BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS009A06

Length=613
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004243472.1|  PREDICTED: aconitate hydratase, cytoplasmic        154   4e-39   Solanum lycopersicum
ref|XP_006366590.1|  PREDICTED: aconitate hydratase 2, mitochondr...    154   4e-39   Solanum tuberosum [potatoes]
dbj|BAG16527.1|  putative aconitase                                     149   2e-37   Capsicum chinense [bonnet pepper]
ref|XP_009770911.1|  PREDICTED: aconitate hydratase, cytoplasmic        149   2e-37   Nicotiana sylvestris
gb|KDP22711.1|  hypothetical protein JCGZ_01813                         148   3e-37   Jatropha curcas
ref|XP_006376779.1|  aconitate hydratase family protein                 148   4e-37   Populus trichocarpa [western balsam poplar]
ref|XP_002524184.1|  aconitase, putative                                145   4e-36   Ricinus communis
ref|XP_011048785.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    145   5e-36   Populus euphratica
ref|XP_011047264.1|  PREDICTED: aconitate hydratase, cytoplasmic        145   6e-36   Populus euphratica
ref|XP_009601350.1|  PREDICTED: aconitate hydratase, cytoplasmic        144   7e-36   Nicotiana tomentosiformis
ref|XP_010276105.1|  PREDICTED: aconitate hydratase, cytoplasmic        144   1e-35   Nelumbo nucifera [Indian lotus]
emb|CDP10817.1|  unnamed protein product                                144   1e-35   Coffea canephora [robusta coffee]
ref|XP_011095404.1|  PREDICTED: putative aconitate hydratase, cyt...    143   2e-35   Sesamum indicum [beniseed]
emb|CDP05740.1|  unnamed protein product                                142   5e-35   Coffea canephora [robusta coffee]
ref|XP_002321126.2|  hypothetical protein POPTR_0014s15170g             141   8e-35   Populus trichocarpa [western balsam poplar]
gb|KDO62733.1|  hypothetical protein CISIN_1g001863mg                   138   9e-34   Citrus sinensis [apfelsine]
ref|XP_006452377.1|  hypothetical protein CICLE_v10007338mg             138   1e-33   Citrus clementina [clementine]
ref|XP_010046497.1|  PREDICTED: aconitate hydratase, cytoplasmic        138   1e-33   Eucalyptus grandis [rose gum]
gb|EPS60517.1|  hypothetical protein M569_14286                         136   6e-33   Genlisea aurea
ref|XP_006351962.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    134   3e-32   Solanum tuberosum [potatoes]
gb|KDO54659.1|  hypothetical protein CISIN_1g001917mg                   133   6e-32   Citrus sinensis [apfelsine]
gb|KDO54661.1|  hypothetical protein CISIN_1g001917mg                   133   6e-32   Citrus sinensis [apfelsine]
ref|XP_006447556.1|  hypothetical protein CICLE_v10014140mg             133   6e-32   
gb|KDO54656.1|  hypothetical protein CISIN_1g001917mg                   133   6e-32   Citrus sinensis [apfelsine]
gb|KDO54657.1|  hypothetical protein CISIN_1g001917mg                   133   6e-32   Citrus sinensis [apfelsine]
gb|KDO54660.1|  hypothetical protein CISIN_1g001917mg                   133   6e-32   Citrus sinensis [apfelsine]
ref|XP_006447555.1|  hypothetical protein CICLE_v10014140mg             133   7e-32   Citrus clementina [clementine]
ref|XP_009598331.1|  PREDICTED: aconitate hydratase 2, mitochondr...    132   1e-31   Nicotiana tomentosiformis
ref|XP_009598330.1|  PREDICTED: aconitate hydratase, cytoplasmic ...    132   2e-31   Nicotiana tomentosiformis
ref|XP_010278679.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    130   5e-31   Nelumbo nucifera [Indian lotus]
ref|XP_002278138.1|  PREDICTED: aconitate hydratase, cytoplasmic        129   2e-30   Vitis vinifera
gb|EYU27339.1|  hypothetical protein MIMGU_mgv1a000710mg                129   2e-30   Erythranthe guttata [common monkey flower]
ref|XP_009787326.1|  PREDICTED: aconitate hydratase 2, mitochondr...    126   1e-29   Nicotiana sylvestris
ref|XP_009787319.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    126   1e-29   Nicotiana sylvestris
ref|XP_003543388.1|  PREDICTED: aconitate hydratase 2, mitochondr...    124   9e-29   Glycine max [soybeans]
gb|KJB60837.1|  hypothetical protein B456_009G327800                    123   1e-28   Gossypium raimondii
gb|KJB60836.1|  hypothetical protein B456_009G327800                    123   1e-28   Gossypium raimondii
gb|KJB60835.1|  hypothetical protein B456_009G327800                    123   2e-28   Gossypium raimondii
ref|XP_007045642.1|  Aconitase 3                                        123   2e-28   
gb|KHN36531.1|  Aconitate hydratase, cytoplasmic                        123   2e-28   Glycine soja [wild soybean]
ref|XP_004251517.2|  PREDICTED: aconitate hydratase, cytoplasmic        121   1e-27   Solanum lycopersicum
ref|XP_006346211.1|  PREDICTED: aconitate hydratase 2, mitochondr...    120   2e-27   Solanum tuberosum [potatoes]
gb|KJB50479.1|  hypothetical protein B456_008G173400                    120   2e-27   Gossypium raimondii
ref|XP_003540302.1|  PREDICTED: aconitate hydratase 2, mitochondr...    120   2e-27   Glycine max [soybeans]
gb|KHG15607.1|  Aconitate hydratase 2, mitochondrial -like protein      117   1e-26   Gossypium arboreum [tree cotton]
gb|EYU24785.1|  hypothetical protein MIMGU_mgv1a000742mg                118   1e-26   Erythranthe guttata [common monkey flower]
gb|KDP39136.1|  hypothetical protein JCGZ_00893                         118   1e-26   Jatropha curcas
ref|XP_007149973.1|  hypothetical protein PHAVU_005G115100g             117   2e-26   Phaseolus vulgaris [French bean]
ref|XP_011100304.1|  PREDICTED: aconitate hydratase, cytoplasmic        117   3e-26   Sesamum indicum [beniseed]
gb|KHG18502.1|  Aconitate hydratase 2, mitochondrial -like protein      116   5e-26   Gossypium arboreum [tree cotton]
gb|KJB62848.1|  hypothetical protein B456_009G440000                    116   5e-26   Gossypium raimondii
ref|XP_010445106.1|  PREDICTED: aconitate hydratase 3, mitochondr...    113   5e-26   
gb|KJB62847.1|  hypothetical protein B456_009G440000                    116   5e-26   Gossypium raimondii
ref|XP_010448188.1|  PREDICTED: aconitate hydratase 3, mitochondr...    116   6e-26   Camelina sativa [gold-of-pleasure]
ref|XP_006283068.1|  hypothetical protein CARUB_v10004061mg             115   7e-26   Capsella rubella
ref|XP_003596988.1|  Aconitate hydratase                                115   1e-25   Medicago truncatula
ref|XP_004159202.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    115   1e-25   
ref|XP_008379632.1|  PREDICTED: aconitate hydratase, cytoplasmic        115   1e-25   
ref|XP_008455442.1|  PREDICTED: aconitate hydratase, cytoplasmic        115   1e-25   Cucumis melo [Oriental melon]
ref|XP_002869584.1|  hypothetical protein ARALYDRAFT_492099             114   2e-25   
ref|NP_567763.2|  aconitase 2                                           114   2e-25   Arabidopsis thaliana [mouse-ear cress]
gb|AAK91447.1|  AT4g26970/F10M23_310                                    114   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009353280.1|  PREDICTED: aconitate hydratase, cytoplasmic        114   2e-25   Pyrus x bretschneideri [bai li]
ref|XP_004144496.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    114   3e-25   Cucumis sativus [cucumbers]
ref|XP_009599619.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    114   3e-25   Nicotiana tomentosiformis
ref|XP_009769027.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    113   5e-25   Nicotiana sylvestris
ref|XP_003527493.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    113   6e-25   Glycine max [soybeans]
ref|XP_003539865.1|  PREDICTED: aconitate hydratase 2, mitochondr...    113   7e-25   Glycine max [soybeans]
ref|XP_006592372.1|  PREDICTED: aconitate hydratase 2, mitochondr...    112   7e-25   Glycine max [soybeans]
ref|XP_006413121.1|  hypothetical protein EUTSA_v10024309mg             112   1e-24   Eutrema salsugineum [saltwater cress]
ref|XP_010433420.1|  PREDICTED: aconitate hydratase 3, mitochondrial    111   2e-24   Camelina sativa [gold-of-pleasure]
gb|KJB30569.1|  hypothetical protein B456_005G149700                    111   3e-24   Gossypium raimondii
gb|KJB30566.1|  hypothetical protein B456_005G149700                    111   3e-24   Gossypium raimondii
ref|XP_004487412.1|  PREDICTED: aconitate hydratase 2, mitochondr...    110   4e-24   Cicer arietinum [garbanzo]
emb|CDY66424.1|  BnaAnng22230D                                          110   4e-24   Brassica napus [oilseed rape]
emb|CDY14291.1|  BnaA08g14220D                                          110   4e-24   Brassica napus [oilseed rape]
gb|KHG08190.1|  Aconitate hydratase 2, mitochondrial                    109   9e-24   Gossypium arboreum [tree cotton]
ref|XP_009109156.1|  PREDICTED: aconitate hydratase 3, mitochondrial    109   1e-23   Brassica rapa
ref|XP_008230066.1|  PREDICTED: aconitate hydratase, cytoplasmic        109   1e-23   Prunus mume [ume]
ref|XP_007217144.1|  hypothetical protein PRUPE_ppa000812mg             108   2e-23   Prunus persica
ref|XP_008342002.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    108   3e-23   
ref|XP_010675721.1|  PREDICTED: putative aconitate hydratase, cyt...    108   4e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010488774.1|  PREDICTED: aconitate hydratase 2, mitochondrial    107   5e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010467089.1|  PREDICTED: aconitate hydratase 2, mitochondr...    107   5e-23   Camelina sativa [gold-of-pleasure]
gb|KFK29204.1|  hypothetical protein AALP_AA7G102800                    106   1e-22   Arabis alpina [alpine rockcress]
ref|XP_002883704.1|  hypothetical protein ARALYDRAFT_480186             106   2e-22   
ref|XP_010412716.1|  PREDICTED: aconitate hydratase 2, mitochondr...    105   4e-22   
ref|XP_010929878.1|  PREDICTED: putative aconitate hydratase, cyt...    104   5e-22   Elaeis guineensis
emb|CDY50945.1|  BnaC03g74450D                                          103   1e-21   Brassica napus [oilseed rape]
ref|XP_010443085.1|  PREDICTED: aconitate hydratase 3, mitochondr...    103   2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_006296904.1|  hypothetical protein CARUB_v10012896mg             102   2e-21   Capsella rubella
ref|XP_008804304.1|  PREDICTED: putative aconitate hydratase, cyt...    101   5e-21   Phoenix dactylifera
gb|KFK39331.1|  hypothetical protein AALP_AA3G230700                    101   5e-21   Arabis alpina [alpine rockcress]
gb|KHG02134.1|  hypothetical protein F383_25649                         101   5e-21   Gossypium arboreum [tree cotton]
ref|XP_009148490.1|  PREDICTED: aconitate hydratase 2, mitochondrial    101   9e-21   Brassica rapa
emb|CDX97969.1|  BnaA06g07200D                                          100   9e-21   
ref|XP_009136177.1|  PREDICTED: aconitate hydratase 2, mitochondrial    100   9e-21   Brassica rapa
emb|CDY18054.1|  BnaC07g04160D                                        99.8    3e-20   Brassica napus [oilseed rape]
ref|XP_003605929.1|  Aconitate hydratase                              99.4    3e-20   Medicago truncatula
ref|XP_010450391.1|  PREDICTED: aconitate hydratase 2, mitochondr...  99.4    4e-20   Camelina sativa [gold-of-pleasure]
ref|NP_178634.2|  aconitate hydratase 3                               99.0    5e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396145.1|  hypothetical protein EUTSA_v10002387mg           98.2    9e-20   Eutrema salsugineum [saltwater cress]
emb|CDX93088.1|  BnaA03g38100D                                        97.4    1e-19   
ref|XP_010440740.1|  PREDICTED: aconitate hydratase 2, mitochondr...  96.7    3e-19   Camelina sativa [gold-of-pleasure]
ref|XP_002279260.1|  PREDICTED: aconitate hydratase, cytoplasmic      96.3    4e-19   Vitis vinifera
ref|XP_002870438.1|  predicted protein                                95.9    5e-19   Arabidopsis lyrata subsp. lyrata
emb|CDY56501.1|  BnaAnng14360D                                        95.9    5e-19   Brassica napus [oilseed rape]
ref|XP_007132546.1|  hypothetical protein PHAVU_011G1037001g          94.7    1e-18   Phaseolus vulgaris [French bean]
ref|XP_004287944.1|  PREDICTED: aconitate hydratase, cytoplasmic      94.4    2e-18   Fragaria vesca subsp. vesca
ref|XP_010533007.1|  PREDICTED: aconitate hydratase, cytoplasmic ...  94.0    2e-18   Tarenaya hassleriana [spider flower]
ref|XP_002532564.1|  aconitase, putative                              94.0    2e-18   
ref|XP_004517086.1|  PREDICTED: aconitate hydratase 2, mitochondr...  93.2    5e-18   Cicer arietinum [garbanzo]
ref|XP_010482909.1|  PREDICTED: putative aconitate hydratase, cyt...  91.3    2e-17   
ref|XP_008800034.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  89.0    1e-16   Phoenix dactylifera
ref|XP_010943467.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  88.2    2e-16   Elaeis guineensis
ref|XP_010918136.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  88.2    2e-16   Elaeis guineensis
ref|XP_008785050.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  87.0    5e-16   Phoenix dactylifera
ref|XP_009419582.1|  PREDICTED: putative aconitate hydratase, cyt...  86.3    9e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399225.1|  PREDICTED: putative aconitate hydratase, cyt...  83.2    1e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006828850.1|  hypothetical protein AMTR_s00001p00156400        81.6    3e-14   Amborella trichopoda
ref|XP_009382046.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  79.0    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC83022.1|  hypothetical protein OsI_28099                        77.4    3e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_007020811.1|  Aconitase 3                                      78.6    3e-13   
ref|XP_004974379.1|  PREDICTED: putative aconitate hydratase, cyt...  78.2    4e-13   
ref|XP_008676648.1|  PREDICTED: uncharacterized protein LOC100216...  77.8    5e-13   
ref|XP_009384004.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  77.4    8e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002445174.1|  hypothetical protein SORBIDRAFT_07g005390        76.6    1e-12   Sorghum bicolor [broomcorn]
gb|AAD25640.1|  cytoplasmic aconitate hydratase                       74.7    5e-12   Arabidopsis thaliana [mouse-ear cress]
gb|AAP30039.1|  aconitase                                             72.4    3e-11   Solanum pennellii
gb|AAO62410.1|  aconitase                                             72.0    4e-11   Solanum pennellii
gb|AAG28426.1|AF194945_1  cytosolic aconitase                         71.2    7e-11   Nicotiana tabacum [American tobacco]
ref|XP_003573387.2|  PREDICTED: putative aconitate hydratase, cyt...  69.7    2e-10   Brachypodium distachyon [annual false brome]
gb|AAC26045.1|  aconitase-iron regulated protein 1                    68.6    5e-10   Citrus limon [lemon]
gb|KJB30565.1|  hypothetical protein B456_005G149700                  68.6    5e-10   Gossypium raimondii
emb|CBE71057.1|  aconitate hydratase 3                                68.6    6e-10   Citrus clementina [clementine]
gb|ADM34980.1|  cytosolic aconitase                                   68.2    6e-10   Pyrus pyrifolia [sha li]
sp|Q6YZX6.1|ACOC_ORYSJ  RecName: Full=Putative aconitate hydratas...  67.8    1e-09   Oryza sativa Japonica Group [Japonica rice]
gb|KHN41224.1|  Aconitate hydratase, cytoplasmic                      67.4    1e-09   Glycine soja [wild soybean]
gb|KHG08189.1|  hypothetical protein F383_11434                       66.6    2e-09   Gossypium arboreum [tree cotton]
emb|CBE71058.1|  aconitate hydratase 2                                66.2    3e-09   Citrus clementina [clementine]
sp|P49608.1|ACOC_CUCMA  RecName: Full=Aconitate hydratase, cytopl...  65.9    4e-09   Cucurbita maxima [Boston marrow]
ref|XP_011097878.1|  PREDICTED: putative aconitate hydratase, cyt...  65.5    6e-09   
ref|XP_010100637.1|  Aconitate hydratase                              63.5    2e-08   
ref|XP_008363093.1|  PREDICTED: aconitate hydratase 1-like            58.9    3e-08   
ref|XP_004287770.1|  PREDICTED: aconitate hydratase 1                 62.8    4e-08   Fragaria vesca subsp. vesca
gb|KFK30197.1|  hypothetical protein AALP_AA7G230700                  62.0    6e-08   Arabis alpina [alpine rockcress]
dbj|BAJ85661.1|  predicted protein                                    62.0    6e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007020807.1|  Aconitase 3                                      61.6    8e-08   
ref|XP_006413195.1|  hypothetical protein EUTSA_v10024325mg           61.6    9e-08   
emb|CAA58046.1|  aconitase                                            61.6    9e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CAB36543.1|  putative aconitase                                   61.2    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007046597.1|  Aconitase 1                                      60.8    1e-07   
gb|KDO71343.1|  hypothetical protein CISIN_1g002610mg                 60.8    2e-07   Citrus sinensis [apfelsine]
emb|CBE71056.1|  aconitate hydratase 1                                60.5    2e-07   Citrus clementina [clementine]
ref|XP_006467022.1|  PREDICTED: aconitate hydratase 1                 60.5    2e-07   Citrus sinensis [apfelsine]
gb|KDO71342.1|  hypothetical protein CISIN_1g002610mg                 60.5    2e-07   Citrus sinensis [apfelsine]
gb|KDO71345.1|  hypothetical protein CISIN_1g002610mg                 60.5    2e-07   Citrus sinensis [apfelsine]
gb|KDO71344.1|  hypothetical protein CISIN_1g002610mg                 60.5    2e-07   Citrus sinensis [apfelsine]
emb|CDX69174.1|  BnaC01g02790D                                        60.5    2e-07   
ref|XP_009109264.1|  PREDICTED: aconitate hydratase 1-like            60.1    3e-07   Brassica rapa
ref|XP_008242011.1|  PREDICTED: aconitate hydratase 1                 60.1    3e-07   Prunus mume [ume]
ref|XP_007203240.1|  hypothetical protein PRUPE_ppa001138mg           60.1    3e-07   Prunus persica
gb|AAL13084.1|  putative aconitase                                    60.1    3e-07   Prunus avium [gean]
ref|NP_195308.1|  aconitate hydratase 1                               59.7    3e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010446873.1|  PREDICTED: aconitate hydratase 1                 59.7    3e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010437416.1|  PREDICTED: aconitate hydratase 1-like            59.7    3e-07   Camelina sativa [gold-of-pleasure]
ref|XP_006285963.1|  hypothetical protein CARUB_v10007484mg           59.7    3e-07   Capsella rubella
ref|XP_009363442.1|  PREDICTED: aconitate hydratase 1-like            59.7    3e-07   Pyrus x bretschneideri [bai li]
ref|XP_009337075.1|  PREDICTED: aconitate hydratase 1-like            59.7    3e-07   Pyrus x bretschneideri [bai li]
ref|XP_008337967.1|  PREDICTED: aconitate hydratase 1                 59.7    3e-07   
ref|XP_010526818.1|  PREDICTED: aconitate hydratase 1                 59.7    3e-07   Tarenaya hassleriana [spider flower]
ref|XP_009344825.1|  PREDICTED: aconitate hydratase 1                 59.7    3e-07   Pyrus x bretschneideri [bai li]
ref|XP_009150005.1|  PREDICTED: aconitate hydratase 1                 59.7    3e-07   Brassica rapa
ref|XP_002445994.1|  hypothetical protein SORBIDRAFT_06g000200        55.8    4e-07   
ref|XP_006425366.1|  hypothetical protein CICLE_v10024840mg           59.7    4e-07   Citrus clementina [clementine]
gb|KDO71346.1|  hypothetical protein CISIN_1g002610mg                 59.3    4e-07   Citrus sinensis [apfelsine]
ref|XP_002460765.1|  hypothetical protein SORBIDRAFT_02g034590        59.3    5e-07   Sorghum bicolor [broomcorn]
ref|XP_006412056.1|  hypothetical protein EUTSA_v10024358mg           58.5    8e-07   Eutrema salsugineum [saltwater cress]
gb|KHN41868.1|  Aconitate hydratase 1                                 58.5    8e-07   Glycine soja [wild soybean]
ref|XP_010432222.1|  PREDICTED: aconitate hydratase 1-like            58.5    9e-07   Camelina sativa [gold-of-pleasure]
ref|XP_006412054.1|  hypothetical protein EUTSA_v10024358mg           58.2    1e-06   
gb|KDP23953.1|  hypothetical protein JCGZ_25341                       57.8    2e-06   Jatropha curcas
emb|CDY41626.1|  BnaC03g62580D                                        57.4    2e-06   Brassica napus [oilseed rape]
ref|XP_010113288.1|  Aconitate hydratase 1                            57.4    2e-06   
ref|XP_008669746.1|  PREDICTED: putative aconitate hydratase, cyt...  57.4    2e-06   Zea mays [maize]
gb|AES61065.2|  cytoplasmic-like aconitate hydratase                  57.0    2e-06   Medicago truncatula
ref|XP_002867051.1|  aconitate hydratase, cytoplasmic                 57.0    2e-06   
gb|EMS45933.1|  Putative aconitate hydratase, cytoplasmic             57.0    2e-06   Triticum urartu
gb|KJB48278.1|  hypothetical protein B456_008G061900                  57.0    3e-06   Gossypium raimondii
gb|KHG25175.1|  Aconitate hydratase, cytoplasmic                      57.0    3e-06   Gossypium arboreum [tree cotton]
gb|KHG25176.1|  Aconitate hydratase, cytoplasmic                      57.0    3e-06   Gossypium arboreum [tree cotton]
emb|CDX75532.1|  BnaA01g01700D                                        56.6    3e-06   
ref|XP_002263337.1|  PREDICTED: aconitate hydratase 1                 56.2    4e-06   Vitis vinifera
ref|XP_003517155.1|  PREDICTED: aconitate hydratase 1                 56.2    4e-06   Glycine max [soybeans]
ref|XP_006380559.1|  hypothetical protein POPTR_0007s09260g           56.2    4e-06   Populus trichocarpa [western balsam poplar]
ref|XP_007157870.1|  hypothetical protein PHAVU_002G105000g           56.2    5e-06   Phaseolus vulgaris [French bean]
ref|XP_003537655.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  55.5    7e-06   Glycine max [soybeans]
ref|XP_010266897.1|  PREDICTED: aconitate hydratase 1                 55.5    8e-06   Nelumbo nucifera [Indian lotus]
ref|XP_008669747.1|  PREDICTED: putative aconitate hydratase, cyt...  55.5    8e-06   Zea mays [maize]
gb|EMT33022.1|  Putative aconitate hydratase, cytoplasmic             55.5    9e-06   
ref|XP_008670445.1|  PREDICTED: putative aconitate hydratase, cyt...  55.1    1e-05   Zea mays [maize]
ref|XP_008670444.1|  PREDICTED: putative aconitate hydratase, cyt...  55.1    1e-05   Zea mays [maize]
ref|XP_006383042.1|  aconitate hydratase family protein               55.1    1e-05   Populus trichocarpa [western balsam poplar]
ref|XP_011022256.1|  PREDICTED: aconitate hydratase 1                 55.1    1e-05   Populus euphratica
ref|NP_001147431.1|  aconitase2                                       55.1    1e-05   Zea mays [maize]
ref|XP_008440877.1|  PREDICTED: aconitate hydratase                   54.7    2e-05   Cucumis melo [Oriental melon]
emb|CBI24446.3|  unnamed protein product                              54.7    2e-05   Vitis vinifera
ref|XP_001779205.1|  predicted protein                                54.3    2e-05   
gb|KJB17578.1|  hypothetical protein B456_003G006000                  53.9    2e-05   Gossypium raimondii
ref|XP_008661884.1|  PREDICTED: aconitase2 isoform X1                 54.3    2e-05   
ref|NP_001048898.1|  Os03g0136900                                     53.5    3e-05   
gb|EEC74472.1|  hypothetical protein OsI_09921                        53.5    3e-05   Oryza sativa Indica Group [Indian rice]
gb|KCW56576.1|  hypothetical protein EUGRSUZ_I02307                   53.5    3e-05   Eucalyptus grandis [rose gum]
ref|XP_010029634.1|  PREDICTED: aconitate hydratase 1                 53.5    3e-05   Eucalyptus grandis [rose gum]
ref|XP_004985790.1|  PREDICTED: putative aconitate hydratase, cyt...  53.5    4e-05   Setaria italica
emb|CDY24823.1|  BnaA08g14870D                                        53.5    4e-05   Brassica napus [oilseed rape]
ref|XP_010529315.1|  PREDICTED: aconitate hydratase 1-like            53.5    4e-05   Tarenaya hassleriana [spider flower]
ref|XP_003612247.1|  Aconitate hydratase                              53.5    4e-05   Medicago truncatula
dbj|BAJ92965.1|  predicted protein                                    53.1    5e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004512178.1|  PREDICTED: aconitate hydratase 1-like            53.1    5e-05   Cicer arietinum [garbanzo]
ref|XP_010033531.1|  PREDICTED: aconitate hydratase 1-like            52.8    6e-05   Eucalyptus grandis [rose gum]
ref|XP_003590814.1|  Aconitate hydratase                              52.4    8e-05   
emb|CAN83844.1|  hypothetical protein VITISV_003004                   52.4    9e-05   Vitis vinifera
ref|XP_008658754.1|  PREDICTED: uncharacterized protein LOC100304...  52.4    1e-04   
ref|XP_002530635.1|  aconitase, putative                              51.2    2e-04   Ricinus communis
gb|KCW53221.1|  hypothetical protein EUGRSUZ_J02488                   51.2    2e-04   Eucalyptus grandis [rose gum]
ref|XP_004166975.1|  PREDICTED: aconitate hydratase 1-like            50.8    2e-04   
ref|XP_003558862.1|  PREDICTED: putative aconitate hydratase, cyt...  51.2    2e-04   Brachypodium distachyon [annual false brome]
ref|XP_004134842.1|  PREDICTED: aconitate hydratase 1-like            50.8    3e-04   Cucumis sativus [cucumbers]
gb|KGN48958.1|  Aconitase                                             50.8    3e-04   Cucumis sativus [cucumbers]
ref|XP_002976825.1|  hypothetical protein SELMODRAFT_443331           50.4    4e-04   
ref|XP_002980554.1|  hypothetical protein SELMODRAFT_444572           50.4    4e-04   
ref|XP_002465901.1|  hypothetical protein SORBIDRAFT_01g047850        50.1    5e-04   Sorghum bicolor [broomcorn]
gb|EMT24311.1|  Putative aconitate hydratase, cytoplasmic             50.1    6e-04   



>ref|XP_004243472.1| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=995

 Score =   154 bits (388),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +1

Query  370  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  549
            ++S  RSLRCSVPRWSHGVDWKSP SLTAQIR+AAP LN FHRK+ATMA+ENPFKGI T 
Sbjct  51   YSSTLRSLRCSVPRWSHGVDWKSPISLTAQIRTAAPALNGFHRKLATMAAENPFKGILTG  110

Query  550  LPKPGGGEFGKFYSLPALNDP  612
            LPKPGGGEFGKFYSLPALNDP
Sbjct  111  LPKPGGGEFGKFYSLPALNDP  131



>ref|XP_006366590.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=997

 Score =   154 bits (388),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +1

Query  370  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  549
            ++S  RSLRCSVPRWSHGVDWKSP SLTAQIR+AAP LN FHRK+ATMA+ENPFKGI T 
Sbjct  53   YSSTLRSLRCSVPRWSHGVDWKSPISLTAQIRTAAPALNGFHRKLATMAAENPFKGILTG  112

Query  550  LPKPGGGEFGKFYSLPALNDP  612
            LPKPGGGEFGKFYSLPALNDP
Sbjct  113  LPKPGGGEFGKFYSLPALNDP  133



>dbj|BAG16527.1| putative aconitase [Capsicum chinense]
Length=995

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R   ++S  RSL CSV RWSHGVDWKSP SLTAQIR+AAP LN FHRK+ATMA+ENPFKG
Sbjct  47   RCYYYSSTLRSLGCSVTRWSHGVDWKSPISLTAQIRTAAPALNSFHRKLATMAAENPFKG  106

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            I T+LPKPGGGEFGKFYSLPALNDP
Sbjct  107  ILTALPKPGGGEFGKFYSLPALNDP  131



>ref|XP_009770911.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana sylvestris]
Length=996

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +1

Query  370  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  549
            F+S FRS+RCSVPRWSHG+DWKSP SLTAQIR+AAP LN FHRK++TMA +NPFK I T+
Sbjct  52   FSSTFRSVRCSVPRWSHGIDWKSPISLTAQIRTAAPALNSFHRKLSTMAEKNPFKEILTA  111

Query  550  LPKPGGGEFGKFYSLPALNDP  612
            LPKPGGGEFGKFYSLPALNDP
Sbjct  112  LPKPGGGEFGKFYSLPALNDP  132



>gb|KDP22711.1| hypothetical protein JCGZ_01813 [Jatropha curcas]
Length=998

 Score =   148 bits (374),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R L+F +A RS RCSVPRWSHGVDW+SP SL +QIRSAAPV+  F RKIATMA+E+PFKG
Sbjct  50   RSLSFTAAVRSFRCSVPRWSHGVDWRSPVSLRSQIRSAAPVIEQFQRKIATMAAEHPFKG  109

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            I T+LPKPGGGEFGKFYSLPALNDP
Sbjct  110  IVTALPKPGGGEFGKFYSLPALNDP  134



>ref|XP_006376779.1| aconitate hydratase family protein [Populus trichocarpa]
 gb|ERP54576.1| aconitate hydratase family protein [Populus trichocarpa]
Length=995

 Score =   148 bits (373),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R L+F+SA RSLRCS PRWSHGVDW+SPA+L  QIR+ APV+  F RKIATMA E+PFKG
Sbjct  47   RSLSFSSAVRSLRCSYPRWSHGVDWRSPATLRHQIRAVAPVVERFQRKIATMAHEHPFKG  106

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            IFTSLPKPGGGEFGKFYSLPALNDP
Sbjct  107  IFTSLPKPGGGEFGKFYSLPALNDP  131



>ref|XP_002524184.1| aconitase, putative [Ricinus communis]
 gb|EEF38199.1| aconitase, putative [Ricinus communis]
Length=997

 Score =   145 bits (366),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R L+F++A RSLRCSVPRWSHGVDW+SP SL +QIR+A+PV+  F RKI+TMA+E+PFKG
Sbjct  48   RSLSFSAAVRSLRCSVPRWSHGVDWRSPVSLRSQIRTASPVIERFQRKISTMAAEHPFKG  107

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            I T LPKPGGGEFGKFYSLPALNDP
Sbjct  108  IVTPLPKPGGGEFGKFYSLPALNDP  132



>ref|XP_011048785.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Populus euphratica]
Length=995

 Score =   145 bits (365),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R  +F SA RSLRCS PRWSHGVDW+SPA+L  QIR+ APV+  F RKIATMA E+PFKG
Sbjct  47   RSSSFTSAVRSLRCSYPRWSHGVDWRSPATLRHQIRAVAPVVERFQRKIATMAHEHPFKG  106

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            IFTSLPKPGGGEFGKFYSLPALNDP
Sbjct  107  IFTSLPKPGGGEFGKFYSLPALNDP  131



>ref|XP_011047264.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047265.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047266.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
Length=1001

 Score =   145 bits (365),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R L+F+SAFRSLRCS PRWSHGVDW+SPA+L  QIR+ +P +  F RKIATM  E+PFKG
Sbjct  53   RSLSFSSAFRSLRCSYPRWSHGVDWRSPATLRHQIRAVSPFVERFQRKIATMVPEHPFKG  112

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            IFTSLPKPGGGEFGKFYSLPALNDP
Sbjct  113  IFTSLPKPGGGEFGKFYSLPALNDP  137



>ref|XP_009601350.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana tomentosiformis]
Length=997

 Score =   144 bits (364),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +1

Query  370  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  549
            F+S  RS+RCSVPRWSHGVDWKSP SLTAQIR+AAP  N FH+K++TMA +NPFK I T+
Sbjct  53   FSSTLRSVRCSVPRWSHGVDWKSPISLTAQIRTAAPAFNSFHKKLSTMAEKNPFKEILTA  112

Query  550  LPKPGGGEFGKFYSLPALNDP  612
            LPKPGGGEFGKFYSLPALNDP
Sbjct  113  LPKPGGGEFGKFYSLPALNDP  133



>ref|XP_010276105.1| PREDICTED: aconitate hydratase, cytoplasmic [Nelumbo nucifera]
Length=992

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R L+F+SAFRSLR S PRWSHG DW+SP SL AQIR+AAPV+  F RKIATMASEN FKG
Sbjct  44   RSLSFSSAFRSLRSSPPRWSHGYDWRSPLSLRAQIRTAAPVIERFQRKIATMASENAFKG  103

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            I TSLPKPGGGEFGKFYSLPA+NDP
Sbjct  104  ILTSLPKPGGGEFGKFYSLPAINDP  128



>emb|CDP10817.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R L+++SA RS+R SVPRWSHGVDWKSP+SL +QIR+ +P  N F+RK+ATMASENPFKG
Sbjct  62   RLLSYSSALRSVRSSVPRWSHGVDWKSPSSLCSQIRTTSPACNGFYRKMATMASENPFKG  121

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
              TSLPKPGGGEFGKFYSLPALNDP
Sbjct  122  TLTSLPKPGGGEFGKFYSLPALNDP  146



>ref|XP_011095404.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum 
indicum]
Length=1011

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R L+F+SA RS+RCS PRWSHGVDW+SP SL AQIR+A+PVL  F RKIATMASE+PF G
Sbjct  63   RSLSFSSALRSIRCSAPRWSHGVDWRSPVSLRAQIRTASPVLERFERKIATMASEHPFSG  122

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            I + LPKPGGGEFGKFYSLPAL DP
Sbjct  123  ILSGLPKPGGGEFGKFYSLPALKDP  147



>emb|CDP05740.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +1

Query  373  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSL  552
            +SA RSLRCSVPRWSHGVDW+SP SL AQIR+AAPV+  F RKIATMA E+P+KGI TSL
Sbjct  68   SSAVRSLRCSVPRWSHGVDWRSPVSLRAQIRTAAPVIERFERKIATMAPEHPYKGILTSL  127

Query  553  PKPGGGEFGKFYSLPALNDP  612
            PKPGGG+FGKFYSLPALNDP
Sbjct  128  PKPGGGDFGKFYSLPALNDP  147



>ref|XP_002321126.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
 gb|EEE99441.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
Length=999

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R L+F+SA RSLRCS  RWSHGVDW+SPA+L  QIR+ AP +  F RKIATMA E+PFKG
Sbjct  51   RSLSFSSAVRSLRCSYRRWSHGVDWRSPATLRHQIRAVAPFVERFQRKIATMAPEHPFKG  110

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            IFTSLPKPGGGEFGKFYSLPALNDP
Sbjct  111  IFTSLPKPGGGEFGKFYSLPALNDP  135



>gb|KDO62733.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=875

 Score =   138 bits (348),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R L+F+SA R++RCS PRWSHGV+W+SP SL AQ R AAPVL  F RKIA+MA EN FKG
Sbjct  54   RSLSFSSALRTVRCSAPRWSHGVNWRSPVSLRAQSRIAAPVLERFQRKIASMAPENAFKG  113

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            I TSLPKPGGGEFGKF+SLPALNDP
Sbjct  114  ILTSLPKPGGGEFGKFFSLPALNDP  138



>ref|XP_006452377.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 ref|XP_006475065.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Citrus 
sinensis]
 gb|ESR65617.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 gb|KDO62731.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=1002

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R L+F+SA R++RCS PRWSHGV+W+SP SL AQ R AAPVL  F RKIA+MA EN FKG
Sbjct  54   RSLSFSSALRTVRCSAPRWSHGVNWRSPVSLRAQSRIAAPVLERFQRKIASMAPENAFKG  113

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            I TSLPKPGGGEFGKF+SLPALNDP
Sbjct  114  ILTSLPKPGGGEFGKFFSLPALNDP  138



>ref|XP_010046497.1| PREDICTED: aconitate hydratase, cytoplasmic [Eucalyptus grandis]
Length=996

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R L+F+SAFRSLR SVPRWSHGVDW+SPASL  QIR+ APV+    RK ATMASENPFK 
Sbjct  48   RSLSFSSAFRSLRSSVPRWSHGVDWRSPASLRPQIRAVAPVIERLQRKFATMASENPFKE  107

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            I T+LPK GGG FGKFYSLPALNDP
Sbjct  108  ILTTLPKAGGGHFGKFYSLPALNDP  132



>gb|EPS60517.1| hypothetical protein M569_14286, partial [Genlisea aurea]
Length=862

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R L+F+SA RSLR S PRWSHGVDW+ P SL +QI + +PVL  FHRKIATMASE+PF G
Sbjct  17   RSLSFSSAIRSLRISAPRWSHGVDWRYPVSLRSQIGTVSPVLERFHRKIATMASEHPFSG  76

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            +  +LPKPGGGEFGK+YSLPALNDP
Sbjct  77   LLQTLPKPGGGEFGKYYSLPALNDP  101



>ref|XP_006351962.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Solanum tuberosum]
Length=981

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 72/85 (85%), Gaps = 7/85 (8%)
 Frame = +1

Query  364  LTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAA--PVLNDFHRKIATMASENPFKG  537
            L F+S FRS     PRWS+GVDWKSP SL AQIR+AA  PVLN+FHRK+ TMASENPFKG
Sbjct  38   LGFSSTFRS-----PRWSYGVDWKSPISLKAQIRTAAVTPVLNNFHRKLTTMASENPFKG  92

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            I TSLPKPGGGEFGK+YSLPALNDP
Sbjct  93   ILTSLPKPGGGEFGKYYSLPALNDP  117



>gb|KDO54659.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=896

 Score =   133 bits (334),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            I T+LPKPGGGEFGKFYSLPALNDP
Sbjct  108  ILTALPKPGGGEFGKFYSLPALNDP  132



>gb|KDO54661.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=876

 Score =   133 bits (334),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            I T+LPKPGGGEFGKFYSLPALNDP
Sbjct  108  ILTALPKPGGGEFGKFYSLPALNDP  132



>ref|XP_006447556.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
 gb|ESR60796.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
Length=888

 Score =   133 bits (334),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  52   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  111

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            I T+LPKPGGGEFGKFYSLPALNDP
Sbjct  112  ILTALPKPGGGEFGKFYSLPALNDP  136



>gb|KDO54656.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score =   133 bits (335),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            I T+LPKPGGGEFGKFYSLPALNDP
Sbjct  108  ILTALPKPGGGEFGKFYSLPALNDP  132



>gb|KDO54657.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score =   133 bits (335),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            I T+LPKPGGGEFGKFYSLPALNDP
Sbjct  108  ILTALPKPGGGEFGKFYSLPALNDP  132



>gb|KDO54660.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=902

 Score =   133 bits (334),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            I T+LPKPGGGEFGKFYSLPALNDP
Sbjct  108  ILTALPKPGGGEFGKFYSLPALNDP  132



>ref|XP_006447555.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
 ref|XP_006469685.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Citrus sinensis]
 ref|XP_006469686.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Citrus sinensis]
 gb|ESR60795.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
Length=1000

 Score =   133 bits (334),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  52   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  111

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            I T+LPKPGGGEFGKFYSLPALNDP
Sbjct  112  ILTALPKPGGGEFGKFYSLPALNDP  136



>ref|XP_009598331.1| PREDICTED: aconitate hydratase 2, mitochondrial isoform X2 [Nicotiana 
tomentosiformis]
Length=865

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R  +F+SA  SLR SVPRWSHGVDW+SP SL AQ+R+A+P +    R IATMASE+PF+G
Sbjct  116  RSFSFSSALPSLRYSVPRWSHGVDWRSPISLRAQVRTASPDIEPLDRNIATMASEHPFRG  175

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            IFTSLPKPGGGEFGKFYSL ALNDP
Sbjct  176  IFTSLPKPGGGEFGKFYSLTALNDP  200



>ref|XP_009598330.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Nicotiana 
tomentosiformis]
Length=1063

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R  +F+SA  SLR SVPRWSHGVDW+SP SL AQ+R+A+P +    R IATMASE+PF+G
Sbjct  116  RSFSFSSALPSLRYSVPRWSHGVDWRSPISLRAQVRTASPDIEPLDRNIATMASEHPFRG  175

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            IFTSLPKPGGGEFGKFYSL ALNDP
Sbjct  176  IFTSLPKPGGGEFGKFYSLTALNDP  200



>ref|XP_010278679.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nelumbo nucifera]
Length=997

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +1

Query  394  RCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGE  573
            R S PRWSHG DWKSP SL AQIR+AAPV+  F RKIATMASEN FKGI TSLPKPGGGE
Sbjct  61   RSSAPRWSHGFDWKSPLSLRAQIRTAAPVIERFQRKIATMASENAFKGILTSLPKPGGGE  120

Query  574  FGKFYSLPALNDP  612
            FGKFYSLPALNDP
Sbjct  121  FGKFYSLPALNDP  133



>ref|XP_002278138.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI26642.3| unnamed protein product [Vitis vinifera]
Length=1009

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 70/85 (82%), Gaps = 5/85 (6%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R L F SAFRS      RWSHGVDW+SP SL AQIR+AAPV+  F RK+AT+ASE+PFKG
Sbjct  66   RSLGFLSAFRS-----RRWSHGVDWRSPVSLRAQIRAAAPVIERFERKMATIASEHPFKG  120

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            I TS+PKPGGGEFGKFYSLPALNDP
Sbjct  121  ILTSVPKPGGGEFGKFYSLPALNDP  145



>gb|EYU27339.1| hypothetical protein MIMGU_mgv1a000710mg [Erythranthe guttata]
Length=1010

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 70/86 (81%), Gaps = 1/86 (1%)
 Frame = +1

Query  358  RPLTFASAFRSLR-CSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFK  534
            R L+F+SA RS+R  S  RWSHG DW+SP SL AQIRS++PVL  F RKIATMASE+PF 
Sbjct  61   RSLSFSSALRSIRYSSSQRWSHGADWRSPVSLRAQIRSSSPVLERFERKIATMASEHPFN  120

Query  535  GIFTSLPKPGGGEFGKFYSLPALNDP  612
            GI + LPKP GGEFGKFYSLPALNDP
Sbjct  121  GILSGLPKPEGGEFGKFYSLPALNDP  146



>ref|XP_009787326.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Nicotiana sylvestris]
Length=818

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +1

Query  370  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  549
            F+SA  SL  S PRWSHGVDW+SP SL AQIR+A+P +    R IATMASE+PF+GIFTS
Sbjct  73   FSSALPSLSYSTPRWSHGVDWRSPISLRAQIRTASPDIERLDRNIATMASEHPFRGIFTS  132

Query  550  LPKPGGGEFGKFYSLPALNDP  612
            LPKPGGGEFGKFYSL ALNDP
Sbjct  133  LPKPGGGEFGKFYSLTALNDP  153



>ref|XP_009787319.1| PREDICTED: aconitate hydratase, cytoplasmic-like isoform X1 [Nicotiana 
sylvestris]
Length=1017

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +1

Query  370  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  549
            F+SA  SL  S PRWSHGVDW+SP SL AQIR+A+P +    R IATMASE+PF+GIFTS
Sbjct  73   FSSALPSLSYSTPRWSHGVDWRSPISLRAQIRTASPDIERLDRNIATMASEHPFRGIFTS  132

Query  550  LPKPGGGEFGKFYSLPALNDP  612
            LPKPGGGEFGKFYSL ALNDP
Sbjct  133  LPKPGGGEFGKFYSLTALNDP  153



>ref|XP_003543388.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  361  PLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGI  540
            P + ++A RS   +VPRWSHGVDW+SP  L  QIR+AAP++  FHR+IAT A++NPFKG 
Sbjct  37   PGSSSAATRSFGSAVPRWSHGVDWRSPLGLRPQIRAAAPLIERFHRRIATSATDNPFKGN  96

Query  541  FTSLPKPGGGEFGKFYSLPALNDP  612
             TSLPKPGGGEFGKFYSLP+LNDP
Sbjct  97   LTSLPKPGGGEFGKFYSLPSLNDP  120



>gb|KJB60837.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=865

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +1

Query  373  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSL  552
            ++A RS  CSVPRWSH +DW+SP SL AQIR+  PV+    RK +TMA+E+PFK + TSL
Sbjct  47   SAAVRSFHCSVPRWSHRLDWRSPFSLRAQIRAVNPVIERLERKFSTMAAEHPFKAVLTSL  106

Query  553  PKPGGGEFGKFYSLPALNDP  612
            PKPGGGEFGKFYSLPALNDP
Sbjct  107  PKPGGGEFGKFYSLPALNDP  126



>gb|KJB60836.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=860

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +1

Query  373  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSL  552
            ++A RS  CSVPRWSH +DW+SP SL AQIR+  PV+    RK +TMA+E+PFK + TSL
Sbjct  47   SAAVRSFHCSVPRWSHRLDWRSPFSLRAQIRAVNPVIERLERKFSTMAAEHPFKAVLTSL  106

Query  553  PKPGGGEFGKFYSLPALNDP  612
            PKPGGGEFGKFYSLPALNDP
Sbjct  107  PKPGGGEFGKFYSLPALNDP  126



>gb|KJB60835.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=990

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +1

Query  373  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSL  552
            ++A RS  CSVPRWSH +DW+SP SL AQIR+  PV+    RK +TMA+E+PFK + TSL
Sbjct  47   SAAVRSFHCSVPRWSHRLDWRSPFSLRAQIRAVNPVIERLERKFSTMAAEHPFKAVLTSL  106

Query  553  PKPGGGEFGKFYSLPALNDP  612
            PKPGGGEFGKFYSLPALNDP
Sbjct  107  PKPGGGEFGKFYSLPALNDP  126



>ref|XP_007045642.1| Aconitase 3 [Theobroma cacao]
 gb|EOY01474.1| Aconitase 3 [Theobroma cacao]
Length=995

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 67/85 (79%), Gaps = 1/85 (1%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R LT ++A RS   SVPRWSH +DW+SP SL AQIR+  PV+    RK ATMASE+PFK 
Sbjct  48   RSLT-SAAVRSFHGSVPRWSHRLDWRSPLSLRAQIRAVTPVIERLERKFATMASEHPFKA  106

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            + TSLPKPGGGEFGKFYSLPALNDP
Sbjct  107  VLTSLPKPGGGEFGKFYSLPALNDP  131



>gb|KHN36531.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=984

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  361  PLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGI  540
            P + ++A RS   +VPRWSHGVDW+SP  L  QIR+AAP++  FHR+IAT A++NPFKG 
Sbjct  37   PGSSSAATRSFGSAVPRWSHGVDWRSPLGLRPQIRAAAPLIERFHRRIATSATDNPFKGN  96

Query  541  FTSLPKPGGGEFGKFYSLPALNDP  612
             TSLP+PGGGEFGKFYSLP+LNDP
Sbjct  97   LTSLPRPGGGEFGKFYSLPSLNDP  120



>ref|XP_004251517.2| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=981

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 66/79 (84%), Gaps = 7/79 (9%)
 Frame = +1

Query  382  FRSLRCSVPRWSHGVDWKSPASLTAQIRSAA--PVLNDFHRKIATMASENPFKGIFTSLP  555
            FRSLR     W +GVDWKSP SLT+QIR+AA  PVLN+F RK+ TMAS NPFKGI TSLP
Sbjct  44   FRSLR-----WRYGVDWKSPISLTSQIRTAAVTPVLNNFRRKLTTMASGNPFKGILTSLP  98

Query  556  KPGGGEFGKFYSLPALNDP  612
            KPGGGEFGK+YSLPALNDP
Sbjct  99   KPGGGEFGKYYSLPALNDP  117



>ref|XP_006346211.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=980

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 70/82 (85%), Gaps = 4/82 (5%)
 Frame = +1

Query  370  FASAFRSLRCSVPRWS-HGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  546
            FA+ +RS+RCSVPRWS +GV+ + P SL AQIR+A+ V+    R +ATMASE+PFKGIFT
Sbjct  38   FATTYRSIRCSVPRWSNYGVNRRFPISLKAQIRTASQVV---ERNVATMASEHPFKGIFT  94

Query  547  SLPKPGGGEFGKFYSLPALNDP  612
            SLPKPGGGEFGKFYSLPALNDP
Sbjct  95   SLPKPGGGEFGKFYSLPALNDP  116



>gb|KJB50479.1| hypothetical protein B456_008G173400 [Gossypium raimondii]
Length=996

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R LT ++A RS  CSVPRWSH +DW+SP +L ++IR+  P++    RK ATMA+E+PFK 
Sbjct  49   RSLT-SAAVRSFHCSVPRWSHRLDWRSPLNLRSEIRAFNPIIEQLQRKFATMAAEHPFKA  107

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            + TSLP+PGGGEFGKFYSLPALNDP
Sbjct  108  VLTSLPRPGGGEFGKFYSLPALNDP  132



>ref|XP_003540302.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +1

Query  361  PLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGI  540
            P + A+A RS   +VPRWS GVDW+SP  L   IR+AAP++  FHR+IAT A+ENPFKG 
Sbjct  37   PGSSAAATRSFGSAVPRWSRGVDWRSPLGLRPHIRAAAPLIERFHRRIATSATENPFKGN  96

Query  541  FTSLPKPGGGEFGKFYSLPALNDP  612
             TSLP+PGGGEFGKFYSLP+LNDP
Sbjct  97   LTSLPRPGGGEFGKFYSLPSLNDP  120



>gb|KHG15607.1| Aconitate hydratase 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=668

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 67/85 (79%), Gaps = 1/85 (1%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R LT ++A RS  CSVPRWS  +DW+SP +L ++IR+  P++    RK ATMA+E+PFK 
Sbjct  49   RSLT-STAVRSFHCSVPRWSPRLDWRSPLNLRSEIRAFNPIIEQLQRKFATMAAEHPFKA  107

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            + TSLPKPGGGEFGKFYSLPALNDP
Sbjct  108  VLTSLPKPGGGEFGKFYSLPALNDP  132



>gb|EYU24785.1| hypothetical protein MIMGU_mgv1a000742mg [Erythranthe guttata]
Length=997

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 64/78 (82%), Gaps = 2/78 (3%)
 Frame = +1

Query  385  RSLR-CSVPRWSHGVDWKSPASLTAQIR-SAAPVLNDFHRKIATMASENPFKGIFTSLPK  558
            RSL   S  RWSHGVDWKSPASL +QIR S+A      HRKIATMASEN FKGIFTSLPK
Sbjct  54   RSLSYLSAARWSHGVDWKSPASLASQIRISSAFSDTLLHRKIATMASENAFKGIFTSLPK  113

Query  559  PGGGEFGKFYSLPALNDP  612
            PGGGEFGKFYSLPALNDP
Sbjct  114  PGGGEFGKFYSLPALNDP  131



>gb|KDP39136.1| hypothetical protein JCGZ_00893 [Jatropha curcas]
Length=1002

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 68/85 (80%), Gaps = 6/85 (7%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R L+F+   RSLRCS P WSHGVDW SP SL AQ R ++PV+    R+++TM SE+PFKG
Sbjct  57   RYLSFS---RSLRCSAPLWSHGVDWHSPISLRAQARVSSPVV---ERRLSTMTSEHPFKG  110

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            I T+LPKPGGGEFGKFY+LPALNDP
Sbjct  111  ILTNLPKPGGGEFGKFYNLPALNDP  135



>ref|XP_007149973.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
 gb|ESW21967.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
Length=983

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  400  SVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFG  579
            +VPRWSHGVDW+SP  L  QIR+ AP++  FHR+IAT A +NPFKG  TSLPKPGGGEFG
Sbjct  49   AVPRWSHGVDWRSPLGLRHQIRAVAPLIERFHRRIATSALDNPFKGNLTSLPKPGGGEFG  108

Query  580  KFYSLPALNDP  612
            KFYSLP+LNDP
Sbjct  109  KFYSLPSLNDP  119



>ref|XP_011100304.1| PREDICTED: aconitate hydratase, cytoplasmic [Sesamum indicum]
Length=1001

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 65/80 (81%), Gaps = 4/80 (5%)
 Frame = +1

Query  382  FRSLR-CSVPRWSHGVDWKSPASLTAQIRSAAPVLND--FHRKIATMASENPFKGIFTSL  552
             RSL   S  RWSHGVDWKSP SL AQIR A+ V +D   HRKIATMA+ENPFKGIFTSL
Sbjct  55   LRSLSYLSAARWSHGVDWKSPPSLAAQIRIAS-VSSDTLLHRKIATMAAENPFKGIFTSL  113

Query  553  PKPGGGEFGKFYSLPALNDP  612
            PK GGGEFGKFYSLPALNDP
Sbjct  114  PKSGGGEFGKFYSLPALNDP  133



>gb|KHG18502.1| Aconitate hydratase 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=933

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +1

Query  373  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSL  552
            ++A RS  CS PRWSH +DW+SP SL AQ+R+  PV+    RK +TMA+E+PFK + TSL
Sbjct  47   SAAVRSFHCS-PRWSHRLDWRSPFSLRAQVRAVNPVIERLERKFSTMAAEHPFKAVLTSL  105

Query  553  PKPGGGEFGKFYSLPALNDP  612
            PKPGGGEFGKFYSLPALNDP
Sbjct  106  PKPGGGEFGKFYSLPALNDP  125



>gb|KJB62848.1| hypothetical protein B456_009G440000 [Gossypium raimondii]
Length=864

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 66/85 (78%), Gaps = 4/85 (5%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R L+F+ + RSLRCS PR    + W+SP SL    R++ PV+  FHR+IAT ASE+PFKG
Sbjct  49   RSLSFSYSLRSLRCSAPR----LHWRSPESLRVLARTSVPVVERFHRRIATTASEHPFKG  104

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            + TSLPKPGGGEFGKFYSLPALNDP
Sbjct  105  VMTSLPKPGGGEFGKFYSLPALNDP  129



>ref|XP_010445106.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=383

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +1

Query  358  RPLTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  531
            R  +F+SA RS R CS   RWSHG  W+ PASL AQ R++APV+  F RK AT+ASE+ +
Sbjct  47   RSKSFSSALRSFRVCSASTRWSHGGSWRYPASLRAQSRNSAPVMEKFERKYATIASEHAY  106

Query  532  KGIFTSLPKPGGGEFGKFYSLPALNDP  612
            K I TSLPKPGGGE+G++YSLPALNDP
Sbjct  107  KDILTSLPKPGGGEYGQYYSLPALNDP  133



>gb|KJB62847.1| hypothetical protein B456_009G440000 [Gossypium raimondii]
Length=993

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 66/85 (78%), Gaps = 4/85 (5%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R L+F+ + RSLRCS PR    + W+SP SL    R++ PV+  FHR+IAT ASE+PFKG
Sbjct  49   RSLSFSYSLRSLRCSAPR----LHWRSPESLRVLARTSVPVVERFHRRIATTASEHPFKG  104

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            + TSLPKPGGGEFGKFYSLPALNDP
Sbjct  105  VMTSLPKPGGGEFGKFYSLPALNDP  129



>ref|XP_010448188.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=998

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 68/87 (78%), Gaps = 2/87 (2%)
 Frame = +1

Query  358  RPLTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  531
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R++APV+  F RK ATMASE+ +
Sbjct  48   RSKSFSSALRSFRVCSASTRWSHGGSWRSPASLRAQSRNSAPVMEKFERKYATMASEHAY  107

Query  532  KGIFTSLPKPGGGEFGKFYSLPALNDP  612
            K I TSLPKPGGGE+G++YSLPALNDP
Sbjct  108  KDILTSLPKPGGGEYGQYYSLPALNDP  134



>ref|XP_006283068.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
 gb|EOA15966.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
Length=995

 Score =   115 bits (289),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +1

Query  358  RPLTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  531
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+  F RK ATMASE+ +
Sbjct  45   RSKSFSSALRSFRVCSASTRWSHGGSWRSPASLRAQSRISAPVMEKFERKYATMASEHAY  104

Query  532  KGIFTSLPKPGGGEFGKFYSLPALNDP  612
            K I TSLPKPGGGE+GK+YSLPALNDP
Sbjct  105  KDILTSLPKPGGGEYGKYYSLPALNDP  131



>ref|XP_003596988.1| Aconitate hydratase [Medicago truncatula]
 gb|AES67239.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +1

Query  367  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  546
            T ++   + R +V RWSHGV W+SP SL  QIR+ AP +  +HRKIAT A ENPFKG  T
Sbjct  34   TSSAVANAARSTVNRWSHGVLWRSPFSLRPQIRAVAPFIEQYHRKIATSAGENPFKGNLT  93

Query  547  SLPKPGGGEFGKFYSLPALNDP  612
            SLPKPGGGEFGKFYSLP+LNDP
Sbjct  94   SLPKPGGGEFGKFYSLPSLNDP  115



>ref|XP_004159202.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Cucumis sativus]
Length=989

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 65/85 (76%), Gaps = 4/85 (5%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R L+ +SAFRS      RWSHGV W+SP SL AQIR+ AP +   HRK ++MA+ENPFK 
Sbjct  45   RSLSASSAFRS----TARWSHGVGWRSPLSLRAQIRAVAPAIERLHRKFSSMAAENPFKE  100

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
              TSLPKPGGGEFGK+YSLP+LNDP
Sbjct  101  NLTSLPKPGGGEFGKYYSLPSLNDP  125



>ref|XP_008379632.1| PREDICTED: aconitate hydratase, cytoplasmic [Malus domestica]
Length=994

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 66/84 (79%), Gaps = 2/84 (2%)
 Frame = +1

Query  364  LTFASAFRSLRCSVPRWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGI  540
            L F SA  + R S PRWSHG V W+SP +L +QIR+ APV+  F RKIA+MASENPFK  
Sbjct  48   LRFLSASSAAR-SFPRWSHGGVHWRSPYTLRSQIRAVAPVIEQFQRKIASMASENPFKAN  106

Query  541  FTSLPKPGGGEFGKFYSLPALNDP  612
             TSLPKPGGGEFGKFYSLP+LNDP
Sbjct  107  LTSLPKPGGGEFGKFYSLPSLNDP  130



>ref|XP_008455442.1| PREDICTED: aconitate hydratase, cytoplasmic [Cucumis melo]
Length=989

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 65/85 (76%), Gaps = 4/85 (5%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R L+ +SAFRS      RWSHGV W+SP SL AQIR+ AP +   HRK ++MA+ENPFK 
Sbjct  45   RSLSASSAFRS----TTRWSHGVGWRSPLSLRAQIRAVAPAIERLHRKFSSMAAENPFKE  100

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
              TSLPKPGGGEFGK+YSLP+LNDP
Sbjct  101  NLTSLPKPGGGEFGKYYSLPSLNDP  125



>ref|XP_002869584.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45843.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
Length=995

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 66/87 (76%), Gaps = 2/87 (2%)
 Frame = +1

Query  358  RPLTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  531
            R  +F+SA RS R CS   RWSHGV W SPASL AQ R++APV+  F R  ATMASE+ +
Sbjct  45   RSKSFSSALRSFRVCSASTRWSHGVSWGSPASLRAQSRNSAPVMEKFERTYATMASEHAY  104

Query  532  KGIFTSLPKPGGGEFGKFYSLPALNDP  612
            K I TSLPKPGGGE+G +YSLPALNDP
Sbjct  105  KDILTSLPKPGGGEYGNYYSLPALNDP  131



>ref|NP_567763.2| aconitase 2 [Arabidopsis thaliana]
 sp|Q94A28.3|ACO3M_ARATH RecName: Full=Aconitate hydratase 3, mitochondrial; Short=Aconitase 
3; AltName: Full=Citrate hydro-lyase 3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE85279.1| aconitase 2 [Arabidopsis thaliana]
Length=995

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 66/87 (76%), Gaps = 2/87 (2%)
 Frame = +1

Query  358  RPLTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  531
            R  +F+SA RS R CS   RWSHG  W SPASL AQ R++ PV+  F RK ATMASE+ +
Sbjct  45   RSKSFSSALRSFRVCSASTRWSHGGSWGSPASLRAQARNSTPVMEKFERKYATMASEHSY  104

Query  532  KGIFTSLPKPGGGEFGKFYSLPALNDP  612
            K I TSLPKPGGGE+GK+YSLPALNDP
Sbjct  105  KDILTSLPKPGGGEYGKYYSLPALNDP  131



>gb|AAK91447.1| AT4g26970/F10M23_310 [Arabidopsis thaliana]
 gb|AAN18061.1| At4g26970/F10M23_310 [Arabidopsis thaliana]
Length=995

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 66/87 (76%), Gaps = 2/87 (2%)
 Frame = +1

Query  358  RPLTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  531
            R  +F+SA RS R CS   RWSHG  W SPASL AQ R++ PV+  F RK ATMASE+ +
Sbjct  45   RSKSFSSALRSFRVCSASTRWSHGGSWGSPASLRAQARNSTPVMEKFERKYATMASEHSY  104

Query  532  KGIFTSLPKPGGGEFGKFYSLPALNDP  612
            K I TSLPKPGGGE+GK+YSLPALNDP
Sbjct  105  KDILTSLPKPGGGEYGKYYSLPALNDP  131



>ref|XP_009353280.1| PREDICTED: aconitate hydratase, cytoplasmic [Pyrus x bretschneideri]
Length=994

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 67/86 (78%), Gaps = 5/86 (6%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFK  534
            R L+ +SA RS     PRWSHG V W+SP +L +QIR+ APV+  F RKIA+MASENPFK
Sbjct  49   RFLSSSSAARSF----PRWSHGGVHWRSPYTLRSQIRAVAPVIEQFQRKIASMASENPFK  104

Query  535  GIFTSLPKPGGGEFGKFYSLPALNDP  612
               TSLPKPGGGEFGKFYSLP+LNDP
Sbjct  105  ANLTSLPKPGGGEFGKFYSLPSLNDP  130



>ref|XP_004144496.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Cucumis sativus]
 gb|KGN43521.1| hypothetical protein Csa_7G043630 [Cucumis sativus]
Length=989

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 65/85 (76%), Gaps = 4/85 (5%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R L+ +SAFRS      RWSHGV W+SP SL AQIR+ AP +   HRK ++MA+ENPFK 
Sbjct  45   RSLSASSAFRS----TARWSHGVGWRSPLSLRAQIRAVAPAIERLHRKFSSMAAENPFKE  100

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
              TSLPKPGGGE+GK+YSLP+LNDP
Sbjct  101  NLTSLPKPGGGEYGKYYSLPSLNDP  125



>ref|XP_009599619.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana tomentosiformis]
Length=985

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 66/87 (76%), Gaps = 11/87 (13%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAA--PVLNDFHRKIATMASENPF  531
            R L F+SA RSLR     W    +WKSP  L AQIR+ A  PVLN FHRK++TMA+ENPF
Sbjct  44   RSLNFSSAVRSLR-----W----NWKSPIILKAQIRTTATTPVLNSFHRKLSTMAAENPF  94

Query  532  KGIFTSLPKPGGGEFGKFYSLPALNDP  612
            KGI T LPKPGGGEFGK+YSLPALNDP
Sbjct  95   KGILTVLPKPGGGEFGKYYSLPALNDP  121



>ref|XP_009769027.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana sylvestris]
Length=989

 Score =   113 bits (282),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 67/87 (77%), Gaps = 11/87 (13%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAA--PVLNDFHRKIATMASENPF  531
            R L+F+SA RSLR     W    +WKSP SL AQIR+ A  PVLN  HRK++TMA+ENPF
Sbjct  48   RSLSFSSAVRSLR-----W----NWKSPISLKAQIRTTATTPVLNSSHRKLSTMAAENPF  98

Query  532  KGIFTSLPKPGGGEFGKFYSLPALNDP  612
            KGI T LPKPGGGEFGK+YSLPALNDP
Sbjct  99   KGILTVLPKPGGGEFGKYYSLPALNDP  125



>ref|XP_003527493.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Glycine max]
Length=979

 Score =   113 bits (282),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R  +F++A   LRCSVPRWSH +   SP S    I + APV+  FHR+IATMA+ENPFKG
Sbjct  31   RTSSFSAAPSLLRCSVPRWSHRLHSTSPLSPRPPITAVAPVVERFHRQIATMANENPFKG  90

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
              TSLPKPGGGEFGKFYSLP+LNDP
Sbjct  91   NLTSLPKPGGGEFGKFYSLPSLNDP  115



>ref|XP_003539865.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Glycine max]
Length=984

 Score =   113 bits (282),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = +1

Query  367  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  546
            +F++  RSL CSVPRWSH +   SP +   +I + AP++  FHR+IATMA+ENPFKG  T
Sbjct  39   SFSATARSLLCSVPRWSHRLHSASPLTPRPRISAVAPLVERFHREIATMANENPFKGNLT  98

Query  547  SLPKPGGGEFGKFYSLPALNDP  612
            SLPKPGGGEFGKFYSLP+LNDP
Sbjct  99   SLPKPGGGEFGKFYSLPSLNDP  120



>ref|XP_006592372.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Glycine max]
Length=890

 Score =   112 bits (281),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = +1

Query  367  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  546
            +F++  RSL CSVPRWSH +   SP +   +I + AP++  FHR+IATMA+ENPFKG  T
Sbjct  39   SFSATARSLLCSVPRWSHRLHSASPLTPRPRISAVAPLVERFHREIATMANENPFKGNLT  98

Query  547  SLPKPGGGEFGKFYSLPALNDP  612
            SLPKPGGGEFGKFYSLP+LNDP
Sbjct  99   SLPKPGGGEFGKFYSLPSLNDP  120



>ref|XP_006413121.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
 gb|ESQ54574.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
Length=999

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +1

Query  358  RPLTFASAFRSLRC--SVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  531
            R  +F+SA RS R   +  RWS+G +W+SPASL AQ R++APV+  F RK ATMASE+ +
Sbjct  48   RSKSFSSALRSFRVGSASTRWSYGGNWRSPASLRAQTRNSAPVMERFERKYATMASEHAY  107

Query  532  KGIFTSLPKPGGGEFGKFYSLPALNDP  612
            K I TSLPKP GGE+GK+YSLPALNDP
Sbjct  108  KDILTSLPKPDGGEYGKYYSLPALNDP  134



>ref|XP_010433420.1| PREDICTED: aconitate hydratase 3, mitochondrial [Camelina sativa]
Length=997

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 65/87 (75%), Gaps = 2/87 (2%)
 Frame = +1

Query  358  RPLTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  531
            R  +F+SA RS R CS   RWSHG  W+SP SL AQ R++APV+  F RK ATM SE+ +
Sbjct  47   RSKSFSSALRSFRVCSASTRWSHGGSWRSPVSLRAQSRNSAPVMEKFERKYATMTSEHAY  106

Query  532  KGIFTSLPKPGGGEFGKFYSLPALNDP  612
            K I TSLPKPGGG +GK+YSLPALNDP
Sbjct  107  KDILTSLPKPGGGAYGKYYSLPALNDP  133



>gb|KJB30569.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=985

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +1

Query  367  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  546
            T +   RS   S  RW H +DW+SP SL AQIR+  PV+  F ++ ATMA+E+PFK + T
Sbjct  47   TASVVVRSFHSSASRWCHRLDWRSPFSLRAQIRALNPVIERFQKQFATMAAEHPFKEVLT  106

Query  547  SLPKPGGGEFGKFYSLPALNDP  612
            SLPKPGGGEFGKFYSLPALNDP
Sbjct  107  SLPKPGGGEFGKFYSLPALNDP  128



>gb|KJB30566.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
 gb|KJB30567.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=992

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +1

Query  367  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  546
            T +   RS   S  RW H +DW+SP SL AQIR+  PV+  F ++ ATMA+E+PFK + T
Sbjct  47   TASVVVRSFHSSASRWCHRLDWRSPFSLRAQIRALNPVIERFQKQFATMAAEHPFKEVLT  106

Query  547  SLPKPGGGEFGKFYSLPALNDP  612
            SLPKPGGGEFGKFYSLPALNDP
Sbjct  107  SLPKPGGGEFGKFYSLPALNDP  128



>ref|XP_004487412.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=984

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +1

Query  403  VPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGK  582
            V RWSHGV W+SP SL  QIR+ AP +  FHRKIAT A ENPFKG   +LPKPGGGEFGK
Sbjct  52   VNRWSHGVHWRSPFSLRPQIRAVAPFIERFHRKIATSAGENPFKGNLATLPKPGGGEFGK  111

Query  583  FYSLPALNDP  612
            FYSLP+LNDP
Sbjct  112  FYSLPSLNDP  121



>emb|CDY66424.1| BnaAnng22230D [Brassica napus]
Length=995

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 66/87 (76%), Gaps = 2/87 (2%)
 Frame = +1

Query  358  RPLTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  531
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+    R+ A+MASE+ +
Sbjct  45   RSRSFSSALRSYRVCSASTRWSHGGSWRSPASLRAQARVSAPVMERLERRYASMASEHAY  104

Query  532  KGIFTSLPKPGGGEFGKFYSLPALNDP  612
            K + TSLPKPGGGE+GK+YSLPALNDP
Sbjct  105  KDLLTSLPKPGGGEYGKYYSLPALNDP  131



>emb|CDY14291.1| BnaA08g14220D [Brassica napus]
Length=995

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 66/87 (76%), Gaps = 2/87 (2%)
 Frame = +1

Query  358  RPLTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  531
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+    R+ A+MASE+ +
Sbjct  45   RSRSFSSALRSYRVCSASTRWSHGGSWRSPASLRAQARVSAPVMERLERRYASMASEHAY  104

Query  532  KGIFTSLPKPGGGEFGKFYSLPALNDP  612
            K + TSLPKPGGGE+GK+YSLPALNDP
Sbjct  105  KDLLTSLPKPGGGEYGKYYSLPALNDP  131



>gb|KHG08190.1| Aconitate hydratase 2, mitochondrial [Gossypium arboreum]
Length=973

 Score =   109 bits (273),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +1

Query  367  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  546
            T +   RS   S  RW H +DW+SP SL AQIR+  PV   F ++ ATMA+E+PFK + T
Sbjct  47   TASVVVRSFHSSASRWCHRLDWRSPLSLRAQIRAFNPVTERFQKQFATMAAEHPFKEVLT  106

Query  547  SLPKPGGGEFGKFYSLPALNDP  612
            SLPKPGGGEFGKFYSLPALNDP
Sbjct  107  SLPKPGGGEFGKFYSLPALNDP  128



>ref|XP_009109156.1| PREDICTED: aconitate hydratase 3, mitochondrial [Brassica rapa]
Length=995

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 65/84 (77%), Gaps = 2/84 (2%)
 Frame = +1

Query  367  TFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGI  540
            +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+    R+ A+MASE+ ++ I
Sbjct  48   SFSSALRSYRVCSASTRWSHGGSWRSPASLRAQARVSAPVMERLERRYASMASEHTYQDI  107

Query  541  FTSLPKPGGGEFGKFYSLPALNDP  612
             TSLPKPGGGE+GK+YSLPALNDP
Sbjct  108  LTSLPKPGGGEYGKYYSLPALNDP  131



>ref|XP_008230066.1| PREDICTED: aconitate hydratase, cytoplasmic [Prunus mume]
Length=994

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 58/69 (84%), Gaps = 1/69 (1%)
 Frame = +1

Query  409  RWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKF  585
            RWSHG V W+SP +L +QIR+ APV+  F RKIA+MASENPFK   TSLPKPGGGEFGKF
Sbjct  64   RWSHGGVHWRSPYTLRSQIRAIAPVIEQFQRKIASMASENPFKANLTSLPKPGGGEFGKF  123

Query  586  YSLPALNDP  612
            YSLP+LNDP
Sbjct  124  YSLPSLNDP  132



>ref|XP_007217144.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
 gb|EMJ18343.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
Length=996

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 58/69 (84%), Gaps = 1/69 (1%)
 Frame = +1

Query  409  RWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKF  585
            RWSHG V W+SP +L +QIR+ APV+  F RK+A+MASENPFK   TSLPKPGGGEFGKF
Sbjct  64   RWSHGGVHWRSPYTLRSQIRAVAPVIEQFQRKMASMASENPFKANLTSLPKPGGGEFGKF  123

Query  586  YSLPALNDP  612
            YSLP+LNDP
Sbjct  124  YSLPSLNDP  132



>ref|XP_008342002.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Malus domestica]
Length=992

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 58/70 (83%), Gaps = 1/70 (1%)
 Frame = +1

Query  406  PRWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGK  582
            PRWSHG V W+S  +L +QIR+ APV+  F RKIA+MASENPFK   TSLPKPGGGEFGK
Sbjct  59   PRWSHGGVHWRSSYTLRSQIRAVAPVIEQFQRKIASMASENPFKPNLTSLPKPGGGEFGK  118

Query  583  FYSLPALNDP  612
            FYSLP+LNDP
Sbjct  119  FYSLPSLNDP  128



>ref|XP_010675721.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Beta vulgaris 
subsp. vulgaris]
Length=1015

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R L F+S  RS+  +  RWSHGVDW+SP SL +QI ++ P++  F RKIATMASE+P+K 
Sbjct  67   RSLGFSSVIRSISSASSRWSHGVDWRSPVSLRSQIAASPPLVERFQRKIATMASEHPYKE  126

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            IFTSLPKPGGGEFGKFYSLPALNDP
Sbjct  127  IFTSLPKPGGGEFGKFYSLPALNDP  151



>ref|XP_010488774.1| PREDICTED: aconitate hydratase 2, mitochondrial [Camelina sativa]
Length=991

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 65/83 (78%), Gaps = 5/83 (6%)
 Frame = +1

Query  367  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  543
            T + AFRSL    PRWSH    K SP SLT+QIR+ +PVL+   R  ++MASE+P+KGIF
Sbjct  49   TISPAFRSL----PRWSHCFHSKPSPFSLTSQIRAVSPVLDRLQRTFSSMASEHPYKGIF  104

Query  544  TSLPKPGGGEFGKFYSLPALNDP  612
            T+LPKPGGGEFGKFYSLPALNDP
Sbjct  105  TTLPKPGGGEFGKFYSLPALNDP  127



>ref|XP_010467089.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=994

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 65/83 (78%), Gaps = 5/83 (6%)
 Frame = +1

Query  367  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  543
            T + AFRSL    PRWSH    K SP SLT+QIR+ +PVL+   R  ++MASE+P+KGIF
Sbjct  52   TISPAFRSL----PRWSHCFHSKPSPFSLTSQIRAVSPVLDRLQRTFSSMASEHPYKGIF  107

Query  544  TSLPKPGGGEFGKFYSLPALNDP  612
            T+LPKPGGGEFGKFYSLPALNDP
Sbjct  108  TTLPKPGGGEFGKFYSLPALNDP  130



>gb|KFK29204.1| hypothetical protein AALP_AA7G102800 [Arabis alpina]
Length=999

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 66/89 (74%), Gaps = 4/89 (4%)
 Frame = +1

Query  358  RPLTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMAS--EN  525
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+  F RK AT+AS  E+
Sbjct  47   RSKSFSSALRSFRVCSASTRWSHGGSWRSPASLRAQARISAPVMERFERKYATIASDSEH  106

Query  526  PFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
             +K I TSLPKP GGE+GK+YSLPALNDP
Sbjct  107  AYKDILTSLPKPDGGEYGKYYSLPALNDP  135



>ref|XP_002883704.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59963.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
Length=993

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 63/83 (76%), Gaps = 5/83 (6%)
 Frame = +1

Query  367  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  543
            T + AFRSL    PRWSH    K SP  LT QIR+ +PVL+   R  ++MASE+PFKGIF
Sbjct  51   TISPAFRSL----PRWSHCFHSKPSPFRLTTQIRAVSPVLDRLERTFSSMASEHPFKGIF  106

Query  544  TSLPKPGGGEFGKFYSLPALNDP  612
            T+LPKPGGGEFGKFYSLPALNDP
Sbjct  107  TTLPKPGGGEFGKFYSLPALNDP  129



>ref|XP_010412716.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=991

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 64/83 (77%), Gaps = 5/83 (6%)
 Frame = +1

Query  367  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  543
            T + AFRSL    PRWSH    K SP SLT+QIR+ +PVL+   R  ++MASE+P+KGIF
Sbjct  49   TISPAFRSL----PRWSHCFHSKPSPFSLTSQIRAVSPVLDRLQRTFSSMASEHPYKGIF  104

Query  544  TSLPKPGGGEFGKFYSLPALNDP  612
            T+LPKP GGEFGKFYSLPALNDP
Sbjct  105  TTLPKPSGGEFGKFYSLPALNDP  127



>ref|XP_010929878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Elaeis 
guineensis]
Length=1009

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = +1

Query  385  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPG  564
            R L  S   W HG +W+SP SL AQIRS+A V+  F RK+AT+A+ENPFK I TSLPKP 
Sbjct  69   RPLVRSFGTWRHG-NWRSPVSLRAQIRSSAVVIERFQRKMATLATENPFKNILTSLPKPR  127

Query  565  GGEFGKFYSLPALNDP  612
            GGEFGKFYSLPALNDP
Sbjct  128  GGEFGKFYSLPALNDP  143



>emb|CDY50945.1| BnaC03g74450D [Brassica napus]
Length=995

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 67/87 (77%), Gaps = 6/87 (7%)
 Frame = +1

Query  358  RPLTFAS-AFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPF  531
            RP   +S AFRSL    PRWSH +  + SP  L++QIR+ +P L+   RK ++MASE+PF
Sbjct  49   RPFATSSPAFRSL----PRWSHCLHSRLSPFRLSSQIRAVSPGLDRLERKFSSMASEHPF  104

Query  532  KGIFTSLPKPGGGEFGKFYSLPALNDP  612
            KGIFT+LPKPGGGEFGKFYSLPALNDP
Sbjct  105  KGIFTTLPKPGGGEFGKFYSLPALNDP  131



>ref|XP_010443085.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443086.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443087.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443088.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443089.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443090.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443091.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443092.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
Length=981

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 61/85 (72%), Gaps = 2/85 (2%)
 Frame = +1

Query  364  LTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            + F  AFR  R CS   RWSHG +W+ PASL AQ R AAP L  F RK A++ASE+ +K 
Sbjct  38   VKFLLAFRLFRVCSAATRWSHGANWRLPASLQAQTRIAAPRLKKFERKFASIASEHAYKD  97

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
            I T+L KP GGE+GKFYSLPALNDP
Sbjct  98   ILTTLHKPDGGEYGKFYSLPALNDP  122



>ref|XP_006296904.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
 gb|EOA29802.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
Length=988

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = +1

Query  379  AFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLP  555
            +F S+  +  RWSH    K SP SLT+QIR+ +PVL+   R  ++MASE+PFKGIFT+LP
Sbjct  46   SFGSISPAFRRWSHCFHSKPSPISLTSQIRAVSPVLDRLQRTFSSMASEHPFKGIFTALP  105

Query  556  KPGGGEFGKFYSLPALNDP  612
            KPGGGEFGKFYSLPALNDP
Sbjct  106  KPGGGEFGKFYSLPALNDP  124



>ref|XP_008804304.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Phoenix 
dactylifera]
Length=1010

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 58/76 (76%), Gaps = 1/76 (1%)
 Frame = +1

Query  385  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPG  564
            R L  S   W HG   +SP SL AQIRS+A V+  F RK+ATMA+ENPFK I TSLPKPG
Sbjct  70   RPLVRSFGTWRHG-SSRSPVSLRAQIRSSAAVIERFQRKMATMATENPFKNILTSLPKPG  128

Query  565  GGEFGKFYSLPALNDP  612
            GGEFGKFYSLPAL+DP
Sbjct  129  GGEFGKFYSLPALSDP  144



>gb|KFK39331.1| hypothetical protein AALP_AA3G230700 [Arabis alpina]
Length=986

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 64/83 (77%), Gaps = 5/83 (6%)
 Frame = +1

Query  367  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  543
            +FA+ FRSL    PRWSH +  + S   L++QIR+ +PVL+   R  ++MASE+PFKGIF
Sbjct  44   SFATCFRSL----PRWSHCLHSRPSSFRLSSQIRAVSPVLDRLQRTFSSMASEHPFKGIF  99

Query  544  TSLPKPGGGEFGKFYSLPALNDP  612
            T+LPKP GGEFGKFYSLPALNDP
Sbjct  100  TTLPKPDGGEFGKFYSLPALNDP  122



>gb|KHG02134.1| hypothetical protein F383_25649 [Gossypium arboreum]
Length=993

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 56/72 (78%), Gaps = 4/72 (6%)
 Frame = +1

Query  397  CSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEF  576
            CS PR    + W+SP SL    R++ PV+  FHR+IAT ASE+PFKG+ TSLPKPGGGEF
Sbjct  62   CSAPR----LHWRSPESLRILARTSVPVVERFHRRIATTASEHPFKGVMTSLPKPGGGEF  117

Query  577  GKFYSLPALNDP  612
            GKFYSLPALNDP
Sbjct  118  GKFYSLPALNDP  129



>ref|XP_009148490.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=991

 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 64/83 (77%), Gaps = 5/83 (6%)
 Frame = +1

Query  367  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  543
            T + AFRSL    PRWSH +  + SP  L++QIR+ +P L+   R  ++MASE+PFKGIF
Sbjct  49   TSSPAFRSL----PRWSHCLHSRPSPFRLSSQIRAVSPGLDRLERNFSSMASEHPFKGIF  104

Query  544  TSLPKPGGGEFGKFYSLPALNDP  612
            T+LPKPGGGEFGKFYSLPALNDP
Sbjct  105  TTLPKPGGGEFGKFYSLPALNDP  127



>emb|CDX97969.1| BnaA06g07200D [Brassica napus]
Length=991

 Score =   100 bits (250),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 64/83 (77%), Gaps = 5/83 (6%)
 Frame = +1

Query  367  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  543
            T + AFRSL    PRWSH +  + SP  L++QIR+ +P L+   R  ++MASE+PFKGIF
Sbjct  49   TSSPAFRSL----PRWSHCLHSRPSPFRLSSQIRAVSPGLDRLERNFSSMASEHPFKGIF  104

Query  544  TSLPKPGGGEFGKFYSLPALNDP  612
            T+LPKPGGGEFGKFYSLPALNDP
Sbjct  105  TTLPKPGGGEFGKFYSLPALNDP  127



>ref|XP_009136177.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=995

 Score =   100 bits (250),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 64/83 (77%), Gaps = 5/83 (6%)
 Frame = +1

Query  367  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  543
            T + AFRSL    PRWSH +  + SP  L++QIR+ +P L+   R  ++MASE+PFKGIF
Sbjct  53   TSSPAFRSL----PRWSHCLHSRPSPFRLSSQIRAVSPGLDRLERNFSSMASEHPFKGIF  108

Query  544  TSLPKPGGGEFGKFYSLPALNDP  612
            T+LPKPGGGEFGKFYSLPALNDP
Sbjct  109  TTLPKPGGGEFGKFYSLPALNDP  131



>emb|CDY18054.1| BnaC07g04160D [Brassica napus]
Length=986

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 64/82 (78%), Gaps = 5/82 (6%)
 Frame = +1

Query  367  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  543
            T++ AFRSL     RWSH +  + SP  L++QIR+A+PVL+   +  ++MASE+PFKGI 
Sbjct  44   TYSPAFRSL----ARWSHCLHSRPSPFRLSSQIRTASPVLDRLEKNFSSMASEHPFKGIL  99

Query  544  TSLPKPGGGEFGKFYSLPALND  609
            T+LPKPGGGEFGKFYSLPALND
Sbjct  100  TTLPKPGGGEFGKFYSLPALND  121



>ref|XP_003605929.1| Aconitate hydratase [Medicago truncatula]
 gb|AES88126.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +1

Query  385  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPG  564
            RS   S+PR++      S  SL  QI + AP++  FHRKIATMASENPFKG  TSLPKPG
Sbjct  40   RSFFYSLPRFNRRFHSSSHLSLRPQITAVAPLVERFHRKIATMASENPFKGNLTSLPKPG  99

Query  565  GGEFGKFYSLPALNDP  612
            GGEFGKFYSLP+LNDP
Sbjct  100  GGEFGKFYSLPSLNDP  115



>ref|XP_010450391.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=980

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 59/77 (77%), Gaps = 1/77 (1%)
 Frame = +1

Query  385  RSLRCSVPRWSHGVDWKS-PASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKP  561
            RS   S+PR SH +  KS    L +QIR+ +PVL+   R  ++MASE+PFKGIFT+LPKP
Sbjct  40   RSFLTSLPRLSHCLHSKSFQIRLGSQIRAVSPVLDRLQRTFSSMASEHPFKGIFTTLPKP  99

Query  562  GGGEFGKFYSLPALNDP  612
            GGGEFGKFYSLPALNDP
Sbjct  100  GGGEFGKFYSLPALNDP  116



>ref|NP_178634.2| aconitate hydratase 3 [Arabidopsis thaliana]
 sp|Q9SIB9.2|ACO2M_ARATH RecName: Full=Aconitate hydratase 2, mitochondrial; Short=Aconitase 
2; AltName: Full=Citrate hydro-lyase 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAM97080.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
 gb|AAP68248.1| At2g05710 [Arabidopsis thaliana]
 gb|AEC05964.1| aconitate hydratase 3 [Arabidopsis thaliana]
Length=990

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 60/83 (72%), Gaps = 8/83 (10%)
 Frame = +1

Query  367  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  543
            T + AFR       RWSH    K SP   T+QIR+ +PVL+   R  ++MASE+PFKGIF
Sbjct  51   TISPAFR-------RWSHSFHSKPSPFRFTSQIRAVSPVLDRLQRTFSSMASEHPFKGIF  103

Query  544  TSLPKPGGGEFGKFYSLPALNDP  612
            T+LPKPGGGEFGKFYSLPALNDP
Sbjct  104  TTLPKPGGGEFGKFYSLPALNDP  126



>ref|XP_006396145.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
 gb|ESQ36924.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
Length=995

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 66/84 (79%), Gaps = 4/84 (5%)
 Frame = +1

Query  367  TFASAFRSLRCSVPRWSHGVDWKSPASL--TAQIRSAAPVLNDFHRKIATMASENPFKGI  540
            +FA++  + R S+PRWSH +  + P S   ++QIR+ +PVL+   R  ++MASE+PFKGI
Sbjct  50   SFATSSPTFR-SLPRWSHCLHSR-PYSFRFSSQIRAVSPVLDRLERNFSSMASEHPFKGI  107

Query  541  FTSLPKPGGGEFGKFYSLPALNDP  612
            FTSLPKPGGGEFGKFYSLPALNDP
Sbjct  108  FTSLPKPGGGEFGKFYSLPALNDP  131



>emb|CDX93088.1| BnaA03g38100D [Brassica napus]
Length=994

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 63/83 (76%), Gaps = 5/83 (6%)
 Frame = +1

Query  367  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  543
            T + AFRSL    PRWSH +  + S   L++QIR+ +P L+   R  ++MASE+PFKGIF
Sbjct  52   TSSPAFRSL----PRWSHCLHSRPSLFRLSSQIRAVSPGLDRLERNFSSMASEHPFKGIF  107

Query  544  TSLPKPGGGEFGKFYSLPALNDP  612
            T+LPKPGGGEFGKFYSLPALNDP
Sbjct  108  TTLPKPGGGEFGKFYSLPALNDP  130



>ref|XP_010440740.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010440741.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Camelina sativa]
Length=981

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 58/77 (75%), Gaps = 1/77 (1%)
 Frame = +1

Query  385  RSLRCSVPRWSHGVDWKS-PASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKP  561
            RS   S+PR SH +  K     L +QIR+ +PVL+   R  ++MASE+PFKGIFT+LPKP
Sbjct  41   RSFLTSLPRLSHCLHSKPFQIRLGSQIRAVSPVLDRLQRTFSSMASEHPFKGIFTTLPKP  100

Query  562  GGGEFGKFYSLPALNDP  612
            GGGEFGKFYSLPALNDP
Sbjct  101  GGGEFGKFYSLPALNDP  117



>ref|XP_002279260.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI28935.3| unnamed protein product [Vitis vinifera]
Length=987

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 60/86 (70%), Gaps = 9/86 (10%)
 Frame = +1

Query  358  RPLTFAS-AFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFK  534
            R L F+S AFRSLR         V+++ P SL AQI +A PV+  F R+IATMA EN FK
Sbjct  46   RSLRFSSSAFRSLRS--------VNFRPPMSLRAQIGAAVPVVEQFQRRIATMAPENAFK  97

Query  535  GIFTSLPKPGGGEFGKFYSLPALNDP  612
            GI T LPK  GGEFGK+YSLPALNDP
Sbjct  98   GILTGLPKASGGEFGKYYSLPALNDP  123



>ref|XP_002870438.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46697.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=977

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 58/76 (76%), Gaps = 2/76 (3%)
 Frame = +1

Query  385  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPG  564
            RS   S+PR SH   +  P  + +QIR+ +PVL+   R  ++MASE+P+KGIFT+LPKPG
Sbjct  40   RSFVTSLPRLSHSKPF--PLRIGSQIRAVSPVLDRLQRTFSSMASEHPYKGIFTTLPKPG  97

Query  565  GGEFGKFYSLPALNDP  612
            GGEFGKFYSLPALNDP
Sbjct  98   GGEFGKFYSLPALNDP  113



>emb|CDY56501.1| BnaAnng14360D [Brassica napus]
Length=973

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 62/80 (78%), Gaps = 6/80 (8%)
 Frame = +1

Query  379  AFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASEN-PFKGIFTSL  552
            AFRSL    PRWSH +  + S   L++ IR+A+PVL+   R  ++MASE+ PFKGIFT+L
Sbjct  46   AFRSL----PRWSHCLHSRPSLFRLSSHIRTASPVLDRLERNFSSMASEHHPFKGIFTTL  101

Query  553  PKPGGGEFGKFYSLPALNDP  612
            PKPGGGEFGKFYSLPALNDP
Sbjct  102  PKPGGGEFGKFYSLPALNDP  121



>ref|XP_007132546.1| hypothetical protein PHAVU_011G1037001g, partial [Phaseolus vulgaris]
 gb|ESW04540.1| hypothetical protein PHAVU_011G1037001g, partial [Phaseolus vulgaris]
Length=846

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +1

Query  406  PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKF  585
            P+WSH +   SP +L   IR+ AP +  FHR+IA  A ENPFKG  TSLPKPGGGEFGKF
Sbjct  50   PQWSHRLRRVSPLTLRRPIRAVAPPVERFHREIAATAKENPFKGNLTSLPKPGGGEFGKF  109

Query  586  YSLPALNDP  612
            YSLP+LNDP
Sbjct  110  YSLPSLNDP  118



>ref|XP_004287944.1| PREDICTED: aconitate hydratase, cytoplasmic [Fragaria vesca subsp. 
vesca]
Length=990

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +1

Query  409  RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASE-NPFKGIFTSLPKPGGGEFGKF  585
            RWSHGV W++P +L +QIR+ APV+    R+IATMA E +PFK   TSLPKPGGGE+GKF
Sbjct  58   RWSHGVHWRAPYTLRSQIRAIAPVVERVQRRIATMAPESHPFKEHLTSLPKPGGGEYGKF  117

Query  586  YSLPALNDP  612
            YSL +L DP
Sbjct  118  YSLTSLKDP  126



>ref|XP_010533007.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Tarenaya 
hassleriana]
Length=998

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 58/79 (73%), Gaps = 6/79 (8%)
 Frame = +1

Query  379  AFRSLRCSVPRWSHGVDWKS-PASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLP  555
             FRSL    PRWSH +  +S P  +  QIR+ +PVL    +  +TMA E+PFKGIFTSLP
Sbjct  61   GFRSL----PRWSHCLHRRSIPLRVGPQIRAVSPVLERLEKTFSTMA-EHPFKGIFTSLP  115

Query  556  KPGGGEFGKFYSLPALNDP  612
            KPGGGEFGKFYSLPALNDP
Sbjct  116  KPGGGEFGKFYSLPALNDP  134



>ref|XP_002532564.1| aconitase, putative [Ricinus communis]
 gb|EEF29825.1| aconitase, putative [Ricinus communis]
Length=990

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 61/85 (72%), Gaps = 9/85 (11%)
 Frame = +1

Query  358  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  537
            R  +F+SA RSL C+V RWSH VDW+SP SL AQ  +A+PV+    RK++T+ASE+P   
Sbjct  51   RSFSFSSALRSLPCAVSRWSHRVDWRSPISLRAQAPAASPVI---ERKLSTIASEHP---  104

Query  538  IFTSLPKPGGGEFGKFYSLPALNDP  612
                  KPGGGEFGKFYSL AL+DP
Sbjct  105  ---XXXKPGGGEFGKFYSLTALDDP  126



>ref|XP_004517086.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=979

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  385  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPG  564
            RS   S+PR++    + S  SL   I +  P +  FHR IATM++ENPFKG  TSLPKPG
Sbjct  40   RSFFSSIPRFNRRFHYTSYRSLRPHISAVTPGIERFHRTIATMSNENPFKGNLTSLPKPG  99

Query  565  GGEFGKFYSLPALNDP  612
            GGEFGKFYSLP+LNDP
Sbjct  100  GGEFGKFYSLPSLNDP  115



>ref|XP_010482909.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Camelina 
sativa]
Length=997

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 54/81 (67%), Gaps = 2/81 (2%)
 Frame = +1

Query  376  SAFRSLRC--SVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  549
            SAFR  R   S  RWS   +W+ P S  AQ R AAP L  F RK A++ASE+ +K I T+
Sbjct  42   SAFRLFRVCSSATRWSQHANWRLPESFRAQTRIAAPRLEKFQRKFASIASEHAYKDILTT  101

Query  550  LPKPGGGEFGKFYSLPALNDP  612
            L KP  GE+GKFYSLPALNDP
Sbjct  102  LHKPDVGEYGKFYSLPALNDP  122



>ref|XP_008800034.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Phoenix dactylifera]
Length=997

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +1

Query  418  HGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLP  597
            H  DW+SP S  AQIRS+A V   F R+ ATMA+ N ++ I TSL KPGGGEFGK+YSLP
Sbjct  67   HFGDWRSPLSHRAQIRSSAAVAERFERRFATMATRNSYESILTSLSKPGGGEFGKYYSLP  126

Query  598  ALNDP  612
            ALNDP
Sbjct  127  ALNDP  131



>ref|XP_010943467.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Elaeis guineensis]
Length=995

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +1

Query  427  DWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALN  606
            DW+SP S  AQIR +A V   F R  ATMA+ N ++ I TSLPKPGGGEFGK+YSLPALN
Sbjct  68   DWRSPLSHRAQIRYSAAVAERFERYFATMATRNAYESILTSLPKPGGGEFGKYYSLPALN  127

Query  607  DP  612
            DP
Sbjct  128  DP  129



>ref|XP_010918136.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Elaeis guineensis]
Length=992

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +1

Query  418  HGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLP  597
            H  DW+SP S  AQIRS+A V + F R+ ATMA+ N ++ I +SL KPGGGEFGK+YSLP
Sbjct  62   HFGDWRSPLSHRAQIRSSAAVADRFERRFATMATRNSYESILSSLSKPGGGEFGKYYSLP  121

Query  598  ALNDP  612
            ALNDP
Sbjct  122  ALNDP  126



>ref|XP_008785050.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Phoenix dactylifera]
Length=998

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  427  DWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALN  606
            DW+SP S  AQIR +A V   F R   TMA+ N ++ I TSLPKPGGGEFGK+YSLPALN
Sbjct  69   DWRSPLSHRAQIRYSATVAERFERHFTTMATRNAYESILTSLPKPGGGEFGKYYSLPALN  128

Query  607  DP  612
            DP
Sbjct  129  DP  130



>ref|XP_009419582.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=1003

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 54/78 (69%), Gaps = 2/78 (3%)
 Frame = +1

Query  385  RSLRCSVP--RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPK  558
            RS    +P  R      W+SP    A+IRS+A V+  F RK+AT+A+EN FK + TSLPK
Sbjct  60   RSCSSYIPGSRVGLSTSWRSPIGPRARIRSSAAVIERFDRKMATVATENVFKDVLTSLPK  119

Query  559  PGGGEFGKFYSLPALNDP  612
             GGGE+GK+YSLPALNDP
Sbjct  120  TGGGEYGKYYSLPALNDP  137



>ref|XP_009399225.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=993

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +1

Query  421  GVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPA  600
            G DW+SP     +IRS++ V+  F RK+ T A+EN FK + TSLPKP GGE+GK+YSLPA
Sbjct  64   GSDWRSPIGPRPRIRSSSTVIQLFDRKMTTTATENVFKDVLTSLPKPEGGEYGKYYSLPA  123

Query  601  LNDP  612
            LNDP
Sbjct  124  LNDP  127



>ref|XP_006828850.1| hypothetical protein AMTR_s00001p00156400 [Amborella trichopoda]
 gb|ERM96266.1| hypothetical protein AMTR_s00001p00156400 [Amborella trichopoda]
Length=977

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  430  WKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALND  609
            W+SP S  A IRS+   L+ F R++ATMA++N ++ I TSLPKP GGEFGK+YSLP+LND
Sbjct  51   WRSPLSHRAFIRSSTINLDRFERRLATMATQNVYESILTSLPKPSGGEFGKYYSLPSLND  110

Query  610  P  612
            P
Sbjct  111  P  111



>ref|XP_009382046.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=986

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +1

Query  418  HGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLP  597
            H  D +SP S  A +RS+A V + F R+ ATMAS+N ++ I T+L KPGGGEFGK+Y LP
Sbjct  56   HLADLRSPISHRALVRSSAAVADRFERRFATMASKNSYESILTTLSKPGGGEFGKYYCLP  115

Query  598  ALNDP  612
            AL DP
Sbjct  116  ALTDP  120



>gb|EEC83022.1| hypothetical protein OsI_28099 [Oryza sativa Indica Group]
Length=396

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = +1

Query  454  AQIRSAAPVLNDFHRKIA-TMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            AQI + AP +   HR++A T A+E+PFK I T+LPKPGGGE+GKFYSLPALNDP
Sbjct  74   AQIGAVAPAVERVHRRMAATAAAEHPFKNILTTLPKPGGGEYGKFYSLPALNDP  127



>ref|XP_007020811.1| Aconitase 3 [Theobroma cacao]
 gb|EOY12336.1| Aconitase 3 [Theobroma cacao]
Length=951

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 46/69 (67%), Gaps = 7/69 (10%)
 Frame = +1

Query  406  PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKF  585
            PRWSHGVDW SP SL AQ+R A PV+  F R+IAT+ S +          +  G E+G+F
Sbjct  67   PRWSHGVDWNSPGSLRAQVRIAVPVMERFRRRIATIGSVDKSS-------QAWGREYGRF  119

Query  586  YSLPALNDP  612
            YSLPALNDP
Sbjct  120  YSLPALNDP  128



>ref|XP_004974379.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Setaria 
italica]
Length=892

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  442  ASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            A   AQI +A P +    R++AT A+E+ FK I TSLPKPGGGE+GKFYSLPALNDP
Sbjct  63   AGARAQIGAAVPAVERLQRRMATQATEHAFKNILTSLPKPGGGEYGKFYSLPALNDP  119



>ref|XP_008676648.1| PREDICTED: uncharacterized protein LOC100216599 isoform X1 [Zea 
mays]
Length=987

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  442  ASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            A   AQI +A P +  F R++AT A+ + FK I TSLPKPGGGE+GKFYSLPALNDP
Sbjct  65   AGARAQIGAAVPAVEQFQRRMATQATVHAFKDILTSLPKPGGGEYGKFYSLPALNDP  121



>ref|XP_009384004.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384006.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=977

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 49/70 (70%), Gaps = 1/70 (1%)
 Frame = +1

Query  403  VPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGK  582
            VPR SH  D +SP S  A +RS A V   F R+ ATMA+ N ++ I T+L KPGGG+FGK
Sbjct  43   VPR-SHLSDGRSPISHRALVRSYAAVAYRFERRFATMATRNSYESILTTLRKPGGGDFGK  101

Query  583  FYSLPALNDP  612
            +YSLPAL DP
Sbjct  102  YYSLPALTDP  111



>ref|XP_002445174.1| hypothetical protein SORBIDRAFT_07g005390 [Sorghum bicolor]
 gb|EES14669.1| hypothetical protein SORBIDRAFT_07g005390 [Sorghum bicolor]
Length=996

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = +1

Query  442  ASLTAQIRSAA-PVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            A   AQI +AA P +  F R++AT A+E+ FK I TSLPKPGGGE+GKFYSLPALNDP
Sbjct  73   AGARAQIGAAAVPAVERFQRRMATQATEHAFKDILTSLPKPGGGEYGKFYSLPALNDP  130



>gb|AAD25640.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
Length=898

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MASE+PFKGIFT+LPKPGGGEFGKFYSLPALNDP
Sbjct  1    MASEHPFKGIFTTLPKPGGGEFGKFYSLPALNDP  34



>gb|AAP30039.1| aconitase [Solanum pennellii]
Length=898

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+ENPFKGI T LPKPGGGEFGKFYSLPALNDP
Sbjct  1    MAAENPFKGILTVLPKPGGGEFGKFYSLPALNDP  34



>gb|AAO62410.1| aconitase [Solanum pennellii]
Length=898

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+ENPFKGI T LPKPGGGEFGKFYSLPALNDP
Sbjct  1    MAAENPFKGILTVLPKPGGGEFGKFYSLPALNDP  34



>gb|AAG28426.1|AF194945_1 cytosolic aconitase [Nicotiana tabacum]
Length=898

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+ENPFKGI T LPKPGGGEFGK+YSLPALNDP
Sbjct  1    MAAENPFKGILTVLPKPGGGEFGKYYSLPALNDP  34



>ref|XP_003573387.2| PREDICTED: putative aconitate hydratase, cytoplasmic [Brachypodium 
distachyon]
Length=987

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +1

Query  490  FHRK-IATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            FHR+ +AT A+E+ FK I TSLPKPGGGEFGKFYSLPALNDP
Sbjct  80   FHRRRMATSATEHAFKNILTSLPKPGGGEFGKFYSLPALNDP  121



>gb|AAC26045.1| aconitase-iron regulated protein 1 [Citrus limon]
Length=898

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA EN FKGI TSLPKPGGGEFGKF+SLPALNDP
Sbjct  1    MAPENAFKGILTSLPKPGGGEFGKFFSLPALNDP  34



>gb|KJB30565.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
 gb|KJB30568.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=898

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+E+PFK + TSLPKPGGGEFGKFYSLPALNDP
Sbjct  1    MAAEHPFKEVLTSLPKPGGGEFGKFYSLPALNDP  34



>emb|CBE71057.1| aconitate hydratase 3 [Citrus clementina]
Length=898

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA EN FKGI TSLPKPGGGEFGKF+SLPALNDP
Sbjct  1    MAPENAFKGILTSLPKPGGGEFGKFFSLPALNDP  34



>gb|ADM34980.1| cytosolic aconitase [Pyrus pyrifolia]
Length=898

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MASENPFK   TSLPKPGGGEFGKFYSLP+LNDP
Sbjct  1    MASENPFKPNLTSLPKPGGGEFGKFYSLPSLNDP  34



>sp|Q6YZX6.1|ACOC_ORYSJ RecName: Full=Putative aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase [Oryza sativa 
Japonica Group]
 dbj|BAD05751.1| putative Aconitate hydratase [Oryza sativa Japonica Group]
Length=898

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+E+PFK I T+LPKPGGGE+GKFYSLPALNDP
Sbjct  1    MAAEHPFKNILTTLPKPGGGEYGKFYSLPALNDP  34



>gb|KHN41224.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=903

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            + +ENPFKG  TSLPKPGGGEFGKFYSLP+LNDP
Sbjct  6    LTNENPFKGNLTSLPKPGGGEFGKFYSLPSLNDP  39



>gb|KHG08189.1| hypothetical protein F383_11434 [Gossypium arboreum]
Length=879

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+E+PFK + TSLPKPGGGEFGKFYSLPALNDP
Sbjct  1    MAAEHPFKEVLTSLPKPGGGEFGKFYSLPALNDP  34



>emb|CBE71058.1| aconitate hydratase 2 [Citrus clementina]
Length=898

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+E+PFK I T+LPKPGGGEFGKFYSLPALNDP
Sbjct  1    MAAEHPFKEILTALPKPGGGEFGKFYSLPALNDP  34



>sp|P49608.1|ACOC_CUCMA RecName: Full=Aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase [Cucurbita maxima]
 pir||T10101 aconitate hydratase (EC 4.2.1.3) - cucurbit
 dbj|BAA06108.1| aconitase [Cucurbita cv. Kurokawa Amakuri]
Length=898

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+ENPFK   TSLPKPGGGEFGK+YSLP+LNDP
Sbjct  1    MAAENPFKENLTSLPKPGGGEFGKYYSLPSLNDP  34



>ref|XP_011097878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum 
indicum]
Length=898

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MASE+PFK I T L KPGGGEFGKFYSLPALNDP
Sbjct  1    MASEHPFKEILTGLSKPGGGEFGKFYSLPALNDP  34



>ref|XP_010100637.1| Aconitate hydratase [Morus notabilis]
 gb|EXB83385.1| Aconitate hydratase [Morus notabilis]
Length=938

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 3/49 (6%)
 Frame = +1

Query  376  SAFRSLRC---SVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATM  513
            +A+RSL     SVPRWSHGV W SP +L +QIR+ APV+  F RKIA+M
Sbjct  50   AAYRSLSSAVRSVPRWSHGVHWNSPYTLRSQIRAVAPVIQQFQRKIASM  98



>ref|XP_008363093.1| PREDICTED: aconitate hydratase 1-like [Malus domestica]
Length=107

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDP
Sbjct  1    MAAANPFQKILTALEKPDGGEFGKYYSLPALNDP  34



>ref|XP_004287770.1| PREDICTED: aconitate hydratase 1 [Fragaria vesca subsp. vesca]
Length=898

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+ENPFK I  SL KP GGEFGK+YSLPALNDP
Sbjct  1    MAAENPFKSILKSLEKPDGGEFGKYYSLPALNDP  34



>gb|KFK30197.1| hypothetical protein AALP_AA7G230700 [Arabis alpina]
Length=898

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MASENPF+ IF +L KP GGEFG +YSLPALNDP
Sbjct  1    MASENPFRSIFKALEKPDGGEFGNYYSLPALNDP  34



>dbj|BAJ85661.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=984

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  493  HRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
             R++A   +E+ +  I TSLPKPGGGE+GKFYSLPALNDP
Sbjct  79   QRRMAASGTEHAYSNILTSLPKPGGGEYGKFYSLPALNDP  118



>ref|XP_007020807.1| Aconitase 3 [Theobroma cacao]
 gb|EOY12332.1| Aconitase 3 [Theobroma cacao]
Length=883

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 5/50 (10%)
 Frame = +1

Query  463  RSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            R  AP LN     +    SE+ FK I TSLPKPGG EFGKFYSLPALNDP
Sbjct  11   RLMAPQLN-----LGMKCSEHAFKAILTSLPKPGGEEFGKFYSLPALNDP  55



>ref|XP_006413195.1| hypothetical protein EUTSA_v10024325mg [Eutrema salsugineum]
 gb|ESQ54648.1| hypothetical protein EUTSA_v10024325mg [Eutrema salsugineum]
Length=962

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  514  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            ASE+ +K I TSLPKPGGGE+GK+YSLPALNDP
Sbjct  97   ASEHAYKDILTSLPKPGGGEYGKYYSLPALNDP  129



>emb|CAA58046.1| aconitase [Arabidopsis thaliana]
Length=919

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  502  IATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            +++MASENPF+ I  +L KP GGEFG +YSLPALNDP
Sbjct  20   LSSMASENPFRSILKALEKPDGGEFGNYYSLPALNDP  56



>emb|CAB36543.1| putative aconitase [Arabidopsis thaliana]
 emb|CAB79552.1| putative aconitase [Arabidopsis thaliana]
Length=907

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  502  IATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            +   ASE+ +K I TSLPKPGGGE+GK+YSLPALNDP
Sbjct  7    VKNAASEHSYKDILTSLPKPGGGEYGKYYSLPALNDP  43



>ref|XP_007046597.1| Aconitase 1 [Theobroma cacao]
 gb|EOX90754.1| Aconitase 1 [Theobroma cacao]
Length=900

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+ENPF  I  +L KPGGGEFGK+YSLPAL+DP
Sbjct  1    MATENPFNSILKTLEKPGGGEFGKYYSLPALDDP  34



>gb|KDO71343.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=898

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDP
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDP  34



>emb|CBE71056.1| aconitate hydratase 1 [Citrus clementina]
Length=900

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDP
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDP  34



>ref|XP_006467022.1| PREDICTED: aconitate hydratase 1 [Citrus sinensis]
Length=900

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDP
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDP  34



>gb|KDO71342.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=900

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDP
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDP  34



>gb|KDO71345.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=889

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDP
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDP  34



>gb|KDO71344.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=881

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDP
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDP  34



>emb|CDX69174.1| BnaC01g02790D [Brassica napus]
Length=901

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  514  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            ASENPF+ I  +L KPGGGEFG +YSLPALNDP
Sbjct  5    ASENPFRSILKALEKPGGGEFGNYYSLPALNDP  37



>ref|XP_009109264.1| PREDICTED: aconitate hydratase 1-like [Brassica rapa]
Length=898

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MASENPF+ I  +L KP GGEFG +YSLPALNDP
Sbjct  1    MASENPFRSILKTLEKPDGGEFGNYYSLPALNDP  34



>ref|XP_008242011.1| PREDICTED: aconitate hydratase 1 [Prunus mume]
Length=898

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDP
Sbjct  1    MATANPFQKILTALEKPDGGEFGKYYSLPALNDP  34



>ref|XP_007203240.1| hypothetical protein PRUPE_ppa001138mg [Prunus persica]
 gb|EMJ04439.1| hypothetical protein PRUPE_ppa001138mg [Prunus persica]
Length=898

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDP
Sbjct  1    MATANPFQKILTALEKPDGGEFGKYYSLPALNDP  34



>gb|AAL13084.1| putative aconitase [Prunus avium]
Length=902

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDP
Sbjct  1    MATANPFQKILTALEKPDGGEFGKYYSLPALNDP  34



>ref|NP_195308.1| aconitate hydratase 1 [Arabidopsis thaliana]
 sp|Q42560.2|ACO1_ARATH RecName: Full=Aconitate hydratase 1; Short=Aconitase 1; AltName: 
Full=Citrate hydro-lyase 1 [Arabidopsis thaliana]
 emb|CAA21469.1| cytoplasmatic aconitate hydratase (citrate hydro-lyase)(aconitase)(EC 
4.2.1.3) [Arabidopsis thaliana]
 emb|CAB81492.1| cytoplasmatic aconitate hydratase (citrate hydro-lyase)(aconitase)(EC 
4.2.1.3) [Arabidopsis thaliana]
 gb|AAL32850.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE86576.1| aconitate hydratase 1 [Arabidopsis thaliana]
Length=898

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MASENPF+ I  +L KP GGEFG +YSLPALNDP
Sbjct  1    MASENPFRSILKALEKPDGGEFGNYYSLPALNDP  34



>ref|XP_010446873.1| PREDICTED: aconitate hydratase 1 [Camelina sativa]
 ref|XP_010446874.1| PREDICTED: aconitate hydratase 1 [Camelina sativa]
Length=898

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MASENPF+ I  +L KP GGEFG +YSLPALNDP
Sbjct  1    MASENPFRSILKALEKPDGGEFGNYYSLPALNDP  34



>ref|XP_010437416.1| PREDICTED: aconitate hydratase 1-like [Camelina sativa]
Length=898

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MASENPF+ I  +L KP GGEFG +YSLPALNDP
Sbjct  1    MASENPFRSILKALEKPDGGEFGNYYSLPALNDP  34



>ref|XP_006285963.1| hypothetical protein CARUB_v10007484mg [Capsella rubella]
 gb|EOA18861.1| hypothetical protein CARUB_v10007484mg [Capsella rubella]
Length=898

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MASENPF+ I  +L KP GGEFG +YSLPALNDP
Sbjct  1    MASENPFRSILKALEKPDGGEFGNYYSLPALNDP  34



>ref|XP_009363442.1| PREDICTED: aconitate hydratase 1-like [Pyrus x bretschneideri]
Length=898

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDP
Sbjct  1    MAAANPFQKILTALEKPDGGEFGKYYSLPALNDP  34



>ref|XP_009337075.1| PREDICTED: aconitate hydratase 1-like [Pyrus x bretschneideri]
Length=898

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDP
Sbjct  1    MAAANPFQKILTALEKPDGGEFGKYYSLPALNDP  34



>ref|XP_008337967.1| PREDICTED: aconitate hydratase 1 [Malus domestica]
Length=898

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDP
Sbjct  1    MAAANPFQKILTALEKPDGGEFGKYYSLPALNDP  34



>ref|XP_010526818.1| PREDICTED: aconitate hydratase 1 [Tarenaya hassleriana]
Length=899

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MASENPF  IF +L +P GGEFGK+YSLP LNDP
Sbjct  1    MASENPFHSIFKTLERPDGGEFGKYYSLPDLNDP  34



>ref|XP_009344825.1| PREDICTED: aconitate hydratase 1 [Pyrus x bretschneideri]
Length=898

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MAS NPF+ I T+L +P GGEFGK+YSLPALNDP
Sbjct  1    MASANPFQKILTALERPDGGEFGKYYSLPALNDP  34



>ref|XP_009150005.1| PREDICTED: aconitate hydratase 1 [Brassica rapa]
Length=898

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MASENPF+ I  +L KP GGEFG +YSLPALNDP
Sbjct  1    MASENPFRSILKALEKPDGGEFGNYYSLPALNDP  34



>ref|XP_002445994.1| hypothetical protein SORBIDRAFT_06g000200 [Sorghum bicolor]
 gb|EES10322.1| hypothetical protein SORBIDRAFT_06g000200 [Sorghum bicolor]
Length=106

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  514  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            A+++ FK I  SLPKPGGGE+GKF+SLPALNDP
Sbjct  6    ATKHAFKSILASLPKPGGGEYGKFFSLPALNDP  38



>ref|XP_006425366.1| hypothetical protein CICLE_v10024840mg [Citrus clementina]
 gb|ESR38606.1| hypothetical protein CICLE_v10024840mg [Citrus clementina]
Length=900

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+ENPFK I  +L  P GGEFGK+YSLPALNDP
Sbjct  1    MATENPFKSILKTLQSPDGGEFGKYYSLPALNDP  34



>gb|KDO71346.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=807

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDP
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDP  34



>ref|XP_002460765.1| hypothetical protein SORBIDRAFT_02g034590 [Sorghum bicolor]
 gb|EER97286.1| hypothetical protein SORBIDRAFT_02g034590 [Sorghum bicolor]
Length=979

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +1

Query  496  RKIATMASENP-FKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            R +ATMA  N  F  + TSLPKPGGGE+GK+YSLPALNDP
Sbjct  72   RGLATMADGNSRFGHVLTSLPKPGGGEYGKYYSLPALNDP  111



>ref|XP_006412056.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 gb|ESQ53509.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
Length=898

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MASENPF+ I  +L KPGGGEFG +YSL ALNDP
Sbjct  1    MASENPFRCILKTLQKPGGGEFGNYYSLAALNDP  34



>gb|KHN41868.1| Aconitate hydratase 1 [Glycine soja]
Length=901

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGG-GEFGKFYSLPALNDP  612
            MA+ENPF  I T+L KPGG GEFGK++SLPALNDP
Sbjct  1    MATENPFNSILTTLEKPGGAGEFGKYFSLPALNDP  35



>ref|XP_010432222.1| PREDICTED: aconitate hydratase 1-like [Camelina sativa]
Length=898

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MAS+NPF+ I  +L KP GGEFG +YSLPALNDP
Sbjct  1    MASDNPFRSILKALEKPDGGEFGNYYSLPALNDP  34



>ref|XP_006412054.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 ref|XP_006412055.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 gb|ESQ53507.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 gb|ESQ53508.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
Length=763

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MASENPF+ I  +L KPGGGEFG +YSL ALNDP
Sbjct  1    MASENPFRCILKTLQKPGGGEFGNYYSLAALNDP  34



>gb|KDP23953.1| hypothetical protein JCGZ_25341 [Jatropha curcas]
Length=900

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            M +ENPF  I  +L KP GGEFGK+YSLPALNDP
Sbjct  1    MVNENPFTSILKTLEKPDGGEFGKYYSLPALNDP  34



>emb|CDY41626.1| BnaC03g62580D [Brassica napus]
Length=905

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            ++SENPF+ I  +L KP GGEFG +YSLPALNDP
Sbjct  8    LSSENPFRSILKTLEKPDGGEFGNYYSLPALNDP  41



>ref|XP_010113288.1| Aconitate hydratase 1 [Morus notabilis]
 gb|EXC35295.1| Aconitate hydratase 1 [Morus notabilis]
Length=977

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  520  ENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            ENPFK I  +L KP GGEFGK+YSLPALNDP
Sbjct  64   ENPFKSILKTLEKPDGGEFGKYYSLPALNDP  94



>ref|XP_008669746.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X1 [Zea mays]
 tpg|DAA38797.1| TPA: hypothetical protein ZEAMMB73_641300 [Zea mays]
Length=975

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 4/61 (7%)
 Frame = +1

Query  442  ASLTAQIRSAA---PVLNDFHR-KIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALND  609
            A L   + ++A   P  +  HR ++   A+++ FK I TSL KPGGGE+GKF+SLPALND
Sbjct  49   ARLVPDVTTSAKLQPRDDALHRIRVGVGATKHAFKRILTSLIKPGGGEYGKFFSLPALND  108

Query  610  P  612
            P
Sbjct  109  P  109



>gb|AES61065.2| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=895

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 1/37 (3%)
 Frame = +1

Query  502  IATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALND  609
            +AT+ SE+ FKGI T LPKPGGG E+GKF+SLP LND
Sbjct  1    MATLTSEHVFKGILTGLPKPGGGDEYGKFFSLPLLND  37



>ref|XP_002867051.1| aconitate hydratase, cytoplasmic [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43310.1| aconitate hydratase, cytoplasmic [Arabidopsis lyrata subsp. lyrata]
Length=868

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALND  609
            MASENPF+GI  +L KP  GEFG +YSLPALND
Sbjct  1    MASENPFRGILKALEKPDSGEFGNYYSLPALND  33



>gb|EMS45933.1| Putative aconitate hydratase, cytoplasmic [Triticum urartu]
Length=858

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  502  IATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            +A   +E+ +  I TSLPKP GGE+GKFYSLPALNDP
Sbjct  1    MAASGTEHAYNNILTSLPKPEGGEYGKFYSLPALNDP  37



>gb|KJB48278.1| hypothetical protein B456_008G061900 [Gossypium raimondii]
Length=900

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MAS NPF  I  +L KP GGEFGK+YSLPALNDP
Sbjct  1    MASANPFNSILKTLEKPQGGEFGKYYSLPALNDP  34



>gb|KHG25175.1| Aconitate hydratase, cytoplasmic [Gossypium arboreum]
Length=900

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MAS NPF  I  +L KP GGEFGK+YSLPALNDP
Sbjct  1    MASANPFNSILKTLEKPQGGEFGKYYSLPALNDP  34



>gb|KHG25176.1| Aconitate hydratase, cytoplasmic [Gossypium arboreum]
Length=929

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MAS NPF  I  +L KP GGEFGK+YSLPALNDP
Sbjct  1    MASANPFNSILKTLEKPQGGEFGKYYSLPALNDP  34



>emb|CDX75532.1| BnaA01g01700D [Brassica napus]
Length=925

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  502  IATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            +   ASENPF+ I  +L KP GGEFG +YSLPALNDP
Sbjct  25   VCVSASENPFRSILKALEKPDGGEFGSYYSLPALNDP  61



>ref|XP_002263337.1| PREDICTED: aconitate hydratase 1 [Vitis vinifera]
Length=900

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MAS NPF  I  +L KP GGEFGK+YSLPAL DP
Sbjct  1    MASSNPFASILKTLEKPAGGEFGKYYSLPALGDP  34



>ref|XP_003517155.1| PREDICTED: aconitate hydratase 1 [Glycine max]
Length=901

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGG-GEFGKFYSLPALNDP  612
            MA+ENPF  I  +L KPGG GEFGK++SLPALNDP
Sbjct  1    MATENPFNSILRTLEKPGGAGEFGKYFSLPALNDP  35



>ref|XP_006380559.1| hypothetical protein POPTR_0007s09260g [Populus trichocarpa]
 gb|ERP58356.1| hypothetical protein POPTR_0007s09260g [Populus trichocarpa]
Length=899

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 1/34 (3%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+ENPFK I  +L KPGG EFGK+YSLPALNDP
Sbjct  1    MANENPFKSILKTLEKPGG-EFGKYYSLPALNDP  33



>ref|XP_007157870.1| hypothetical protein PHAVU_002G105000g [Phaseolus vulgaris]
 gb|ESW29864.1| hypothetical protein PHAVU_002G105000g [Phaseolus vulgaris]
Length=901

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDP  612
            M +ENPF  I  +L KPGGG EFGK+YSLPALNDP
Sbjct  1    MVTENPFSSILRTLEKPGGGGEFGKYYSLPALNDP  35



>ref|XP_003537655.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Glycine max]
Length=901

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 1/34 (3%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGG-GEFGKFYSLPALND  609
            MA+ENPF  I T+L KPGG GEFGK++SLPALND
Sbjct  1    MATENPFNSILTTLEKPGGAGEFGKYFSLPALND  34



>ref|XP_010266897.1| PREDICTED: aconitate hydratase 1 [Nelumbo nucifera]
Length=900

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+ N ++ I  +L KPGGGEFGK+YSLPALNDP
Sbjct  1    MATRNVYESILKTLEKPGGGEFGKYYSLPALNDP  34



>ref|XP_008669747.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X2 [Zea mays]
 tpg|DAA38798.1| TPA: hypothetical protein ZEAMMB73_641300 [Zea mays]
Length=905

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  508  TMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            + A+++ FK I TSL KPGGGE+GKF+SLPALNDP
Sbjct  5    STATKHAFKRILTSLIKPGGGEYGKFFSLPALNDP  39



>gb|EMT33022.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=937

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  517  SENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            +E+ +  I TSLPKP GGE+GKFYSLPALNDP
Sbjct  40   TEHAYSNILTSLPKPEGGEYGKFYSLPALNDP  71



>ref|XP_008670445.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X2 [Zea mays]
 tpg|DAA40969.1| TPA: hypothetical protein ZEAMMB73_742994 [Zea mays]
Length=980

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 1/39 (3%)
 Frame = +1

Query  496  RKIATMAS-ENPFKGIFTSLPKPGGGEFGKFYSLPALND  609
            R +ATMA   + F  + TSLPKPGGGE+GK+YSLPALND
Sbjct  74   RGVATMADGSSRFGHVLTSLPKPGGGEYGKYYSLPALND  112



>ref|XP_008670444.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X1 [Zea mays]
Length=982

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 1/39 (3%)
 Frame = +1

Query  496  RKIATMAS-ENPFKGIFTSLPKPGGGEFGKFYSLPALND  609
            R +ATMA   + F  + TSLPKPGGGE+GK+YSLPALND
Sbjct  74   RGVATMADGSSRFGHVLTSLPKPGGGEYGKYYSLPALND  112



>ref|XP_006383042.1| aconitate hydratase family protein [Populus trichocarpa]
 gb|ERP60839.1| aconitate hydratase family protein [Populus trichocarpa]
Length=899

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 1/34 (3%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            M +ENPFK I  +L KPGG EFGK+YSLPALNDP
Sbjct  1    MVNENPFKSILKTLEKPGG-EFGKYYSLPALNDP  33



>ref|XP_011022256.1| PREDICTED: aconitate hydratase 1 [Populus euphratica]
Length=899

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 1/34 (3%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            M +ENPFK I  +L KPGG EFGK+YSLPALNDP
Sbjct  1    MVNENPFKSILKTLEKPGG-EFGKYYSLPALNDP  33



>ref|NP_001147431.1| aconitase2 [Zea mays]
 gb|ACG27495.1| aconitate hydratase, cytoplasmic [Zea mays]
 gb|ACN28210.1| unknown [Zea mays]
 gb|AFW57775.1| aconitate hydratase, cytoplasmic [Zea mays]
Length=905

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  514  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            A+++ FK I TSL KPGGGE+GKF+SLPALNDP
Sbjct  6    ATKHAFKRILTSLLKPGGGEYGKFFSLPALNDP  38



>ref|XP_008440877.1| PREDICTED: aconitate hydratase [Cucumis melo]
Length=900

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+ENPF  I  +L  P GG FGK+YSLPALNDP
Sbjct  1    MATENPFNSILKTLENPEGGVFGKYYSLPALNDP  34



>emb|CBI24446.3| unnamed protein product [Vitis vinifera]
Length=918

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  484  NDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            ++F ++    AS NPF  I  +L KP GGEFGK+YSLPAL DP
Sbjct  10   SNFSKRKNNYASSNPFASILKTLEKPAGGEFGKYYSLPALGDP  52



>ref|XP_001779205.1| predicted protein [Physcomitrella patens]
 gb|EDQ55968.1| predicted protein, partial [Physcomitrella patens]
Length=896

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  514  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            ASENPF  + T LPKP GG +GKFYSL  LNDP
Sbjct  1    ASENPFSSLITDLPKPDGGSYGKFYSLVKLNDP  33



>gb|KJB17578.1| hypothetical protein B456_003G006000 [Gossypium raimondii]
Length=896

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+EN F  I  +L KP GGEFGK+Y LPALNDP
Sbjct  1    MAAENAFNTILKTLEKPDGGEFGKYYCLPALNDP  34



>ref|XP_008661884.1| PREDICTED: aconitase2 isoform X1 [Zea mays]
Length=949

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  514  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            A+++ FK I TSL KPGGGE+GKF+SLPALNDP
Sbjct  67   ATKHAFKRILTSLLKPGGGEYGKFFSLPALNDP  99



>ref|NP_001048898.1| Os03g0136900 [Oryza sativa Japonica Group]
 gb|ABF93861.1| Aconitate hydratase, cytoplasmic, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF10812.1| Os03g0136900 [Oryza sativa Japonica Group]
Length=986

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +1

Query  490  FHRKIATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDP  612
            F R+ A+ A++N +  I T L KPGGG EFGK+YSLPAL+DP
Sbjct  81   FERRFASAAAKNSYDEILTGLAKPGGGAEFGKYYSLPALSDP  122



>gb|EEC74472.1| hypothetical protein OsI_09921 [Oryza sativa Indica Group]
Length=986

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +1

Query  490  FHRKIATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDP  612
            F R+ A+ A++N +  I T L KPGGG EFGK+YSLPAL+DP
Sbjct  81   FERRFASAAAKNSYDEILTGLAKPGGGAEFGKYYSLPALSDP  122



>gb|KCW56576.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=898

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALND  609
            MA ENPFK I  +L +PGGGEFG ++SLPAL D
Sbjct  1    MACENPFKSILKTLERPGGGEFGTYFSLPALGD  33



>ref|XP_010029634.1| PREDICTED: aconitate hydratase 1 [Eucalyptus grandis]
 gb|KCW56577.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=900

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALND  609
            MA ENPFK I  +L +PGGGEFG ++SLPAL D
Sbjct  1    MACENPFKSILKTLERPGGGEFGTYFSLPALGD  33



>ref|XP_004985790.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Setaria 
italica]
Length=986

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +1

Query  490  FHRKIATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDP  612
            F R+ A+ A++N +  I T L KPGGG EFGK+YSLPAL+DP
Sbjct  81   FERRFASAATKNSYDEILTGLGKPGGGEEFGKYYSLPALSDP  122



>emb|CDY24823.1| BnaA08g14870D [Brassica napus]
Length=922

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +1

Query  496  RKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            +++    SENPF+ I  +L KP GGEFG +YSL ALNDP
Sbjct  20   QELRIFTSENPFRSILKTLEKPDGGEFGNYYSLAALNDP  58



>ref|XP_010529315.1| PREDICTED: aconitate hydratase 1-like [Tarenaya hassleriana]
Length=901

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            M  ENPF+ I  +L +P GGE+GKF+SLP+LNDP
Sbjct  1    MDCENPFRRILKTLERPDGGEYGKFFSLPSLNDP  34



>ref|XP_003612247.1| Aconitate hydratase [Medicago truncatula]
 gb|AES95205.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=901

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 1/34 (3%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGG-EFGKFYSLPALND  609
            MA++NPF  I  +L KPGGG EFGK+YSLPALND
Sbjct  1    MATQNPFNNILKTLEKPGGGGEFGKYYSLPALND  34



>dbj|BAJ92965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=999

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +1

Query  490  FHRKIATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDP  612
            F R+ A+ A++N +  I TSL KPGGG +FGK+YSLPAL DP
Sbjct  93   FERRFASAATKNSYDEILTSLAKPGGGADFGKYYSLPALADP  134



>ref|XP_004512178.1| PREDICTED: aconitate hydratase 1-like [Cicer arietinum]
Length=901

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 1/34 (3%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGG-GEFGKFYSLPALND  609
            MA+ENPFK I  +L KPGG G FG +YSLPALND
Sbjct  1    MATENPFKSILKTLEKPGGDGHFGNYYSLPALND  34



>ref|XP_010033531.1| PREDICTED: aconitate hydratase 1-like [Eucalyptus grandis]
Length=903

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 1/35 (3%)
 Frame = +1

Query  511  MASENPF-KGIFTSLPKPGGGEFGKFYSLPALNDP  612
            M SENPF K I  +L KP GGEFGK+Y LPAL+DP
Sbjct  1    MGSENPFEKSILRTLEKPDGGEFGKYYYLPALDDP  35



>ref|XP_003590814.1| Aconitate hydratase [Medicago truncatula]
Length=924

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 1/32 (3%)
 Frame = +1

Query  517  SENPFKGIFTSLPKPGGG-EFGKFYSLPALND  609
            SE+ FKGI T LPKPGGG E+GKF+SLP LND
Sbjct  35   SEHVFKGILTGLPKPGGGDEYGKFFSLPLLND  66



>emb|CAN83844.1| hypothetical protein VITISV_003004 [Vitis vinifera]
Length=885

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 22/32 (69%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  517  SENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            S NPF  I  +L KP GGEFGK+YSLPAL DP
Sbjct  6    SSNPFASILKTLEKPXGGEFGKYYSLPALGDP  37



>ref|XP_008658754.1| PREDICTED: uncharacterized protein LOC100304315 isoform X1 [Zea 
mays]
Length=989

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +1

Query  490  FHRKIATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDP  612
            F R+ A+ A+ N +  I T L +PGGG EFGK+YSLPAL+DP
Sbjct  84   FERRFASAATRNSYDEILTGLGRPGGGEEFGKYYSLPALSDP  125



>ref|XP_002530635.1| aconitase, putative [Ricinus communis]
 gb|EEF31743.1| aconitase, putative [Ricinus communis]
Length=900

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            M +E+PFK I  +L K  GG FGK+YSLPALNDP
Sbjct  1    MVNESPFKSILKTLEKADGGAFGKYYSLPALNDP  34



>gb|KCW53221.1| hypothetical protein EUGRSUZ_J02488 [Eucalyptus grandis]
Length=930

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 27/37 (73%), Gaps = 1/37 (3%)
 Frame = +1

Query  505  ATMASENPF-KGIFTSLPKPGGGEFGKFYSLPALNDP  612
            A   SENPF K I  +L KP GGEFGK+Y LPAL+DP
Sbjct  26   AEQRSENPFEKSILRTLEKPDGGEFGKYYYLPALDDP  62



>ref|XP_004166975.1| PREDICTED: aconitate hydratase 1-like, partial [Cucumis sativus]
Length=466

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+ENPF  I  +L    GG FGK+YSLPALNDP
Sbjct  1    MATENPFNSILKTLENHEGGVFGKYYSLPALNDP  34



>ref|XP_003558862.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Brachypodium 
distachyon]
Length=994

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +1

Query  490  FHRKIATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDP  612
            F R+ A+ A++N +  I TSL KPGGG +FGK+YSLP L DP
Sbjct  88   FERRFASAATKNSYDEILTSLAKPGGGADFGKYYSLPRLADP  129



>ref|XP_004134842.1| PREDICTED: aconitate hydratase 1-like [Cucumis sativus]
Length=900

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+ENPF  I  +L    GG FGK+YSLPALNDP
Sbjct  1    MATENPFNSILKTLENHEGGVFGKYYSLPALNDP  34



>gb|KGN48958.1| Aconitase [Cucumis sativus]
Length=881

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  511  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            MA+ENPF  I  +L    GG FGK+YSLPALNDP
Sbjct  1    MATENPFNSILKTLENHEGGVFGKYYSLPALNDP  34



>ref|XP_002976825.1| hypothetical protein SELMODRAFT_443331 [Selaginella moellendorffii]
 gb|EFJ21935.1| hypothetical protein SELMODRAFT_443331 [Selaginella moellendorffii]
Length=949

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  493  HRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
             R+   M S +PF+ I TSL K  GGE+GK+YSLP L+DP
Sbjct  45   QRQEIAMVSGHPFESILTSLSKDDGGEYGKYYSLPDLHDP  84



>ref|XP_002980554.1| hypothetical protein SELMODRAFT_444572 [Selaginella moellendorffii]
 gb|EFJ18205.1| hypothetical protein SELMODRAFT_444572 [Selaginella moellendorffii]
Length=949

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  493  HRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDP  612
             R+   M S +PF+ I TSL K  GGE+GK+YSLP L+DP
Sbjct  45   QRQEIAMVSGHPFESILTSLSKDDGGEYGKYYSLPDLHDP  84



>ref|XP_002465901.1| hypothetical protein SORBIDRAFT_01g047850 [Sorghum bicolor]
 gb|ABE77202.1| putative aconitate hydratase 1 [Sorghum bicolor]
 gb|EER92899.1| hypothetical protein SORBIDRAFT_01g047850 [Sorghum bicolor]
Length=991

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 1/42 (2%)
 Frame = +1

Query  490  FHRKIATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDP  612
            F R+ A+ A+ N +  I T L +PG G EFGK+YSLPAL+DP
Sbjct  86   FERRFASAATRNTYDEILTGLKRPGAGDEFGKYYSLPALSDP  127



>gb|EMT24311.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=1009

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  529  FKGIFTSLPKPGGGEFGKFYSLPALNDP  612
            F    T LPKPGGGE+GKFYS+PALNDP
Sbjct  120  FAKTLTILPKPGGGEYGKFYSIPALNDP  147



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660