LK  CPH+VVGT
Sbjct  140  PSVKVSVFFGGLSIKKDEDVLKKNCPHVVVGT  171



>ref|XP_006904735.1| PREDICTED: spliceosome RNA helicase DDX39B [Pteropus alecto]
Length=428

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>dbj|BAE43010.1| unnamed protein product [Mus musculus]
Length=427

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +3

Query  153  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  332
            +AP         +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPQESTPAPPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  333  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  512
            LGMDV+CQAKSGMGKTAVFVL+T+QQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDVLCQAKSGMGKTAVFVLATMQQIEPVNGQVSVLVMCHTRELAFQISKEYERFSKYM  139

Query  513  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            P +KV+VF+GG++I   +D+LK  CPH+VVGT
Sbjct  140  PSVKVSVFFGGLSIKKDEDVLKKNCPHVVVGT  171



>ref|XP_005381156.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X1 [Chinchilla 
lanigera]
 ref|XP_005381157.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X2 [Chinchilla 
lanigera]
 ref|XP_005381158.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X3 [Chinchilla 
lanigera]
Length=427

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +3

Query  153  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  332
            +AP      +  +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPSENTPTLPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  333  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  512
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVSVLVMCHTRELAFQISKEYERFSKYM  139

Query  513  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            P +KV+VF+GG++I   +++LK  CPH+VVGT
Sbjct  140  PSVKVSVFFGGLSIKKDEEVLKRNCPHVVVGT  171



>ref|XP_003972140.1| PREDICTED: ATP-dependent RNA helicase DDX39A-like [Takifugu rubripes]
Length=427

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 127/151 (84%), Gaps = 1/151 (1%)
 Frame = +3

Query  156  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  335
            AP+S     N +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAIL
Sbjct  22   APES-GTPANKKEVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAIL  80

Query  336  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  515
            GMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P
Sbjct  81   GMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTRELAFQISKEYERFSKYMP  140

Query  516  DIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
             +KV+VF+GG+ I   +++LK  CPHI+VGT
Sbjct  141  TVKVSVFFGGLTIKKDEEVLKKNCPHIIVGT  171



>emb|CAA84355.1| BAT1 [Sus scrofa]
Length=427

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  32   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  91

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  92   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  151

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  152  SIKKDEEVLKKNCPHIVVGT  171



>ref|XP_006874383.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Chrysochloris asiatica]
Length=427

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +3

Query  153  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  332
            +AP         +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPPESTPAPPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  333  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  512
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEPV+GQV+ LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDVLCQAKSGMGKTAVFVLATLQQIEPVSGQVSVLVMCHTRELAFQISKEYERFSKYM  139

Query  513  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            P++KV+VF+GG++I   +++LK  CPH+VVGT
Sbjct  140  PNVKVSVFFGGLSIKKDEEVLKKNCPHVVVGT  171



>ref|XP_006178881.1| PREDICTED: spliceosome RNA helicase DDX39B [Camelus ferus]
Length=426

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>ref|XP_001366378.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X1 [Monodelphis 
domestica]
 ref|XP_007489117.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X3 [Monodelphis 
domestica]
Length=427

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  32   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  91

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQIEPV GQV  LV+CHTRELA+QI  E+ERFS Y+P++KV+VF+GG+
Sbjct  92   MGKTAVFVLATLQQIEPVDGQVTVLVMCHTRELAFQISKEYERFSKYMPNVKVSVFFGGL  151

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +D+LK  CPH+VVGT
Sbjct  152  SIKKDEDVLKKNCPHVVVGT  171



>ref|NP_062667.1| spliceosome RNA helicase Ddx39b [Mus musculus]
 ref|NP_579834.2| spliceosome RNA helicase Ddx39b [Rattus norvegicus]
 ref|NP_001239386.1| spliceosome RNA helicase Ddx39b [Mus musculus]
 sp|Q9Z1N5.1|DX39B_MOUSE RecName: Full=Spliceosome RNA helicase Ddx39b; AltName: Full=56 
kDa U2AF65-associated protein; AltName: Full=DEAD box protein 
UAP56; AltName: Full=HLA-B-associated transcript 1 protein 
[Mus musculus]
 sp|Q63413.3|DX39B_RAT RecName: Full=Spliceosome RNA helicase Ddx39b; AltName: Full=56 
kDa U2AF65-associated protein; AltName: Full=ATP-dependent 
RNA helicase p47; AltName: Full=DEAD box protein Uap56 [Rattus 
norvegicus]
 gb|AAD30177.1|AC007080_3 BAT1 [Mus musculus]
 gb|AAD13115.1| nuclear RNA helicase Bat1 [Mus musculus]
 gb|AAH11067.1| HLA-B-associated transcript 1A [Mus musculus]
 emb|CAC85694.1| putative RNA helicase [Rattus norvegicus]
 gb|AAH24859.1| HLA-B-associated transcript 1A [Mus musculus]
 dbj|BAC34505.1| unnamed protein product [Mus musculus]
 dbj|BAC40624.1| unnamed protein product [Mus musculus]
 gb|AAP91685.1| HLA-B associated transcript 1 [Mus musculus]
 gb|AAP91686.1| HLA-B associated transcript 1 [Mus musculus]
 gb|AAH80243.1| HLA-B associated transcript 1 [Rattus norvegicus]
 gb|EDL83554.1| HLA-B-associated transcript 1A, isoform CRA_a [Rattus norvegicus]
Length=428

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>ref|XP_004277466.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Orcinus orca]
 ref|XP_004312321.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Tursiops truncatus]
 ref|XP_007469110.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Lipotes vexillifer]
Length=427

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +3

Query  153  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  332
            +AP   A     +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPPESAPTAPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  333  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  512
            LGMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV  LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDILCQAKSGMGKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYM  139

Query  513  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            P +KV+VF+GG++I   +++LK  CPH+VVGT
Sbjct  140  PSVKVSVFFGGLSIKKDEEVLKKNCPHVVVGT  171



>ref|XP_003501931.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Cricetulus griseus]
 ref|XP_005087613.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Mesocricetus auratus]
 ref|XP_005370974.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Microtus ochrogaster]
 ref|XP_007612805.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Cricetulus griseus]
Length=427

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +3

Query  153  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  332
            +AP         +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPQESTPAPPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  333  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  512
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEP+ GQV+ LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDVLCQAKSGMGKTAVFVLATLQQIEPINGQVSVLVMCHTRELAFQISKEYERFSKYM  139

Query  513  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            P +KV+VF+GG++I   +D+LK  CPH+VVGT
Sbjct  140  PSVKVSVFFGGLSIKKDEDVLKKNCPHVVVGT  171



>gb|EPY85364.1| v-type proton ATPase subunit G 2 isoform 1 [Camelus ferus]
Length=414

 Score =   234 bits (597),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>gb|ELK18937.1| Spliceosome RNA helicase BAT1 [Pteropus alecto]
Length=426

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>ref|NP_001014399.1| spliceosome RNA helicase DDX39B [Canis lupus familiaris]
 sp|Q5WR10.1|DX39B_CANFA RecName: Full=Spliceosome RNA helicase DDX39B; AltName: Full=56 
kDa U2AF65-associated protein; AltName: Full=DEAD box protein 
UAP56 [Canis lupus familiaris]
 gb|AAR27886.1| BAT1 [Canis lupus familiaris]
Length=428

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>ref|XP_006154309.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X1 [Tupaia 
chinensis]
 ref|XP_006154310.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2 [Tupaia 
chinensis]
 ref|XP_006154311.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X3 [Tupaia 
chinensis]
 gb|ELW61840.1| Spliceosome RNA helicase DDX39B [Tupaia chinensis]
Length=428

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>ref|XP_008992391.1| PREDICTED: LOW QUALITY PROTEIN: spliceosome RNA helicase DDX39B 
[Callithrix jacchus]
Length=422

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>gb|EFB18180.1| hypothetical protein PANDA_020423 [Ailuropoda melanoleuca]
Length=425

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>gb|EHH52904.1| hypothetical protein EGM_13439 [Macaca fascicularis]
Length=426

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>gb|EHH18152.1| hypothetical protein EGK_14701 [Macaca mulatta]
Length=426

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>ref|XP_006896266.1| PREDICTED: spliceosome RNA helicase DDX39B [Elephantulus edwardii]
Length=428

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>gb|AAP36788.1| Homo sapiens HLA-B associated transcript 1 [synthetic construct]
 gb|AAX29702.1| HLA-B associated transcript 1, partial [synthetic construct]
 gb|AAX29703.1| HLA-B associated transcript 1, partial [synthetic construct]
Length=429

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>ref|XP_010611745.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X3 [Fukomys 
damarensis]
 ref|XP_010611746.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X3 [Fukomys 
damarensis]
 ref|XP_010611747.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X3 [Fukomys 
damarensis]
Length=427

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +3

Query  153  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  332
            +AP      +  +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPPESTPTLPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  333  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  512
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVSVLVMCHTRELAFQISKEYERFSKYM  139

Query  513  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            P +KV+VF+GG++I   +++LK  CPH+VVGT
Sbjct  140  PSVKVSVFFGGLSIKKDEEVLKRNCPHVVVGT  171



>ref|XP_004060213.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform 2 [Gorilla 
gorilla gorilla]
Length=295

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  198  KKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGK  377
            K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSGMGK
Sbjct  35   KGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK  94

Query  378  TAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIT  557
            TAVFVL+TLQQIEPV GQV  LV+CHTRELA+QI  E+ERFS Y+P +KV+VF+GG++I 
Sbjct  95   TAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLSIK  154

Query  558  IHKDLLKNECPHIVVGT  608
              +++LK  CPH+VVGT
Sbjct  155  KDEEVLKKNCPHVVVGT  171



>ref|XP_007537232.1| PREDICTED: spliceosome RNA helicase DDX39B [Erinaceus europaeus]
Length=428

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>ref|XP_006738543.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2 [Leptonychotes 
weddellii]
Length=428

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>ref|XP_004621320.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X1 [Sorex 
araneus]
Length=428

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>dbj|BAD96632.1| HLA-B associated transcript 1 variant [Homo sapiens]
Length=428

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>ref|NP_004631.1| spliceosome RNA helicase DDX39B [Homo sapiens]
 ref|NP_542165.1| spliceosome RNA helicase DDX39B [Homo sapiens]
 ref|NP_001005157.1| spliceosome RNA helicase DDX39B [Sus scrofa]
 ref|NP_001040608.1| spliceosome RNA helicase DDX39B [Macaca mulatta]
 ref|NP_001107635.1| spliceosome RNA helicase DDX39B [Pan troglodytes]
 ref|XP_003768951.1| PREDICTED: spliceosome RNA helicase DDX39B [Sarcophilus harrisii]
 ref|XP_003831638.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2 [Pan paniscus]
 ref|XP_003831639.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2 [Pan paniscus]
 ref|XP_003897379.1| PREDICTED: spliceosome RNA helicase DDX39B [Papio anubis]
 ref|XP_004043682.1| PREDICTED: spliceosome RNA helicase DDX39B isoform 1 [Gorilla 
gorilla gorilla]
 ref|XP_004043683.1| PREDICTED: spliceosome RNA helicase DDX39B isoform 2 [Gorilla 
gorilla gorilla]
 ref|XP_004286665.1| PREDICTED: spliceosome RNA helicase DDX39B isoform 2 [Orcinus 
orca]
 ref|XP_004311275.1| PREDICTED: spliceosome RNA helicase DDX39B [Tursiops truncatus]
 ref|XP_004390786.1| PREDICTED: spliceosome RNA helicase DDX39B isoform 1 [Trichechus 
manatus latirostris]
 ref|XP_004424435.1| PREDICTED: spliceosome RNA helicase DDX39B isoform 1 [Ceratotherium 
simum simum]
 ref|XP_004424436.1| PREDICTED: spliceosome RNA helicase DDX39B isoform 2 [Ceratotherium 
simum simum]
 ref|XP_004695169.1| PREDICTED: spliceosome RNA helicase DDX39B [Condylura cristata]
 ref|XP_005603751.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X1 [Equus 
caballus]
 ref|XP_005603752.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2 [Equus 
caballus]
 ref|XP_005665850.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2 [Sus scrofa]
 ref|XP_005665851.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X3 [Sus scrofa]
 ref|XP_005859958.1| PREDICTED: spliceosome RNA helicase DDX39B [Myotis brandtii]
 ref|XP_006215372.1| PREDICTED: spliceosome RNA helicase DDX39B [Vicugna pacos]
 ref|XP_006772872.1| PREDICTED: spliceosome RNA helicase DDX39B [Myotis davidii]
 ref|XP_007110223.1| PREDICTED: spliceosome RNA helicase DDX39B [Physeter catodon]
 ref|XP_007194044.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X1 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007194045.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007459649.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2 [Lipotes 
vexillifer]
 ref|XP_007483596.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X1 [Monodelphis 
domestica]
 ref|XP_007483597.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2 [Monodelphis 
domestica]
 ref|XP_007949568.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X1 [Orycteropus 
afer afer]
 ref|XP_007949569.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X1 [Orycteropus 
afer afer]
 ref|XP_007971329.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X1 [Chlorocebus 
sabaeus]
 ref|XP_008155589.1| PREDICTED: spliceosome RNA helicase DDX39B [Eptesicus fuscus]
 ref|XP_008155590.1| PREDICTED: spliceosome RNA helicase DDX39B [Eptesicus fuscus]
 ref|XP_008588878.1| PREDICTED: spliceosome RNA helicase DDX39B [Galeopterus variegatus]
 ref|XP_008819773.1| PREDICTED: spliceosome RNA helicase DDX39B [Nannospalax galili]
 ref|XP_008955197.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2 [Pan paniscus]
 ref|XP_009239917.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X3 [Pongo 
abelii]
 ref|XP_009239918.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X3 [Pongo 
abelii]
 ref|XP_009239919.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X3 [Pongo 
abelii]
 ref|XP_009239921.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X3 [Pongo 
abelii]
 ref|XP_009239922.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X3 [Pongo 
abelii]
 ref|XP_010361040.1| PREDICTED: spliceosome RNA helicase DDX39B [Rhinopithecus roxellana]
 ref|XP_010361041.1| PREDICTED: spliceosome RNA helicase DDX39B [Rhinopithecus roxellana]
 ref|XP_010959841.1| PREDICTED: spliceosome RNA helicase DDX39B [Camelus bactrianus]
 sp|Q13838.1|DX39B_HUMAN RecName: Full=Spliceosome RNA helicase DDX39B; AltName: Full=56 
kDa U2AF65-associated protein; AltName: Full=ATP-dependent 
RNA helicase p47; AltName: Full=DEAD box protein UAP56; AltName: 
Full=HLA-B-associated transcript 1 protein [Homo sapiens]
 sp|P60024.1|DX39B_PANTR RecName: Full=Spliceosome RNA helicase DDX39B; AltName: Full=56 
kDa U2AF65-associated protein; AltName: Full=DEAD box protein 
UAP56 [Pan troglodytes]
 sp|Q29024.2|DX39B_PIG RecName: Full=Spliceosome RNA helicase DDX39B; AltName: Full=56 
kDa U2AF65-associated protein; AltName: Full=DEAD box protein 
UAP56 [Sus scrofa]
 sp|Q5RE47.1|DX39B_PONAB RecName: Full=Spliceosome RNA helicase DDX39B; AltName: Full=56 
kDa U2AF65-associated protein; AltName: Full=DEAD box protein 
UAP56 [Pongo abelii]
 sp|Q5TM17.1|DX39B_MACMU RecName: Full=Spliceosome RNA helicase DDX39B; AltName: Full=56 
kDa U2AF65-associated protein; AltName: Full=DEAD box protein 
UAP56 [Macaca mulatta]
 emb|CAA85523.1| nuclear RNA helicase (DEAD family) [Homo sapiens]
 emb|CAB63856.1| putative RNA helicase [Sus scrofa]
 gb|AAH00361.1| HLA-B associated transcript 1 [Homo sapiens]
 dbj|BAB63306.1| putative ATP-dependent RNA helicase [Homo sapiens]
 gb|AAH13006.1| HLA-B associated transcript 1 [Homo sapiens]
 dbj|BAB83886.1| BAT1 [Pan troglodytes]
 dbj|BAC54953.1| HLA-B associated transcript 1 [Homo sapiens]
 dbj|BAC78161.1| ATP-dependent RNA helicase [Pan troglodytes]
 gb|AAP88911.1| HLA-B associated transcript 1 [Homo sapiens]
 dbj|BAD69728.1| HLA-B associated transcript-1 [Macaca mulatta]
 emb|CAH89960.1| hypothetical protein [Pongo abelii]
 gb|AAX42257.1| HLA-B associated transcript 1 [synthetic construct]
 gb|AAX42258.1| HLA-B associated transcript 1 [synthetic construct]
 dbj|BAE78637.1| HLA-B associated transcript 1 [Homo sapiens]
 dbj|BAE91387.1| unnamed protein product [Macaca fascicularis]
 dbj|BAE92779.1| nuclear RNA helicase [Pan troglodytes]
 dbj|BAE92782.1| nuclear RNA helicase [Pan troglodytes]
 gb|EAX03404.1| hCG2005638, isoform CRA_a [Homo sapiens]
 gb|EAX03407.1| hCG2005638, isoform CRA_a [Homo sapiens]
 gb|EAX03408.1| hCG2005638, isoform CRA_a [Homo sapiens]
 gb|EAX03409.1| hCG2005638, isoform CRA_a [Homo sapiens]
 gb|EAX03410.1| hCG2005638, isoform CRA_a [Homo sapiens]
 gb|EAX03411.1| hCG2005638, isoform CRA_a [Homo sapiens]
 gb|EAX03413.1| hCG2005638, isoform CRA_a [Homo sapiens]
 gb|ABM82807.1| HLA-B associated transcript 1 [synthetic construct]
 gb|ABM85993.1| HLA-B associated transcript 1 [synthetic construct]
 gb|ABX82809.1| HLA-B-associated protein 1 [Sus scrofa]
 dbj|BAI46469.1| HLA-B associated transcript 1 [synthetic construct]
 dbj|BAI49420.1| HLA-B associated transcript 1 [Microcebus murinus]
Length=428

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>gb|ACN58701.1| ATP-dependent RNA helicase DDX39 [Salmo salar]
Length=422

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 127/151 (84%), Gaps = 1/151 (1%)
 Frame = +3

Query  156  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  335
            AP++ A     +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAIL
Sbjct  17   APET-ATPAGKKEVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAIL  75

Query  336  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  515
            GMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P
Sbjct  76   GMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTRELAFQISKEYERFSKYMP  135

Query  516  DIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
             +K AVF+GG++I   +D+LK  CPHIVVGT
Sbjct  136  TVKAAVFFGGLSIKKDEDVLKKNCPHIVVGT  166



>ref|XP_006821292.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2 [Saccoglossus 
kowalevskii]
Length=441

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAIL MDV+CQAKSG
Sbjct  35   KDVKGNYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILSMDVLCQAKSG  94

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQIEPV GQV+ LVLCHTRELA+QI  E+ERFS Y+P IKV VF+GG+
Sbjct  95   MGKTAVFVLATLQQIEPVDGQVSVLVLCHTRELAFQIAKEYERFSKYMPTIKVGVFFGGI  154

Query  549  NITIHKDLLKNECPHIVVGT  608
            NI   +  LKN CPHIVVGT
Sbjct  155  NIKKDEQTLKNNCPHIVVGT  174



>ref|XP_006875676.1| PREDICTED: spliceosome RNA helicase DDX39B [Chrysochloris asiatica]
Length=428

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>ref|XP_003985959.1| PREDICTED: spliceosome RNA helicase DDX39B [Felis catus]
 ref|XP_004415273.1| PREDICTED: spliceosome RNA helicase DDX39B isoform 2 [Odobenus 
rosmarus divergens]
 ref|XP_004598780.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X1 [Ochotona 
princeps]
 ref|XP_004598781.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2 [Ochotona 
princeps]
 ref|XP_011215034.1| PREDICTED: spliceosome RNA helicase DDX39B [Ailuropoda melanoleuca]
Length=428

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>ref|XP_004624380.1| PREDICTED: spliceosome RNA helicase DDX39B [Octodon degus]
Length=428

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>gb|AIC55357.1| hypothetical protein, partial [synthetic construct]
Length=428

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>ref|XP_003474035.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X1 [Cavia 
porcellus]
 ref|XP_005005547.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2 [Cavia 
porcellus]
 ref|XP_010608141.1| PREDICTED: spliceosome RNA helicase DDX39B [Fukomys damarensis]
Length=428

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>gb|AAL98920.1| Bat1 [Rattus norvegicus]
Length=428

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>ref|XP_003443119.1| PREDICTED: ATP-dependent RNA helicase DDX39A-like [Oreochromis 
niloticus]
 ref|XP_004562993.1| PREDICTED: ATP-dependent RNA helicase DDX39A-like [Maylandia 
zebra]
 ref|XP_005738104.1| PREDICTED: ATP-dependent RNA helicase DDX39A-like [Pundamilia 
nyererei]
 ref|XP_005926773.1| PREDICTED: ATP-dependent RNA helicase DDX39A-like [Haplochromis 
burtoni]
 ref|XP_006805133.1| PREDICTED: ATP-dependent RNA helicase DDX39A-like [Neolamprologus 
brichardi]
Length=427

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 126/151 (83%), Gaps = 1/151 (1%)
 Frame = +3

Query  156  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  335
            AP+S A     +  K  Y+ IHSSGFRDFLLKPELLRAI+D GFEHPSEVQHECIPQAIL
Sbjct  22   APES-ATPAGKKEVKGSYVSIHSSGFRDFLLKPELLRAIIDCGFEHPSEVQHECIPQAIL  80

Query  336  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  515
            GMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P
Sbjct  81   GMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTRELAFQISKEYERFSKYMP  140

Query  516  DIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
             IK AVF+GG+ I   +D+LK  CPHIVVGT
Sbjct  141  TIKAAVFFGGLPIKKDEDVLKKNCPHIVVGT  171



>ref|XP_006161075.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Tupaia chinensis]
Length=427

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +3

Query  153  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  332
            +AP         +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPPESTPAPPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  333  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  512
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEPV GQV  LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYM  139

Query  513  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
            P +KV+VF+GG++I   +D+LK  CPH+VVGT
Sbjct  140  PSVKVSVFFGGLSIKKDEDVLKKNCPHVVVGT  171



>ref|XP_005339077.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X1 [Ictidomys 
tridecemlineatus]
Length=428

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  368
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  369  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  548
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  549  NITIHKDLLKNECPHIVVGT  608
            +I   +++LK  CPHIVVGT
Sbjct  153  SIKKDEEVLKKNCPHIVVGT  172



>ref|XP_010744670.1| PREDICTED: ATP-dependent RNA helicase DDX39A-like isoform X2 
[Larimichthys crocea]
Length=429

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 127/151 (84%), Gaps = 1/151 (1%)
 Frame = +3

Query  156  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  335
            AP+S AA    +  K  Y+ IHSSGFRDFLLKPELLRAI+D GFEHPSEVQHECIPQAIL
Sbjct  22   APES-AAPAGKKEVKGSYVSIHSSGFRDFLLKPELLRAIIDCGFEHPSEVQHECIPQAIL  80

Query  336  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  515
            GMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P
Sbjct  81   GMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTRELAFQISKEYERFSKYMP  140

Query  516  DIKVAVFYGGVNITIHKDLLKNECPHIVVGT  608
             +K AVF+GG+ I   +++LK  CPHIVVGT
Sbjct  141  TVKAAVFFGGLAIKKDEEVLKKNCPHIVVGT  171



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230