BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS008A05

Length=607
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009783913.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    182   8e-49   Nicotiana sylvestris
gb|AFD22619.1|  dicer-like 2 protein                                    181   3e-48   Nicotiana attenuata
ref|XP_009625898.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    180   5e-48   
emb|CDO96786.1|  unnamed protein product                                165   1e-44   Coffea canephora [robusta coffee]
ref|XP_010312608.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    167   1e-43   
emb|CDP06207.1|  unnamed protein product                                165   1e-43   Coffea canephora [robusta coffee]
emb|CDO96788.1|  unnamed protein product                                154   5e-40   Coffea canephora [robusta coffee]
ref|XP_008370841.1|  PREDICTED: endoribonuclease Dicer homolog 2        153   1e-38   
ref|XP_009361581.1|  PREDICTED: endoribonuclease Dicer homolog 2        152   2e-38   
ref|XP_002315119.1|  hypothetical protein POPTR_0010s18870g             152   2e-38   
ref|XP_009340367.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    152   2e-38   Pyrus x bretschneideri [bai li]
ref|XP_006300010.1|  hypothetical protein CARUB_v10016233mg             152   2e-38   
ref|XP_011015099.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    151   6e-38   Populus euphratica
ref|XP_011015091.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    151   6e-38   Populus euphratica
ref|XP_011015068.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    151   6e-38   Populus euphratica
emb|CDO96789.1|  unnamed protein product                                149   9e-38   Coffea canephora [robusta coffee]
emb|CDP04170.1|  unnamed protein product                                149   2e-37   Coffea canephora [robusta coffee]
ref|XP_002514810.1|  ATP binding protein, putative                      149   2e-37   
ref|XP_011084676.1|  PREDICTED: endoribonuclease Dicer homolog 2        149   3e-37   Sesamum indicum [beniseed]
ref|XP_008218472.1|  PREDICTED: endoribonuclease Dicer homolog 2        149   4e-37   Prunus mume [ume]
emb|CDY50692.1|  BnaC05g47910D                                          149   4e-37   Brassica napus [oilseed rape]
ref|XP_002312197.1|  hypothetical protein POPTR_0008s07580g             149   4e-37   
ref|XP_006480493.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    147   9e-37   Citrus sinensis [apfelsine]
ref|XP_006428679.1|  hypothetical protein CICLE_v10010912mg             147   9e-37   Citrus clementina [clementine]
emb|CDY43132.1|  BnaA05g32540D                                          147   1e-36   Brassica napus [oilseed rape]
ref|XP_010508629.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    147   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010508779.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    147   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010508928.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    147   1e-36   
ref|XP_009130358.1|  PREDICTED: endoribonuclease Dicer homolog 2        147   1e-36   
ref|XP_006408318.1|  hypothetical protein EUTSA_v10019898mg             145   6e-36   Eutrema salsugineum [saltwater cress]
ref|XP_008240740.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    143   1e-35   Prunus mume [ume]
ref|XP_007208392.1|  hypothetical protein PRUPE_ppa000240mg             144   1e-35   
ref|XP_010549772.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    144   1e-35   Tarenaya hassleriana [spider flower]
ref|XP_010549776.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    144   1e-35   Tarenaya hassleriana [spider flower]
ref|NP_001078101.1|  endoribonuclease Dicer-like 2                      144   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566199.4|  endoribonuclease Dicer-like 2                         144   1e-35   Arabidopsis thaliana [mouse-ear cress]
gb|ABF19798.1|  dicer-like 2 spliceform 2                               144   1e-35   Arabidopsis thaliana [mouse-ear cress]
gb|ABF19797.1|  dicer-like 2 spliceform 1                               144   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010485670.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    144   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010312607.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    144   2e-35   
ref|XP_010485666.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    143   2e-35   Camelina sativa [gold-of-pleasure]
gb|AAF26098.1|AC012328_1  unknown protein                               144   3e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010485668.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    143   3e-35   Camelina sativa [gold-of-pleasure]
ref|XP_007217819.1|  hypothetical protein PRUPE_ppa027063mg             140   7e-35   
ref|XP_011006570.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    142   1e-34   Populus euphratica
ref|XP_002884369.1|  hypothetical protein ARALYDRAFT_317213             142   1e-34   
gb|KJB14793.1|  hypothetical protein B456_002G143000                    141   2e-34   Gossypium raimondii
gb|ACE60552.1|  dicer-like protein 2                                    140   4e-34   Brassica rapa
gb|KCW84635.1|  hypothetical protein EUGRSUZ_B01461                     139   6e-34   Eucalyptus grandis [rose gum]
ref|XP_010038609.1|  PREDICTED: endoribonuclease Dicer homolog 2        139   6e-34   Eucalyptus grandis [rose gum]
gb|KHG30499.1|  hypothetical protein F383_12835                         139   9e-34   Gossypium arboreum [tree cotton]
ref|XP_011466081.1|  PREDICTED: endoribonuclease Dicer homolog 2        137   4e-33   Fragaria vesca subsp. vesca
ref|XP_007029211.1|  Dicer-like protein isoform 4                       134   2e-32   
gb|EYU39730.1|  hypothetical protein MIMGU_mgv1a0003142mg               135   2e-32   Erythranthe guttata [common monkey flower]
ref|XP_007029213.1|  Dicer-like protein isoform 6                       135   2e-32   
gb|KDO45679.1|  hypothetical protein CISIN_1g0030621mg                  131   2e-32   Citrus sinensis [apfelsine]
ref|XP_007029209.1|  Dicer-like protein isoform 2                       134   3e-32   
ref|XP_007029208.1|  Dicer-like protein isoform 1                       134   3e-32   
ref|XP_007216896.1|  hypothetical protein PRUPE_ppa019601mg             132   6e-32   
ref|XP_007216887.1|  hypothetical protein PRUPE_ppa020875mg             132   9e-32   
emb|CAN77284.1|  hypothetical protein VITISV_043738                     133   9e-32   Vitis vinifera
ref|XP_008240779.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    132   9e-32   Prunus mume [ume]
ref|XP_006480488.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    132   2e-31   
ref|XP_006428678.1|  hypothetical protein CICLE_v10010911mg             132   2e-31   Citrus clementina [clementine]
ref|XP_006480490.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    132   2e-31   Citrus sinensis [apfelsine]
ref|XP_010649218.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    132   2e-31   Vitis vinifera
ref|XP_010649214.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    132   2e-31   Vitis vinifera
ref|XP_010649215.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    132   2e-31   Vitis vinifera
ref|XP_010649216.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    132   2e-31   Vitis vinifera
emb|CBI17597.3|  unnamed protein product                                132   2e-31   Vitis vinifera
ref|XP_010312606.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    130   1e-30   Solanum lycopersicum
gb|KJB61696.1|  hypothetical protein B456_009G374900                    129   1e-30   Gossypium raimondii
gb|KJB61693.1|  hypothetical protein B456_009G374900                    129   2e-30   Gossypium raimondii
gb|KJB61692.1|  hypothetical protein B456_009G374900                    129   2e-30   Gossypium raimondii
ref|XP_004303843.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    123   3e-28   Fragaria vesca subsp. vesca
ref|XP_010101236.1|  Endoribonuclease Dicer-2-like protein              121   1e-27   
ref|XP_008392375.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    120   1e-27   
ref|XP_008351646.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    120   2e-27   
ref|XP_008443676.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    120   2e-27   Cucumis melo [Oriental melon]
ref|XP_008443674.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    120   2e-27   Cucumis melo [Oriental melon]
ref|XP_008443675.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    120   2e-27   
ref|XP_008443670.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    120   2e-27   Cucumis melo [Oriental melon]
gb|KHG30500.1|  hypothetical protein F383_12835                         117   3e-26   Gossypium arboreum [tree cotton]
ref|XP_004139098.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    114   4e-25   Cucumis sativus [cucumbers]
ref|XP_004171378.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    110   4e-25   
gb|KEH20231.1|  endoribonuclease dicer-like protein                     113   5e-25   Medicago truncatula
gb|KEH42074.1|  endoribonuclease dicer-like protein                     111   3e-24   Medicago truncatula
gb|AES64802.2|  endoribonuclease dicer-like protein                     110   6e-24   Medicago truncatula
ref|XP_009348591.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    108   7e-24   
ref|XP_003594551.1|  Endoribonuclease Dicer                             110   7e-24   
ref|XP_010249398.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    109   1e-23   Nelumbo nucifera [Indian lotus]
ref|XP_010249397.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    109   1e-23   Nelumbo nucifera [Indian lotus]
ref|XP_009348590.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    108   1e-23   Pyrus x bretschneideri [bai li]
ref|XP_003535104.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    109   2e-23   Glycine max [soybeans]
ref|XP_008373031.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    107   5e-23   
ref|XP_008373030.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    107   6e-23   
ref|XP_010673887.1|  PREDICTED: endoribonuclease Dicer homolog 2        107   8e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007147466.1|  hypothetical protein PHAVU_006G127100g             105   4e-22   Phaseolus vulgaris [French bean]
ref|XP_010088523.1|  Endoribonuclease Dicer-2-like protein              103   9e-22   
ref|XP_004486471.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    103   2e-21   Cicer arietinum [garbanzo]
gb|KFK39865.1|  hypothetical protein AALP_AA3G298800                    100   1e-20   Arabis alpina [alpine rockcress]
ref|XP_007147294.1|  hypothetical protein PHAVU_006G111800g             100   1e-20   Phaseolus vulgaris [French bean]
gb|ACU23800.1|  unknown                                               95.1    6e-20   Glycine max [soybeans]
ref|XP_007147469.1|  hypothetical protein PHAVU_006G127200g           98.6    7e-20   Phaseolus vulgaris [French bean]
ref|XP_003553782.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  97.1    1e-19   Glycine max [soybeans]
gb|KHN43108.1|  Endoribonuclease Dicer like 2                         97.1    1e-19   Glycine soja [wild soybean]
ref|XP_006604892.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  97.1    2e-19   Glycine max [soybeans]
ref|XP_006586847.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  97.4    2e-19   Glycine max [soybeans]
ref|XP_006586846.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  97.4    2e-19   Glycine max [soybeans]
ref|XP_003534774.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  97.4    2e-19   Glycine max [soybeans]
gb|KHN23014.1|  Endoribonuclease Dicer like 2                         97.4    2e-19   Glycine soja [wild soybean]
ref|XP_010312604.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  96.7    4e-19   Solanum lycopersicum
ref|XP_006844770.1|  hypothetical protein AMTR_s00016p00258500        96.3    4e-19   
ref|XP_007140643.1|  hypothetical protein PHAVU_008G129500g           92.8    6e-18   Phaseolus vulgaris [French bean]
ref|XP_007029210.1|  Dicer-like protein isoform 3                     88.6    2e-16   
ref|XP_007029212.1|  Dicer-like protein isoform 5                     88.2    2e-16   
ref|XP_007029214.1|  Dicer-like protein isoform 7                     88.2    2e-16   
ref|XP_008681083.1|  PREDICTED: uncharacterized protein LOC100192...  83.2    9e-15   
ref|XP_008681082.1|  PREDICTED: uncharacterized protein LOC100192...  83.2    1e-14   Zea mays [maize]
ref|XP_008681081.1|  PREDICTED: uncharacterized protein LOC100192...  83.2    1e-14   
ref|XP_010229604.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...  82.4    2e-14   
ref|XP_010233062.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  80.9    6e-14   
ref|XP_010233057.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  80.5    8e-14   
ref|XP_004982514.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  78.2    5e-13   Setaria italica
ref|XP_004982513.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  78.2    5e-13   Setaria italica
gb|AAS07190.1|  putative ribonuclease III, 5'-partial (with alter...  76.6    7e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002464290.1|  hypothetical protein SORBIDRAFT_01g015670        77.4    8e-13   
gb|AAS07189.1|  putative ribonuclease III, 5'-partial (with alter...  76.6    1e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EEE59414.1|  hypothetical protein OsJ_11564                        76.6    2e-12   Oryza sativa Japonica Group [Japonica rice]
sp|Q69LX2.2|DCL2B_ORYSJ  RecName: Full=Endoribonuclease Dicer hom...  76.3    2e-12   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD34005.1|  CAF protein-like                                     76.3    2e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006651573.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  76.3    2e-12   Oryza brachyantha
gb|EMS67762.1|  Endoribonuclease Dicer-like protein 2a                75.1    2e-12   Triticum urartu
gb|EEC75643.1|  hypothetical protein OsI_12390                        75.9    2e-12   Oryza sativa Indica Group [Indian rice]
ref|NP_001050564.1|  Os03g0583900                                     75.9    2e-12   
gb|AFW68290.1|  hypothetical protein ZEAMMB73_539070                  69.7    2e-10   
ref|XP_002464288.1|  hypothetical protein SORBIDRAFT_01g015663        67.0    3e-10   
gb|AFW68292.1|  hypothetical protein ZEAMMB73_963828                  65.9    6e-10   
ref|XP_004982512.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  65.9    4e-09   
ref|XP_004982509.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  65.9    4e-09   Setaria italica
ref|XP_004982510.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  65.9    4e-09   Setaria italica
ref|XP_008644681.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  65.1    5e-09   Zea mays [maize]
ref|XP_008644679.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  65.5    5e-09   Zea mays [maize]
ref|XP_008644676.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  65.1    6e-09   Zea mays [maize]
ref|XP_004982511.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  59.3    4e-07   Setaria italica
gb|AAS07188.1|  putative ribonuclease III, 5'-partial (with alter...  53.9    2e-05   Oryza sativa Japonica Group [Japonica rice]



>ref|XP_009783913.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2-like [Nicotiana sylvestris]
Length=1403

 Score =   182 bits (462),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 139/206 (67%), Gaps = 7/206 (3%)
 Frame = +1

Query  4    ISQLGCQ------PKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  165
            I +LGCQ       KYFPPELV    N  +T+Y CY+++L    Y   QL+ I+LA+RTR
Sbjct  647  IKELGCQISTDEESKYFPPELVSHCANDTETVYYCYVVDLQHDSYSSYQLRGIVLAVRTR  706

Query  166  LESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDE  345
            L+ DDE L+F+L+++ G+ + Q  Y G V L++E+ILRC+RFQV++ R+L + +L+ L +
Sbjct  707  LKFDDERLTFDLDVDKGSLLVQVNYSGVVRLTSEEILRCQRFQVSLFRILLDRDLSKLQD  766

Query  346  ALGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGC  525
            AL  + L  GSAV DYLLLP S+  +  P+I+W  ++SVLF       +H D CS++   
Sbjct  767  ALAAVQLPVGSAVSDYLLLP-SLGSTQNPQINWECVNSVLFPSLVLGDKHIDCCSTQGCK  825

Query  526  RPMHTKNGLLFSCLLESSLVSTPHNG  603
            R ++TK G++ SC+LE+SLV TPHNG
Sbjct  826  RSVNTKTGVVCSCMLENSLVCTPHNG  851



>gb|AFD22619.1| dicer-like 2 protein [Nicotiana attenuata]
Length=1403

 Score =   181 bits (458),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 138/206 (67%), Gaps = 7/206 (3%)
 Frame = +1

Query  4    ISQLGCQP------KYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  165
            I +LGCQ       KYFPPELV    N  + +Y CY ++L    Y   QL  IILA+RTR
Sbjct  647  IKELGCQIYTDEELKYFPPELVSHCANDTEAVYYCYEVDLQHDSYSSYQLCGIILAVRTR  706

Query  166  LESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDE  345
            L+ DDE L+F+L+++ G+ + Q  Y G V L++E++LRC+RFQV++ R+L + +L+ L++
Sbjct  707  LKFDDERLTFDLDVDKGSLLVQVNYSGVVRLTSEEVLRCQRFQVSLFRILLDRDLSKLED  766

Query  346  ALGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGC  525
            AL  + L  GSAV DYLLLP S+  +  P+I+W  ++SVLF  Q    +H D CS++   
Sbjct  767  ALAAVQLPVGSAVSDYLLLP-SLGSTQNPQINWECVNSVLFPSQVLGDKHIDCCSTQGRK  825

Query  526  RPMHTKNGLLFSCLLESSLVSTPHNG  603
            R ++TK G++ SC+LE+SLV TPHNG
Sbjct  826  RSVNTKTGVVCSCMLENSLVCTPHNG  851



>ref|XP_009625898.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2-like [Nicotiana tomentosiformis]
Length=1403

 Score =   180 bits (456),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 94/206 (46%), Positives = 137/206 (67%), Gaps = 7/206 (3%)
 Frame = +1

Query  4    ISQLGCQ------PKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  165
            + +LGCQ       KYFPPELV    N  + +Y CY+++L    Y   QL+ IILA+RTR
Sbjct  647  VKELGCQIYTDEESKYFPPELVSHCANDTEAVYYCYVVDLQHDSYSNYQLRGIILAVRTR  706

Query  166  LESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDE  345
            L+ DDE L F+L+++ G+ + Q  Y G V L++E+ILRC+RFQV++ R+L + +L+ L +
Sbjct  707  LKLDDERLIFDLDVDNGSLLVQVNYSGVVRLTSEEILRCQRFQVSLFRILLDRDLSKLQD  766

Query  346  ALGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGC  525
            AL  + L  GSAV DYLLLP S+  +  P+I+W  ++SVLF  Q    +H D CS++   
Sbjct  767  ALSAVQLPVGSAVSDYLLLP-SLGSTQNPQINWECVNSVLFPSQVLGDKHIDCCSTQGRK  825

Query  526  RPMHTKNGLLFSCLLESSLVSTPHNG  603
            R ++ K G++ SC+LE+SLV TPHNG
Sbjct  826  RSVNIKTGVVCSCMLENSLVCTPHNG  851



>emb|CDO96786.1| unnamed protein product [Coffea canephora]
Length=478

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 121/191 (63%), Gaps = 1/191 (1%)
 Frame = +1

Query  31   YFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFELNIE  210
            Y P ELVG   N  +TLY CYLI L   +   T+  +I+LA R RLE DDE L+FEL+++
Sbjct  61   YVPSELVGCPGNDSETLYHCYLIALQPDFSCDTKPHDILLARRARLEFDDETLTFELDVD  120

Query  211  GGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSAVID  390
             G    +  YI  + L++E+++ C++FQVT+LR+L +HN   L EAL  LN      V D
Sbjct  121  RGKLKIRMNYIRQIKLTSEEVVLCQKFQVTLLRLLLDHNQKKLKEALSGLNRNSQRDVFD  180

Query  391  YLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFSCLL  570
            YLL+PS+  P + P IDW  +SSVLF  +    +H D CS+R   R +HT +GL+  C L
Sbjct  181  YLLIPST-GPHENPSIDWTCVSSVLFPQENMSDKHMDGCSNRVQGRYVHTIDGLICCCTL  239

Query  571  ESSLVSTPHNG  603
            ++SLV TPH+G
Sbjct  240  QNSLVVTPHDG  250



>ref|XP_010312608.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2-like [Solanum lycopersicum]
Length=1406

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/195 (47%), Positives = 127/195 (65%), Gaps = 4/195 (2%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            + KYFPPELV    N  + +Y CYL+E+    Y   +L  IILA+RTRL+ DDE L+F+L
Sbjct  660  ESKYFPPELVSHCSNDSEAVYYCYLVEMQHASYNDFELHGIILAVRTRLKCDDEILAFDL  719

Query  202  NIE-GGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  378
            +++  G    Q  Y   V L+ E+I RC+RFQV+V R+L + +L+ L +ALG +    GS
Sbjct  720  DVDRRGLLQVQLNYSKVVTLTAEEIRRCQRFQVSVFRILLDRDLSILQDALGAVQSPIGS  779

Query  379  AVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLF  558
            AV DYLLLPS       P+I+W  ++S+LF  Q    +H D CS++   R ++TKNGL+ 
Sbjct  780  AVSDYLLLPSL---GSTPEINWKCVNSLLFPSQALGDKHMDWCSTQDRKRSVNTKNGLVC  836

Query  559  SCLLESSLVSTPHNG  603
            SC+LE+SLV TPHNG
Sbjct  837  SCMLENSLVFTPHNG  851



>emb|CDP06207.1| unnamed protein product [Coffea canephora]
Length=761

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 122/194 (63%), Gaps = 1/194 (1%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            Q  Y P ELVG   N  + LY CYLI L   +   T   +I+LA R+RLE DDE L+FEL
Sbjct  21   QKHYVPWELVGRPGNDSEILYHCYLIALEPGFSCDTMPHDILLATRSRLEFDDETLTFEL  80

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
            +++ GN   +  Y+  + L++E++L C++FQV +LR+L +HN N L EAL  LN      
Sbjct  81   DVDRGNLKIRMKYVRHIKLTSEEVLLCQKFQVALLRLLLDHNQNKLQEALSGLNQNSQRD  140

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
            V DYLL+PS+    + P IDW  +SSVLF  +    +H D CS+R   R +HT NGL+ S
Sbjct  141  VFDYLLIPST-GLHENPSIDWTCVSSVLFPQENISDKHMDCCSNRVQGRYVHTVNGLICS  199

Query  562  CLLESSLVSTPHNG  603
            C L++SLV TPH+G
Sbjct  200  CTLQNSLVVTPHDG  213



>emb|CDO96788.1| unnamed protein product [Coffea canephora]
Length=726

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 84/192 (44%), Positives = 118/192 (61%), Gaps = 4/192 (2%)
 Frame = +1

Query  28   KYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFELNI  207
            +Y P ELVG   N  +TLY CY I L   +   T   +I+LA R RLE DDE L+FEL++
Sbjct  2    QYVPSELVGCPGNESETLYHCYQIALQPDFSCNTMPHDILLATRARLEFDDETLNFELDV  61

Query  208  EGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSAVI  387
              G+   +  Y+  + L++E+++ C++FQVT+LR+L +HN N L EAL  LN      V 
Sbjct  62   PRGSLKIRMKYVRRIKLASEEVVLCQKFQVTLLRLLLDHNQNKLKEALSGLNRNSQRDVF  121

Query  388  DYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFSCL  567
            DYLL+PS+  P + P IDW  +SSVLF       +H   CS+R     +HT +GL+  C 
Sbjct  122  DYLLIPST-SPHENPSIDWKCVSSVLFPQGNMSDKHMHGCSNR---VQVHTIDGLICRCT  177

Query  568  LESSLVSTPHNG  603
            L++SLV TPH+G
Sbjct  178  LQNSLVVTPHDG  189



>ref|XP_008370841.1| PREDICTED: endoribonuclease Dicer homolog 2 [Malus domestica]
 ref|XP_008370842.1| PREDICTED: endoribonuclease Dicer homolog 2 [Malus domestica]
Length=1397

 Score =   153 bits (387),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 128/207 (62%), Gaps = 10/207 (5%)
 Frame = +1

Query  10   QLGCQP------KYFPPELVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRL  168
            +LG +P       Y P ELV     N P  LY CYLIELN+ +     + NI+L +R+ L
Sbjct  640  ELGSEPYDDVQCSYVPIELVKPFCSNDPSILYHCYLIELNQNFEYDIPVHNIVLGMRSEL  699

Query  169  ESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEA  348
            + D  N  F+L +  G+      Y+G++ L++EQ+L CRRFQ+T+ ++L +HNLN L E 
Sbjct  700  DCDIANPHFDLEVGRGSVTVNFKYVGEIHLNSEQVLLCRRFQITIFQILIDHNLNKLGEV  759

Query  349  LGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGC-  525
            L  L+   G+  IDYLLLP +    +   IDW  ++SVLF+ ++  + H + CS+ +GC 
Sbjct  760  LDGLS-SGGNVGIDYLLLPGTRIHQEAVIIDWRCVTSVLFASEEYSNDHVN-CSTLNGCS  817

Query  526  RPMHTKNGLLFSCLLESSLVSTPHNGN  606
            R +HTK GL+ +C++++SLV TPHNG 
Sbjct  818  RLVHTKQGLVCTCMIQNSLVCTPHNGT  844



>ref|XP_009361581.1| PREDICTED: endoribonuclease Dicer homolog 2 [Pyrus x bretschneideri]
 ref|XP_009361582.1| PREDICTED: endoribonuclease Dicer homolog 2 [Pyrus x bretschneideri]
Length=1410

 Score =   152 bits (385),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 124/207 (60%), Gaps = 10/207 (5%)
 Frame = +1

Query  10   QLGCQP------KYFPPELVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRL  168
            +LG +P       Y P ELV     N P  LY CYLIELN+ +     + NI+L +R  L
Sbjct  640  ELGSEPYDDAQCSYVPIELVKPFCSNDPSILYHCYLIELNQNFEYDIPVHNIVLGMRCEL  699

Query  169  ESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEA  348
            + D  N  F+L +  G+      Y+G + L++EQ+L CRRFQ+T+ R+L +HNLN L + 
Sbjct  700  DCDIANTHFDLEVGRGSLTVNFKYVGGIHLNSEQVLLCRRFQITIFRILIDHNLNKLGKV  759

Query  349  LGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGC-  525
            L  L    G+  IDYLLLP +    +   IDW  ++SVLF+ ++    H + CS+ +GC 
Sbjct  760  LDGL-CSGGNVGIDYLLLPGTRIHQEAVIIDWRCVTSVLFASEEYSKDHVN-CSTHNGCS  817

Query  526  RPMHTKNGLLFSCLLESSLVSTPHNGN  606
            R +HTK GL+ +C++++SLV TPHNG 
Sbjct  818  RLVHTKQGLVCTCMIQNSLVCTPHNGT  844



>ref|XP_002315119.1| hypothetical protein POPTR_0010s18870g [Populus trichocarpa]
 gb|EEF01290.1| hypothetical protein POPTR_0010s18870g [Populus trichocarpa]
Length=1408

 Score =   152 bits (385),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/196 (45%), Positives = 115/196 (59%), Gaps = 6/196 (3%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD-ENLSFE  198
            QP Y PPEL        +T Y CYLIELN+ +     + +I+L +RT LESD   ++ FE
Sbjct  659  QPIYLPPELASQGPRNLKTKYYCYLIELNQKFDYGVPVHDIVLVMRTELESDVLSSMGFE  718

Query  199  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  378
            L  E G       YIGD+ L    +L CRRFQ+T+  VL    +N L+E L  L L  G 
Sbjct  719  LEAERGLLAVSLRYIGDIYLDQVPVLLCRRFQITLFEVLIHREVNKLEEVLKGLELGTG-  777

Query  379  AVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLF  558
             V+DY LLP+    S  P IDW  ISSVLFSY+  +H    +CSS+     +HTK G + 
Sbjct  778  VVMDYFLLPAIRSRSQ-PSIDWEPISSVLFSYKNEDHF---NCSSKGNAHVVHTKGGPVC  833

Query  559  SCLLESSLVSTPHNGN  606
            +C+L++SLV TPHNGN
Sbjct  834  TCVLQNSLVCTPHNGN  849



>ref|XP_009340367.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Pyrus x bretschneideri]
 ref|XP_009340372.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Pyrus x bretschneideri]
Length=1397

 Score =   152 bits (385),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 124/207 (60%), Gaps = 10/207 (5%)
 Frame = +1

Query  10   QLGCQP------KYFPPELVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRL  168
            +LG +P       Y P ELV     N P  LY CYLIELN+ +     + NI+L +R  L
Sbjct  640  ELGSEPYDDAQCSYVPIELVKPFCSNDPSILYHCYLIELNQNFEYDIPVHNIVLGMRCEL  699

Query  169  ESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEA  348
            + D  N  F+L +  G+      Y+G + L++EQ+L CRRFQ+T+ R+L +HNLN L + 
Sbjct  700  DCDIANTHFDLEVGRGSLTVNFKYVGGIHLNSEQVLLCRRFQITIFRILIDHNLNKLGKV  759

Query  349  LGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGC-  525
            L  L    G+  IDYLLLP +    +   IDW  ++SVLF+ ++    H + CS+ +GC 
Sbjct  760  LDGL-CSGGNVGIDYLLLPGTRIHQEAVIIDWRCVTSVLFASEEYSKDHVN-CSTHNGCS  817

Query  526  RPMHTKNGLLFSCLLESSLVSTPHNGN  606
            R +HTK GL+ +C++++SLV TPHNG 
Sbjct  818  RLVHTKQGLVCTCMIQNSLVCTPHNGT  844



>ref|XP_006300010.1| hypothetical protein CARUB_v10016233mg, partial [Capsella rubella]
 gb|EOA32908.1| hypothetical protein CARUB_v10016233mg, partial [Capsella rubella]
Length=1392

 Score =   152 bits (385),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/194 (42%), Positives = 115/194 (59%), Gaps = 3/194 (2%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP YFPPELV      PQT Y  YLI +     ++  L +++L  R  LE D  N  F+L
Sbjct  658  QPCYFPPELVSQFSAQPQTTYHFYLIRMEPNSPRKIHLNDVLLGTRVELEDDIGNTGFQL  717

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
                G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L EAL  L+L DG A
Sbjct  718  EDHKGTIAVTLSYVGAFHLTQEEVLMCRRFQITLFRVLLDHSVENLMEALDGLHLRDGVA  777

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             +DYLL+PS+    +   IDW +I SV  ++ K   +H   CS+    R +HTK+GLL +
Sbjct  778  -LDYLLVPSTYS-HETSLIDWAVIRSVNLTFNKALEKHIH-CSTSGASRMLHTKDGLLCT  834

Query  562  CLLESSLVSTPHNG  603
            C+L+++LV TPHNG
Sbjct  835  CVLQNALVYTPHNG  848



>ref|XP_011015099.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X4 [Populus 
euphratica]
Length=1407

 Score =   151 bits (381),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 115/196 (59%), Gaps = 6/196 (3%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD-ENLSFE  198
            QP Y PPEL        +T Y CYLIELN+ +     + +I+L +RT LESD   ++ FE
Sbjct  660  QPIYLPPELASQGPRNLKTKYYCYLIELNQKFDYGVPVHDIVLVMRTELESDVLSSMGFE  719

Query  199  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  378
            L +E G       YIGD+ L    +L CRRFQ+T+  VL    +N L+E L  L L  G 
Sbjct  720  LEVERGLLAVNLRYIGDIYLDQVPVLLCRRFQITLFEVLIHREVNKLEEVLKGLELGTG-  778

Query  379  AVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLF  558
             V+DY LLP+    S  P IDW  ISSVLFSY+  +H    +CSS+     +HTK G + 
Sbjct  779  VVMDYFLLPAIRSRSQ-PSIDWAPISSVLFSYKNKDHF---NCSSKGNAHVVHTKGGPVC  834

Query  559  SCLLESSLVSTPHNGN  606
            +C+L +SLV TPHNG+
Sbjct  835  TCVLRNSLVCTPHNGS  850



>ref|XP_011015091.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Populus 
euphratica]
Length=1408

 Score =   151 bits (381),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 115/196 (59%), Gaps = 6/196 (3%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD-ENLSFE  198
            QP Y PPEL        +T Y CYLIELN+ +     + +I+L +RT LESD   ++ FE
Sbjct  660  QPIYLPPELASQGPRNLKTKYYCYLIELNQKFDYGVPVHDIVLVMRTELESDVLSSMGFE  719

Query  199  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  378
            L +E G       YIGD+ L    +L CRRFQ+T+  VL    +N L+E L  L L  G 
Sbjct  720  LEVERGLLAVNLRYIGDIYLDQVPVLLCRRFQITLFEVLIHREVNKLEEVLKGLELGTG-  778

Query  379  AVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLF  558
             V+DY LLP+    S  P IDW  ISSVLFSY+  +H    +CSS+     +HTK G + 
Sbjct  779  VVMDYFLLPAIRSRSQ-PSIDWAPISSVLFSYKNKDHF---NCSSKGNAHVVHTKGGPVC  834

Query  559  SCLLESSLVSTPHNGN  606
            +C+L +SLV TPHNG+
Sbjct  835  TCVLRNSLVCTPHNGS  850



>ref|XP_011015068.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Populus 
euphratica]
 ref|XP_011015076.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Populus 
euphratica]
 ref|XP_011015084.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Populus 
euphratica]
Length=1409

 Score =   151 bits (381),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 115/196 (59%), Gaps = 6/196 (3%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD-ENLSFE  198
            QP Y PPEL        +T Y CYLIELN+ +     + +I+L +RT LESD   ++ FE
Sbjct  660  QPIYLPPELASQGPRNLKTKYYCYLIELNQKFDYGVPVHDIVLVMRTELESDVLSSMGFE  719

Query  199  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  378
            L +E G       YIGD+ L    +L CRRFQ+T+  VL    +N L+E L  L L  G 
Sbjct  720  LEVERGLLAVNLRYIGDIYLDQVPVLLCRRFQITLFEVLIHREVNKLEEVLKGLELGTG-  778

Query  379  AVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLF  558
             V+DY LLP+    S  P IDW  ISSVLFSY+  +H    +CSS+     +HTK G + 
Sbjct  779  VVMDYFLLPAIRSRSQ-PSIDWAPISSVLFSYKNKDHF---NCSSKGNAHVVHTKGGPVC  834

Query  559  SCLLESSLVSTPHNGN  606
            +C+L +SLV TPHNG+
Sbjct  835  TCVLRNSLVCTPHNGS  850



>emb|CDO96789.1| unnamed protein product [Coffea canephora]
Length=801

 Score =   149 bits (376),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 117/194 (60%), Gaps = 3/194 (2%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            Q +Y P ELVG   N  + LY CYLI L   +   T   +I+LA  TRLE D E L FEL
Sbjct  26   QMQYVPRELVGRPGNDSEILYHCYLIALQPDFSCNTMPHDILLA--TRLEFDAETLDFEL  83

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
            ++  G+   +  Y+  + L++E++L C++FQVT+ R+L + N N L EAL   N     A
Sbjct  84   DVPRGSLKIRMKYVRHIKLTSEEVLLCQKFQVTLFRLLIDQNQNKLQEALSGSNENIEHA  143

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             +DYLL+PS+    + P IDW  + SVL+  +    +H D CS+R   R +HTKNGL+  
Sbjct  144  FLDYLLIPSTGSREN-PSIDWTCVRSVLYPQETISDKHMDCCSNRVQGRYVHTKNGLICC  202

Query  562  CLLESSLVSTPHNG  603
            C L++SLV TPHNG
Sbjct  203  CKLQNSLVVTPHNG  216



>emb|CDP04170.1| unnamed protein product [Coffea canephora]
Length=1351

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 117/195 (60%), Gaps = 1/195 (1%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            Q +Y PPELV    N  +T Y CYLI+L   +       +I+LA+R  LE   E L+F+L
Sbjct  606  QVQYVPPELVDCLGNDSETSYYCYLIKLQPEFNYDDLPHDIVLAVRKTLECHGETLNFDL  665

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
            + + G+   +  Y G + L++E++L CR+FQVT+ R L +HNLN L EALG L+L     
Sbjct  666  DADRGSLKIEISYAGSITLASEEVLLCRKFQVTIFRALLDHNLNKLHEALGGLHLNSECP  725

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
            + DYLLLPS+    +   IDW  +S+VLF  +   ++H  SC +R   +   TKN  +  
Sbjct  726  LFDYLLLPSTGSCGNA-LIDWKYVSAVLFPQEDIPNKHMASCCTRSHRQYFWTKNAFVCC  784

Query  562  CLLESSLVSTPHNGN  606
            C+L +SLV TPHNG+
Sbjct  785  CMLGNSLVLTPHNGH  799



>ref|XP_002514810.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF47364.1| ATP binding protein, putative [Ricinus communis]
Length=1388

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 118/195 (61%), Gaps = 3/195 (2%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
             P YFPPELVG      +  Y CYLIELN+ +     + N +LA+R+ LESD   L  +L
Sbjct  647  HPMYFPPELVGQASQKSEAKYYCYLIELNQNFVYEIPVHNFVLAMRSELESDILGLDLDL  706

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
              + G  + +  YIG++ L+ E ++ CR+F +TVL+VL +H+++ L++ L  L L +G  
Sbjct  707  EADRGLLMVKLKYIGEIHLTPETVIMCRKFLITVLKVLVDHSIDKLEDILKGLKLRNGPE  766

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             IDYLLLP  +     P IDW+ ++SVLFSY+     H + C  +     + TK+G++  
Sbjct  767  -IDYLLLP-LVGSCQKPSIDWDAVTSVLFSYENVLEDHKN-CPLKEAACVIQTKDGVVCK  823

Query  562  CLLESSLVSTPHNGN  606
            C L++S+V TPHNG 
Sbjct  824  CTLQNSVVYTPHNGK  838



>ref|XP_011084676.1| PREDICTED: endoribonuclease Dicer homolog 2 [Sesamum indicum]
Length=1398

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 122/191 (64%), Gaps = 5/191 (3%)
 Frame = +1

Query  28   KYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFELNI  207
            KY PPELVG+  N  +TLY+CY IEL   +   T+LQ+I+LA+ TRL+ D E  + +L++
Sbjct  661  KYLPPELVGSHGNVSETLYNCYAIELRPNFEYDTKLQDIVLAVHTRLDDDLERSNLDLDV  720

Query  208  EGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSAVI  387
            + G  + +  ++G V L++EQ+  C+RFQ+TV RVL +HNLN L E L   +  +GS V 
Sbjct  721  DRGKLIVRIKHVGYVTLNSEQVALCQRFQLTVFRVLIDHNLNKLHEELHEYSNRNGS-VF  779

Query  388  DYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFSCL  567
            +YLLLPS        +IDW  +++VL+      +  +D  +  +G   + TKNGL+  C+
Sbjct  780  NYLLLPSIGS----YQIDWKCVTAVLYQENASWNLRTDCTNGGYGHYNVRTKNGLVCLCM  835

Query  568  LESSLVSTPHN  600
            LE+SLV TPHN
Sbjct  836  LENSLVLTPHN  846



>ref|XP_008218472.1| PREDICTED: endoribonuclease Dicer homolog 2 [Prunus mume]
Length=1396

 Score =   149 bits (375),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 83/206 (40%), Positives = 125/206 (61%), Gaps = 12/206 (6%)
 Frame = +1

Query  10   QLGCQP------KYFPPELVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRL  168
            +LGC+P       Y P ELV     N    LY CYLIELN+ +     + +I+L +R+ L
Sbjct  649  ELGCEPYDDVQSSYVPVELVKPFCSNDASMLYHCYLIELNQNFGYDIPVHDIVLGMRSEL  708

Query  169  ESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEA  348
            + D+ N+ F+L +  G       Y+G++ LS+EQ+L CR+FQ+T+ R+L +HNLN L+E 
Sbjct  709  DCDNANMHFDLEVGRGTLTMNFKYVGEIHLSSEQVLLCRKFQITIFRILMDHNLNKLEEV  768

Query  349  LGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCR  528
            L  L L  G+  +DYLLLP +  P     IDW  I+SVLF  ++    H D CS  +   
Sbjct  769  LDGLCL-GGNIGVDYLLLPGTKVPQRPLIIDWKCITSVLFPCEEYSRDHVD-CSLPNW--  824

Query  529  PMHTKNGLLFSCLLESSLVSTPHNGN  606
             ++TK+G++ +C++++SLV TPHNG 
Sbjct  825  -IYTKSGVVCTCMIQNSLVCTPHNGT  849



>emb|CDY50692.1| BnaC05g47910D [Brassica napus]
Length=1389

 Score =   149 bits (375),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/194 (42%), Positives = 112/194 (58%), Gaps = 3/194 (2%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP YFPPELV       QT Y  Y I +   +      ++I+L  R +LE D  N  F L
Sbjct  654  QPSYFPPELVSQFSALSQTTYHLYSIRMKSEFPGNLHFKDILLGTRVKLEDDIGNTCFRL  713

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
                G       Y+G   L+ ++IL CRRFQ+T+ RVL +H++  L  AL  L+L DG A
Sbjct  714  EDHLGTIAVTLSYVGAFDLAQDEILLCRRFQITLFRVLLDHSVENLVAALDGLHLRDGLA  773

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             +DYLL+PS+ +      IDW +I SV F+  KP  RH + CS++     +HTKNGL  +
Sbjct  774  -LDYLLVPSTHE-QKASLIDWEVIRSVNFTSHKPWKRHVN-CSAKDASCILHTKNGLFCT  830

Query  562  CLLESSLVSTPHNG  603
            C+L+++LV TPHNG
Sbjct  831  CVLQNALVCTPHNG  844



>ref|XP_002312197.1| hypothetical protein POPTR_0008s07580g [Populus trichocarpa]
 gb|EEE89564.1| hypothetical protein POPTR_0008s07580g [Populus trichocarpa]
Length=1468

 Score =   149 bits (375),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 117/196 (60%), Gaps = 6/196 (3%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD-ENLSFE  198
            QP Y PPELV       +T Y CYLIELN+ +     + +++L +RT LESD   ++ F+
Sbjct  709  QPIYLPPELVSRGPRNLKTKYYCYLIELNQNFAYDIPVHDVVLVVRTELESDVIRSMGFD  768

Query  199  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  378
            L  E G       YIGD+ L    +L CRRFQ+T+ +VL +H++N L E L  L+L  G 
Sbjct  769  LEAERGLLTVNLRYIGDIDLERVLVLLCRRFQITLFKVLLDHSVNKLKEVLEGLDLGSG-  827

Query  379  AVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLF  558
            A IDY LLP+    S  P I+W  ISSVLFSY+  EH    +CS       + TK G + 
Sbjct  828  AEIDYFLLPAFRSCSQ-PSINWAPISSVLFSYKNEEHF---NCSRNGNAHVVQTKCGPVC  883

Query  559  SCLLESSLVSTPHNGN  606
            +C+L++SLV TPHNGN
Sbjct  884  ACVLQNSLVCTPHNGN  899



>ref|XP_006480493.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X6 [Citrus 
sinensis]
Length=1396

 Score =   147 bits (372),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 116/194 (60%), Gaps = 7/194 (4%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
             P YFPPELV       +  Y CYLIEL +++      +NI+LA+RT LES+ + ++F+L
Sbjct  659  HPIYFPPELVNQSPQDTKITYHCYLIELKQHFNYDISARNIVLAMRTELESEIKKVNFDL  718

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
             +E G       ++G + L   Q+L CRRFQ+T+ RV+ +HNL+ L+E L    L D   
Sbjct  719  EVERGRLTVNLKHLGRIQLIPNQVLLCRRFQITLFRVIMDHNLDKLNEILDGFELRDNLE  778

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             IDYLLLPS+        IDW  +++VLF       +H+ +CS+    R +HTK+G L +
Sbjct  779  -IDYLLLPSTGQ-----LIDWKTVATVLFPRDNGS-KHNMNCSTMFNARIVHTKSGPLCT  831

Query  562  CLLESSLVSTPHNG  603
            C + +SLV TPHNG
Sbjct  832  CKIHNSLVCTPHNG  845



>ref|XP_006428679.1| hypothetical protein CICLE_v10010912mg [Citrus clementina]
 gb|ESR41919.1| hypothetical protein CICLE_v10010912mg [Citrus clementina]
 gb|KDO45680.1| hypothetical protein CISIN_1g000607mg [Citrus sinensis]
Length=1396

 Score =   147 bits (372),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 116/194 (60%), Gaps = 7/194 (4%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
             P YFPPELV       +  Y CYLIEL +++      +NI+LA+RT LES+ + ++F+L
Sbjct  659  HPIYFPPELVNQSPQDTKITYHCYLIELKQHFNYDISARNIVLAMRTELESEIKKVNFDL  718

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
             +E G       ++G + L   Q+L CRRFQ+T+ RV+ +HNL+ L+E L    L D   
Sbjct  719  EVERGRLTVNLKHLGRIQLIPNQVLLCRRFQITLFRVIMDHNLDKLNEILDGFELRDNLE  778

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             IDYLLLPS+        IDW  +++VLF       +H+ +CS+    R +HTK+G L +
Sbjct  779  -IDYLLLPSTGQ-----LIDWKTVATVLFPRDNGS-KHNMNCSTMFNARIVHTKSGPLCT  831

Query  562  CLLESSLVSTPHNG  603
            C + +SLV TPHNG
Sbjct  832  CKIHNSLVCTPHNG  845



>emb|CDY43132.1| BnaA05g32540D [Brassica napus]
Length=1388

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 112/194 (58%), Gaps = 3/194 (2%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP YFPPELV       QT Y  Y I +   +      ++++L  R +LE D  N  F L
Sbjct  654  QPSYFPPELVSQFSALSQTTYHFYSIRMKSEFPGNLHFKDVLLGTRVKLEDDIGNTCFRL  713

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
                G       Y+G   L+ +++L CRRFQ+T+ RVL +H++  L  AL  L+L DG A
Sbjct  714  EDHLGTIAVTLSYVGGFDLTQDEVLLCRRFQITLFRVLLDHSVENLLAALDGLHLRDGPA  773

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             +DYLL+PS+ +      IDW +I SV F+  KP  RH D CS++     +HTK+GL  +
Sbjct  774  -LDYLLVPSTHE-QKASLIDWEVIRSVNFTSHKPWERHVD-CSAKDASCILHTKDGLFCT  830

Query  562  CLLESSLVSTPHNG  603
            C+L+++LV TPHNG
Sbjct  831  CVLQNALVYTPHNG  844



>ref|XP_010508629.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Camelina 
sativa]
 ref|XP_010508709.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Camelina 
sativa]
Length=1397

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 112/194 (58%), Gaps = 3/194 (2%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP YFPPELV      PQT Y  YLI +     ++  L +++L  R  LE D  N  F L
Sbjct  662  QPCYFPPELVSQFSAQPQTTYHFYLIRMEPNSPRKFHLNDVLLGTRVELEDDIGNTGFRL  721

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
                G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L +AL  L+L DG A
Sbjct  722  EDHKGTIAVTLSYVGAFHLTQEEVLMCRRFQITLFRVLLDHSVENLMKALDGLHLSDGVA  781

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
            V DYLL+PS+    +   IDW +I SV  +  K   +H   CS+    R +HTK+GL  +
Sbjct  782  V-DYLLVPSTYS-HETSLIDWEVIRSVNLTCHKALEKHL-KCSTNGASRVLHTKDGLFCT  838

Query  562  CLLESSLVSTPHNG  603
            C+++++LV TPHNG
Sbjct  839  CVVQNALVYTPHNG  852



>ref|XP_010508779.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Camelina 
sativa]
 ref|XP_010508854.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Camelina 
sativa]
Length=1394

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 112/194 (58%), Gaps = 3/194 (2%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP YFPPELV      PQT Y  YLI +     ++  L +++L  R  LE D  N  F L
Sbjct  659  QPCYFPPELVSQFSAQPQTTYHFYLIRMEPNSPRKFHLNDVLLGTRVELEDDIGNTGFRL  718

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
                G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L +AL  L+L DG A
Sbjct  719  EDHKGTIAVTLSYVGAFHLTQEEVLMCRRFQITLFRVLLDHSVENLMKALDGLHLSDGVA  778

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
            V DYLL+PS+    +   IDW +I SV  +  K   +H   CS+    R +HTK+GL  +
Sbjct  779  V-DYLLVPSTYS-HETSLIDWEVIRSVNLTCHKALEKHL-KCSTNGASRVLHTKDGLFCT  835

Query  562  CLLESSLVSTPHNG  603
            C+++++LV TPHNG
Sbjct  836  CVVQNALVYTPHNG  849



>ref|XP_010508928.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X3 [Camelina 
sativa]
Length=1355

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 112/194 (58%), Gaps = 3/194 (2%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP YFPPELV      PQT Y  YLI +     ++  L +++L  R  LE D  N  F L
Sbjct  662  QPCYFPPELVSQFSAQPQTTYHFYLIRMEPNSPRKFHLNDVLLGTRVELEDDIGNTGFRL  721

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
                G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L +AL  L+L DG A
Sbjct  722  EDHKGTIAVTLSYVGAFHLTQEEVLMCRRFQITLFRVLLDHSVENLMKALDGLHLSDGVA  781

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
            V DYLL+PS+    +   IDW +I SV  +  K   +H   CS+    R +HTK+GL  +
Sbjct  782  V-DYLLVPSTYS-HETSLIDWEVIRSVNLTCHKALEKHL-KCSTNGASRVLHTKDGLFCT  838

Query  562  CLLESSLVSTPHNG  603
            C+++++LV TPHNG
Sbjct  839  CVVQNALVYTPHNG  852



>ref|XP_009130358.1| PREDICTED: endoribonuclease Dicer homolog 2 [Brassica rapa]
 ref|XP_009130359.1| PREDICTED: endoribonuclease Dicer homolog 2 [Brassica rapa]
Length=1388

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 112/194 (58%), Gaps = 3/194 (2%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP YFPPELV       QT Y  Y I +   +      ++++L  R +LE D  N  F L
Sbjct  654  QPSYFPPELVSQFSALSQTTYHFYSIRMKSEFPGNLHFKDVLLGTRVKLEDDIGNTCFRL  713

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
                G       Y+G   L+ +++L CRRFQ+T+ RVL +H++  L  AL  L+L DG A
Sbjct  714  EDHLGTIAVTLSYVGGFDLTQDEVLLCRRFQITLFRVLLDHSVENLLAALDGLHLRDGPA  773

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             +DYLL+PS+ +      IDW +I SV F+  KP  RH D CS++     +HTK+GL  +
Sbjct  774  -LDYLLVPSTHE-QKASLIDWEVIRSVNFTSHKPWERHVD-CSAKDASCILHTKDGLFCT  830

Query  562  CLLESSLVSTPHNG  603
            C+L+++LV TPHNG
Sbjct  831  CVLQNALVYTPHNG  844



>ref|XP_006408318.1| hypothetical protein EUTSA_v10019898mg [Eutrema salsugineum]
 gb|ESQ49771.1| hypothetical protein EUTSA_v10019898mg [Eutrema salsugineum]
Length=1390

 Score =   145 bits (366),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 116/195 (59%), Gaps = 3/195 (2%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP Y PPELV       QT Y  YLI +     +  Q  +I L  RT LE D  +  F+L
Sbjct  656  QPCYLPPELVSQFSGQSQTTYHLYLIRMKPDSRRNFQFNDIFLGTRTELEDDIGSTCFQL  715

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
                G       Y+G    + E++L CR+FQ+T+ RVL +H++  L EAL  L+L DG A
Sbjct  716  EDHHGTIAVTLSYVGAFDFTQEEVLLCRKFQITLFRVLLDHSVENLMEALDGLHLRDGVA  775

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             +DYLL+P++ + ++   I+W++I SV  +  K   RH+D CS++   R +HTK+GL  +
Sbjct  776  -LDYLLVPATPE-NETSLINWDMIRSVNLTRHKACERHAD-CSAKGASRILHTKDGLFCT  832

Query  562  CLLESSLVSTPHNGN  606
            C++E++LV TPHNG+
Sbjct  833  CVVENALVYTPHNGH  847



>ref|XP_008240740.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Prunus mume]
Length=804

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 114/197 (58%), Gaps = 3/197 (2%)
 Frame = +1

Query  22   QPKYFPPELVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  198
            QP Y PPELV     N    LY CYLI++   +     + +I+L +R+ L+ D  N++F+
Sbjct  59   QPSYVPPELVKPWCSNDASILYHCYLIQMKPNFCSDIPVNDIVLGMRSELDCDVANMNFD  118

Query  199  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  378
            L +  G          ++ LS+EQIL+CRRFQ+T+ R+L +HNL  L+E L RL++    
Sbjct  119  LGVGKGTITVNFKKAAEIHLSSEQILQCRRFQITIFRILMDHNLQKLEEVLERLSVGQNL  178

Query  379  AV--IDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGL  552
             V  IDYLLLP++        IDW  + SV F  ++    H DS    +  R +HTKNG+
Sbjct  179  EVESIDYLLLPAARMHQKPFIIDWECVMSVPFRSEENSEYHVDSSPPNNCSRVLHTKNGI  238

Query  553  LFSCLLESSLVSTPHNG  603
            + +C +++SLV TPH G
Sbjct  239  VCTCRIQNSLVYTPHTG  255



>ref|XP_007208392.1| hypothetical protein PRUPE_ppa000240mg [Prunus persica]
 gb|EMJ09591.1| hypothetical protein PRUPE_ppa000240mg [Prunus persica]
Length=1415

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 122/206 (59%), Gaps = 12/206 (6%)
 Frame = +1

Query  10   QLGCQP------KYFPPELVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRL  168
            +LGC+P       Y P ELV     N     Y CYLIELN+ +     + +I+L +R+ L
Sbjct  668  ELGCEPYDDVQSSYVPVELVKPFCSNDASISYHCYLIELNQNFGYDIPVHDIVLGMRSEL  727

Query  169  ESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEA  348
            + D  N+ F+L +  G       Y+G++ LS+EQ+L CR+FQ+T+ R+L +HNLN L+E 
Sbjct  728  DCDIANMHFDLEVGRGTLTMNFKYVGEIHLSSEQVLLCRKFQITIFRILMDHNLNKLEEV  787

Query  349  LGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCR  528
            L  L L  G   +DYLLLP +  P     IDW  I+SVLF  ++    H D CS  +   
Sbjct  788  LDGLCL-GGQIGVDYLLLPGTKVPQRPLIIDWKCITSVLFPCEEYSKDHVD-CSLPNW--  843

Query  529  PMHTKNGLLFSCLLESSLVSTPHNGN  606
             ++TK+G++ +C++++SLV TPHNG 
Sbjct  844  -IYTKSGVVCTCMIQNSLVCTPHNGT  868



>ref|XP_010549772.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010549773.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010549775.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Tarenaya 
hassleriana]
Length=1395

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 111/195 (57%), Gaps = 3/195 (2%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP YFPPEL+G      +T Y  YLI L  +Y     +Q+I+L  R  LE D    SF+L
Sbjct  656  QPCYFPPELIGHFLVESKTTYHFYLIGLKPWYPDDFHVQDILLGTRAELEDDIGTTSFKL  715

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
             ++GG       YIG   L+ E++  CRRFQ+T+LR L +HN  TL EAL  L   +G  
Sbjct  716  GVKGGAITVTLKYIGVFHLTQEEVFLCRRFQITLLRTLLDHNPETLTEALDGLQCRNG-P  774

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             +D+LLLP++        I+WN+I SV FS  + E  H  SC+     R +H K+GL+  
Sbjct  775  TLDFLLLPANHG-HQTSHINWNVIKSVNFSLHRAEESHFSSCACG-ATRILHAKDGLVCV  832

Query  562  CLLESSLVSTPHNGN  606
            C ++++LV TPH G 
Sbjct  833  CAVQNALVYTPHTGK  847



>ref|XP_010549776.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Tarenaya 
hassleriana]
Length=1350

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 111/195 (57%), Gaps = 3/195 (2%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP YFPPEL+G      +T Y  YLI L  +Y     +Q+I+L  R  LE D    SF+L
Sbjct  611  QPCYFPPELIGHFLVESKTTYHFYLIGLKPWYPDDFHVQDILLGTRAELEDDIGTTSFKL  670

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
             ++GG       YIG   L+ E++  CRRFQ+T+LR L +HN  TL EAL  L   +G  
Sbjct  671  GVKGGAITVTLKYIGVFHLTQEEVFLCRRFQITLLRTLLDHNPETLTEALDGLQCRNG-P  729

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             +D+LLLP++        I+WN+I SV FS  + E  H  SC+     R +H K+GL+  
Sbjct  730  TLDFLLLPANHG-HQTSHINWNVIKSVNFSLHRAEESHFSSCACG-ATRILHAKDGLVCV  787

Query  562  CLLESSLVSTPHNGN  606
            C ++++LV TPH G 
Sbjct  788  CAVQNALVYTPHTGK  802



>ref|NP_001078101.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
 gb|AEE73925.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
Length=1374

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 114/194 (59%), Gaps = 3/194 (2%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP YFPPELV      P+T Y  YLI +     +   L +++L  R  LE D  N SF L
Sbjct  644  QPCYFPPELVSQFSAQPETTYHFYLIRMKPNSPRNFHLNDVLLGTRVVLEDDIGNTSFRL  703

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
                G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L EAL  L+L DG A
Sbjct  704  EDHRGTIAVTLSYVGAFHLTQEEVLFCRRFQITLFRVLLDHSVENLMEALNGLHLRDGVA  763

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             +DYLL+PS+    +   IDW +I SV  +  +   +H ++CS+    R +HTK+GL  +
Sbjct  764  -LDYLLVPST-HSHETSLIDWEVIRSVNLTSHEVLEKH-ENCSTNGASRILHTKDGLFCT  820

Query  562  CLLESSLVSTPHNG  603
            C+++++LV TPHNG
Sbjct  821  CVVQNALVYTPHNG  834



>ref|NP_566199.4| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
 ref|NP_001189798.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
 sp|Q3EBC8.2|DCL2_ARATH RecName: Full=Endoribonuclease Dicer homolog 2; AltName: Full=Dicer-like 
protein 2; Short=AtDCL2 [Arabidopsis thaliana]
 gb|AEE73924.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
 gb|AEE73926.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
Length=1388

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 114/194 (59%), Gaps = 3/194 (2%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP YFPPELV      P+T Y  YLI +     +   L +++L  R  LE D  N SF L
Sbjct  658  QPCYFPPELVSQFSAQPETTYHFYLIRMKPNSPRNFHLNDVLLGTRVVLEDDIGNTSFRL  717

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
                G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L EAL  L+L DG A
Sbjct  718  EDHRGTIAVTLSYVGAFHLTQEEVLFCRRFQITLFRVLLDHSVENLMEALNGLHLRDGVA  777

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             +DYLL+PS+    +   IDW +I SV  +  +   +H ++CS+    R +HTK+GL  +
Sbjct  778  -LDYLLVPST-HSHETSLIDWEVIRSVNLTSHEVLEKH-ENCSTNGASRILHTKDGLFCT  834

Query  562  CLLESSLVSTPHNG  603
            C+++++LV TPHNG
Sbjct  835  CVVQNALVYTPHNG  848



>gb|ABF19798.1| dicer-like 2 spliceform 2 [Arabidopsis thaliana]
Length=1374

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 114/194 (59%), Gaps = 3/194 (2%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP YFPPELV      P+T Y  YLI +     +   L +++L  R  LE D  N SF L
Sbjct  644  QPCYFPPELVSQFSAQPETTYHFYLIRMKPNSPRNLHLNDVLLGTRVVLEDDIGNTSFRL  703

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
                G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L EAL  L+L DG A
Sbjct  704  EDHRGTIAVTLSYVGAFHLTREEVLFCRRFQITLFRVLLDHSVENLMEALNGLHLRDGVA  763

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             +DYLL+PS+    +   IDW +I SV  +  +   +H ++CS+    R +HTK+GL  +
Sbjct  764  -LDYLLVPST-HSHETSLIDWEVIRSVNLTSHEVLEKH-ENCSTNGASRILHTKDGLFCT  820

Query  562  CLLESSLVSTPHNG  603
            C+++++LV TPHNG
Sbjct  821  CVVQNALVYTPHNG  834



>gb|ABF19797.1| dicer-like 2 spliceform 1 [Arabidopsis thaliana]
Length=1386

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 114/194 (59%), Gaps = 3/194 (2%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP YFPPELV      P+T Y  YLI +     +   L +++L  R  LE D  N SF L
Sbjct  656  QPCYFPPELVSQFSAQPETTYHFYLIRMKPNSPRNLHLNDVLLGTRVVLEDDIGNTSFRL  715

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
                G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L EAL  L+L DG A
Sbjct  716  EDHRGTIAVTLSYVGAFHLTREEVLFCRRFQITLFRVLLDHSVENLMEALNGLHLRDGVA  775

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             +DYLL+PS+    +   IDW +I SV  +  +   +H ++CS+    R +HTK+GL  +
Sbjct  776  -LDYLLVPST-HSHETSLIDWEVIRSVNLTSHEVLEKH-ENCSTNGASRILHTKDGLFCT  832

Query  562  CLLESSLVSTPHNG  603
            C+++++LV TPHNG
Sbjct  833  CVVQNALVYTPHNG  846



>ref|XP_010485670.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Camelina 
sativa]
Length=1354

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 112/194 (58%), Gaps = 3/194 (2%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP YFPPELV      PQT Y  YLI +     ++  L +++L  R  LE D  N  F L
Sbjct  663  QPCYFPPELVSQFSAQPQTTYHFYLIRMAPNSPRKFHLNDVLLGTRVELEDDIGNTGFRL  722

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
                G       Y+G   L+ E++L CRRFQ+T+ RVL + ++  L EAL  L+L DG A
Sbjct  723  EDHKGTIAVTLSYVGAFHLTQEEVLVCRRFQITLFRVLLDQSVENLMEALDGLHLRDGVA  782

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             +DYLL+PS+    +   IDW +I SV  +  K   +H + CS+    R +HTK+GL  +
Sbjct  783  -LDYLLVPSTYS-HETSLIDWAVIRSVNLTCHKALEKHLN-CSTNGASRLLHTKDGLFCT  839

Query  562  CLLESSLVSTPHNG  603
            C+++++LV TPHNG
Sbjct  840  CVVQNALVYTPHNG  853



>ref|XP_010312607.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Solanum 
lycopersicum]
Length=1370

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 121/195 (62%), Gaps = 4/195 (2%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            Q  Y+P E V    N  + +Y CYL+EL    Y  +QL  IILA+RT+L+ DDE L+F+L
Sbjct  642  QSLYYPSEFVSHCGNESEAVYYCYLVELPHDSYNDSQLHGIILAVRTKLKFDDEILAFDL  701

Query  202  NIE-GGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  378
            +++  G    Q  Y   V  ++E+I RC+RFQV+V R+L + +L+ L E L  +    GS
Sbjct  702  DVDRRGRLKVQLNYRKVVIFTSEEIRRCQRFQVSVFRILRDPDLSKLQEVLAAVQSPIGS  761

Query  379  AVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLF  558
            AV DYLLLPS   P   P+I+W  ++S+LF  Q    +H D CS++     ++T + ++ 
Sbjct  762  AVSDYLLLPSVGTP---PEINWQYVNSLLFPSQVLGDKHMDWCSTQGRRCSVNTISEVVC  818

Query  559  SCLLESSLVSTPHNG  603
            SC+LE+SLV TPHNG
Sbjct  819  SCMLENSLVCTPHNG  833



>ref|XP_010485666.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010485667.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Camelina 
sativa]
Length=1398

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 112/194 (58%), Gaps = 3/194 (2%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP YFPPELV      PQT Y  YLI +     ++  L +++L  R  LE D  N  F L
Sbjct  663  QPCYFPPELVSQFSAQPQTTYHFYLIRMAPNSPRKFHLNDVLLGTRVELEDDIGNTGFRL  722

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
                G       Y+G   L+ E++L CRRFQ+T+ RVL + ++  L EAL  L+L DG A
Sbjct  723  EDHKGTIAVTLSYVGAFHLTQEEVLVCRRFQITLFRVLLDQSVENLMEALDGLHLRDGVA  782

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             +DYLL+PS+    +   IDW +I SV  +  K   +H + CS+    R +HTK+GL  +
Sbjct  783  -LDYLLVPSTYS-HETSLIDWAVIRSVNLTCHKALEKHLN-CSTNGASRLLHTKDGLFCT  839

Query  562  CLLESSLVSTPHNG  603
            C+++++LV TPHNG
Sbjct  840  CVVQNALVYTPHNG  853



>gb|AAF26098.1|AC012328_1 unknown protein [Arabidopsis thaliana]
Length=2042

 Score =   144 bits (362),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 114/194 (59%), Gaps = 3/194 (2%)
 Frame = +1

Query  22    QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
             QP YFPPELV      P+T Y  YLI +     +   L +++L  R  LE D  N SF L
Sbjct  1312  QPCYFPPELVSQFSAQPETTYHFYLIRMKPNSPRNFHLNDVLLGTRVVLEDDIGNTSFRL  1371

Query  202   NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
                 G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L EAL  L+L DG A
Sbjct  1372  EDHRGTIAVTLSYVGAFHLTQEEVLFCRRFQITLFRVLLDHSVENLMEALNGLHLRDGVA  1431

Query  382   VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
              +DYLL+PS+    +   IDW +I SV  +  +   +H ++CS+    R +HTK+GL  +
Sbjct  1432  -LDYLLVPST-HSHETSLIDWEVIRSVNLTSHEVLEKH-ENCSTNGASRILHTKDGLFCT  1488

Query  562   CLLESSLVSTPHNG  603
             C+++++LV TPHNG
Sbjct  1489  CVVQNALVYTPHNG  1502



>ref|XP_010485668.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Camelina 
sativa]
 ref|XP_010485669.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Camelina 
sativa]
Length=1395

 Score =   143 bits (361),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 112/194 (58%), Gaps = 3/194 (2%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP YFPPELV      PQT Y  YLI +     ++  L +++L  R  LE D  N  F L
Sbjct  660  QPCYFPPELVSQFSAQPQTTYHFYLIRMAPNSPRKFHLNDVLLGTRVELEDDIGNTGFRL  719

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
                G       Y+G   L+ E++L CRRFQ+T+ RVL + ++  L EAL  L+L DG A
Sbjct  720  EDHKGTIAVTLSYVGAFHLTQEEVLVCRRFQITLFRVLLDQSVENLMEALDGLHLRDGVA  779

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             +DYLL+PS+    +   IDW +I SV  +  K   +H + CS+    R +HTK+GL  +
Sbjct  780  -LDYLLVPSTYS-HETSLIDWAVIRSVNLTCHKALEKHLN-CSTNGASRLLHTKDGLFCT  836

Query  562  CLLESSLVSTPHNG  603
            C+++++LV TPHNG
Sbjct  837  CVVQNALVYTPHNG  850



>ref|XP_007217819.1| hypothetical protein PRUPE_ppa027063mg, partial [Prunus persica]
 gb|EMJ19018.1| hypothetical protein PRUPE_ppa027063mg, partial [Prunus persica]
Length=758

 Score =   140 bits (354),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 113/197 (57%), Gaps = 3/197 (2%)
 Frame = +1

Query  22   QPKYFPPELVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  198
            QP Y PPELV     N    LY CYLI++   +     + +I+L +R+ L+ D  N++F+
Sbjct  13   QPSYVPPELVKPWCSNDASVLYHCYLIQMKPNFCSDIPVNDIVLGMRSELDCDVANMNFD  72

Query  199  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  378
            L +             ++ LS+EQIL+CRRFQ+T+ R+L +HNL  L+E L RL++    
Sbjct  73   LGVGKSTITVNFKKAAEIHLSSEQILQCRRFQITIFRILMDHNLQKLEEVLERLSVGQNL  132

Query  379  AV--IDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGL  552
             V  IDYLLLP++        IDW  + SV F  ++    H DS    +  R +HTKNG+
Sbjct  133  EVESIDYLLLPAARMHQRPFIIDWECVMSVPFRSEENSEYHVDSSPPNNCSRVLHTKNGM  192

Query  553  LFSCLLESSLVSTPHNG  603
            + +C +++SLV TPH G
Sbjct  193  VCTCRIQNSLVYTPHTG  209



>ref|XP_011006570.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2-like [Populus euphratica]
Length=1406

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 116/196 (59%), Gaps = 7/196 (4%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD-ENLSFE  198
            QP Y+PPELV       +T Y CYLIELN+ +     + +++L +RT LESD   ++ F+
Sbjct  660  QPIYWPPELVSQGPRNLKTKYYCYLIELNQNFAYDIPVHDVVLVMRTELESDVIRSMGFD  719

Query  199  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  378
            L  E G       YIGD+ L    +L CRRFQ+T+ +VL +H++N L E L  L+L  G 
Sbjct  720  LEAERGLLTVNLRYIGDIDLERVLVLLCRRFQITLFKVLLDHSVNKLKEVLEGLDLGSGF  779

Query  379  AVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLF  558
              IDY LLP +      P I+W  ISSVLFSY K +H    +CS       + TK G + 
Sbjct  780  E-IDYFLLP-AFRSCPQPSINWTPISSVLFSY-KNDHF---NCSRNGNAHVVQTKCGPVC  833

Query  559  SCLLESSLVSTPHNGN  606
            +C+L++SLV TPHNGN
Sbjct  834  ACVLQNSLVCTPHNGN  849



>ref|XP_002884369.1| hypothetical protein ARALYDRAFT_317213 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60628.1| hypothetical protein ARALYDRAFT_317213 [Arabidopsis lyrata subsp. 
lyrata]
Length=2033

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 110/194 (57%), Gaps = 3/194 (2%)
 Frame = +1

Query  22    QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
             QP YFPPELV      P+T Y  YLI +     +   L +++L  R  LE D  N  F L
Sbjct  1303  QPCYFPPELVSQFSVQPETTYHFYLIRMKPSSQRNFHLNDVLLGTRVVLEDDIGNTGFRL  1362

Query  202   NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
                 G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L EAL  L L DG A
Sbjct  1363  EDHKGTIAVTLSYVGAFHLTQEEVLLCRRFQITLFRVLLDHSVKNLMEALNGLLLRDGIA  1422

Query  382   VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
              +DYLL+PS+      P IDW +I SV  +  +   +H + CS     R +HTK+GL  +
Sbjct  1423  -LDYLLVPSTHSHETSP-IDWEVIRSVNLTCHEALEKHVN-CSINGASRILHTKDGLFCT  1479

Query  562   CLLESSLVSTPHNG  603
             C+++++LV TPHNG
Sbjct  1480  CVVQNALVYTPHNG  1493



>gb|KJB14793.1| hypothetical protein B456_002G143000 [Gossypium raimondii]
Length=1393

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/194 (42%), Positives = 120/194 (62%), Gaps = 8/194 (4%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP +FPPELV        T Y CYL+EL + +     +QNIIL +R++LE + +++  EL
Sbjct  659  QPIFFPPELVNQDSQESMTKYYCYLMELKQNFGYEFPVQNIILLVRSQLEMEAKSVGIEL  718

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
             ++ G       YIG + LS++Q++ CRRFQ+ + RVL +H    L E L  L   + S 
Sbjct  719  EVDRGTLTVNLKYIGLIRLSSDQVILCRRFQIALFRVLMDHKAEKLTE-LSDLTSGNNSE  777

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             IDYLLLPS+    + P IDW  ISS+LFSY+K    H + C++      + TK+GL+ +
Sbjct  778  -IDYLLLPSNYMGQN-PVIDWLSISSILFSYEKVWKNHVN-CNAGM----IQTKSGLVCT  830

Query  562  CLLESSLVSTPHNG  603
            C++++SLVSTPHNG
Sbjct  831  CMIKNSLVSTPHNG  844



>gb|ACE60552.1| dicer-like protein 2 [Brassica rapa]
Length=1392

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 113/195 (58%), Gaps = 5/195 (3%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            Q  YFPPELV       QT Y  Y I +   + +     +I+L  R  LE+D  N  F L
Sbjct  657  QSSYFPPELVSQFSAHSQTTYHFYSIRMKSEFPRNLHFNDILLGTRVELEADIGNTCFRL  716

Query  202  NIEGGNWVGQTV-YIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  378
                G  +G T+ Y+G   L+  ++L CRRFQ+T+ RVL +H++  L  AL  L+L DG 
Sbjct  717  EDHLGT-IGVTLSYVGAFDLTQNEVLLCRRFQITLFRVLLDHSVENLAAALDGLHLRDGV  775

Query  379  AVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLF  558
            A +DYLL+PS+ +      IDW ++ SV  +  +P  RH D CS++     +HTK+GL  
Sbjct  776  A-LDYLLVPSTHE-QKASLIDWGVLRSVNLTSNRPRERHVD-CSAKDASCILHTKDGLFC  832

Query  559  SCLLESSLVSTPHNG  603
            +C+L+++LV TPHNG
Sbjct  833  TCVLQNALVYTPHNG  847



>gb|KCW84635.1| hypothetical protein EUGRSUZ_B01461 [Eucalyptus grandis]
Length=1194

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 108/195 (55%), Gaps = 9/195 (5%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
             P YFPPELV    N  +TLY CY+IEL + Y     ++N++LA R+ LE+D  + SF+L
Sbjct  454  HPAYFPPELVNHHPNKSKTLYHCYVIELRQDYNYDATVENMVLATRSELEADICDKSFKL  513

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
             +  G       Y+G++ L   Q+  CR+FQ+T+L VL +H++  L E L  LNLV  S 
Sbjct  514  QVPRGLLSVNVTYVGEIHLDENQVHLCRKFQITLLSVLLDHSMVKLRETLSGLNLVKASD  573

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCR--PMHTKNGLL  555
            V DYLLLP +        IDW  + SV FS          +C     CR   +  K GL+
Sbjct  574  V-DYLLLPHAGAHPTPGAIDWRSVVSVYFSID------DHTCGDYLKCRRHRVRMKTGLV  626

Query  556  FSCLLESSLVSTPHN  600
              CLLE SLV TPHN
Sbjct  627  SRCLLEGSLVHTPHN  641



>ref|XP_010038609.1| PREDICTED: endoribonuclease Dicer homolog 2 [Eucalyptus grandis]
Length=1403

 Score =   139 bits (351),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 108/195 (55%), Gaps = 9/195 (5%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
             P YFPPELV    N  +TLY CY+IEL + Y     ++N++LA R+ LE+D  + SF+L
Sbjct  663  HPAYFPPELVNHHPNKSKTLYHCYVIELRQDYNYDATVENMVLATRSELEADICDKSFKL  722

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
             +  G       Y+G++ L   Q+  CR+FQ+T+L VL +H++  L E L  LNLV  S 
Sbjct  723  QVPRGLLSVNVTYVGEIHLDENQVHLCRKFQITLLSVLLDHSMVKLRETLSGLNLVKASD  782

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCR--PMHTKNGLL  555
            V DYLLLP +        IDW  + SV FS          +C     CR   +  K GL+
Sbjct  783  V-DYLLLPHAGAHPTPGAIDWRSVVSVYFSID------DHTCGDYLKCRRHRVRMKTGLV  835

Query  556  FSCLLESSLVSTPHN  600
              CLLE SLV TPHN
Sbjct  836  SRCLLEGSLVHTPHN  850



>gb|KHG30499.1| hypothetical protein F383_12835 [Gossypium arboreum]
Length=1358

 Score =   139 bits (349),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 117/195 (60%), Gaps = 10/195 (5%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP +FPPELV        T Y CYL+EL + +     + NIIL +R++LE   E  S EL
Sbjct  710  QPIFFPPELVNQDSQESMTKYYCYLMELKQNFGYEIPVHNIILLVRSQLEM--EAKSIEL  767

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
             ++ G       YIG + LS++Q++ CRRFQ+ + RVL +H    L E L  L   + S 
Sbjct  768  EVDRGTLTVNLKYIGLIRLSSDQVILCRRFQIALFRVLMDHKAEKLTELLSDLTSGNNSE  827

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             IDYLLLPS+      P IDW  ISS+LFSY+K    H + C++      + TK+GL+ +
Sbjct  828  -IDYLLLPSNY--MGQPVIDWLSISSILFSYEKVWKNHVN-CNAGM----IQTKSGLVCT  879

Query  562  CLLESSLVSTPHNGN  606
            C++++SLVSTPHNG+
Sbjct  880  CMIKNSLVSTPHNGH  894



>ref|XP_011466081.1| PREDICTED: endoribonuclease Dicer homolog 2 [Fragaria vesca subsp. 
vesca]
Length=1397

 Score =   137 bits (345),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 113/196 (58%), Gaps = 7/196 (4%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            Q  Y P ELV         LY CYLIEL++ +     + + +L +R++L+ D  NL FEL
Sbjct  659  QSSYVPIELVKPSSAGTSILYHCYLIELDQKFGYEIPVNDFVLGVRSQLDRDISNLHFEL  718

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
                G+      Y G++ L +EQ+L CRRFQ+T+ R+L +HNL+ L EAL    L  G  
Sbjct  719  EFGRGSLSVNFKYAGEMHLDSEQVLLCRRFQITIFRILMDHNLDKLKEALD--GLCSGEN  776

Query  382  V-IDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLF  558
            +  DYL+LP  +       IDW  ++SVL+S ++    H D CS     R +HTKNG + 
Sbjct  777  LGFDYLMLPGIIIHKRPSMIDWKCVTSVLYSCEENSKEHID-CSLP---RVLHTKNGAVC  832

Query  559  SCLLESSLVSTPHNGN  606
            +C++ +S+V TPHNG+
Sbjct  833  TCMIRNSVVCTPHNGS  848



>ref|XP_007029211.1| Dicer-like protein isoform 4, partial [Theobroma cacao]
 gb|EOY09713.1| Dicer-like protein isoform 4, partial [Theobroma cacao]
Length=970

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 116/195 (59%), Gaps = 8/195 (4%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP +FPPELV   ++     Y CYLIEL + +     + NI+L +R++LE D++++ FEL
Sbjct  642  QPIFFPPELVNQCEHEDMKKYYCYLIELKQNFDYEFPVHNIMLLVRSQLEIDNKSMGFEL  701

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
             ++ G       Y+G + L   Q++  +RFQ+ V RVL +H +  L E LG     + S 
Sbjct  702  EVDRGFLTVNLKYVGLIRLDPSQVILSKRFQIAVFRVLMDHKVEKLTEVLGDPRSGNNSD  761

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             IDYLLLPS+    + P IDW  + SVLFSY+     H   C++      + TK+GLL +
Sbjct  762  -IDYLLLPSTYLGQN-PVIDWPSVCSVLFSYENVWKDH--VCNAGM----IQTKSGLLCA  813

Query  562  CLLESSLVSTPHNGN  606
            C++E+SLV TPHNG+
Sbjct  814  CMIENSLVCTPHNGH  828



>gb|EYU39730.1| hypothetical protein MIMGU_mgv1a0003142mg, partial [Erythranthe 
guttata]
Length=1143

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/205 (40%), Positives = 122/205 (60%), Gaps = 9/205 (4%)
 Frame = +1

Query  10   QLGCQP------KYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLE  171
            +LG +P      KYFPPEL+G+     +T Y CYLIEL   +    QLQ ++LA+  RL+
Sbjct  395  ELGSEPYIDEHAKYFPPELIGSCRKESKTHYHCYLIELKANFQYDVQLQEVVLAVHERLD  454

Query  172  SDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEAL  351
             D E ++ +L+++ G  +    +IG + L +EQ+  CRRFQ+T+ R+L +H L+ L E  
Sbjct  455  DDIEKVNLDLDVDRGKIIVGIKHIGYISLDSEQVALCRRFQITLFRLLLDHKLDKLYEED  514

Query  352  GRLNLVDGSAVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRP  531
             + +    S++ +YLLLP+   P +   IDW  I+SV +     +  H ++CS   G  P
Sbjct  515  NQSSEKIDSSIFNYLLLPTIGSPHNT-SIDWKCITSVTYPENSSKDEH-NNCSRNGGNGP  572

Query  532  -MHTKNGLLFSCLLESSLVSTPHNG  603
             MHTKNG    C+L++SLV TPHNG
Sbjct  573  RMHTKNGSACRCMLDNSLVCTPHNG  597



>ref|XP_007029213.1| Dicer-like protein isoform 6 [Theobroma cacao]
 gb|EOY09715.1| Dicer-like protein isoform 6 [Theobroma cacao]
Length=1114

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 116/195 (59%), Gaps = 8/195 (4%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP +FPPELV   ++     Y CYLIEL + +     + NI+L +R++LE D++++ FEL
Sbjct  375  QPIFFPPELVNQCEHEDMKKYYCYLIELKQNFDYEFPVHNIMLLVRSQLEIDNKSMGFEL  434

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
             ++ G       Y+G + L   Q++  +RFQ+ V RVL +H +  L E LG     + S 
Sbjct  435  EVDRGFLTVNLKYVGLIRLDPSQVILSKRFQIAVFRVLMDHKVEKLTEVLGDPRSGNNSD  494

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             IDYLLLPS+    + P IDW  + SVLFSY+     H   C++      + TK+GLL +
Sbjct  495  -IDYLLLPSTYLGQN-PVIDWPSVCSVLFSYENVWKDH--VCNAGM----IQTKSGLLCA  546

Query  562  CLLESSLVSTPHNGN  606
            C++E+SLV TPHNG+
Sbjct  547  CMIENSLVCTPHNGH  561



>gb|KDO45679.1| hypothetical protein CISIN_1g0030621mg, partial [Citrus sinensis]
Length=506

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 114/194 (59%), Gaps = 7/194 (4%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
             P YFPPELV       +  Y CYLIEL + +       +I+LA+RT LES+ + ++F+L
Sbjct  115  HPIYFPPELVNQCPQDTKITYHCYLIELKQNFNYDIPAHDIVLAVRTELESEIKKVNFDL  174

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
             ++ G       ++G + L+ +++L CRRFQ+ + RV+ +HNL+ L+E L  L L D   
Sbjct  175  EVDRGRLTVNLKHLGKIQLTPDKVLLCRRFQIALFRVIMDHNLDKLNEILKGLWLRDNLE  234

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             IDYLLLP+S        IDW  ++S+ F       +H  +CS+    R + TK+G L +
Sbjct  235  -IDYLLLPASEQ-----SIDWEPVASLSFPCDIGL-KHHKNCSTMSNARVVQTKSGPLCT  287

Query  562  CLLESSLVSTPHNG  603
            C++ +S+V TPH+G
Sbjct  288  CMIYNSVVCTPHSG  301



>ref|XP_007029209.1| Dicer-like protein isoform 2 [Theobroma cacao]
 gb|EOY09711.1| Dicer-like protein isoform 2 [Theobroma cacao]
Length=1307

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 116/195 (59%), Gaps = 8/195 (4%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP +FPPELV   ++     Y CYLIEL + +     + NI+L +R++LE D++++ FEL
Sbjct  568  QPIFFPPELVNQCEHEDMKKYYCYLIELKQNFDYEFPVHNIMLLVRSQLEIDNKSMGFEL  627

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
             ++ G       Y+G + L   Q++  +RFQ+ V RVL +H +  L E LG     + S 
Sbjct  628  EVDRGFLTVNLKYVGLIRLDPSQVILSKRFQIAVFRVLMDHKVEKLTEVLGDPRSGNNSD  687

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             IDYLLLPS+    + P IDW  + SVLFSY+     H   C++      + TK+GLL +
Sbjct  688  -IDYLLLPSTYLGQN-PVIDWPSVCSVLFSYENVWKDH--VCNAGM----IQTKSGLLCA  739

Query  562  CLLESSLVSTPHNGN  606
            C++E+SLV TPHNG+
Sbjct  740  CMIENSLVCTPHNGH  754



>ref|XP_007029208.1| Dicer-like protein isoform 1 [Theobroma cacao]
 gb|EOY09710.1| Dicer-like protein isoform 1 [Theobroma cacao]
Length=1418

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 116/195 (59%), Gaps = 8/195 (4%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP +FPPELV   ++     Y CYLIEL + +     + NI+L +R++LE D++++ FEL
Sbjct  679  QPIFFPPELVNQCEHEDMKKYYCYLIELKQNFDYEFPVHNIMLLVRSQLEIDNKSMGFEL  738

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
             ++ G       Y+G + L   Q++  +RFQ+ V RVL +H +  L E LG     + S 
Sbjct  739  EVDRGFLTVNLKYVGLIRLDPSQVILSKRFQIAVFRVLMDHKVEKLTEVLGDPRSGNNSD  798

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             IDYLLLPS+    + P IDW  + SVLFSY+     H   C++      + TK+GLL +
Sbjct  799  -IDYLLLPSTYLGQN-PVIDWPSVCSVLFSYENVWKDH--VCNAGM----IQTKSGLLCA  850

Query  562  CLLESSLVSTPHNGN  606
            C++E+SLV TPHNG+
Sbjct  851  CMIENSLVCTPHNGH  865



>ref|XP_007216896.1| hypothetical protein PRUPE_ppa019601mg, partial [Prunus persica]
 gb|EMJ18095.1| hypothetical protein PRUPE_ppa019601mg, partial [Prunus persica]
Length=806

 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 112/198 (57%), Gaps = 5/198 (3%)
 Frame = +1

Query  22   QPKYFPPELVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  198
            QP Y P ELV     N    LY CYLIE+ + +     + N++L LR+ L  D  N++F+
Sbjct  37   QPSYVPAELVKPWCSNDASVLYHCYLIEMKQNFCSYIPVNNVVLGLRSELNCDIANMNFD  96

Query  199  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVD--  372
            L ++ G          ++ LS EQ+L+CRRFQ+T+ R+L + NL  L E L RL+L    
Sbjct  97   LVVDKGTITVNFKKATEIHLSPEQVLQCRRFQITIFRILVDCNLQNLKEVLERLSLGQNI  156

Query  373  GSAVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRP-MHTKNG  549
            G   I+YLLLP++        IDW  + SV F  ++    H D CS  + C   +HTKNG
Sbjct  157  GVESINYLLLPAARMHQKPLIIDWECVMSVPFRSEENSEYHID-CSPPNNCSGVLHTKNG  215

Query  550  LLFSCLLESSLVSTPHNG  603
            ++ +C +++SLV TPH G
Sbjct  216  MVCTCRVQNSLVCTPHTG  233



>ref|XP_007216887.1| hypothetical protein PRUPE_ppa020875mg, partial [Prunus persica]
 gb|EMJ18086.1| hypothetical protein PRUPE_ppa020875mg, partial [Prunus persica]
Length=752

 Score =   132 bits (331),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 110/197 (56%), Gaps = 3/197 (2%)
 Frame = +1

Query  22   QPKYFPPELVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  198
            QP Y P ELV     N    LY CYLI++   +     + +I+L +R+ L+ D  N++F+
Sbjct  8    QPSYVPAELVKPWCSNDASALYHCYLIQMKPNFCYDIPVNDIVLGMRSELDCDIANMTFD  67

Query  199  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVD--  372
            L +  G          ++ LS+EQ+L+CRRFQ+T+ R+L +H L  L + L RL L    
Sbjct  68   LEVGRGTITVNFKKAAEIHLSSEQVLQCRRFQITIFRILLDHELPNLGKVLERLCLGQNL  127

Query  373  GSAVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGL  552
            G   IDYLLLP++        IDW  ++SV F  ++    H D    ++    +HTKNG+
Sbjct  128  GIESIDYLLLPAARMHQRPSIIDWECVTSVSFRCEENSEYHVDCSPPKNCSGVLHTKNGM  187

Query  553  LFSCLLESSLVSTPHNG  603
            + +C +++SLV TPH G
Sbjct  188  VCTCRIQNSLVYTPHTG  204



>emb|CAN77284.1| hypothetical protein VITISV_043738 [Vitis vinifera]
Length=1296

 Score =   133 bits (334),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 74/196 (38%), Positives = 115/196 (59%), Gaps = 15/196 (8%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            Q  Y+PPEL+      P T Y CYLIEL++ Y      Q I+LA+R+ LE D  N++F+L
Sbjct  562  QATYYPPELINPSLKDPVTPYHCYLIELBQKYEYEVSPQGIVLAVRSELEYDVGNVNFDL  621

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
             ++ G       Y+G + L+ EQ+L CR+FQ+T+LRVL +     +D+ +     +    
Sbjct  622  QVDRGTMTVSMNYVGVIHLTAEQVLMCRKFQITLLRVLID---RAIDKGVFDRYDLGNDQ  678

Query  382  VIDYLLLPSSMDPSDVPKI-DWNIISSVLFSYQKPEHRHSDSCSSRHGC--RPMHTKNGL  552
            ++DYL+LPS+ +  ++P I DW  + SV FS++        + S+  GC    MHTK+G 
Sbjct  679  MVDYLMLPST-NSREIPSIVDWKCLGSVFFSHE--------NASNHMGCFFPRMHTKSGF  729

Query  553  LFSCLLESSLVSTPHN  600
            + SC L++S+V TPH 
Sbjct  730  VCSCTLKNSIVYTPHT  745



>ref|XP_008240779.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Prunus mume]
Length=781

 Score =   132 bits (331),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 110/197 (56%), Gaps = 3/197 (2%)
 Frame = +1

Query  22   QPKYFPPELVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  198
            QP Y P ELV     N    LY CYLIE+   +     + +I+L +R+ L+ D  N++F+
Sbjct  37   QPSYVPAELVKPWCSNDASALYHCYLIEMKPNFCYDIPVNDIVLGMRSELDCDIANMTFD  96

Query  199  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVD--  372
            L +  G          ++ LS+EQ+L+CRRFQ+T+  +L +H L  L + L RL L    
Sbjct  97   LEVGRGTITVNFKKAAEIHLSSEQVLQCRRFQITIFGILLDHELPNLGKVLERLCLGQNL  156

Query  373  GSAVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGL  552
            G+  IDYLLLP++        IDW  ++SV F  ++    H D    ++    +HTKNG+
Sbjct  157  GNESIDYLLLPAARMHQRPSIIDWECVTSVSFRCEENSEYHVDCSPPKNCSGALHTKNGM  216

Query  553  LFSCLLESSLVSTPHNG  603
            + +C +++SLV TPH G
Sbjct  217  VCTCRIQNSLVYTPHTG  233



>ref|XP_006480488.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006480489.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Citrus 
sinensis]
Length=1401

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 115/194 (59%), Gaps = 7/194 (4%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
             P YFPPELV       +  Y CYLIEL + +       +I+LA+RT LES+ + ++F+L
Sbjct  659  HPIYFPPELVNQCPQDTKITYHCYLIELKQNFNYDIPAHDIVLAVRTELESEIKKVNFDL  718

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
             ++ G       ++G + L+ +++L CRRFQ+ + RV+ +HNL+ L+E L  L L D + 
Sbjct  719  EVDRGRLTVNLKHLGKIQLTPDKVLLCRRFQIALFRVIMDHNLDKLNEILKGLRLRD-NL  777

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             IDYLLLP+S        IDW  ++S+ F       +H  +CS+    R + TK+G L +
Sbjct  778  EIDYLLLPASEQ-----LIDWEPVASLSFPCDIGL-KHHKNCSTMSNARVIQTKSGPLCT  831

Query  562  CLLESSLVSTPHNG  603
            C++ +S+V TPH+G
Sbjct  832  CMIHNSVVCTPHSG  845



>ref|XP_006428678.1| hypothetical protein CICLE_v10010911mg [Citrus clementina]
 gb|ESR41918.1| hypothetical protein CICLE_v10010911mg [Citrus clementina]
Length=1401

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 115/194 (59%), Gaps = 7/194 (4%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
             P YFPPELV       +  Y CYLIEL + +       +I+LA+RT LES+ + ++F+L
Sbjct  659  HPIYFPPELVNQCPQDTKITYHCYLIELKQNFNYDIPAHDIVLAVRTELESEIKKVNFDL  718

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
             ++ G       ++G + L+ +++L CRRFQ+ + RV+ +HNL+ L+E L  L L D + 
Sbjct  719  EVDRGRLTVNLKHLGKIQLTPDKVLLCRRFQIALFRVIMDHNLDKLNEILKGLRLRD-NL  777

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             IDYLLLP+S        IDW  ++S+ F       +H  +CS+    R + TK+G L +
Sbjct  778  EIDYLLLPASEQ-----LIDWEPVASLSFPCDIGL-KHHKNCSTMSNARVVQTKSGPLCT  831

Query  562  CLLESSLVSTPHNG  603
            C++ +S+V TPH+G
Sbjct  832  CMIHNSVVCTPHSG  845



>ref|XP_006480490.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Citrus 
sinensis]
 ref|XP_006480491.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X4 [Citrus 
sinensis]
 ref|XP_006480492.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X5 [Citrus 
sinensis]
Length=1401

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 115/194 (59%), Gaps = 7/194 (4%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
             P YFPPELV       +  Y CYLIEL + +       +I+LA+RT LES+ + ++F+L
Sbjct  659  HPIYFPPELVNQCPQDTKITYHCYLIELKQNFNYDIPAHDIVLAVRTELESEIKKVNFDL  718

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
             ++ G       ++G + L+ +++L CRRFQ+ + RV+ +HNL+ L+E L  L L D + 
Sbjct  719  EVDRGRLTVNLKHLGKIQLTPDKVLLCRRFQIALFRVIMDHNLDKLNEILKGLRLRD-NL  777

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             IDYLLLP+S        IDW  ++S+ F       +H  +CS+    R + TK+G L +
Sbjct  778  EIDYLLLPASEQ-----LIDWEPVASLSFPCDIGL-KHHKNCSTMSNARVIQTKSGPLCT  831

Query  562  CLLESSLVSTPHNG  603
            C++ +S+V TPH+G
Sbjct  832  CMIHNSVVCTPHSG  845



>ref|XP_010649218.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X4 [Vitis 
vinifera]
Length=1405

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/196 (38%), Positives = 115/196 (59%), Gaps = 15/196 (8%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            Q  Y+PPEL+      P T Y CYLIEL++ Y      Q I+LA+R+ LE D  N++F+L
Sbjct  669  QATYYPPELINPSLKDPVTPYHCYLIELDQKYEYEVSPQGIVLAVRSELEYDVGNVNFDL  728

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
             ++ G       Y+G + L+ EQ+L CR+FQ+T+LRVL +     +D+ +     +    
Sbjct  729  QVDRGTMTVSMNYVGVIHLTAEQVLMCRKFQITLLRVLID---RAIDKGVFDRYDLGNDQ  785

Query  382  VIDYLLLPSSMDPSDVPKI-DWNIISSVLFSYQKPEHRHSDSCSSRHGC--RPMHTKNGL  552
            ++DYL+LPS+ +  ++P I DW  + SV FS++        + S+  GC    MHTK+G 
Sbjct  786  MVDYLMLPST-NSREIPSIVDWKCLGSVFFSHE--------NASNHMGCFFPRMHTKSGF  836

Query  553  LFSCLLESSLVSTPHN  600
            + SC L++S+V TPH 
Sbjct  837  VCSCTLKNSIVYTPHT  852



>ref|XP_010649214.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Vitis 
vinifera]
Length=1468

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/196 (38%), Positives = 115/196 (59%), Gaps = 15/196 (8%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            Q  Y+PPEL+      P T Y CYLIEL++ Y      Q I+LA+R+ LE D  N++F+L
Sbjct  669  QATYYPPELINPSLKDPVTPYHCYLIELDQKYEYEVSPQGIVLAVRSELEYDVGNVNFDL  728

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
             ++ G       Y+G + L+ EQ+L CR+FQ+T+LRVL +     +D+ +     +    
Sbjct  729  QVDRGTMTVSMNYVGVIHLTAEQVLMCRKFQITLLRVLID---RAIDKGVFDRYDLGNDQ  785

Query  382  VIDYLLLPSSMDPSDVPKI-DWNIISSVLFSYQKPEHRHSDSCSSRHGC--RPMHTKNGL  552
            ++DYL+LPS+ +  ++P I DW  + SV FS++        + S+  GC    MHTK+G 
Sbjct  786  MVDYLMLPST-NSREIPSIVDWKCLGSVFFSHE--------NASNHMGCFFPRMHTKSGF  836

Query  553  LFSCLLESSLVSTPHN  600
            + SC L++S+V TPH 
Sbjct  837  VCSCTLKNSIVYTPHT  852



>ref|XP_010649215.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Vitis 
vinifera]
Length=1461

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/196 (38%), Positives = 115/196 (59%), Gaps = 15/196 (8%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            Q  Y+PPEL+      P T Y CYLIEL++ Y      Q I+LA+R+ LE D  N++F+L
Sbjct  669  QATYYPPELINPSLKDPVTPYHCYLIELDQKYEYEVSPQGIVLAVRSELEYDVGNVNFDL  728

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
             ++ G       Y+G + L+ EQ+L CR+FQ+T+LRVL +     +D+ +     +    
Sbjct  729  QVDRGTMTVSMNYVGVIHLTAEQVLMCRKFQITLLRVLID---RAIDKGVFDRYDLGNDQ  785

Query  382  VIDYLLLPSSMDPSDVPKI-DWNIISSVLFSYQKPEHRHSDSCSSRHGC--RPMHTKNGL  552
            ++DYL+LPS+ +  ++P I DW  + SV FS++        + S+  GC    MHTK+G 
Sbjct  786  MVDYLMLPST-NSREIPSIVDWKCLGSVFFSHE--------NASNHMGCFFPRMHTKSGF  836

Query  553  LFSCLLESSLVSTPHN  600
            + SC L++S+V TPH 
Sbjct  837  VCSCTLKNSIVYTPHT  852



>ref|XP_010649216.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X3 [Vitis 
vinifera]
Length=1460

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/196 (38%), Positives = 115/196 (59%), Gaps = 15/196 (8%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            Q  Y+PPEL+      P T Y CYLIEL++ Y      Q I+LA+R+ LE D  N++F+L
Sbjct  661  QATYYPPELINPSLKDPVTPYHCYLIELDQKYEYEVSPQGIVLAVRSELEYDVGNVNFDL  720

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
             ++ G       Y+G + L+ EQ+L CR+FQ+T+LRVL +     +D+ +     +    
Sbjct  721  QVDRGTMTVSMNYVGVIHLTAEQVLMCRKFQITLLRVLID---RAIDKGVFDRYDLGNDQ  777

Query  382  VIDYLLLPSSMDPSDVPKI-DWNIISSVLFSYQKPEHRHSDSCSSRHGC--RPMHTKNGL  552
            ++DYL+LPS+ +  ++P I DW  + SV FS++        + S+  GC    MHTK+G 
Sbjct  778  MVDYLMLPST-NSREIPSIVDWKCLGSVFFSHE--------NASNHMGCFFPRMHTKSGF  828

Query  553  LFSCLLESSLVSTPHN  600
            + SC L++S+V TPH 
Sbjct  829  VCSCTLKNSIVYTPHT  844



>emb|CBI17597.3| unnamed protein product [Vitis vinifera]
Length=1340

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/196 (38%), Positives = 115/196 (59%), Gaps = 15/196 (8%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            Q  Y+PPEL+      P T Y CYLIEL++ Y      Q I+LA+R+ LE D  N++F+L
Sbjct  606  QATYYPPELINPSLKDPVTPYHCYLIELDQKYEYEVSPQGIVLAVRSELEYDVGNVNFDL  665

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
             ++ G       Y+G + L+ EQ+L CR+FQ+T+LRVL +     +D+ +     +    
Sbjct  666  QVDRGTMTVSMNYVGVIHLTAEQVLMCRKFQITLLRVLID---RAIDKGVFDRYDLGNDQ  722

Query  382  VIDYLLLPSSMDPSDVPKI-DWNIISSVLFSYQKPEHRHSDSCSSRHGC--RPMHTKNGL  552
            ++DYL+LPS+ +  ++P I DW  + SV FS++        + S+  GC    MHTK+G 
Sbjct  723  MVDYLMLPST-NSREIPSIVDWKCLGSVFFSHE--------NASNHMGCFFPRMHTKSGF  773

Query  553  LFSCLLESSLVSTPHN  600
            + SC L++S+V TPH 
Sbjct  774  VCSCTLKNSIVYTPHT  789



>ref|XP_010312606.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Solanum 
lycopersicum]
Length=1406

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/231 (36%), Positives = 122/231 (53%), Gaps = 40/231 (17%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            Q  Y+P E V    N  + +Y CYL+EL    Y  +QL  IILA+RT+L+ DDE L+F+L
Sbjct  642  QSLYYPSEFVSHCGNESEAVYYCYLVELPHDSYNDSQLHGIILAVRTKLKFDDEILAFDL  701

Query  202  NI--------------------EGGNWVGQTVYIGDVGL-----------------SNEQ  270
            ++                    E   W   + Y   V +                 ++E+
Sbjct  702  DVDRRGRLKVQLNYRKVVIFTSEEVRWFLSSFYSLPVKMVWGRLKVQLNYRKVVIFTSEE  761

Query  271  ILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDWNI  450
            I RC+RFQV+V R+L + +L+ L E L  +    GSAV DYLLLPS   P   P+I+W  
Sbjct  762  IRRCQRFQVSVFRILRDPDLSKLQEVLAAVQSPIGSAVSDYLLLPSVGTP---PEINWQY  818

Query  451  ISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFSCLLESSLVSTPHNG  603
            ++S+LF  Q    +H D CS++     ++T + ++ SC+LE+SLV TPHNG
Sbjct  819  VNSLLFPSQVLGDKHMDWCSTQGRRCSVNTISEVVCSCMLENSLVCTPHNG  869



>gb|KJB61696.1| hypothetical protein B456_009G374900 [Gossypium raimondii]
Length=1076

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 115/195 (59%), Gaps = 7/195 (4%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP +FPPELV        T Y CYL+EL + +     + NI+L +R + + D+++++ EL
Sbjct  340  QPIFFPPELVNKGSLDSMTKYYCYLMELKQNFDYEVPVHNIMLLVRNQFDMDEKSVNIEL  399

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
             ++ G       YIG + L+++Q++ CRRFQ+ V +VL +       E L      + S 
Sbjct  400  EVDRGTLTVNMKYIGLIRLNSDQVILCRRFQLAVFQVLMDRKAEKFAEVLCDHTFGNNSE  459

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             IDYLLLPS+      P IDW  ++SV FSY+K    H + C++      + TK+GL+ +
Sbjct  460  -IDYLLLPSNY-VGQSPLIDWLSVTSVTFSYEKAWKNHVN-CNAGM----IQTKSGLVCT  512

Query  562  CLLESSLVSTPHNGN  606
            C++++SLVSTPHNG+
Sbjct  513  CMVQNSLVSTPHNGH  527



>gb|KJB61693.1| hypothetical protein B456_009G374900 [Gossypium raimondii]
Length=1306

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/195 (37%), Positives = 113/195 (58%), Gaps = 7/195 (4%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP +FPPELV        T Y CYL+EL + +     + NI+L +R + + D+++++ EL
Sbjct  570  QPIFFPPELVNKGSLDSMTKYYCYLMELKQNFDYEVPVHNIMLLVRNQFDMDEKSVNIEL  629

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
             ++ G       YIG + L+++Q++ CRRFQ+ V +VL +       E L      + S 
Sbjct  630  EVDRGTLTVNMKYIGLIRLNSDQVILCRRFQLAVFQVLMDRKAEKFAEVLCDHTFGNNSE  689

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             IDYLLLPS+      P IDW  ++SV FSY+K    H +  +       + TK+GL+ +
Sbjct  690  -IDYLLLPSNY-VGQSPLIDWLSVTSVTFSYEKAWKNHVNCNAGM-----IQTKSGLVCT  742

Query  562  CLLESSLVSTPHNGN  606
            C++++SLVSTPHNG+
Sbjct  743  CMVQNSLVSTPHNGH  757



>gb|KJB61692.1| hypothetical protein B456_009G374900 [Gossypium raimondii]
 gb|KJB61694.1| hypothetical protein B456_009G374900 [Gossypium raimondii]
 gb|KJB61695.1| hypothetical protein B456_009G374900 [Gossypium raimondii]
Length=1395

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/195 (37%), Positives = 113/195 (58%), Gaps = 7/195 (4%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP +FPPELV        T Y CYL+EL + +     + NI+L +R + + D+++++ EL
Sbjct  659  QPIFFPPELVNKGSLDSMTKYYCYLMELKQNFDYEVPVHNIMLLVRNQFDMDEKSVNIEL  718

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
             ++ G       YIG + L+++Q++ CRRFQ+ V +VL +       E L      + S 
Sbjct  719  EVDRGTLTVNMKYIGLIRLNSDQVILCRRFQLAVFQVLMDRKAEKFAEVLCDHTFGNNSE  778

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             IDYLLLPS+      P IDW  ++SV FSY+K    H +  +       + TK+GL+ +
Sbjct  779  -IDYLLLPSNY-VGQSPLIDWLSVTSVTFSYEKAWKNHVNCNAGM-----IQTKSGLVCT  831

Query  562  CLLESSLVSTPHNGN  606
            C++++SLVSTPHNG+
Sbjct  832  CMVQNSLVSTPHNGH  846



>ref|XP_004303843.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Fragaria vesca 
subsp. vesca]
Length=1393

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 114/197 (58%), Gaps = 7/197 (4%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            Q  Y P ELV T  N    LY  Y+I L++ +     +++ +L +RT+L+ +  N   EL
Sbjct  651  QSCYVPSELVKTCSNDDTMLYHQYIIVLDQTFDYEIPVKDFVLCMRTKLDFEIANWHSEL  710

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
                G       Y G++ L+ EQ+L CRRFQVT+  +L +HNL+  +E    L+L + S 
Sbjct  711  EFGSGCLTVNFKYGGEIHLNAEQVLNCRRFQVTIFGILIDHNLDKWNEVFDGLSLRE-SL  769

Query  382  VIDYLLLPSS-MDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGC-RPMHTKNGLL  555
             +DYLLLP + + PS    IDW  + SVLFS  +    H D CS  +GC   + TKN ++
Sbjct  770  GVDYLLLPGTRVRPS---IIDWQCVRSVLFSRGEYVKEHID-CSLPNGCSHAVQTKNSVV  825

Query  556  FSCLLESSLVSTPHNGN  606
             +C++++SLV TPHNG+
Sbjct  826  CTCMIQNSLVYTPHNGS  842



>ref|XP_010101236.1| Endoribonuclease Dicer-2-like protein [Morus notabilis]
 gb|EXB88160.1| Endoribonuclease Dicer-2-like protein [Morus notabilis]
Length=1429

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/194 (37%), Positives = 113/194 (58%), Gaps = 3/194 (2%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTL-YSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  198
            QP Y P E+VG+   A   + Y CYLIEL + +     + +++L +R+ LESD  N+ F+
Sbjct  655  QPSYVPSEMVGSFGPADAGVSYHCYLIELKQDFGYDVPIHDLVLCMRSALESDLANIHFD  714

Query  199  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  378
            L +  G+       +G + L+ +Q+   R FQVT+LR+L +H  + L E   +L   + +
Sbjct  715  LQVGRGSVTVNLKNVGTLSLNRDQVTWSRMFQVTLLRLLVDHKFDNLREVHSQLYFSE-T  773

Query  379  AVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLF  558
              IDYLLLP ++  +  P IDW  ++SVLFS ++    H      +   R +HTKNG++ 
Sbjct  774  IQIDYLLLP-AITMNKRPLIDWKSVTSVLFSSEEFCKDHMSCPLPKGISRCIHTKNGIVC  832

Query  559  SCLLESSLVSTPHN  600
            +C+L +SLV TPH+
Sbjct  833  TCMLRNSLVYTPHS  846



>ref|XP_008392375.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Malus domestica]
Length=731

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 111/210 (53%), Gaps = 29/210 (14%)
 Frame = +1

Query  22   QPKYFPPELVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD-ENLSF  195
            QP+Y P ELV     N    +Y CYLI+L +       + +I+LA R +L+ D   N++F
Sbjct  30   QPRYVPTELVKPPCSNDASVMYHCYLIKLKQNIDCDIPVSDIVLATRNKLDCDTIANMNF  89

Query  196  ELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVD-  372
            EL ++ G       Y GDV L +EQ+L CRRFQ+T+ R+L +H L  L++ L R +L   
Sbjct  90   ELQVQRGPLAVNFKYAGDVNLCSEQVLVCRRFQITIFRILVDHELTKLEKVLERFHLGQN  149

Query  373  -GSAVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCR-------  528
             G+  IDYLLLP++        ID + + S+           S  C+   G R       
Sbjct  150  YGTESIDYLLLPAARIHQRASIIDLDTVMSM-----------SSHCNKDFGNRVCVDCPQ  198

Query  529  -------PMHTKNGLLFSCLLESSLVSTPH  597
                   P+HTKNG++ +C +++S+V TPH
Sbjct  199  PNNNSHVPLHTKNGMVCTCRIQNSVVYTPH  228



>ref|XP_008351646.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Malus domestica]
Length=730

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 111/210 (53%), Gaps = 29/210 (14%)
 Frame = +1

Query  22   QPKYFPPELVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD-ENLSF  195
            QP+Y P ELV     N    +Y CYLI+L +       + +I+LA R +L+ D   N++F
Sbjct  29   QPRYVPTELVKPPCSNDASVMYHCYLIKLKQNIDCDIPVSDIVLATRNKLDCDTIANMNF  88

Query  196  ELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVD-  372
            EL ++ G       Y GDV L +EQ+L CRRFQ+T+ R+L +H L  L++ L R +L   
Sbjct  89   ELQVQRGPLAVNFKYAGDVNLCSEQVLVCRRFQITIFRILVDHELTKLEKVLERFHLGQN  148

Query  373  -GSAVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCR-------  528
             G+  IDYLLLP++        ID + + S+           S  C+   G R       
Sbjct  149  YGTESIDYLLLPAARIHQRASIIDLDTVMSM-----------SSHCNKDFGNRVCVDCPQ  197

Query  529  -------PMHTKNGLLFSCLLESSLVSTPH  597
                   P+HTKNG++ +C +++S+V TPH
Sbjct  198  PNNNSHVPLHTKNGMVCTCRIQNSVVYTPH  227



>ref|XP_008443676.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X4 [Cucumis 
melo]
 ref|XP_008443677.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X4 [Cucumis 
melo]
Length=1306

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 108/195 (55%), Gaps = 6/195 (3%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP Y PPE V    +    +Y CYLIEL + ++      NI+LA+RT LE + +++  +L
Sbjct  566  QPIYVPPEFVHCCPHNSSVVYHCYLIELKQNFHYDISAHNIVLAMRTELEFEVQSMCHDL  625

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
            +++ G++     Y+G + LS EQ+L  R+FQ T+ R L  H           + L DG  
Sbjct  626  DVDRGSFDVNFKYVGIIKLSPEQVLLSRQFQRTIFRALLNHTWTNKLSENNEIYLGDGPK  685

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
            V DYLLLPS    + V  I W I+ SVLFS  +    H    SS+     + TK+GL+  
Sbjct  686  V-DYLLLPS----TGVELISWEIVLSVLFS-SREYCVHRGISSSKGLAYDVQTKSGLVCI  739

Query  562  CLLESSLVSTPHNGN  606
            C L++SLV TPHNG+
Sbjct  740  CRLQNSLVYTPHNGH  754



>ref|XP_008443674.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Cucumis 
melo]
Length=1365

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 108/195 (55%), Gaps = 6/195 (3%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP Y PPE V    +    +Y CYLIEL + ++      NI+LA+RT LE + +++  +L
Sbjct  653  QPIYVPPEFVHCCPHNSSVVYHCYLIELKQNFHYDISAHNIVLAMRTELEFEVQSMCHDL  712

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
            +++ G++     Y+G + LS EQ+L  R+FQ T+ R L  H           + L DG  
Sbjct  713  DVDRGSFDVNFKYVGIIKLSPEQVLLSRQFQRTIFRALLNHTWTNKLSENNEIYLGDGPK  772

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
            V DYLLLPS    + V  I W I+ SVLFS  +    H    SS+     + TK+GL+  
Sbjct  773  V-DYLLLPS----TGVELISWEIVLSVLFS-SREYCVHRGISSSKGLAYDVQTKSGLVCI  826

Query  562  CLLESSLVSTPHNGN  606
            C L++SLV TPHNG+
Sbjct  827  CRLQNSLVYTPHNGH  841



>ref|XP_008443675.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X3 [Cucumis 
melo]
Length=1346

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 108/195 (55%), Gaps = 6/195 (3%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP Y PPE V    +    +Y CYLIEL + ++      NI+LA+RT LE + +++  +L
Sbjct  606  QPIYVPPEFVHCCPHNSSVVYHCYLIELKQNFHYDISAHNIVLAMRTELEFEVQSMCHDL  665

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
            +++ G++     Y+G + LS EQ+L  R+FQ T+ R L  H           + L DG  
Sbjct  666  DVDRGSFDVNFKYVGIIKLSPEQVLLSRQFQRTIFRALLNHTWTNKLSENNEIYLGDGPK  725

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
            V DYLLLPS    + V  I W I+ SVLFS  +    H    SS+     + TK+GL+  
Sbjct  726  V-DYLLLPS----TGVELISWEIVLSVLFS-SREYCVHRGISSSKGLAYDVQTKSGLVCI  779

Query  562  CLLESSLVSTPHNGN  606
            C L++SLV TPHNG+
Sbjct  780  CRLQNSLVYTPHNGH  794



>ref|XP_008443670.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Cucumis 
melo]
 ref|XP_008443671.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Cucumis 
melo]
 ref|XP_008443672.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Cucumis 
melo]
Length=1393

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 108/195 (55%), Gaps = 6/195 (3%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP Y PPE V    +    +Y CYLIEL + ++      NI+LA+RT LE + +++  +L
Sbjct  653  QPIYVPPEFVHCCPHNSSVVYHCYLIELKQNFHYDISAHNIVLAMRTELEFEVQSMCHDL  712

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
            +++ G++     Y+G + LS EQ+L  R+FQ T+ R L  H           + L DG  
Sbjct  713  DVDRGSFDVNFKYVGIIKLSPEQVLLSRQFQRTIFRALLNHTWTNKLSENNEIYLGDGPK  772

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
            V DYLLLPS    + V  I W I+ SVLFS  +    H    SS+     + TK+GL+  
Sbjct  773  V-DYLLLPS----TGVELISWEIVLSVLFS-SREYCVHRGISSSKGLAYDVQTKSGLVCI  826

Query  562  CLLESSLVSTPHNGN  606
            C L++SLV TPHNG+
Sbjct  827  CRLQNSLVYTPHNGH  841



>gb|KHG30500.1| hypothetical protein F383_12835 [Gossypium arboreum]
Length=1290

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 105/192 (55%), Gaps = 10/192 (5%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP +FPPELV        T Y CYL+EL + +     + NIIL +R++LE   E  S EL
Sbjct  710  QPIFFPPELVNQDSQESMTKYYCYLMELKQNFGYEIPVHNIILLVRSQLEM--EAKSIEL  767

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
             ++ G       YIG + LS++Q++ CRRFQ+ + RVL +H    L E L  L   + S 
Sbjct  768  EVDRGTLTVNLKYIGLIRLSSDQVILCRRFQIALFRVLMDHKAEKLTELLSDLTSGNNSE  827

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             IDYLLLPS+      P IDW  ISS+LFSY+K    H + C++      + TK+GL+  
Sbjct  828  -IDYLLLPSNY--MGQPVIDWLSISSILFSYEKVWKNHVN-CNAGM----IQTKSGLVLE  879

Query  562  CLLESSLVSTPH  597
             +     + + H
Sbjct  880  AITTKKCLESFH  891



>ref|XP_004139098.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Cucumis sativus]
 gb|KGN66658.1| hypothetical protein Csa_1G654870 [Cucumis sativus]
Length=1393

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 108/195 (55%), Gaps = 6/195 (3%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP Y PPE V    +    +Y CYLIEL + ++      NI+LA+RT LE + +++  +L
Sbjct  653  QPIYVPPEFVHCCPHNSSVVYHCYLIELKQNFHYDISAHNIVLAMRTELEFEVQSMCHDL  712

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
            +++ G++     Y+G + LS EQ+L  R+FQ T+ +VL  H           + L DG  
Sbjct  713  DVDRGSFDVNFKYVGIIKLSPEQVLLSRQFQRTIFKVLLNHTWTNKLSENNEICLGDGPR  772

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
            V DYLLLPS+        I W I+ SVL S Q+    H    SS+     + TK+GL+  
Sbjct  773  V-DYLLLPSTGGEL----ISWEIVLSVLVSSQE-YCVHRGISSSKDVSYDVPTKSGLVCI  826

Query  562  CLLESSLVSTPHNGN  606
            C L++S+V TPHNG+
Sbjct  827  CRLQNSVVYTPHNGH  841



>ref|XP_004171378.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Cucumis sativus]
Length=453

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 72/195 (37%), Positives = 106/195 (54%), Gaps = 6/195 (3%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP Y PPE V    +    +Y CYLIEL + ++      NI+LA+RT LE + +++  +L
Sbjct  163  QPIYVPPEFVHCCPHNSSVVYHCYLIELKQNFHYDISAHNIVLAMRTELEFEVQSMCHDL  222

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
            +++ G++     Y+G + LS EQ+L  R+FQ T+ RVL  H           + L DG  
Sbjct  223  DVDRGSFDVNFKYVGIIKLSPEQVLLSRQFQRTIFRVLLNHTWTDKLSENNEICLGDGPR  282

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
            V DYLLLPS+        I W I+ SVL S  +    H    SS+     + TK+GL+  
Sbjct  283  V-DYLLLPSTGGEL----ISWEIVLSVLVS-SREYCVHRGISSSKDVSYDVPTKSGLVCI  336

Query  562  CLLESSLVSTPHNGN  606
            C L++S+V TPHN +
Sbjct  337  CRLQNSVVYTPHNDH  351



>gb|KEH20231.1| endoribonuclease dicer-like protein [Medicago truncatula]
Length=1219

 Score =   113 bits (283),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 107/194 (55%), Gaps = 13/194 (7%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP Y P ELV    N   T+Y CYLIEL + +     +Q+I LA R +L+ + E + F++
Sbjct  658  QPSYVPLELVNRMSNNSCTIYYCYLIELKQKFSYDLTVQDIFLATRVKLDLESECMEFDM  717

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
              + G+      Y G + LS +Q+L C+RFQV VL +L  H  +   ++ G+  L D   
Sbjct  718  CFDRGSLSVNLRYKGSINLSPDQVLLCKRFQVNVLGILMNHKTDKETDS-GKFCLEDDLE  776

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             IDYLLLP S+   +   +DW  I+S+  S  K  H  ++          + T+ GL+  
Sbjct  777  -IDYLLLP-SIAIEETLSVDWITINSIHPSIVKCLHHEAN----------IWTEKGLVCP  824

Query  562  CLLESSLVSTPHNG  603
            C+L+++L+STPHNG
Sbjct  825  CILQNALISTPHNG  838



>gb|KEH42074.1| endoribonuclease dicer-like protein [Medicago truncatula]
Length=1385

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 102/194 (53%), Gaps = 13/194 (7%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP Y P ELV    N   T+Y CYL+EL + +     +Q+I LA R +L+ + E + F +
Sbjct  656  QPSYVPLELVNRMPNNSNTIYYCYLLELKQNFSYDITVQDIFLATRVKLDLETECMQFNM  715

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
              + G+      Y G + LS +Q+L C+RFQV VL +L  H  +   E +     ++   
Sbjct  716  GFDRGSLSVNLKYKGSINLSPDQVLLCKRFQVNVLGILMNHKTDM--ETVSDKFCLEDDL  773

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
              DYLLLP S+   + P +DW  I+S+  S  K  H  ++          + T+ GL+  
Sbjct  774  EFDYLLLP-SIAIEETPSVDWITINSIHPSIVKCLHHEAN----------IWTEKGLVCP  822

Query  562  CLLESSLVSTPHNG  603
            C+L ++L+ TPHNG
Sbjct  823  CILRNALICTPHNG  836



>gb|AES64802.2| endoribonuclease dicer-like protein [Medicago truncatula]
Length=1377

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 64/194 (33%), Positives = 100/194 (52%), Gaps = 13/194 (7%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP Y P ELV    N   T+Y CYLIEL + +     +Q+I LA R  L+ +   + F++
Sbjct  654  QPSYVPFELVNHMSNNSSTIYYCYLIELKQNFSYDITVQDIFLATRVELDPEIGCMQFDM  713

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
              + G+      Y G++ LS +Q+L C+RFQV++L +L    ++   E+      ++   
Sbjct  714  CFDRGSLAVNLRYRGNINLSPDQVLLCKRFQVSILGILMNSKMD--KESFSEKYSLEDDL  771

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             IDYLLLP S+   + P +DW  ISS+          H      R+    + T+ G    
Sbjct  772  EIDYLLLP-SIAIEETPSVDWLTISSI----------HPSKIQCRYHAANILTEKGFACG  820

Query  562  CLLESSLVSTPHNG  603
            C+L ++L+ TPHNG
Sbjct  821  CILRNALICTPHNG  834



>ref|XP_009348591.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Pyrus 
x bretschneideri]
Length=581

 Score =   108 bits (271),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 72/201 (36%), Positives = 108/201 (54%), Gaps = 9/201 (4%)
 Frame = +1

Query  22   QPKYFPPELVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD-ENLSF  195
            QP+Y P ELV     N    +Y CYLIEL   +     + +I+L  R  L+ D   N++F
Sbjct  32   QPRYVPIELVKPPCSNDASVMYHCYLIELKPNFDCDIPVSDIVLGTRNELDCDTVANMNF  91

Query  196  ELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDG  375
            EL ++GG       + GDV LS+EQ+L CRRFQ+T+ ++L +  L  LDE L R  L   
Sbjct  92   ELQVQGGPLTVNFKHAGDVSLSSEQVLACRRFQITIFKILVDCKLKKLDEVLERFCLGQN  151

Query  376  --SAVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCS----SRHGCRPMH  537
              +  IDYLLLP          ID   I S + S    + ++S   +    + +    +H
Sbjct  152  HRTESIDYLLLPVERIHQRPSIIDLESIMS-MSSLCNDDSKNSACVNFPQPNNNSHVLLH  210

Query  538  TKNGLLFSCLLESSLVSTPHN  600
            T+NG++ +C +++S+V TPHN
Sbjct  211  TQNGMVCTCRIQNSVVYTPHN  231



>ref|XP_003594551.1| Endoribonuclease Dicer [Medicago truncatula]
Length=1418

 Score =   110 bits (275),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 64/194 (33%), Positives = 100/194 (52%), Gaps = 13/194 (7%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP Y P ELV    N   T+Y CYLIEL + +     +Q+I LA R  L+ +   + F++
Sbjct  693  QPSYVPFELVNHMSNNSSTIYYCYLIELKQNFSYDITVQDIFLATRVELDPEIGCMQFDM  752

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
              + G+      Y G++ LS +Q+L C+RFQV++L +L    ++   E+      ++   
Sbjct  753  CFDRGSLAVNLRYRGNINLSPDQVLLCKRFQVSILGILMNSKMD--KESFSEKYSLEDDL  810

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             IDYLLLP S+   + P +DW  ISS+          H      R+    + T+ G    
Sbjct  811  EIDYLLLP-SIAIEETPSVDWLTISSI----------HPSKIQCRYHAANILTEKGFACG  859

Query  562  CLLESSLVSTPHNG  603
            C+L ++L+ TPHNG
Sbjct  860  CILRNALICTPHNG  873



>ref|XP_010249398.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Nelumbo 
nucifera]
Length=1188

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 102/199 (51%), Gaps = 14/199 (7%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQ----TLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  189
            Q  YFP ELV   ++ P      +Y CY+I L + +      ++I L +R  L +D EN 
Sbjct  445  QVNYFPAELV---NHCPSCSVIEMYHCYVIRLKKNFKYDVPFRDIALLVRHNLGADFENF  501

Query  190  SFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLV  369
             F+L ++ G      VY G + LS +Q+L  RRFQ+TVLRVL +H+++ + + +      
Sbjct  502  YFDLEVDWGFVTVNLVYNGTIHLSPDQVLMARRFQITVLRVLIDHSMDKVKDVMDETFQK  561

Query  370  DGSAVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNG  549
                ++DY+LLP S    +    DW  +      + K  H     C  R     MHT NG
Sbjct  562  QILPIVDYILLPFS---DNTKCFDWEYVIYDGNDWGKQMHY----CRCRSNVHWMHTING  614

Query  550  LLFSCLLESSLVSTPHNGN  606
            +   C+L +SLV TPHNG+
Sbjct  615  IFCRCMLVNSLVLTPHNGH  633



>ref|XP_010249397.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Nelumbo 
nucifera]
Length=1394

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 102/199 (51%), Gaps = 14/199 (7%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQ----TLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  189
            Q  YFP ELV   ++ P      +Y CY+I L + +      ++I L +R  L +D EN 
Sbjct  651  QVNYFPAELV---NHCPSCSVIEMYHCYVIRLKKNFKYDVPFRDIALLVRHNLGADFENF  707

Query  190  SFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLV  369
             F+L ++ G      VY G + LS +Q+L  RRFQ+TVLRVL +H+++ + + +      
Sbjct  708  YFDLEVDWGFVTVNLVYNGTIHLSPDQVLMARRFQITVLRVLIDHSMDKVKDVMDETFQK  767

Query  370  DGSAVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNG  549
                ++DY+LLP S    +    DW  +      + K  H     C  R     MHT NG
Sbjct  768  QILPIVDYILLPFS---DNTKCFDWEYVIYDGNDWGKQMHY----CRCRSNVHWMHTING  820

Query  550  LLFSCLLESSLVSTPHNGN  606
            +   C+L +SLV TPHNG+
Sbjct  821  IFCRCMLVNSLVLTPHNGH  839



>ref|XP_009348590.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=775

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 72/201 (36%), Positives = 108/201 (54%), Gaps = 9/201 (4%)
 Frame = +1

Query  22   QPKYFPPELVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD-ENLSF  195
            QP+Y P ELV     N    +Y CYLIEL   +     + +I+L  R  L+ D   N++F
Sbjct  32   QPRYVPIELVKPPCSNDASVMYHCYLIELKPNFDCDIPVSDIVLGTRNELDCDTVANMNF  91

Query  196  ELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDG  375
            EL ++GG       + GDV LS+EQ+L CRRFQ+T+ ++L +  L  LDE L R  L   
Sbjct  92   ELQVQGGPLTVNFKHAGDVSLSSEQVLACRRFQITIFKILVDCKLKKLDEVLERFCLGQN  151

Query  376  --SAVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCS----SRHGCRPMH  537
              +  IDYLLLP          ID   I S + S    + ++S   +    + +    +H
Sbjct  152  HRTESIDYLLLPVERIHQRPSIIDLESIMS-MSSLCNDDSKNSACVNFPQPNNNSHVLLH  210

Query  538  TKNGLLFSCLLESSLVSTPHN  600
            T+NG++ +C +++S+V TPHN
Sbjct  211  TQNGMVCTCRIQNSVVYTPHN  231



>ref|XP_003535104.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Glycine 
max]
 ref|XP_006586845.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Glycine 
max]
 gb|KHN23015.1| Endoribonuclease Dicer like 2 [Glycine soja]
Length=1414

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/192 (34%), Positives = 103/192 (54%), Gaps = 12/192 (6%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP + P  LV +  N  QT+Y CY +E N  +     +Q+I L +R  L+ +   + F++
Sbjct  658  QPTFVPFGLVNSVSNNSQTVYHCYFMEFNNKFSYDVSVQDIFLLMRIELDPEIGCMQFDM  717

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
              + G+      Y G + LS +Q+L C++FQVT+LR+L +H++N L   L R  L D   
Sbjct  718  GFDRGSLSVNFRYKGTINLSPDQVLLCKKFQVTILRILIDHDMNKLTAGLDRCYLED-DL  776

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             IDYLLLP +M       I+W  ++SV          +    S ++    + TK+GL+ S
Sbjct  777  EIDYLLLP-AMGKGKYTAINWLAVNSV----------NPSEVSCKYHEPHIRTKSGLVCS  825

Query  562  CLLESSLVSTPH  597
            C L+++LV T H
Sbjct  826  CKLQNALVCTSH  837



>ref|XP_008373031.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Malus 
domestica]
Length=665

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 108/204 (53%), Gaps = 14/204 (7%)
 Frame = +1

Query  22   QPKYFPPELVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD-ENLSF  195
            QP+Y P ELV     N    +Y CYLIEL   +     + +I+L +R  L+ D   N++F
Sbjct  32   QPRYVPIELVKPPCSNDASVMYHCYLIELKPNFDCDIPVSDIVLGMRNELDCDTIANMNF  91

Query  196  ELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDG  375
            EL ++ G       + GDV LS+EQ+L CRRFQ+T+ ++L +H L  L+E L R  L   
Sbjct  92   ELQVQRGPLTVNFKHAGDVSLSSEQVLACRRFQITIFKILVDHKLKKLEEVLERFCLGQN  151

Query  376  --SAVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRP------  531
              +  IDYLLLP+         I   I    + S     +  S + +  +  +P      
Sbjct  152  HWTESIDYLLLPAERRIHXRSSI---IDLESIMSMSSLCNNDSKNSACVNFPQPNNNSHV  208

Query  532  -MHTKNGLLFSCLLESSLVSTPHN  600
             +HT+NG++ +C +++S+V TPHN
Sbjct  209  LLHTQNGMVCTCRIQNSVVYTPHN  232



>ref|XP_008373030.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Malus 
domestica]
Length=776

 Score =   107 bits (266),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 108/204 (53%), Gaps = 14/204 (7%)
 Frame = +1

Query  22   QPKYFPPELVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD-ENLSF  195
            QP+Y P ELV     N    +Y CYLIEL   +     + +I+L +R  L+ D   N++F
Sbjct  32   QPRYVPIELVKPPCSNDASVMYHCYLIELKPNFDCDIPVSDIVLGMRNELDCDTIANMNF  91

Query  196  ELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDG  375
            EL ++ G       + GDV LS+EQ+L CRRFQ+T+ ++L +H L  L+E L R  L   
Sbjct  92   ELQVQRGPLTVNFKHAGDVSLSSEQVLACRRFQITIFKILVDHKLKKLEEVLERFCLGQN  151

Query  376  --SAVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRP------  531
              +  IDYLLLP+         I   I    + S     +  S + +  +  +P      
Sbjct  152  HWTESIDYLLLPAERRIHXRSSI---IDLESIMSMSSLCNNDSKNSACVNFPQPNNNSHV  208

Query  532  -MHTKNGLLFSCLLESSLVSTPHN  600
             +HT+NG++ +C +++S+V TPHN
Sbjct  209  LLHTQNGMVCTCRIQNSVVYTPHN  232



>ref|XP_010673887.1| PREDICTED: endoribonuclease Dicer homolog 2 [Beta vulgaris subsp. 
vulgaris]
Length=1432

 Score =   107 bits (267),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 68/201 (34%), Positives = 105/201 (52%), Gaps = 8/201 (4%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            Q +Y P E VG    +   +Y  YL+EL + +Y    + +I+L  +T L SD  N+ F++
Sbjct  683  QARYVPSEFVGDGPTSSSDVYHGYLMELKQDFYSDIPVHDIVLVFKTELASDVGNMHFDM  742

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLV---D  372
            +++ GN      YIG + L+ +Q+  C ++QV VLRVL + + + L E++  LN     D
Sbjct  743  DVDWGNMSVDVKYIGKINLTRKQVALCTQYQVAVLRVLRDLDFDKLVESVKELNKWENND  802

Query  373  GSAV--IDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRP--MHT  540
            G+ V   DYLLLP          +D   ISS  F     +    + C+ R    P  ++T
Sbjct  803  GAPVSHYDYLLLPRHWLHQRSLVVDLECISSSCFLRDVVQGSFPN-CNKRKCAHPDDVYT  861

Query  541  KNGLLFSCLLESSLVSTPHNG  603
            KNG +   +LE+ LV  PHNG
Sbjct  862  KNGYIHRSVLENCLVCAPHNG  882



>ref|XP_007147466.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 ref|XP_007147467.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 ref|XP_007147468.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 gb|ESW19460.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 gb|ESW19461.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 gb|ESW19462.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
Length=1392

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 109/199 (55%), Gaps = 22/199 (11%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP Y P  LV    N+  T Y CYL+E +  +   T +Q++ LA+R +L+ +   + F+L
Sbjct  656  QPIYAPFGLVNCVSNSSHTTYHCYLMEFSPNFCYHTSVQDVFLAIRIKLDPEIGCMQFDL  715

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
            + + G+   +  Y G + LS++Q+L C++FQVT+LR+L ++ +N     L +  L D   
Sbjct  716  DFDRGSVSVKLRYKGTINLSSDQVLLCKKFQVTLLRILIDNCMNKFTTGLDKCFLKD-DL  774

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFS-----YQKPEHRHSDSCSSRHGCRPMHTKN  546
             IDYLLLP++    +   +DW I++SV  S     Y +P                + TK+
Sbjct  775  EIDYLLLPATGKRPN-STVDWLIVNSVNPSNIRCKYHQPH---------------ISTKS  818

Query  547  GLLFSCLLESSLVSTPHNG  603
            GL+ +C L+++LV T H G
Sbjct  819  GLVCACKLQNALVCTSHAG  837



>ref|XP_010088523.1| Endoribonuclease Dicer-2-like protein [Morus notabilis]
 gb|EXB36440.1| Endoribonuclease Dicer-2-like protein [Morus notabilis]
Length=1077

 Score =   103 bits (258),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 102/198 (52%), Gaps = 22/198 (11%)
 Frame = +1

Query  22   QPKYFPPELVGTR--DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSF  195
             P+Y P E+VG+   D    TLY CYL+EL + +     + NI+L  R  LE D  N  F
Sbjct  345  HPRYIPSEMVGSFCPDGDAHTLYYCYLLELKQEFEYDIPVHNILLGTRNELEVDGGNTHF  404

Query  196  ELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDG  375
            +L +  G+ +    Y+G        + +C            E N N + E   + +L + 
Sbjct  405  DLKVGSGSLIVNLKYVG--------VKKCYSS---------EENFNYVREVSSQHHLQE-  446

Query  376  SAVIDYLLLPSS-MDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGL  552
               IDYL+LP++ ++P D+  + W    S LFS++K    H+  C  ++     HTKNG+
Sbjct  447  DIEIDYLILPATILNPRDL-MVKWESTISALFSFEKCNENHTTRCLVKNYFNRTHTKNGI  505

Query  553  LFSCLLESSLVSTPHNGN  606
            + +C L++SLV TPHNGN
Sbjct  506  VCTCKLKNSLVYTPHNGN  523



>ref|XP_004486471.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Cicer arietinum]
Length=1400

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 99/197 (50%), Gaps = 19/197 (10%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP Y P ELV    N   T Y CYLIEL + +     +Q+I LA R  L+ +   + F++
Sbjct  672  QPSYVPFELVNRVLNNSNTTYYCYLIELKQNFSYDFTVQDIFLATRVELDPEIACMQFDM  731

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLN---TLDEALGRLNLVD  372
              + G+      Y G + LS +Q+L C+RFQV VL +L +H  +     DE     NL  
Sbjct  732  CFDRGSLDVNLKYKGSINLSPDQVLLCKRFQVNVLGILMDHKTDKGTVFDECCLEDNL--  789

Query  373  GSAVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGL  552
                +DYLLLP S+   +   +DW  I+S+          H       H    + T+ G 
Sbjct  790  ---EVDYLLLP-SIAIEERTDVDWLTINSI----------HPSKMECLHHEANIRTEKGF  835

Query  553  LFSCLLESSLVSTPHNG  603
            + +C+L+++LV TPHNG
Sbjct  836  ICACILKNALVCTPHNG  852



>gb|KFK39865.1| hypothetical protein AALP_AA3G298800 [Arabis alpina]
Length=986

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 76/145 (52%), Gaps = 2/145 (1%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP Y PPELV      PQT Y  Y I +     +  + + I L  R  LE D  N  F L
Sbjct  436  QPCYLPPELVSQFSAEPQTTYHMYSIRMKPSSSRDIKFKEIFLGTRVELEDDLGNTGFRL  495

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
                G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L EAL  L L DG A
Sbjct  496  EDHKGTVAVTLSYVGAFHLTQEEVLLCRRFQITLFRVLLDHSVENLVEALDGLQLRDGVA  555

Query  382  VIDYLLLPSSMDPSDVPKIDWNIIS  456
             +DYLL+PS++       IDW  +S
Sbjct  556  -LDYLLVPSTLSLG-TSLIDWEDLS  578



>ref|XP_007147294.1| hypothetical protein PHAVU_006G111800g [Phaseolus vulgaris]
 gb|ESW19288.1| hypothetical protein PHAVU_006G111800g [Phaseolus vulgaris]
Length=754

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 101/199 (51%), Gaps = 12/199 (6%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYS--CYLIELNRYYYKRTQLQNIILALRTRLESDD-ENLS  192
             P Y PPELV     +    Y   CYL+EL   Y    ++ +I+LA+RT LES+  E LS
Sbjct  8    HPCYVPPELVNCSSKSCSVTYEYYCYLMELKEDYKYEVKVGDIVLAMRTELESEIIETLS  67

Query  193  -FELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLV  369
               L +E G           + LS+EQ+ +CRRFQ T+ ++L   + N L  A    +L 
Sbjct  68   GTSLVVERGKLSLNLTPAKPIQLSSEQVEKCRRFQTTLFKILLNGDFNQLPSASDNFSLG  127

Query  370  DGSAVIDYLLLPSSMDPSDVPK--IDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTK  543
            D    IDYLLLP+++      K  IDW  + S  FS +      +  C+  H    +  +
Sbjct  128  DNPE-IDYLLLPATVKDQRPSKSIIDWKSVYSFPFSSES-----TCDCNCNHHACDVKIQ  181

Query  544  NGLLFSCLLESSLVSTPHN  600
            NG + SC LE+ +V TPH+
Sbjct  182  NGSVCSCKLENCVVYTPHS  200



>gb|ACU23800.1| unknown [Glycine max]
Length=273

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 103/200 (52%), Gaps = 16/200 (8%)
 Frame = +1

Query  25   PKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESD--DENLSFE  198
            P Y P E V          Y CYL+EL ++Y  +  + +I+LA+R+ L+S+  D      
Sbjct  9    PSYVPSERVSCSSKGRNVTYHCYLMELEQHYEYQVSVNDIVLAIRSELDSEIVDTLSGTS  68

Query  199  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  378
             +++ G  +    ++  + LS E++  CRRFQ T+ R+L   ++  L       +L D  
Sbjct  69   FDVKRGKLLVNLRHLEPIQLSPEKVQSCRRFQTTLFRILLNRDVTKLTSVSDDFSLGDNP  128

Query  379  AVIDYLLLPSSMD---PSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSR-HGCRPMHTKN  546
              ID+LLLP+++    PS+   IDW  + SV FS +        +C  + H C  +  +N
Sbjct  129  E-IDFLLLPATVKHQRPSN-SIIDWKPVLSVPFSSE-------STCDCKDHACN-VRIRN  178

Query  547  GLLFSCLLESSLVSTPHNGN  606
              + SC LE+ +V TPHNG+
Sbjct  179  DSVCSCKLENCVVYTPHNGS  198



>ref|XP_007147469.1| hypothetical protein PHAVU_006G127200g [Phaseolus vulgaris]
 ref|XP_007147470.1| hypothetical protein PHAVU_006G127200g [Phaseolus vulgaris]
 gb|ESW19463.1| hypothetical protein PHAVU_006G127200g [Phaseolus vulgaris]
 gb|ESW19464.1| hypothetical protein PHAVU_006G127200g [Phaseolus vulgaris]
Length=1388

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 104/194 (54%), Gaps = 16/194 (8%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP Y P  LV    N   T Y CYL+EL + +     +Q+I LA R  L+ +     F++
Sbjct  655  QPAYVPFGLVNCVSNNSHTTYHCYLMELIQNFSYDICVQDIFLATRIELDPEIGCTQFDM  714

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
              + G+   + +Y G + LS + +L C++FQVT+LR+L ++++N L   L +  L +G  
Sbjct  715  GFDRGSLSVKLIYKGTIDLSPDLVLLCKKFQVTLLRILIDNSMNKLAMGLDKCYL-EGDV  773

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMH--TKNGLL  555
             IDYLLLP ++   +   ++W  IS+V  S  K E+             P H  TK+GL+
Sbjct  774  EIDYLLLP-AIGKGEKSIVNWLAISAVNPSNIKCEY------------HPNHIRTKSGLV  820

Query  556  FSCLLESSLVSTPH  597
             +C L+ +LV T H
Sbjct  821  CTCRLQDALVFTSH  834



>ref|XP_003553782.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Glycine 
max]
Length=756

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 104/200 (52%), Gaps = 16/200 (8%)
 Frame = +1

Query  25   PKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESD--DENLSFE  198
            P Y P ELV          Y CYL+EL ++Y  +  + +I+LA+R+ L+S+  D      
Sbjct  9    PSYVPSELVSCSSKGRNVTYHCYLMELEQHYEYQVSVNDIVLAIRSELDSEIVDTLSGTS  68

Query  199  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  378
             +++ G  +    ++  + LS E++  CRRFQ T+ R+L   ++  L       +L D  
Sbjct  69   FDVKRGKLLVNLRHLEPIQLSPEKVQSCRRFQTTLFRILLNRDVTKLTSVSDDFSLGDNP  128

Query  379  AVIDYLLLPSSMD---PSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSR-HGCRPMHTKN  546
              ID+LLLP+++    PS+   IDW  + SV FS +        +C  + H C  +  +N
Sbjct  129  E-IDFLLLPATVKHQRPSN-SIIDWKPVLSVPFSSE-------STCDCKDHACN-VRIRN  178

Query  547  GLLFSCLLESSLVSTPHNGN  606
              + SC LE+ +V TPHNG+
Sbjct  179  DSVCSCKLENCVVYTPHNGS  198



>gb|KHN43108.1| Endoribonuclease Dicer like 2 [Glycine soja]
Length=836

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 104/200 (52%), Gaps = 16/200 (8%)
 Frame = +1

Query  25   PKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESD--DENLSFE  198
            P Y P ELV          Y CYL+EL ++Y  +  + +I+LA+R+ L+S+  D      
Sbjct  57   PSYVPSELVSCSSKGRNVTYHCYLMELEQHYEYQVSVNDIVLAIRSELDSEIVDTLSGTS  116

Query  199  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  378
             +++ G  +    ++  + LS E++  CRRFQ T+ R+L   ++  L       +L D  
Sbjct  117  FDVKRGKLLVNLRHLEPIQLSPEKVQSCRRFQTTLFRILLNRDVTKLTSVSDDFSLGDNP  176

Query  379  AVIDYLLLPSSMD---PSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSR-HGCRPMHTKN  546
              ID+LLLP+++    PS+   IDW  + SV FS +        +C  + H C  +  +N
Sbjct  177  E-IDFLLLPATVKHQRPSN-SIIDWKPVLSVPFSSE-------STCDCKDHACN-VRIRN  226

Query  547  GLLFSCLLESSLVSTPHNGN  606
              + SC LE+ +V TPHNG+
Sbjct  227  DSVCSCKLENCVVYTPHNGS  246



>ref|XP_006604892.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Glycine 
max]
Length=788

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 104/200 (52%), Gaps = 16/200 (8%)
 Frame = +1

Query  25   PKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESD--DENLSFE  198
            P Y P ELV          Y CYL+EL ++Y  +  + +I+LA+R+ L+S+  D      
Sbjct  9    PSYVPSELVSCSSKGRNVTYHCYLMELEQHYEYQVSVNDIVLAIRSELDSEIVDTLSGTS  68

Query  199  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  378
             +++ G  +    ++  + LS E++  CRRFQ T+ R+L   ++  L       +L D  
Sbjct  69   FDVKRGKLLVNLRHLEPIQLSPEKVQSCRRFQTTLFRILLNRDVTKLTSVSDDFSLGDNP  128

Query  379  AVIDYLLLPSSMD---PSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSR-HGCRPMHTKN  546
              ID+LLLP+++    PS+   IDW  + SV FS +        +C  + H C  +  +N
Sbjct  129  E-IDFLLLPATVKHQRPSN-SIIDWKPVLSVPFSSE-------STCDCKDHACN-VRIRN  178

Query  547  GLLFSCLLESSLVSTPHNGN  606
              + SC LE+ +V TPHNG+
Sbjct  179  DSVCSCKLENCVVYTPHNGS  198



>ref|XP_006586847.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Glycine 
max]
Length=1387

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 104/194 (54%), Gaps = 12/194 (6%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP + P  LV +  N   T+Y CYL+EL++ +     +Q+I LA+R  L+ +     F++
Sbjct  657  QPTFVPFGLVNSVSNNSHTIYHCYLMELSQNFSYDISVQDIFLAIRIELDPEIGCTQFDM  716

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
              + G+   +  Y G + LS   +L C++FQVT+L  + +H++N L  +L +  L D + 
Sbjct  717  GFDRGSVSLKLRYKGTINLSPNLVLLCKKFQVTLLGSIIDHSMNKLATSLDKCYLED-NV  775

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             IDYLLLP ++   +   ++W  I SV             S + ++    + TK+GL+ +
Sbjct  776  EIDYLLLP-AIGKGEKSHVNWLAIKSV----------EPSSFTCKYHQPHIETKSGLVCT  824

Query  562  CLLESSLVSTPHNG  603
            C L+ +LV T H G
Sbjct  825  CKLQDALVCTSHPG  838



>ref|XP_006586846.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Glycine 
max]
Length=1420

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 104/194 (54%), Gaps = 12/194 (6%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP + P  LV +  N   T+Y CYL+EL++ +     +Q+I LA+R  L+ +     F++
Sbjct  691  QPTFVPFGLVNSVSNNSHTIYHCYLMELSQNFSYDISVQDIFLAIRIELDPEIGCTQFDM  750

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
              + G+   +  Y G + LS   +L C++FQVT+L  + +H++N L  +L +  L D + 
Sbjct  751  GFDRGSVSLKLRYKGTINLSPNLVLLCKKFQVTLLGSIIDHSMNKLATSLDKCYLED-NV  809

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             IDYLLLP ++   +   ++W  I SV             S + ++    + TK+GL+ +
Sbjct  810  EIDYLLLP-AIGKGEKSHVNWLAIKSV----------EPSSFTCKYHQPHIETKSGLVCT  858

Query  562  CLLESSLVSTPHNG  603
            C L+ +LV T H G
Sbjct  859  CKLQDALVCTSHPG  872



>ref|XP_003534774.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Glycine 
max]
Length=1421

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 104/194 (54%), Gaps = 12/194 (6%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP + P  LV +  N   T+Y CYL+EL++ +     +Q+I LA+R  L+ +     F++
Sbjct  691  QPTFVPFGLVNSVSNNSHTIYHCYLMELSQNFSYDISVQDIFLAIRIELDPEIGCTQFDM  750

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
              + G+   +  Y G + LS   +L C++FQVT+L  + +H++N L  +L +  L D + 
Sbjct  751  GFDRGSVSLKLRYKGTINLSPNLVLLCKKFQVTLLGSIIDHSMNKLATSLDKCYLED-NV  809

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             IDYLLLP ++   +   ++W  I SV             S + ++    + TK+GL+ +
Sbjct  810  EIDYLLLP-AIGKGEKSHVNWLAIKSV----------EPSSFTCKYHQPHIETKSGLVCT  858

Query  562  CLLESSLVSTPHNG  603
            C L+ +LV T H G
Sbjct  859  CKLQDALVCTSHPG  872



>gb|KHN23014.1| Endoribonuclease Dicer like 2 [Glycine soja]
Length=1324

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 104/194 (54%), Gaps = 12/194 (6%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP + P  LV +  N   T+Y CYL+EL++ +     +Q+I LA+R  L+ +     F++
Sbjct  594  QPTFVPFGLVNSVSNNSHTIYHCYLMELSQNFSYDISVQDIFLAIRIELDPEIGCTQFDM  653

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  381
              + G+   +  Y G + LS   +L C++FQVT+L  + +H++N L  +L +  L D + 
Sbjct  654  GFDRGSVSLKLRYKGTINLSPNLVLLCKKFQVTLLGSIIDHSMNKLATSLDKCYLED-NV  712

Query  382  VIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLFS  561
             IDYLLLP ++   +   ++W  I SV             S + ++    + TK+GL+ +
Sbjct  713  EIDYLLLP-AIGKGEKSHVNWLAIKSV----------EPSSFTCKYHQPHIETKSGLVCT  761

Query  562  CLLESSLVSTPHNG  603
            C L+ +LV T H G
Sbjct  762  CKLQDALVCTSHPG  775



>ref|XP_010312604.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010312605.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Solanum 
lycopersicum]
Length=1433

 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 82/258 (32%), Positives = 115/258 (45%), Gaps = 67/258 (26%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNI-------------ILAL--  156
            Q  Y+P E V    N  + +Y CYL+EL    Y  +QL  I             ILA   
Sbjct  642  QSLYYPSEFVSHCGNESEAVYYCYLVELPHDSYNDSQLHGIILAVRTKLKFDDEILAFDL  701

Query  157  ----RTRLE-----------SDDE------------------NLSFELNI--------EG  213
                R RL+           + +E                   L  +LN         E 
Sbjct  702  DVDRRGRLKVQLNYRKVVIFTSEEVRWFLSSFYSLPVKMVWGRLKVQLNYRKVVIFTSEE  761

Query  214  GNWVGQTVYIGDVGLSNE--------QILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLV  369
              W   + Y   V +  E        QI RC+RFQV+V R+L + +L+ L E L  +   
Sbjct  762  VRWFLSSFYSLPVKMVGELHLFDLSLQIRRCQRFQVSVFRILRDPDLSKLQEVLAAVQSP  821

Query  370  DGSAVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNG  549
             GSAV DYLLLPS   P   P+I+W  ++S+LF  Q    +H D CS++     ++T + 
Sbjct  822  IGSAVSDYLLLPSVGTP---PEINWQYVNSLLFPSQVLGDKHMDWCSTQGRRCSVNTISE  878

Query  550  LLFSCLLESSLVSTPHNG  603
            ++ SC+LE+SLV TPHNG
Sbjct  879  VVCSCMLENSLVCTPHNG  896



>ref|XP_006844770.1| hypothetical protein AMTR_s00016p00258500 [Amborella trichopoda]
 gb|ERN06445.1| hypothetical protein AMTR_s00016p00258500 [Amborella trichopoda]
Length=1424

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 67/198 (34%), Positives = 101/198 (51%), Gaps = 9/198 (5%)
 Frame = +1

Query  31   YFPPELVG-TRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFELNI  207
            YFP EL+G  +    + LY CY I L+       + ++++L ++  L  D E LSF   +
Sbjct  675  YFPQELIGHLKKGCGKELYDCYSITLHSNVDHGWEFRSLLLMVKCNLGYDFEQLSF---V  731

Query  208  EGGNWVGQTVYIGDVG---LSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  378
             G N V   V +G  G   L  EQ+L  RRFQ T+ ++L   N++ + E+L RLN  +  
Sbjct  732  MGPNQVSVAVNMGYAGTRELDVEQVLMARRFQTTIFKILITGNVSEMRESLERLNQGETC  791

Query  379  AV-IDYLLLPSSMDPSDVPKIDWNII-SSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGL  552
               I+YLLLPS        +IDW+ + S+   +  + ++     CS +     +   NG 
Sbjct  792  CTQIEYLLLPSIGSGFTSSQIDWDSVRSASALNPDRAKNYQKCHCSPKSNAHFVRLTNGT  851

Query  553  LFSCLLESSLVSTPHNGN  606
               CLL +SLV TPHNG 
Sbjct  852  SCDCLLRNSLVLTPHNGK  869



>ref|XP_007140643.1| hypothetical protein PHAVU_008G129500g [Phaseolus vulgaris]
 gb|ESW12637.1| hypothetical protein PHAVU_008G129500g [Phaseolus vulgaris]
Length=1420

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 60/194 (31%), Positives = 104/194 (54%), Gaps = 17/194 (9%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP Y P  LV    N   T Y CYL+EL++ +     +++I LA+R  L+++     F++
Sbjct  690  QPTYVPFGLVNCVSNNSHTTYHCYLMELSQNFSYDIFVEDIFLAMRVELDTEVVCSQFDM  749

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGR--LNLVDG  375
              + G+   +  Y G + LS +Q+L C+ FQ T+LR+L   ++N     L +  L+ VD 
Sbjct  750  GFDRGDVSVKLSYKGTINLSQDQVLLCKNFQATLLRILIRRDINKFPIGLDKSCLHEVD-  808

Query  376  SAVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLL  555
               IDYLLLP ++   +   ++W  I+SV          ++ + + ++    + TK+GL+
Sbjct  809  ---IDYLLLP-AIGKGEKSSVNWLAINSV----------NASNFTCKYHQPHIWTKSGLV  854

Query  556  FSCLLESSLVSTPH  597
             +C L+ +LV T H
Sbjct  855  CTCKLQDALVCTSH  868



>ref|XP_007029210.1| Dicer-like protein isoform 3 [Theobroma cacao]
 gb|EOY09712.1| Dicer-like protein isoform 3 [Theobroma cacao]
Length=1202

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 66/111 (59%), Gaps = 0/111 (0%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP +FPPELV   ++     Y CYLIEL + +     + NI+L +R++LE D++++ FEL
Sbjct  570  QPIFFPPELVNQCEHEDMKKYYCYLIELKQNFDYEFPVHNIMLLVRSQLEIDNKSMGFEL  629

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALG  354
             ++ G       Y+G + L   Q++  +RFQ+ V RVL +H +  L E LG
Sbjct  630  EVDRGFLTVNLKYVGLIRLDPSQVILSKRFQIAVFRVLMDHKVEKLTEVLG  680



>ref|XP_007029212.1| Dicer-like protein isoform 5 [Theobroma cacao]
 gb|EOY09714.1| Dicer-like protein isoform 5 [Theobroma cacao]
Length=1077

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 66/111 (59%), Gaps = 0/111 (0%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP +FPPELV   ++     Y CYLIEL + +     + NI+L +R++LE D++++ FEL
Sbjct  445  QPIFFPPELVNQCEHEDMKKYYCYLIELKQNFDYEFPVHNIMLLVRSQLEIDNKSMGFEL  504

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALG  354
             ++ G       Y+G + L   Q++  +RFQ+ V RVL +H +  L E LG
Sbjct  505  EVDRGFLTVNLKYVGLIRLDPSQVILSKRFQIAVFRVLMDHKVEKLTEVLG  555



>ref|XP_007029214.1| Dicer-like protein isoform 7, partial [Theobroma cacao]
 gb|EOY09716.1| Dicer-like protein isoform 7, partial [Theobroma cacao]
Length=947

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 66/111 (59%), Gaps = 0/111 (0%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  201
            QP +FPPELV   ++     Y CYLIEL + +     + NI+L +R++LE D++++ FEL
Sbjct  375  QPIFFPPELVNQCEHEDMKKYYCYLIELKQNFDYEFPVHNIMLLVRSQLEIDNKSMGFEL  434

Query  202  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALG  354
             ++ G       Y+G + L   Q++  +RFQ+ V RVL +H +  L E LG
Sbjct  435  EVDRGFLTVNLKYVGLIRLDPSQVILSKRFQIAVFRVLMDHKVEKLTEVLG  485



>ref|XP_008681083.1| PREDICTED: uncharacterized protein LOC100192986 isoform X3 [Zea 
mays]
Length=1192

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 101/202 (50%), Gaps = 22/202 (11%)
 Frame = +1

Query  22   QPKYFPPELVGTRDN-APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  198
            QP YFP +LV    + + +  Y CY++ L      +T    I+LA++  + SD  + SF+
Sbjct  677  QPDYFPEQLVDNWSSFSRRGFYYCYMVSLEGC--SKTTPAEIVLAVKCDMGSDFISNSFK  734

Query  199  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  378
            L            Y+G + L+ EQ++  RRFQ T+L +L  ++L+ +   +  L  +  S
Sbjct  735  LWGVQDYLSFTMRYVGIIHLNQEQVIAARRFQTTILSLLISNDLSEVSNYIKNLLEMPAS  794

Query  379  AVIDYLLLPSSMDPSDVPKIDWNIISSVLFSY-QKPEHRHSDSCSSRHGCRP------MH  537
                YLLLP         KIDW    S+ FS  + PE  + D    RH C P      + 
Sbjct  795  PGAVYLLLPVVSG-----KIDWR---SIKFSASEMPEATNMD---MRH-CYPCKDTGIVQ  842

Query  538  TKNGLLFSCLLESSLVSTPHNG  603
            TK+G   SC+L +S+V TPHNG
Sbjct  843  TKDGTFCSCMLRNSIVCTPHNG  864



>ref|XP_008681082.1| PREDICTED: uncharacterized protein LOC100192986 isoform X2 [Zea 
mays]
Length=1401

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 101/202 (50%), Gaps = 22/202 (11%)
 Frame = +1

Query  22   QPKYFPPELVGTRDN-APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  198
            QP YFP +LV    + + +  Y CY++ L      +T    I+LA++  + SD  + SF+
Sbjct  670  QPDYFPEQLVDNWSSFSRRGFYYCYMVSLEGC--SKTTPAEIVLAVKCDMGSDFISNSFK  727

Query  199  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  378
            L            Y+G + L+ EQ++  RRFQ T+L +L  ++L+ +   +  L  +  S
Sbjct  728  LWGVQDYLSFTMRYVGIIHLNQEQVIAARRFQTTILSLLISNDLSEVSNYIKNLLEMPAS  787

Query  379  AVIDYLLLPSSMDPSDVPKIDWNIISSVLFSY-QKPEHRHSDSCSSRHGCRP------MH  537
                YLLLP         KIDW    S+ FS  + PE  + D    RH C P      + 
Sbjct  788  PGAVYLLLPVVSG-----KIDWR---SIKFSASEMPEATNMD---MRH-CYPCKDTGIVQ  835

Query  538  TKNGLLFSCLLESSLVSTPHNG  603
            TK+G   SC+L +S+V TPHNG
Sbjct  836  TKDGTFCSCMLRNSIVCTPHNG  857



>ref|XP_008681081.1| PREDICTED: uncharacterized protein LOC100192986 isoform X1 [Zea 
mays]
Length=1408

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 101/202 (50%), Gaps = 22/202 (11%)
 Frame = +1

Query  22   QPKYFPPELVGTRDN-APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  198
            QP YFP +LV    + + +  Y CY++ L      +T    I+LA++  + SD  + SF+
Sbjct  677  QPDYFPEQLVDNWSSFSRRGFYYCYMVSLEGC--SKTTPAEIVLAVKCDMGSDFISNSFK  734

Query  199  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  378
            L            Y+G + L+ EQ++  RRFQ T+L +L  ++L+ +   +  L  +  S
Sbjct  735  LWGVQDYLSFTMRYVGIIHLNQEQVIAARRFQTTILSLLISNDLSEVSNYIKNLLEMPAS  794

Query  379  AVIDYLLLPSSMDPSDVPKIDWNIISSVLFSY-QKPEHRHSDSCSSRHGCRP------MH  537
                YLLLP         KIDW    S+ FS  + PE  + D    RH C P      + 
Sbjct  795  PGAVYLLLPVVSG-----KIDWR---SIKFSASEMPEATNMD---MRH-CYPCKDTGIVQ  842

Query  538  TKNGLLFSCLLESSLVSTPHNG  603
            TK+G   SC+L +S+V TPHNG
Sbjct  843  TKDGTFCSCMLRNSIVCTPHNG  864



>ref|XP_010229604.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2a-like [Brachypodium distachyon]
Length=1398

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/196 (31%), Positives = 100/196 (51%), Gaps = 9/196 (5%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQT-LYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  198
            QP YFP E +G   +     +Y CY I L           +IILA++  L SD    SF+
Sbjct  660  QPDYFPEEFLGNWFSFSHLGIYHCYKISLGGCLKTIASPTDIILAVKCDLGSDFIANSFK  719

Query  199  LNIEGGNWVGQTV-YIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL-NLVD  372
            L+    +++  ++ Y+G++ L+ EQ+   RRFQ T+L +L   + +    A+ +  ++ +
Sbjct  720  LS-GAQDFISVSIKYVGNIHLNQEQVNSARRFQTTILSLLINKDHSEASNAIKQFHDMQE  778

Query  373  GSAVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGL  552
             S  + YLLLP         K+DW  I+       +  ++ +  C S      + TK+G 
Sbjct  779  ASVGVVYLLLPFVSG-----KVDWCSINFSTSHIYETSNKDTRCCHSCKEVDLLQTKDGP  833

Query  553  LFSCLLESSLVSTPHN  600
            L  C+L++S+VSTPHN
Sbjct  834  LCRCMLKNSIVSTPHN  849



>ref|XP_010233062.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X2 
[Brachypodium distachyon]
 ref|XP_010233066.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X2 
[Brachypodium distachyon]
Length=1144

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 96/200 (48%), Gaps = 28/200 (14%)
 Frame = +1

Query  22   QPKYFPPELVGTRDN----APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  189
            QP YFP ELV   DN    +   +Y CY+I L  +  + T   +IILA++  + SD  + 
Sbjct  402  QPAYFPEELV---DNWLSFSCLGIYICYMISLEGFL-QTTAPTDIILAMKCDMGSDFVSR  457

Query  190  SFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLV  369
            SF+L            Y+G + L+ EQ++  RRFQ ++L +L  + +    E    + +V
Sbjct  458  SFKLYGTQDYVTVAIKYMGIIHLNQEQVIIARRFQTSILSLLINNAIKYYYEMQRSIGIV  517

Query  370  DGSAVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRP---MHT  540
                   YLLLP         KIDW         +  P+  ++      H C+    + T
Sbjct  518  -------YLLLPLVSG-----KIDW-----CTMKFSAPQEVNNKDVRHCHSCKEVDLLQT  560

Query  541  KNGLLFSCLLESSLVSTPHN  600
            K+GLL  C+L +S++ TPHN
Sbjct  561  KDGLLCRCMLRNSIICTPHN  580



>ref|XP_010233057.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X1 
[Brachypodium distachyon]
Length=1248

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 96/200 (48%), Gaps = 28/200 (14%)
 Frame = +1

Query  22   QPKYFPPELVGTRDN----APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  189
            QP YFP ELV   DN    +   +Y CY+I L  +  + T   +IILA++  + SD  + 
Sbjct  506  QPAYFPEELV---DNWLSFSCLGIYICYMISLEGFL-QTTAPTDIILAMKCDMGSDFVSR  561

Query  190  SFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLV  369
            SF+L            Y+G + L+ EQ++  RRFQ ++L +L  + +    E    + +V
Sbjct  562  SFKLYGTQDYVTVAIKYMGIIHLNQEQVIIARRFQTSILSLLINNAIKYYYEMQRSIGIV  621

Query  370  DGSAVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRP---MHT  540
                   YLLLP         KIDW         +  P+  ++      H C+    + T
Sbjct  622  -------YLLLPLVSG-----KIDW-----CTMKFSAPQEVNNKDVRHCHSCKEVDLLQT  664

Query  541  KNGLLFSCLLESSLVSTPHN  600
            K+GLL  C+L +S++ TPHN
Sbjct  665  KDGLLCRCMLRNSIICTPHN  684



>ref|XP_004982514.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X2 
[Setaria italica]
Length=1199

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 63/199 (32%), Positives = 95/199 (48%), Gaps = 14/199 (7%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQT-LYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  198
            QP YFP +LV +  +  +  LY CY I L            I+LA++  + SD  + SF+
Sbjct  667  QPNYFPEQLVDSWLSFSRLGLYHCYEISLEWCSKTANSPAEIVLAVKCDMGSDFISNSFK  726

Query  199  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHN-LNTLDEALGRLNLVDG  375
            +     +      YIG + L+ EQ++  RRFQ  +L +L  +N L   D     L +   
Sbjct  727  MWGVQDHVSVTMRYIGIIHLNQEQVIVARRFQTAILSLLISNNQLEVRDSIKNSLEMQAS  786

Query  376  SAVIDYLLLPSSMDPSDVPKIDWNII---SSVLFSYQKPEHRHSDSCSSRHGCRPMHTKN  546
              V+ YL+LP         KIDW  I   +S +      + RH  SC   +    + TK+
Sbjct  787  PGVV-YLVLPLVSG-----KIDWCSIKFSASPMLEVTNKDMRHCHSCKDTN---LVQTKD  837

Query  547  GLLFSCLLESSLVSTPHNG  603
            G L  C+L+ ++V TPHNG
Sbjct  838  GPLCQCMLQHAIVCTPHNG  856



>ref|XP_004982513.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X1 
[Setaria italica]
Length=1404

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 63/199 (32%), Positives = 95/199 (48%), Gaps = 14/199 (7%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQT-LYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  198
            QP YFP +LV +  +  +  LY CY I L            I+LA++  + SD  + SF+
Sbjct  667  QPNYFPEQLVDSWLSFSRLGLYHCYEISLEWCSKTANSPAEIVLAVKCDMGSDFISNSFK  726

Query  199  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHN-LNTLDEALGRLNLVDG  375
            +     +      YIG + L+ EQ++  RRFQ  +L +L  +N L   D     L +   
Sbjct  727  MWGVQDHVSVTMRYIGIIHLNQEQVIVARRFQTAILSLLISNNQLEVRDSIKNSLEMQAS  786

Query  376  SAVIDYLLLPSSMDPSDVPKIDWNII---SSVLFSYQKPEHRHSDSCSSRHGCRPMHTKN  546
              V+ YL+LP         KIDW  I   +S +      + RH  SC   +    + TK+
Sbjct  787  PGVV-YLVLPLVSG-----KIDWCSIKFSASPMLEVTNKDMRHCHSCKDTN---LVQTKD  837

Query  547  GLLFSCLLESSLVSTPHNG  603
            G L  C+L+ ++V TPHNG
Sbjct  838  GPLCQCMLQHAIVCTPHNG  856



>gb|AAS07190.1| putative ribonuclease III, 5'-partial (with alternative splicing) 
[Oryza sativa Japonica Group]
Length=538

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 89/194 (46%), Gaps = 7/194 (4%)
 Frame = +1

Query  22   QPKYFPPELVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  198
            QP YFP E V   R  +   +Y CY I L     K     +I+LAL+  L SD  + SF+
Sbjct  274  QPSYFPEEFVDNWRSFSRLGIYYCYKISLEGCP-KTASPTDILLALKCDLGSDFTSSSFK  332

Query  199  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  378
            L     N      Y+G + L+ EQ++  RRFQ T+L  L   +   +   +   + +   
Sbjct  333  LPGGQDNASVTMKYVGIIHLNQEQVIIARRFQTTILSFLIGDDHLEVSNGIKYFHEMQVP  392

Query  379  AVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLF  558
              + YLLLP         +IDW  +        +  ++H   C S      + TK+G   
Sbjct  393  IGVVYLLLPLVSG-----RIDWCSMKFSSSPIYEANNKHMTHCHSCKDIDLLQTKDGPFC  447

Query  559  SCLLESSLVSTPHN  600
             C+L++S+V TPHN
Sbjct  448  RCILKNSIVCTPHN  461



>ref|XP_002464290.1| hypothetical protein SORBIDRAFT_01g015670 [Sorghum bicolor]
 gb|EER91288.1| hypothetical protein SORBIDRAFT_01g015670 [Sorghum bicolor]
Length=1385

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 104/203 (51%), Gaps = 23/203 (11%)
 Frame = +1

Query  22   QPKYFPPELVGTRDN----APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  189
            QP YFP +L+   DN      + LY CY I L     + T    I+LA++  L SD  + 
Sbjct  676  QPDYFPEQLM---DNWLSFCHRGLYYCYKISLEGCS-ETTTPAEIVLAVKCDLGSDFIST  731

Query  190  SFEL-NIEGGNWVGQTV-YIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLN  363
            +F+L  ++  +++  T+ Y+G + L+ EQ++  RRFQ  +L +L   +L+    ++  L 
Sbjct  732  TFKLWGVQ--DYLSFTIRYVGVIHLNQEQVIVARRFQTRILSLLISKDLSEDGNSIKSLL  789

Query  364  LVDGSAVIDYLLLPSSMDPSDVPKIDWNII---SSVLFSYQKPEHRHSDSCSSRHGCRPM  534
             +  S+   YLLLP         KIDW  I   SS +      + RHS SC        +
Sbjct  790  EMQVSSGAVYLLLPVVSG-----KIDWCSIKFSSSEMHEDTIMDSRHSHSCKDTG---LL  841

Query  535  HTKNGLLFSCLLESSLVSTPHNG  603
             TK G    C+L++S+VSTPHNG
Sbjct  842  QTKGGPFCPCMLQNSIVSTPHNG  864



>gb|AAS07189.1| putative ribonuclease III, 5'-partial (with alternative splicing) 
[Oryza sativa Japonica Group]
Length=1017

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 89/194 (46%), Gaps = 7/194 (4%)
 Frame = +1

Query  22   QPKYFPPELVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  198
            QP YFP E V   R  +   +Y CY I L     K     +I+LAL+  L SD  + SF+
Sbjct  274  QPSYFPEEFVDNWRSFSRLGIYYCYKISLEGCP-KTASPTDILLALKCDLGSDFTSSSFK  332

Query  199  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  378
            L     N      Y+G + L+ EQ++  RRFQ T+L  L   +   +   +   + +   
Sbjct  333  LPGGQDNASVTMKYVGIIHLNQEQVIIARRFQTTILSFLIGDDHLEVSNGIKYFHEMQVP  392

Query  379  AVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLF  558
              + YLLLP         +IDW  +        +  ++H   C S      + TK+G   
Sbjct  393  IGVVYLLLPLVSG-----RIDWCSMKFSSSPIYEANNKHMTHCHSCKDIDLLQTKDGPFC  447

Query  559  SCLLESSLVSTPHN  600
             C+L++S+V TPHN
Sbjct  448  RCILKNSIVCTPHN  461



>gb|EEE59414.1| hypothetical protein OsJ_11564 [Oryza sativa Japonica Group]
Length=1371

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/197 (31%), Positives = 91/197 (46%), Gaps = 13/197 (7%)
 Frame = +1

Query  22   QPKYFPPELVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  198
            QP YFP E V   R  +   +Y CY I L     K     +I+LAL+  L SD  + SF+
Sbjct  632  QPSYFPEEFVDNWRSFSRLGIYYCYKISLEGCP-KTASPTDILLALKCDLGSDFTSSSFK  690

Query  199  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  378
            L     N      Y+G + L+ EQ++  RRFQ T+L  L   +   +   +   + +   
Sbjct  691  LPGGQDNASVTMKYVGIIHLNQEQVIIARRFQTTILSFLIGDDHLEVSNGIKYFHEMQVP  750

Query  379  AVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRP---MHTKNG  549
              + YLLLP         +IDW  +        +  ++H   C   H CR    + TK+G
Sbjct  751  IGVVYLLLPLVSG-----RIDWCSMKFSSSPIYEANNKHMTHC---HSCRDIDLLQTKDG  802

Query  550  LLFSCLLESSLVSTPHN  600
                C+L++S+V TPHN
Sbjct  803  PFCRCILKNSIVCTPHN  819



>sp|Q69LX2.2|DCL2B_ORYSJ RecName: Full=Endoribonuclease Dicer homolog 2b; AltName: Full=Dicer-like 
protein 2b; Short=OsDCL2b [Oryza sativa Japonica 
Group]
Length=1377

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/197 (31%), Positives = 91/197 (46%), Gaps = 13/197 (7%)
 Frame = +1

Query  22   QPKYFPPELVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  198
            QP YFP E V   R  +   +Y CY I L     K     +I+LAL+  L SD  + SF+
Sbjct  638  QPSYFPEEFVDNWRSFSRLGIYYCYKISLEGCP-KTASPTDILLALKCDLGSDFTSSSFK  696

Query  199  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  378
            L     N      Y+G + L+ EQ++  RRFQ T+L  L   +   +   +   + +   
Sbjct  697  LPGGQDNASVTMKYVGIIHLNQEQVIIARRFQTTILSFLIGDDHLEVSNGIKYFHEMQVP  756

Query  379  AVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRP---MHTKNG  549
              + YLLLP         +IDW  +        +  ++H   C   H CR    + TK+G
Sbjct  757  IGVVYLLLPLVSG-----RIDWCSMKFSSSPIYEANNKHMTHC---HSCRDIDLLQTKDG  808

Query  550  LLFSCLLESSLVSTPHN  600
                C+L++S+V TPHN
Sbjct  809  PFCRCILKNSIVCTPHN  825



>dbj|BAD34005.1| CAF protein-like [Oryza sativa Japonica Group]
 dbj|BAD36404.1| CAF protein-like [Oryza sativa Japonica Group]
Length=1375

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/197 (31%), Positives = 91/197 (46%), Gaps = 13/197 (7%)
 Frame = +1

Query  22   QPKYFPPELVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  198
            QP YFP E V   R  +   +Y CY I L     K     +I+LAL+  L SD  + SF+
Sbjct  636  QPSYFPEEFVDNWRSFSRLGIYYCYKISLEGCP-KTASPTDILLALKCDLGSDFTSSSFK  694

Query  199  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  378
            L     N      Y+G + L+ EQ++  RRFQ T+L  L   +   +   +   + +   
Sbjct  695  LPGGQDNASVTMKYVGIIHLNQEQVIIARRFQTTILSFLIGDDHLEVSNGIKYFHEMQVP  754

Query  379  AVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRP---MHTKNG  549
              + YLLLP         +IDW  +        +  ++H   C   H CR    + TK+G
Sbjct  755  IGVVYLLLPLVSG-----RIDWCSMKFSSSPIYEANNKHMTHC---HSCRDIDLLQTKDG  806

Query  550  LLFSCLLESSLVSTPHN  600
                C+L++S+V TPHN
Sbjct  807  PFCRCILKNSIVCTPHN  823



>ref|XP_006651573.1| PREDICTED: endoribonuclease Dicer homolog 2a-like [Oryza brachyantha]
Length=1348

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/200 (31%), Positives = 95/200 (48%), Gaps = 19/200 (10%)
 Frame = +1

Query  22   QPKYFPPELVGTRDN----APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  189
            QP YFP E V   DN    + Q +Y CY I L     +     +I+LA++  + SD  ++
Sbjct  604  QPAYFPEEFV---DNWCSFSHQGIYYCYKISLEGCL-ETDSPTDILLAVKCDMGSDFTSI  659

Query  190  SFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLV  369
            SF++     N      Y G + L+ EQ++  RRFQ T+L +L   +   +  A+   + +
Sbjct  660  SFQMPGGQDNACVTMNYAGIIHLNQEQVIIARRFQTTILSLLISDDHLVVSNAIKYSHEM  719

Query  370  DGSAVIDYLLLPSSMDPSDVPKIDW---NIISSVLFSYQKPEHRHSDSCSSRHGCRPMHT  540
              S  + YLLLP         KIDW    + +S ++       RH  SC        + T
Sbjct  720  QVSIGVVYLLLPLVSG-----KIDWCSMKVSASPVYEANGKHMRHCHSCED---VDLLQT  771

Query  541  KNGLLFSCLLESSLVSTPHN  600
             +G    C+L++S+V TPHN
Sbjct  772  NDGPFCRCILKNSIVVTPHN  791



>gb|EMS67762.1| Endoribonuclease Dicer-like protein 2a [Triticum urartu]
Length=473

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 95/199 (48%), Gaps = 12/199 (6%)
 Frame = +1

Query  22   QPKYFPPELVGTRDNAPQT-LYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  198
            QP+YFP E V    +  +  +Y CY I +           +I+LA++  L  D  + S +
Sbjct  205  QPEYFPEEFVYNWLSFSRLGIYYCYKISVEGCLKTTYCPNDILLAVKCDLGPDFVSTSLK  264

Query  199  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  378
               E  N      Y+G + L+ EQ++  RRFQ T+L +L   + + +  A+   + +  S
Sbjct  265  NFGEQDNASVAMKYVGIIHLNQEQVVMARRFQTTILSLLINKDHSEVINAVKYSHEMQVS  324

Query  379  AVIDYLLLPSSMDPSDVPKIDWNII---SSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNG  549
              I YLLLP         K+DW  I   +S ++     + RH  SC        + TK+G
Sbjct  325  IGIVYLLLPLVSG-----KVDWCSIKFSTSQVYDASNKDIRHCHSCKQ---VDLLQTKDG  376

Query  550  LLFSCLLESSLVSTPHNGN  606
             L  C+L++S+V TPHN  
Sbjct  377  PLCRCMLQNSIVCTPHNSK  395



>gb|EEC75643.1| hypothetical protein OsI_12390 [Oryza sativa Indica Group]
Length=1318

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 89/194 (46%), Gaps = 7/194 (4%)
 Frame = +1

Query  22   QPKYFPPELVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  198
            QP YFP E V   R  +   +Y CY I L     K     +I+LAL+  L SD  + SF+
Sbjct  575  QPSYFPEEFVDNWRSFSRLGIYYCYKISLEGCP-KTASPTDILLALKCDLGSDFTSSSFK  633

Query  199  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  378
            L     N      Y+G + L+ EQ++  RRFQ T+L  L   +   +   +   + +   
Sbjct  634  LPGGQDNASVTMKYVGIIHLNQEQVIIARRFQTTILSFLIGDDHLEVSNGIKYFHEMQVP  693

Query  379  AVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLF  558
              + YLLLP         +IDW  +        +  ++H   C S      + TK+G   
Sbjct  694  IGVVYLLLPLVSG-----RIDWCSMKFSSSPIYEANNKHMTHCHSCKDIDLLQTKDGPFC  748

Query  559  SCLLESSLVSTPHN  600
             C+L++S+V TPHN
Sbjct  749  RCILKNSIVCTPHN  762



>ref|NP_001050564.1| Os03g0583900 [Oryza sativa Japonica Group]
 sp|Q10HL3.1|DCL2A_ORYSJ RecName: Full=Endoribonuclease Dicer homolog 2a; AltName: Full=Dicer-like 
protein 2a; Short=OsDCL2a [Oryza sativa Japonica 
Group]
 gb|AAT76309.1| putative RNA helicase/RNAseIII protein, C-terminus truncated 
[Oryza sativa Japonica Group]
 gb|ABF97330.1| Type III restriction enzyme, res subunit family protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF12478.1| Os03g0583900 [Oryza sativa Japonica Group]
 dbj|BAG92928.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1410

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 89/194 (46%), Gaps = 7/194 (4%)
 Frame = +1

Query  22   QPKYFPPELVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  198
            QP YFP E V   R  +   +Y CY I L     K     +I+LAL+  L SD  + SF+
Sbjct  667  QPSYFPEEFVDNWRSFSRLGIYYCYKISLEGCP-KTASPTDILLALKCDLGSDFTSSSFK  725

Query  199  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  378
            L     N      Y+G + L+ EQ++  RRFQ T+L  L   +   +   +   + +   
Sbjct  726  LPGGQDNASVTMKYVGIIHLNQEQVIIARRFQTTILSFLIGDDHLEVSNGIKYFHEMQVP  785

Query  379  AVIDYLLLPSSMDPSDVPKIDWNIISSVLFSYQKPEHRHSDSCSSRHGCRPMHTKNGLLF  558
              + YLLLP         +IDW  +        +  ++H   C S      + TK+G   
Sbjct  786  IGVVYLLLPLVSG-----RIDWCSMKFSSSPIYEANNKHMTHCHSCKDIDLLQTKDGPFC  840

Query  559  SCLLESSLVSTPHN  600
             C+L++S+V TPHN
Sbjct  841  RCILKNSIVCTPHN  854



>gb|AFW68290.1| hypothetical protein ZEAMMB73_539070 [Zea mays]
Length=707

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 56/167 (34%), Positives = 84/167 (50%), Gaps = 19/167 (11%)
 Frame = +1

Query  124  RTQLQNIILALRTRLESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTV  303
            +T    I+LA++  + SD  + SF+L            Y+G + L+ EQ++  RRFQ T+
Sbjct  9    KTTPAEIVLAVKCDMGSDFISNSFKLWGVQDYLSFTMRYVGIIHLNQEQVIAARRFQTTI  68

Query  304  LRVLFEHNLNTLDEALGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDWNIISSVLFSY-QK  480
            L +L  ++L+ +   +  L  +  S    YLLLP         KIDW    S+ FS  + 
Sbjct  69   LSLLISNDLSEVSNYIKNLLEMPASPGAVYLLLPVVSG-----KIDWR---SIKFSASEM  120

Query  481  PEHRHSDSCSSRHGCRP------MHTKNGLLFSCLLESSLVSTPHNG  603
            PE  + D    RH C P      + TK+G   SC+L +S+V TPHNG
Sbjct  121  PEATNMD---MRH-CYPCKDTGIVQTKDGTFCSCMLRNSIVCTPHNG  163



>ref|XP_002464288.1| hypothetical protein SORBIDRAFT_01g015663 [Sorghum bicolor]
 gb|EER91286.1| hypothetical protein SORBIDRAFT_01g015663 [Sorghum bicolor]
Length=255

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 66/202 (33%), Positives = 94/202 (47%), Gaps = 27/202 (13%)
 Frame = +1

Query  22   QPKYFPPELVGTRDN----APQTLYSCYLIELNRYYYKRTQLQ--NIILALRTRLESDDE  183
            QP YFP ELV   DN    +   LY CY I ++      T     NIILA++  +  D  
Sbjct  38   QPVYFPEELV---DNWVSFSRHGLYYCYSINISLQGSCNTAADPTNIILAVKCDMGPDFF  94

Query  184  NLSFELNIEGGNWVGQTV-YIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  360
              SF     GG  +G T+ Y+  + L+ EQ++  RRFQ TVL +L   +   + +A+   
Sbjct  95   WHSFN---SGG--IGITIKYLCKIHLNQEQVIFARRFQTTVLSLLINSDHLEVSDAIKYF  149

Query  361  NLVDGSAVIDYLLLPSSMDPSDVPKIDWNII----SSVLFSYQKPEHRHSDSCSSRHGCR  528
            + +     + YLLLP+        KIDW  I    SSV         RHS SC       
Sbjct  150  HELQVDVGVVYLLLPTVYG-----KIDWCGIKFSTSSVYDDVTDKNTRHSHSCKDA---D  201

Query  529  PMHTKNGLLFSCLLESSLVSTP  594
             + T +G    C+L++S+V  P
Sbjct  202  ILQTMDGPCCRCILQNSVVYAP  223



>gb|AFW68292.1| hypothetical protein ZEAMMB73_963828 [Zea mays]
Length=251

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 89/198 (45%), Gaps = 22/198 (11%)
 Frame = +1

Query  22   QPKYFPPELVGTRDN----APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  189
            QP YFP EL+   DN    + + LY CY I L           +IILA++  +  D    
Sbjct  37   QPVYFPEELM---DNWVSFSLRGLYYCYNISLQGSCNTTADPTDIILAVKCDMGPDFFRY  93

Query  190  SFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLV  369
            SF L   GG  +    Y+  + L+ EQ+L  RRFQ+TVL +L   N + +  A+      
Sbjct  94   SFNL---GGTDI-TIKYLYKIHLNQEQVLFARRFQITVLSLLINSNSSEVSNAIKYFREW  149

Query  370  DGSAVIDYLLLPSSMDPSDVPKIDWNII---SSVLFSYQKPEHRHSDSCSSRHGCRPMHT  540
                 + YLLLP++       KIDW  I   +S  +       RH  SC        + T
Sbjct  150  QVDLGVVYLLLPTASG-----KIDWCGIKFSTSSAYDVTDKNMRHCHSCKDAD---ILQT  201

Query  541  KNGLLFSCLLESSLVSTP  594
             +     C+L++S+V  P
Sbjct  202  MDDPCCRCILQNSVVYAP  219



>ref|XP_004982512.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X4 
[Setaria italica]
Length=654

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 64/203 (32%), Positives = 95/203 (47%), Gaps = 23/203 (11%)
 Frame = +1

Query  22   QPKYFPPELVGTRDN----APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  189
            QP YFP ELV   DN    + + LY CY I +           +IILA++  L  +    
Sbjct  28   QPVYFPEELV---DNWVSFSRRGLYYCYNISMRGCLNTDAAPTDIILAVKCDLGPEFLRN  84

Query  190  SFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLV  369
            SF     GG  V    Y+  + L+ EQ++  RRFQ T+L +L  ++ + + +A+   + +
Sbjct  85   SFN---SGGVEV-TIQYMRIIHLNQEQVIFARRFQTTILSLLIGNDHSEVRDAIKYFHEL  140

Query  370  DGSAVIDYLLLPSSMDPSDVPKIDWNII----SSVLFSYQKPEHRHSDSCSSRHGCRPMH  537
              S  + YLLLPS        KIDW  I    SSV  +    + RH  SC      + M 
Sbjct  141  QVSVGVVYLLLPSVSG-----KIDWCGIKFSTSSVYDATTDKDMRHCHSCKDVDLLQMM-  194

Query  538  TKNGLLFSCLLESSLVSTPHNGN  606
              +G    C+L +S+V  P +G 
Sbjct  195  --DGPCCRCMLRNSVVYIPRDGK  215



>ref|XP_004982509.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X1 
[Setaria italica]
Length=755

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 64/203 (32%), Positives = 95/203 (47%), Gaps = 23/203 (11%)
 Frame = +1

Query  22   QPKYFPPELVGTRDN----APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  189
            QP YFP ELV   DN    + + LY CY I +           +IILA++  L  +    
Sbjct  28   QPVYFPEELV---DNWVSFSRRGLYYCYNISMRGCLNTDAAPTDIILAVKCDLGPEFLRN  84

Query  190  SFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLV  369
            SF     GG  V    Y+  + L+ EQ++  RRFQ T+L +L  ++ + + +A+   + +
Sbjct  85   SFN---SGGVEV-TIQYMRIIHLNQEQVIFARRFQTTILSLLIGNDHSEVRDAIKYFHEL  140

Query  370  DGSAVIDYLLLPSSMDPSDVPKIDWNII----SSVLFSYQKPEHRHSDSCSSRHGCRPMH  537
              S  + YLLLPS        KIDW  I    SSV  +    + RH  SC      + M 
Sbjct  141  QVSVGVVYLLLPSVSG-----KIDWCGIKFSTSSVYDATTDKDMRHCHSCKDVDLLQMM-  194

Query  538  TKNGLLFSCLLESSLVSTPHNGN  606
              +G    C+L +S+V  P +G 
Sbjct  195  --DGPCCRCMLRNSVVYIPRDGK  215



>ref|XP_004982510.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X2 
[Setaria italica]
Length=720

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 64/203 (32%), Positives = 95/203 (47%), Gaps = 23/203 (11%)
 Frame = +1

Query  22   QPKYFPPELVGTRDN----APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  189
            QP YFP ELV   DN    + + LY CY I +           +IILA++  L  +    
Sbjct  28   QPVYFPEELV---DNWVSFSRRGLYYCYNISMRGCLNTDAAPTDIILAVKCDLGPEFLRN  84

Query  190  SFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLV  369
            SF     GG  V    Y+  + L+ EQ++  RRFQ T+L +L  ++ + + +A+   + +
Sbjct  85   SFN---SGGVEV-TIQYMRIIHLNQEQVIFARRFQTTILSLLIGNDHSEVRDAIKYFHEL  140

Query  370  DGSAVIDYLLLPSSMDPSDVPKIDWNII----SSVLFSYQKPEHRHSDSCSSRHGCRPMH  537
              S  + YLLLPS        KIDW  I    SSV  +    + RH  SC      + M 
Sbjct  141  QVSVGVVYLLLPSVSG-----KIDWCGIKFSTSSVYDATTDKDMRHCHSCKDVDLLQMM-  194

Query  538  TKNGLLFSCLLESSLVSTPHNGN  606
              +G    C+L +S+V  P +G 
Sbjct  195  --DGPCCRCMLRNSVVYIPRDGK  215



>ref|XP_008644681.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X6 
[Zea mays]
Length=639

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 89/198 (45%), Gaps = 22/198 (11%)
 Frame = +1

Query  22   QPKYFPPELVGTRDN----APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  189
            QP YFP EL+   DN    + + LY CY I L           +IILA++  +  D    
Sbjct  37   QPVYFPEELM---DNWVSFSLRGLYYCYNISLQGSCNTTADPTDIILAVKCDMGPDFFRY  93

Query  190  SFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLV  369
            SF L   GG  +    Y+  + L+ EQ+L  RRFQ+TVL +L   N + +  A+      
Sbjct  94   SFNL---GGTDI-TIKYLYKIHLNQEQVLFARRFQITVLSLLINSNSSEVSNAIKYFREW  149

Query  370  DGSAVIDYLLLPSSMDPSDVPKIDWNII---SSVLFSYQKPEHRHSDSCSSRHGCRPMHT  540
                 + YLLLP++       KIDW  I   +S  +       RH  SC        + T
Sbjct  150  QVDLGVVYLLLPTASG-----KIDWCGIKFSTSSAYDVTDKNMRHCHSCKDAD---ILQT  201

Query  541  KNGLLFSCLLESSLVSTP  594
             +     C+L++S+V  P
Sbjct  202  MDDPCCRCILQNSVVYAP  219



>ref|XP_008644679.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X4 
[Zea mays]
Length=682

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 89/198 (45%), Gaps = 22/198 (11%)
 Frame = +1

Query  22   QPKYFPPELVGTRDN----APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  189
            QP YFP EL+   DN    + + LY CY I L           +IILA++  +  D    
Sbjct  37   QPVYFPEELM---DNWVSFSLRGLYYCYNISLQGSCNTTADPTDIILAVKCDMGPDFFRY  93

Query  190  SFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLV  369
            SF L   GG  +    Y+  + L+ EQ+L  RRFQ+TVL +L   N + +  A+      
Sbjct  94   SFNL---GGTDI-TIKYLYKIHLNQEQVLFARRFQITVLSLLINSNSSEVSNAIKYFREW  149

Query  370  DGSAVIDYLLLPSSMDPSDVPKIDWNII---SSVLFSYQKPEHRHSDSCSSRHGCRPMHT  540
                 + YLLLP++       KIDW  I   +S  +       RH  SC        + T
Sbjct  150  QVDLGVVYLLLPTASG-----KIDWCGIKFSTSSAYDVTDKNMRHCHSCKD---ADILQT  201

Query  541  KNGLLFSCLLESSLVSTP  594
             +     C+L++S+V  P
Sbjct  202  MDDPCCRCILQNSVVYAP  219



>ref|XP_008644676.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X1 
[Zea mays]
Length=751

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 89/198 (45%), Gaps = 22/198 (11%)
 Frame = +1

Query  22   QPKYFPPELVGTRDN----APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  189
            QP YFP EL+   DN    + + LY CY I L           +IILA++  +  D    
Sbjct  37   QPVYFPEELM---DNWVSFSLRGLYYCYNISLQGSCNTTADPTDIILAVKCDMGPDFFRY  93

Query  190  SFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLV  369
            SF L   GG  +    Y+  + L+ EQ+L  RRFQ+TVL +L   N + +  A+      
Sbjct  94   SFNL---GGTDI-TIKYLYKIHLNQEQVLFARRFQITVLSLLINSNSSEVSNAIKYFREW  149

Query  370  DGSAVIDYLLLPSSMDPSDVPKIDWNII---SSVLFSYQKPEHRHSDSCSSRHGCRPMHT  540
                 + YLLLP++       KIDW  I   +S  +       RH  SC        + T
Sbjct  150  QVDLGVVYLLLPTASG-----KIDWCGIKFSTSSAYDVTDKNMRHCHSCKD---ADILQT  201

Query  541  KNGLLFSCLLESSLVSTP  594
             +     C+L++S+V  P
Sbjct  202  MDDPCCRCILQNSVVYAP  219



>ref|XP_004982511.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X3 
[Setaria italica]
Length=719

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 81/170 (48%), Gaps = 20/170 (12%)
 Frame = +1

Query  22   QPKYFPPELVGTRDN----APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  189
            QP YFP ELV   DN    + + LY CY I +           +IILA++  L  +    
Sbjct  28   QPVYFPEELV---DNWVSFSRRGLYYCYNISMRGCLNTDAAPTDIILAVKCDLGPEFLRN  84

Query  190  SFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLV  369
            SF     GG  V    Y+  + L+ EQ++  RRFQ T+L +L  ++ + + +A+   + +
Sbjct  85   SFN---SGGVEV-TIQYMRIIHLNQEQVIFARRFQTTILSLLIGNDHSEVRDAIKYFHEL  140

Query  370  DGSAVIDYLLLPSSMDPSDVPKIDWNII----SSVLFSYQKPEHRHSDSC  507
              S  + YLLLPS        KIDW  I    SSV  +    + RH  SC
Sbjct  141  QVSVGVVYLLLPSVSG-----KIDWCGIKFSTSSVYDATTDKDMRHCHSC  185



>gb|AAS07188.1| putative ribonuclease III, 5'-partial (with alternative splicing) 
[Oryza sativa Japonica Group]
Length=416

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 64/130 (49%), Gaps = 3/130 (2%)
 Frame = +1

Query  22   QPKYFPPELVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  198
            QP YFP E V   R  +   +Y CY I L     K     +I+LAL+  L SD  + SF+
Sbjct  274  QPSYFPEEFVDNWRSFSRLGIYYCYKISLEGCP-KTASPTDILLALKCDLGSDFTSSSFK  332

Query  199  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLF-EHNLNTLDEALGRLNLVDG  375
            L     N      Y+G + L+ EQ++  RRFQ T+L  L  + +L  L     ++ L  G
Sbjct  333  LPGGQDNASVTMKYVGIIHLNQEQVIIARRFQTTILSFLIGDDHLEILIYCRQKMVLSAG  392

Query  376  SAVIDYLLLP  405
            +++   L +P
Sbjct  393  ASLKIPLCVP  402



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 815770585800