BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS007F08

Length=622
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011088827.1|  PREDICTED: AP-2 complex subunit alpha-1-like       248   7e-73   Sesamum indicum [beniseed]
ref|XP_004241300.1|  PREDICTED: AP-2 complex subunit alpha-1-like       248   9e-73   Solanum lycopersicum
emb|CDP06994.1|  unnamed protein product                                248   1e-72   Coffea canephora [robusta coffee]
ref|XP_009799204.1|  PREDICTED: AP-2 complex subunit alpha-1-like...    248   1e-72   Nicotiana sylvestris
ref|XP_006347221.1|  PREDICTED: AP-2 complex subunit alpha-1-like       248   1e-72   Solanum tuberosum [potatoes]
gb|EYU36992.1|  hypothetical protein MIMGU_mgv1a000680mg                248   2e-72   Erythranthe guttata [common monkey flower]
ref|XP_009799206.1|  PREDICTED: AP-2 complex subunit alpha-1-like...    247   2e-72   Nicotiana sylvestris
ref|XP_002270388.1|  PREDICTED: AP-2 complex subunit alpha-1            248   2e-72   Vitis vinifera
ref|XP_009622881.1|  PREDICTED: AP-2 complex subunit alpha-1-like...    247   2e-72   
ref|XP_009622879.1|  PREDICTED: AP-2 complex subunit alpha-1-like...    247   2e-72   Nicotiana tomentosiformis
ref|XP_011089991.1|  PREDICTED: AP-2 complex subunit alpha-1-like       247   3e-72   Sesamum indicum [beniseed]
ref|XP_004145777.1|  PREDICTED: AP-2 complex subunit alpha-1-like       246   4e-72   Cucumis sativus [cucumbers]
ref|XP_008458646.1|  PREDICTED: AP-2 complex subunit alpha-1-like       246   4e-72   Cucumis melo [Oriental melon]
ref|XP_008227056.1|  PREDICTED: AP-2 complex subunit alpha-1-like...    246   4e-72   Prunus mume [ume]
ref|XP_008360232.1|  PREDICTED: AP-2 complex subunit alpha-1-like       246   4e-72   
ref|XP_009337393.1|  PREDICTED: AP-2 complex subunit alpha-1-like       246   5e-72   Pyrus x bretschneideri [bai li]
ref|XP_007207152.1|  hypothetical protein PRUPE_ppa000732mg             246   5e-72   Prunus persica
ref|XP_002527437.1|  AP-2 complex subunit alpha, putative               246   6e-72   Ricinus communis
gb|AAS79593.1|  putative adapitin protein                               246   6e-72   Ipomoea trifida
ref|XP_004294044.1|  PREDICTED: AP-2 complex subunit alpha-1-like       246   7e-72   Fragaria vesca subsp. vesca
ref|XP_008227049.1|  PREDICTED: AP-2 complex subunit alpha-1-like...    246   7e-72   Prunus mume [ume]
ref|XP_010313320.1|  PREDICTED: LOW QUALITY PROTEIN: AP-2 complex...    246   7e-72   Solanum lycopersicum
ref|XP_009769671.1|  PREDICTED: AP-2 complex subunit alpha-1-like       246   8e-72   Nicotiana sylvestris
ref|XP_009593880.1|  PREDICTED: AP-2 complex subunit alpha-1-like       245   8e-72   Nicotiana tomentosiformis
gb|KGN46909.1|  hypothetical protein Csa_6G150480                       246   8e-72   Cucumis sativus [cucumbers]
ref|XP_010933729.1|  PREDICTED: AP-2 complex subunit alpha-1-like       245   8e-72   Elaeis guineensis
ref|XP_009364838.1|  PREDICTED: AP-2 complex subunit alpha-1-like       245   9e-72   Pyrus x bretschneideri [bai li]
ref|XP_006484962.1|  PREDICTED: AP-2 complex subunit alpha-1-like       244   2e-71   Citrus sinensis [apfelsine]
ref|XP_010243374.1|  PREDICTED: AP-2 complex subunit alpha-1-like       244   2e-71   Nelumbo nucifera [Indian lotus]
gb|KDO45618.1|  hypothetical protein CISIN_1g001845mg                   244   2e-71   Citrus sinensis [apfelsine]
ref|XP_011044304.1|  PREDICTED: AP-2 complex subunit alpha-1-like       244   2e-71   Populus euphratica
ref|XP_006424356.1|  hypothetical protein CICLE_v10027737mg             244   2e-71   Citrus clementina [clementine]
gb|AFW89827.1|  hypothetical protein ZEAMMB73_923918                    234   3e-71   
ref|XP_006851762.1|  hypothetical protein AMTR_s00040p00228310          244   3e-71   Amborella trichopoda
ref|XP_007015979.1|  Alpha-adaptin isoform 6                            243   3e-71   
ref|XP_010031445.1|  PREDICTED: AP-2 complex subunit alpha-1-like       244   4e-71   Eucalyptus grandis [rose gum]
ref|XP_007015977.1|  Alpha-adaptin isoform 4                            243   6e-71   
ref|XP_007015976.1|  Alpha-adaptin isoform 3                            243   6e-71   
ref|XP_008385466.1|  PREDICTED: AP-2 complex subunit alpha-1-like       243   6e-71   
ref|XP_007015974.1|  Adaptor protein complex AP-2, alpha subunit ...    243   7e-71   
ref|XP_007015978.1|  Alpha-adaptin isoform 5                            243   7e-71   
ref|XP_006349071.1|  PREDICTED: AP-2 complex subunit alpha-1-like...    243   9e-71   Solanum tuberosum [potatoes]
gb|KDP34356.1|  hypothetical protein JCGZ_11239                         242   1e-70   Jatropha curcas
ref|XP_003540215.2|  PREDICTED: AP-2 complex subunit alpha-1-like...    242   2e-70   Glycine max [soybeans]
gb|KHN27686.1|  AP-2 complex subunit alpha-2                            242   2e-70   Glycine soja [wild soybean]
ref|XP_007150117.1|  hypothetical protein PHAVU_005G128200g             242   2e-70   Phaseolus vulgaris [French bean]
ref|XP_003551082.1|  PREDICTED: AP-2 complex subunit alpha-1-like...    242   2e-70   Glycine max [soybeans]
ref|XP_002312889.2|  adaptin family protein                             241   2e-70   Populus trichocarpa [western balsam poplar]
ref|XP_004487540.1|  PREDICTED: AP-2 complex subunit alpha-1-like       241   2e-70   Cicer arietinum [garbanzo]
gb|KEH38922.1|  adaptor protein complex AP-2, alpha subunit             241   2e-70   Medicago truncatula
ref|XP_008796857.1|  PREDICTED: AP-2 complex subunit alpha-1-like       241   3e-70   Phoenix dactylifera
ref|XP_009402639.1|  PREDICTED: AP-2 complex subunit alpha-1-like       241   4e-70   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY20343.1|  BnaC01g23970D                                          228   4e-70   Brassica napus [oilseed rape]
gb|KJB35288.1|  hypothetical protein B456_006G108500                    238   7e-70   Gossypium raimondii
ref|XP_009622880.1|  PREDICTED: AP-2 complex subunit alpha-1-like...    238   2e-69   Nicotiana tomentosiformis
gb|KHG23077.1|  AP-2 complex subunit alpha-2 -like protein              238   3e-69   Gossypium arboreum [tree cotton]
ref|XP_008673054.1|  PREDICTED: uncharacterized protein LOC100280...    238   4e-69   Zea mays [maize]
ref|XP_004986017.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    238   4e-69   
gb|KJB35291.1|  hypothetical protein B456_006G108500                    237   4e-69   Gossypium raimondii
ref|XP_006649257.1|  PREDICTED: AP-2 complex subunit alpha-2-like       238   5e-69   Oryza brachyantha
ref|XP_002468657.1|  hypothetical protein SORBIDRAFT_01g049780          238   5e-69   
ref|XP_004986016.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    238   5e-69   Setaria italica
gb|KHG21469.1|  AP-2 complex subunit alpha-1 -like protein              238   5e-69   Gossypium arboreum [tree cotton]
gb|KJB35290.1|  hypothetical protein B456_006G108500                    238   5e-69   Gossypium raimondii
gb|KJB35287.1|  hypothetical protein B456_006G108500                    238   5e-69   Gossypium raimondii
ref|XP_009799205.1|  PREDICTED: AP-2 complex subunit alpha-1-like...    238   6e-69   Nicotiana sylvestris
gb|EEE58196.1|  hypothetical protein OsJ_09142                          237   6e-69   Oryza sativa Japonica Group [Japonica rice]
gb|ABF93610.1|  Adaptin N terminal region family protein, expressed     237   6e-69   Oryza sativa Japonica Group [Japonica rice]
gb|ABF93611.1|  Adaptin N terminal region family protein, expressed     236   7e-69   Oryza sativa Japonica Group [Japonica rice]
gb|KJB21675.1|  hypothetical protein B456_004G008000                    237   8e-69   Gossypium raimondii
ref|XP_008658924.1|  PREDICTED: uncharacterized protein LOC100384...    237   8e-69   Zea mays [maize]
ref|XP_006384679.1|  adaptin family protein                             236   1e-68   
ref|XP_010689981.1|  PREDICTED: AP-2 complex subunit alpha-1-like       236   1e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011005769.1|  PREDICTED: AP-2 complex subunit alpha-1-like       236   2e-68   Populus euphratica
ref|XP_010229321.1|  PREDICTED: AP-2 complex subunit alpha-2-like       236   2e-68   Brachypodium distachyon [annual false brome]
ref|XP_006349072.1|  PREDICTED: AP-2 complex subunit alpha-1-like...    234   8e-68   Solanum tuberosum [potatoes]
ref|XP_010278258.1|  PREDICTED: AP-2 complex subunit alpha-1-like...    234   9e-68   Nelumbo nucifera [Indian lotus]
ref|XP_008791689.1|  PREDICTED: AP-2 complex subunit alpha-2-like       233   3e-67   Phoenix dactylifera
ref|XP_009400885.1|  PREDICTED: AP-2 complex subunit alpha-1-like...    232   4e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009400884.1|  PREDICTED: AP-2 complex subunit alpha-1-like...    232   4e-67   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS45713.1|  AP-2 complex subunit alpha-1                            232   4e-67   Triticum urartu
ref|XP_010456643.1|  PREDICTED: AP-2 complex subunit alpha-2-like       231   6e-67   
ref|XP_010421069.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    231   1e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010421070.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    231   1e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010493371.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    231   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010493372.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    231   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_009149701.1|  PREDICTED: AP-2 complex subunit alpha-2-like       230   2e-66   Brassica rapa
ref|XP_002977233.1|  hypothetical protein SELMODRAFT_443442             230   2e-66   
ref|XP_002965386.1|  hypothetical protein SELMODRAFT_230624             230   2e-66   
ref|XP_006289512.1|  hypothetical protein CARUB_v10003049mg             229   3e-66   
emb|CDY29719.1|  BnaAnng03410D                                          229   3e-66   Brassica napus [oilseed rape]
ref|XP_006400781.1|  hypothetical protein EUTSA_v10012556mg             229   3e-66   Eutrema salsugineum [saltwater cress]
ref|XP_006400780.1|  hypothetical protein EUTSA_v10012556mg             229   3e-66   Eutrema salsugineum [saltwater cress]
gb|KFK39913.1|  hypothetical protein AALP_AA3G305400                    229   5e-66   Arabis alpina [alpine rockcress]
emb|CDX92339.1|  BnaA10g13780D                                          228   1e-65   
ref|XP_009120644.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    228   1e-65   Brassica rapa
emb|CDY26951.1|  BnaC09g36320D                                          228   1e-65   Brassica napus [oilseed rape]
ref|XP_009120645.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    228   1e-65   Brassica rapa
dbj|BAH57126.1|  AT5G22770                                              227   2e-65   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197670.1|  AP-2 complex subunit alpha-2                          228   2e-65   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197669.1|  alpha-adaptin                                         228   2e-65   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB11683.1|  alpha-adaptin                                          228   2e-65   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10137.1|  alpha-adaptin C homolog                                228   2e-65   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH56772.1|  AT5G22770                                              228   2e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874085.1|  hypothetical protein ARALYDRAFT_489126             227   3e-65   
ref|XP_001785715.1|  predicted protein                                  227   4e-65   
ref|XP_001774103.1|  predicted protein                                  226   5e-65   
ref|XP_010493370.1|  PREDICTED: AP-2 complex subunit alpha-2-like       226   1e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010454540.1|  PREDICTED: AP-2 complex subunit alpha-2-like       225   1e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010541300.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    225   1e-64   Tarenaya hassleriana [spider flower]
ref|XP_010541302.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    224   1e-64   Tarenaya hassleriana [spider flower]
ref|XP_010421071.1|  PREDICTED: AP-2 complex subunit alpha-2-like       225   1e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010541301.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    225   1e-64   Tarenaya hassleriana [spider flower]
ref|XP_010535654.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    224   3e-64   Tarenaya hassleriana [spider flower]
ref|XP_010535655.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    224   3e-64   Tarenaya hassleriana [spider flower]
ref|XP_010535652.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    224   3e-64   Tarenaya hassleriana [spider flower]
ref|XP_010535653.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    224   3e-64   Tarenaya hassleriana [spider flower]
ref|XP_001757190.1|  predicted protein                                  224   4e-64   
ref|XP_010520400.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    224   5e-64   Tarenaya hassleriana [spider flower]
ref|XP_010520399.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    224   5e-64   Tarenaya hassleriana [spider flower]
gb|EMT20136.1|  hypothetical protein F775_52366                         218   5e-62   
ref|XP_010100166.1|  AP-2 complex subunit alpha-2                       216   6e-61   
tpg|DAA42890.1|  TPA: hypothetical protein ZEAMMB73_876815              214   3e-60   
dbj|BAF36329.1|  hypothetical protein                                   189   6e-56   Ipomoea trifida
ref|XP_003060967.1|  predicted protein                                  173   1e-45   Micromonas pusilla CCMP1545
emb|CEG00199.1|  Clathrin alpha-adaptin/coatomer adaptor,appendag...    171   4e-45   Ostreococcus tauri
ref|XP_001422806.1|  predicted protein                                  167   1e-43   Ostreococcus lucimarinus CCE9901
ref|XP_001421149.1|  predicted protein                                  166   2e-43   Ostreococcus lucimarinus CCE9901
ref|XP_005650803.1|  Adaptor protein complex AP-2 alpha subunit         164   1e-42   Coccomyxa subellipsoidea C-169
gb|ABF57312.1|  adaptor-related protein complex 2, short form           151   4e-42   Bos taurus [bovine]
ref|XP_002736877.1|  PREDICTED: AP-2 complex subunit alpha-like         152   2e-41   Saccoglossus kowalevskii
ref|XP_002979139.1|  hypothetical protein SELMODRAFT_233268             158   9e-41   
gb|KIZ06051.1|  AP-2 complex subunit alpha                              151   1e-40   Monoraphidium neglectum
gb|EPS69642.1|  hypothetical protein M569_05122                         156   1e-40   Genlisea aurea
ref|XP_005840878.1|  Adaptor protein complex 2 subunit alpha 1          157   2e-40   Guillardia theta CCMP2712
ref|XP_001690919.1|  alpha-adaptin                                      157   2e-40   Chlamydomonas reinhardtii
emb|CDQ77671.1|  unnamed protein product                                150   4e-40   Oncorhynchus mykiss
ref|XP_008252165.1|  PREDICTED: AP-2 complex subunit alpha-2-like       149   5e-40   Oryctolagus cuniculus [domestic rabbit]
ref|XP_002502851.1|  alpha-adaptin protein                              156   7e-40   Micromonas commoda
dbj|BAG50999.1|  unnamed protein product                                150   1e-39   Homo sapiens [man]
ref|XP_003745666.1|  PREDICTED: AP-2 complex subunit alpha-like         155   2e-39   
ref|XP_006802381.1|  PREDICTED: AP-2 complex subunit alpha-2-like       153   2e-39   Neolamprologus brichardi [lyretail cichlid]
pdb|4NEE|G  Chain G, Crystal Structure Of Ap-2 Alpha/simga2 Compl...    150   2e-39   Rattus norvegicus [brown rat]
ref|XP_008111809.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    154   3e-39   
ref|XP_008111810.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    154   3e-39   Anolis carolinensis [Carolina anole]
ref|XP_003222740.2|  PREDICTED: AP-2 complex subunit alpha-1 isof...    154   3e-39   Anolis carolinensis [Carolina anole]
ref|XP_003222739.2|  PREDICTED: AP-2 complex subunit alpha-1 isof...    154   3e-39   Anolis carolinensis [Carolina anole]
ref|XP_008111807.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    154   3e-39   
ref|XP_008111808.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    154   4e-39   Anolis carolinensis [Carolina anole]
ref|NP_001090846.1|  adaptor-related protein complex 2, alpha 1 s...    154   4e-39   Xenopus tropicalis [western clawed frog]
ref|NP_476819.2|  adaptor protein complex 2, alpha subunit, isofo...    154   4e-39   Drosophila melanogaster
ref|XP_002041575.1|  GM16671                                            154   4e-39   Drosophila sechellia
ref|XP_001988543.1|  GH10520                                            154   4e-39   Drosophila grimshawi
ref|XP_001356441.1|  GA18063                                            154   4e-39   Drosophila pseudoobscura pseudoobscura
ref|XP_002003665.1|  GI18037                                            154   5e-39   Drosophila mojavensis
ref|XP_002066736.1|  GK24645                                            153   5e-39   Drosophila willistoni
emb|CDJ95459.1|  Clathrin coatomer adaptor domain containing protein    150   5e-39   Haemonchus contortus [red stomach worm]
ref|XP_002052827.1|  GJ19747                                            153   5e-39   Drosophila virilis
ref|XP_005001814.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    154   5e-39   
ref|XP_002087423.1|  GE16139                                            153   5e-39   Drosophila yakuba
emb|CAA73533.1|  alpha-adaptin                                          153   5e-39   Drosophila melanogaster
gb|EFX80034.1|  hypothetical protein DAPPUDRAFT_212220                  153   5e-39   Daphnia pulex
ref|XP_004767314.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    154   5e-39   
ref|XP_005802713.1|  PREDICTED: LOW QUALITY PROTEIN: AP-2 complex...    153   6e-39   
ref|XP_005186395.1|  PREDICTED: AP-2 complex subunit alpha              153   6e-39   Musca domestica
ref|XP_004767313.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    154   6e-39   
ref|XP_001965376.1|  GF24806                                            153   6e-39   Drosophila ananassae
ref|XP_004767312.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    154   6e-39   
ref|XP_011199623.1|  PREDICTED: AP-2 complex subunit alpha              153   6e-39   Bactrocera dorsalis [papaya fruit fly]
ref|XP_004536312.1|  PREDICTED: AP-2 complex subunit alpha-like i...    153   6e-39   Ceratitis capitata [medfly]
ref|XP_002433752.1|  AP-2 complex subunit alpha-1, putative             153   6e-39   Ixodes scapularis [blacklegged tick]
ref|XP_004767311.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    154   6e-39   
ref|XP_011186748.1|  PREDICTED: AP-2 complex subunit alpha              153   7e-39   Zeugodacus cucurbitae [melon fruit fly]
emb|CAJ83860.1|  daptor-related protein complex 2, alpha 2 subunit      150   7e-39   Xenopus tropicalis [western clawed frog]
ref|XP_004694071.1|  PREDICTED: AP-2 complex subunit alpha-1            150   8e-39   
ref|XP_011492851.1|  PREDICTED: AP-2 complex subunit alpha-2-like       152   9e-39   
ref|XP_008281654.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    152   9e-39   Stegastes partitus
emb|CDQ70588.1|  unnamed protein product                                153   9e-39   Oncorhynchus mykiss
dbj|BAG63408.1|  unnamed protein product                                149   1e-38   Homo sapiens [man]
ref|XP_008281653.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    152   1e-38   Stegastes partitus
emb|CDQ72264.1|  unnamed protein product                                150   1e-38   Oncorhynchus mykiss
ref|XP_005924073.1|  PREDICTED: AP-2 complex subunit alpha-2-like       152   1e-38   
gb|ETN58439.1|  adaptin, alpha/gamma/epsilon                            152   2e-38   Anopheles darlingi [American malaria mosquito]
ref|XP_005726473.1|  PREDICTED: AP-2 complex subunit alpha-2-like       152   2e-38   
ref|XP_011498394.1|  PREDICTED: LOW QUALITY PROTEIN: AP-2 complex...    152   2e-38   Ceratosolen solmsi marchali
ref|XP_310153.4|  AGAP009538-PA                                         152   2e-38   Anopheles gambiae str. PEST
gb|KFM77968.1|  AP-2 complex subunit alpha-2                            152   2e-38   Stegodyphus mimosarum
ref|XP_011139196.1|  PREDICTED: AP-2 complex subunit alpha              152   2e-38   Harpegnathos saltator
ref|XP_008546428.1|  PREDICTED: AP-2 complex subunit alpha              152   2e-38   
ref|NP_001136323.1|  adaptor-related protein complex 2, alpha 2 s...    152   2e-38   Nasonia vitripennis
ref|XP_394621.2|  PREDICTED: AP-2 complex subunit alpha isoformX1       152   2e-38   Apis mellifera [bee]
pdb|2JKR|A  Chain A, Ap2 Clathrin Adaptor Core With Dileucine Pep...    149   2e-38   Mus musculus [mouse]
ref|XP_003978707.1|  PREDICTED: AP-2 complex subunit alpha-2-like       152   2e-38   
ref|XP_004091849.1|  PREDICTED: LOW QUALITY PROTEIN: AP-2 complex...    152   2e-38   
pdb|2VGL|A  Chain A, Ap2 Clathrin Adaptor Core                          149   2e-38   Mus musculus [mouse]
ref|XP_003703257.1|  PREDICTED: AP-2 complex subunit alpha-like         152   2e-38   Megachile rotundata
ref|XP_003491577.1|  PREDICTED: AP-2 complex subunit alpha-like         152   2e-38   Bombus impatiens
ref|XP_004932148.1|  PREDICTED: AP-2 complex subunit alpha-like         152   2e-38   Bombyx mori [silk moth]
pdb|4UQI|A  Chain A, Ap2 Controls Clathrin Polymerization With A ...    149   2e-38   Mus musculus [mouse]
ref|XP_003402975.1|  PREDICTED: AP-2 complex subunit alpha-like         152   2e-38   Bombus terrestris [large earth bumblebee]
gb|EHJ66702.1|  hypothetical protein KGM_03658                          152   2e-38   
ref|XP_011299658.1|  PREDICTED: AP-2 complex subunit alpha isofor...    152   2e-38   Fopius arisanus
ref|XP_011164254.1|  PREDICTED: AP-2 complex subunit alpha              152   2e-38   Solenopsis invicta [imported red fire ant]
ref|XP_003802841.1|  PREDICTED: AP-2 complex subunit alpha-2            152   2e-38   
ref|XP_010732260.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    151   2e-38   Larimichthys crocea [croceine croaker]
ref|XP_011253598.1|  PREDICTED: AP-2 complex subunit alpha isofor...    151   2e-38   Camponotus floridanus
ref|XP_011055344.1|  PREDICTED: AP-2 complex subunit alpha              151   2e-38   Acromyrmex echinatior
ref|XP_011334710.1|  PREDICTED: AP-2 complex subunit alpha              151   2e-38   Ooceraea biroi
ref|XP_008308524.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    151   3e-38   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_010732261.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    151   3e-38   
ref|XP_008308523.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    151   3e-38   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_007568308.1|  PREDICTED: AP-2 complex subunit alpha-2            151   3e-38   Poecilia formosa
ref|XP_008403154.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    151   3e-38   Poecilia reticulata
ref|XP_007074351.1|  PREDICTED: AP-2 complex subunit alpha-1            150   3e-38   
ref|XP_002829637.3|  PREDICTED: AP-2 complex subunit alpha-1            150   3e-38   
ref|XP_011253597.1|  PREDICTED: AP-2 complex subunit alpha isofor...    151   3e-38   Camponotus floridanus
ref|XP_009051374.1|  hypothetical protein LOTGIDRAFT_203023             151   4e-38   Lottia gigantea
ref|XP_008403153.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    151   4e-38   Poecilia reticulata
emb|CAF95181.1|  unnamed protein product                                151   4e-38   Tetraodon nigroviridis
ref|NP_001001209.1|  adaptor-related protein complex 2, alpha 2 s...    150   4e-38   Xenopus tropicalis [western clawed frog]
ref|XP_008413234.1|  PREDICTED: AP-2 complex subunit alpha-1-like...    150   4e-38   Poecilia reticulata
ref|XP_008413236.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   4e-38   Poecilia reticulata
ref|XP_007543249.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   4e-38   Poecilia formosa
ref|XP_008173941.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   5e-38   
ref|XP_005461661.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   5e-38   Oreochromis niloticus
ref|XP_010900568.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   5e-38   Esox lucius
ref|XP_005461660.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   5e-38   Oreochromis niloticus
ref|XP_005164121.2|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   5e-38   Danio rerio [leopard danio]
ref|XP_003976086.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   5e-38   Takifugu rubripes [tiger puffer]
ref|XP_003456913.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   5e-38   
ref|XP_005749708.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   5e-38   Pundamilia nyererei
ref|XP_005749711.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   5e-38   Pundamilia nyererei
ref|XP_009297844.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   5e-38   Danio rerio [leopard danio]
ref|XP_005164120.2|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   5e-38   Danio rerio [leopard danio]
ref|XP_008106455.1|  PREDICTED: AP-2 complex subunit alpha-2            150   5e-38   Anolis carolinensis [Carolina anole]
ref|XP_005749710.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   5e-38   Pundamilia nyererei
ref|XP_005280822.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   5e-38   Chrysemys picta bellii
gb|ELK28574.1|  AP-2 complex subunit alpha-1                            150   5e-38   Myotis davidii
ref|XP_010900567.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   5e-38   Esox lucius
ref|XP_004573167.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   5e-38   Maylandia zebra
ref|XP_009297843.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   5e-38   Danio rerio [leopard danio]
ref|XP_007543248.1|  PREDICTED: AP-2 complex subunit alpha-1-like...    150   5e-38   Poecilia formosa
ref|XP_004573166.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   5e-38   Maylandia zebra
ref|XP_003976089.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   5e-38   
ref|XP_003976087.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   5e-38   
ref|XP_005749712.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   5e-38   
ref|NP_001089303.1|  adaptor-related protein complex 2, alpha 2 s...    150   5e-38   Xenopus laevis [clawed frog]
ref|XP_008173939.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   5e-38   
ref|XP_003456912.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   5e-38   
ref|XP_009297842.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   5e-38   Danio rerio [leopard danio]
ref|XP_004866933.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   5e-38   
ref|XP_004278131.1|  PREDICTED: AP-2 complex subunit alpha-2            150   5e-38   Orcinus orca [Orca]
ref|XP_005749709.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   5e-38   
ref|XP_008413233.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   5e-38   Poecilia reticulata
ref|XP_007465999.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    150   5e-38   Lipotes vexillifer [baiji]
ref|XP_004866932.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   5e-38   
ref|XP_007543244.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   5e-38   
ref|XP_005749706.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   5e-38   Pundamilia nyererei
ref|XP_007251131.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   5e-38   Astyanax mexicanus [blind cave fish]
ref|XP_003976088.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   5e-38   
ref|XP_007429626.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    150   5e-38   Python bivittatus
ref|XP_010900566.1|  PREDICTED: AP-2 complex subunit alpha-1-like...    150   5e-38   Esox lucius
ref|XP_005366896.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   5e-38   
ref|XP_005164119.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   5e-38   Danio rerio [leopard danio]
ref|XP_005461659.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   5e-38   Oreochromis niloticus
ref|XP_005461658.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   5e-38   
ref|XP_007251129.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   5e-38   Astyanax mexicanus [blind cave fish]
ref|XP_008301710.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   5e-38   Stegastes partitus
ref|XP_005366895.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   5e-38   
ref|XP_010752560.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   5e-38   Larimichthys crocea [croceine croaker]
ref|XP_007465998.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    150   6e-38   Lipotes vexillifer [baiji]
ref|XP_007429625.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    150   6e-38   Python bivittatus
ref|XP_006274934.1|  PREDICTED: AP-2 complex subunit alpha-1            150   6e-38   
ref|XP_010900564.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   6e-38   Esox lucius
ref|XP_005749707.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   6e-38   Pundamilia nyererei
ref|XP_004573165.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   6e-38   Maylandia zebra
ref|XP_010900565.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   6e-38   Esox lucius
ref|XP_007251127.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   6e-38   Astyanax mexicanus [blind cave fish]
ref|XP_007251128.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   6e-38   
ref|XP_008301718.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   6e-38   
ref|XP_007251130.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   6e-38   
ref|XP_004866931.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   6e-38   
ref|XP_011476956.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   6e-38   
ref|XP_010752561.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   6e-38   
ref|XP_010900563.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   6e-38   
gb|ELW47126.1|  AP-2 complex subunit alpha-1                            150   6e-38   
ref|XP_005084809.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   6e-38   
ref|XP_006868277.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   6e-38   
ref|XP_005280823.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   6e-38   
ref|XP_004646484.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   6e-38   
ref|XP_008301701.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   6e-38   
ref|XP_008328724.1|  PREDICTED: LOW QUALITY PROTEIN: AP-2 complex...    150   6e-38   
ref|XP_007251126.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   6e-38   
ref|XP_005412884.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   6e-38   
gb|EPQ15998.1|  AP-2 complex subunit alpha-1                            150   6e-38   
ref|XP_010752559.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   6e-38   
ref|XP_006868275.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   6e-38   
ref|XP_008152563.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   6e-38   
ref|XP_003465547.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   6e-38   
ref|XP_006012576.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   6e-38   
ref|XP_008173940.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   6e-38   
ref|XP_007941048.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   6e-38   
ref|XP_007536303.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   6e-38   
gb|ENN74140.1|  hypothetical protein YQE_09113                          150   6e-38   
ref|XP_004889053.1|  PREDICTED: AP-2 complex subunit alpha-1            150   6e-38   
ref|XP_006080137.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   6e-38   
ref|XP_007908145.1|  PREDICTED: AP-2 complex subunit alpha-2            150   6e-38   
ref|XP_004767317.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   6e-38   
ref|XP_004710503.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   6e-38   
ref|XP_004409958.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   6e-38   
ref|XP_003638862.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   6e-38   
ref|XP_005336758.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_005590033.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_006986288.1|  PREDICTED: AP-2 complex subunit alpha-1            150   7e-38   
ref|XP_005336759.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_004440354.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_008152561.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_006012578.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   7e-38   
gb|EHB05668.1|  AP-2 complex subunit alpha-1                            150   7e-38   
ref|XP_004866930.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_006766034.1|  PREDICTED: AP-2 complex subunit alpha-1            150   7e-38   
ref|XP_004286212.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_004646483.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_004672282.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_004619906.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_005955526.1|  PREDICTED: AP-2 complex subunit alpha-1            150   7e-38   
ref|XP_004710504.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_004710502.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_006229126.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|NP_031484.1|  AP-2 complex subunit alpha-1 isoform a                150   7e-38   
ref|XP_010638998.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_011476953.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_007941045.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_005412882.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_006012577.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   7e-38   
ref|XP_005412883.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_010638999.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_005366893.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_005084807.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_009193268.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|NP_001070732.1|  AP-2 complex subunit alpha-1 isoform b             150   7e-38   
ref|XP_010349394.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_008251307.1|  PREDICTED: AP-2 complex subunit alpha-1            150   7e-38   
ref|XP_006229127.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_006208504.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_011476955.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_008843317.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_541490.4|  PREDICTED: AP-2 complex subunit alpha-1 isoform 3     150   7e-38   
ref|XP_005366894.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_005084808.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_008053994.1|  PREDICTED: LOW QUALITY PROTEIN: AP-2 complex...    150   7e-38   
ref|XP_008589127.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_004440352.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_006080136.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_005991052.1|  PREDICTED: AP-2 complex subunit alpha-1-like       150   7e-38   
ref|XP_003465546.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_005652822.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    150   7e-38   
ref|XP_006868276.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|NP_001100981.1|  AP-2 complex subunit alpha-1                       150   7e-38   
emb|CDQ64869.1|  unnamed protein product                                150   7e-38   
ref|XP_004646481.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_006898716.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_008589128.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_003127388.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_004619904.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_005652823.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    150   7e-38   
ref|XP_007941046.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_004619905.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   7e-38   
ref|XP_008152562.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|XP_008965228.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
gb|ELK18522.1|  AP-2 complex subunit alpha-1                            150   8e-38   
ref|XP_003638863.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|XP_010349395.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|XP_004440353.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|XP_004381691.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|XP_003269734.2|  PREDICTED: AP-2 complex subunit alpha-1            150   8e-38   
ref|XP_004381690.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|XP_005336757.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|XP_003465548.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|XP_006012574.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   8e-38   
ref|XP_004672281.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|XP_006160190.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|XP_004672280.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
gb|KIH65318.1|  adaptin region                                          150   8e-38   
tpg|DAA19706.1|  TPA: adaptor-related protein complex 2, alpha 1 ...    150   8e-38   
ref|XP_007536302.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|NP_001178369.1|  AP-2 complex subunit alpha-1                       150   8e-38   
ref|XP_004672279.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|XP_003915969.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|XP_004646482.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|XP_006208502.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|XP_011221492.1|  PREDICTED: AP-2 complex subunit alpha-1            150   8e-38   
ref|XP_006898715.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|XP_003801518.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|NP_001253137.1|  AP-2 complex subunit alpha-1                       150   8e-38   
ref|XP_971368.1|  PREDICTED: AP-2 complex subunit alpha                 150   8e-38   
ref|XP_006905078.1|  PREDICTED: AP-2 complex subunit alpha-1            150   8e-38   
ref|XP_002762424.1|  PREDICTED: AP-2 complex subunit alpha-1            150   8e-38   
ref|XP_005336756.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|XP_004381689.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|XP_004286210.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|NP_570603.2|  AP-2 complex subunit alpha-1 isoform 2                150   8e-38   
ref|XP_004286211.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|XP_005590031.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|XP_007185000.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|XP_006012572.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   8e-38   
ref|XP_011287993.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|XP_004767316.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|XP_004409957.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|XP_007536301.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|NP_055018.2|  AP-2 complex subunit alpha-1 isoform 1                150   8e-38   
gb|EDL22772.1|  adaptor protein complex AP-2, alpha 1 subunit           150   8e-38   
ref|XP_004767315.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|XP_004409956.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|XP_010367812.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|XP_007185002.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|XP_006208503.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|XP_008843316.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|XP_003127386.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
emb|CBY41070.1|  unnamed protein product                                150   8e-38   
gb|AAL11040.1|AF289221_2  alpha-adaptin A related protein               150   8e-38   
ref|XP_003915970.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   8e-38   
ref|XP_006012573.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   9e-38   
ref|XP_011287992.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   9e-38   
ref|XP_006160192.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   9e-38   
ref|XP_006012575.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   9e-38   
ref|XP_003127387.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   9e-38   
ref|XP_010367811.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   9e-38   
gb|AAL11039.1|AF289221_1  alpha-adaptin A related protein               150   9e-38   
ref|XP_006012571.1|  PREDICTED: AP-2 complex subunit alpha-2-like...    150   9e-38   
ref|XP_006898714.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   9e-38   
emb|CDJ85383.1|  Clathrin coatomer adaptor and Clathrin adaptor d...    150   9e-38   
gb|ETN69317.1|  adaptin region                                          150   9e-38   
ref|XP_003801519.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   9e-38   
ref|XP_010991473.1|  PREDICTED: LOW QUALITY PROTEIN: AP-2 complex...    150   9e-38   
gb|EYC13632.1|  hypothetical protein Y032_0043g827                      150   9e-38   
gb|EHH59792.1|  hypothetical protein EGM_09986                          150   9e-38   
ref|XP_006110027.1|  PREDICTED: LOW QUALITY PROTEIN: adaptor-rela...    150   1e-37   
ref|XP_005879683.1|  PREDICTED: AP-2 complex subunit alpha-1            150   1e-37   
gb|AAX27903.2|  SJCHGC04224 protein                                     141   1e-37   
ref|XP_006877033.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    150   1e-37   
ref|XP_004061268.1|  PREDICTED: AP-2 complex subunit alpha-1            150   1e-37   
ref|XP_005046893.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    150   1e-37   
ref|XP_009637907.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    150   1e-37   
ref|NP_001069170.1|  AP-2 complex subunit alpha-2                       150   1e-37   
ref|XP_005046892.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    150   1e-37   
ref|XP_010560873.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    150   1e-37   
ref|XP_007059785.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    150   1e-37   
ref|XP_009637915.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_005001813.1|  PREDICTED: AP-2 complex subunit alpha-1 isof...    150   1e-37   
ref|XP_009100425.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_010560874.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_005491648.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
tpg|DAA13547.1|  TPA: AP-2 complex subunit alpha-2                      149   1e-37   
ref|XP_006877032.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_010560875.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_009100424.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_006937731.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_005491649.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_010560872.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    150   1e-37   
ref|XP_005522418.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_004015429.1|  PREDICTED: LOW QUALITY PROTEIN: AP-2 complex...    149   1e-37   
ref|XP_007059786.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|NP_001012914.1|  AP-2 complex subunit alpha-2                       149   1e-37   
dbj|BAB55435.1|  unnamed protein product                                147   1e-37   
ref|XP_005046895.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_009637890.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
emb|CAA33097.1|  unnamed protein product                                149   1e-37   
ref|XP_005149379.1|  PREDICTED: AP-2 complex subunit alpha-2            150   1e-37   
ref|XP_005522419.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_005351591.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_005064252.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_005351590.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_005046891.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_008852657.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_004638020.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_004638018.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_006937732.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_006741412.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_005064251.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_005491647.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_005509132.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_004638021.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_004638019.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_005509131.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_006977301.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
sp|P18484.3|AP2A2_RAT  RecName: Full=AP-2 complex subunit alpha-2...    149   1e-37   
ref|XP_009637898.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_006536217.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_006741411.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
gb|KDD73994.1|  adaptin                                                 145   1e-37   
ref|XP_005491646.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_004999551.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_008758232.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_007059787.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_004654245.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_003461349.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_008162726.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_006977300.1|  PREDICTED: AP-2 complex subunit alpha-2 isof...    149   1e-37   
ref|XP_004403840.1|  PREDICTED: AP-2 complex subunit alpha-2            149   1e-37   



>ref|XP_011088827.1| PREDICTED: AP-2 complex subunit alpha-1-like [Sesamum indicum]
Length=1025

 Score =   248 bits (634),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 116/117 (99%), Positives = 117/117 (100%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>ref|XP_004241300.1| PREDICTED: AP-2 complex subunit alpha-1-like [Solanum lycopersicum]
Length=1017

 Score =   248 bits (633),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 115/117 (98%), Positives = 117/117 (100%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGN+RTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNVRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>emb|CDP06994.1| unnamed protein product [Coffea canephora]
Length=1012

 Score =   248 bits (632),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/117 (98%), Positives = 117/117 (100%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISD+RNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDVRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>ref|XP_009799204.1| PREDICTED: AP-2 complex subunit alpha-1-like isoform X1 [Nicotiana 
sylvestris]
Length=1022

 Score =   248 bits (632),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/117 (98%), Positives = 117/117 (100%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI+
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDIV  117



>ref|XP_006347221.1| PREDICTED: AP-2 complex subunit alpha-1-like [Solanum tuberosum]
Length=1012

 Score =   248 bits (632),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/117 (97%), Positives = 117/117 (100%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISD+RNCQNKEQERLRVDKELGN+RTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDVRNCQNKEQERLRVDKELGNVRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>gb|EYU36992.1| hypothetical protein MIMGU_mgv1a000680mg [Erythranthe guttata]
Length=1021

 Score =   248 bits (632),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/117 (98%), Positives = 117/117 (100%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISD+RNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDVRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>ref|XP_009799206.1| PREDICTED: AP-2 complex subunit alpha-1-like isoform X3 [Nicotiana 
sylvestris]
Length=903

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/117 (98%), Positives = 117/117 (100%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI+
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDIV  117



>ref|XP_002270388.1| PREDICTED: AP-2 complex subunit alpha-1 [Vitis vinifera]
 emb|CBI17095.3| unnamed protein product [Vitis vinifera]
Length=1015

 Score =   248 bits (632),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/117 (98%), Positives = 117/117 (100%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGN+RTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNVRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>ref|XP_009622881.1| PREDICTED: AP-2 complex subunit alpha-1-like isoform X3 [Nicotiana 
tomentosiformis]
Length=900

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/117 (98%), Positives = 117/117 (100%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI+
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDIV  117



>ref|XP_009622879.1| PREDICTED: AP-2 complex subunit alpha-1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=945

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/117 (98%), Positives = 117/117 (100%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI+
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDIV  117



>ref|XP_011089991.1| PREDICTED: AP-2 complex subunit alpha-1-like [Sesamum indicum]
Length=1024

 Score =   247 bits (630),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/117 (99%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IHMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>ref|XP_004145777.1| PREDICTED: AP-2 complex subunit alpha-1-like [Cucumis sativus]
 ref|XP_004163776.1| PREDICTED: AP-2 complex subunit alpha-1-like [Cucumis sativus]
Length=1019

 Score =   246 bits (629),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/117 (97%), Positives = 117/117 (100%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGL+VFISDIRNCQNKEQERLRVDKELGN+RTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLAVFISDIRNCQNKEQERLRVDKELGNVRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>ref|XP_008458646.1| PREDICTED: AP-2 complex subunit alpha-1-like [Cucumis melo]
Length=1018

 Score =   246 bits (629),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/117 (97%), Positives = 117/117 (100%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGL+VFISDIRNCQNKEQERLRVDKELGN+RTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLAVFISDIRNCQNKEQERLRVDKELGNVRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>ref|XP_008227056.1| PREDICTED: AP-2 complex subunit alpha-1-like isoform X2 [Prunus 
mume]
Length=1020

 Score =   246 bits (629),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/117 (97%), Positives = 117/117 (100%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGN+RTRFKNEKGL+PYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNVRTRFKNEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>ref|XP_008360232.1| PREDICTED: AP-2 complex subunit alpha-1-like [Malus domestica]
Length=1019

 Score =   246 bits (628),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/117 (97%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGN+RTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNVRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVT+CLLNENHDFLR AINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTACLLNENHDFLRJAINTVRNDII  117



>ref|XP_009337393.1| PREDICTED: AP-2 complex subunit alpha-1-like [Pyrus x bretschneideri]
Length=1020

 Score =   246 bits (628),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/117 (97%), Positives = 117/117 (100%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISD+RNCQNKEQERLRVDKELGN+RTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDVRNCQNKEQERLRVDKELGNVRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVT+CLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTACLLNENHDFLRLAINTVRNDII  117



>ref|XP_007207152.1| hypothetical protein PRUPE_ppa000732mg [Prunus persica]
 gb|EMJ08351.1| hypothetical protein PRUPE_ppa000732mg [Prunus persica]
Length=1020

 Score =   246 bits (628),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 114/117 (97%), Positives = 117/117 (100%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGN+RTRFKNEKGL+PYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNVRTRFKNEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>ref|XP_002527437.1| AP-2 complex subunit alpha, putative [Ricinus communis]
 gb|EEF34929.1| AP-2 complex subunit alpha, putative [Ricinus communis]
Length=1018

 Score =   246 bits (627),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 115/117 (98%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNC NKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCPNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>gb|AAS79593.1| putative adapitin protein [Ipomoea trifida]
Length=1080

 Score =   246 bits (628),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 114/117 (97%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGN+RTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNVRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAIN VRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINAVRNDII  117



>ref|XP_004294044.1| PREDICTED: AP-2 complex subunit alpha-1-like [Fragaria vesca 
subsp. vesca]
Length=1021

 Score =   246 bits (627),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 114/117 (97%), Positives = 117/117 (100%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGN+RTRFKN+KGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNVRTRFKNDKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>ref|XP_008227049.1| PREDICTED: AP-2 complex subunit alpha-1-like isoform X1 [Prunus 
mume]
Length=1048

 Score =   246 bits (627),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 114/117 (97%), Positives = 117/117 (100%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGN+RTRFKNEKGL+PYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNVRTRFKNEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>ref|XP_010313320.1| PREDICTED: LOW QUALITY PROTEIN: AP-2 complex subunit alpha-1-like 
[Solanum lycopersicum]
Length=1020

 Score =   246 bits (627),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 114/117 (97%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISD+RNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDVRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI+
Sbjct  61   IHMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDIV  117



>ref|XP_009769671.1| PREDICTED: AP-2 complex subunit alpha-1-like [Nicotiana sylvestris]
Length=1020

 Score =   246 bits (627),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 115/117 (98%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNCQNKE ERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCQNKEAERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>ref|XP_009593880.1| PREDICTED: AP-2 complex subunit alpha-1-like [Nicotiana tomentosiformis]
Length=1020

 Score =   245 bits (626),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 114/117 (97%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNCQNKE ERLRVDKELGN+RTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCQNKEAERLRVDKELGNVRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>gb|KGN46909.1| hypothetical protein Csa_6G150480 [Cucumis sativus]
Length=1055

 Score =   246 bits (627),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 114/117 (97%), Positives = 117/117 (100%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGL+VFISDIRNCQNKEQERLRVDKELGN+RTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLAVFISDIRNCQNKEQERLRVDKELGNVRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>ref|XP_010933729.1| PREDICTED: AP-2 complex subunit alpha-1-like [Elaeis guineensis]
Length=1023

 Score =   245 bits (626),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 114/117 (97%), Positives = 117/117 (100%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNEN+DFLR+AINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENYDFLRMAINTVRNDII  117



>ref|XP_009364838.1| PREDICTED: AP-2 complex subunit alpha-1-like [Pyrus x bretschneideri]
Length=1019

 Score =   245 bits (626),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 113/117 (97%), Positives = 117/117 (100%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGN+RTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNVRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVT+CLLNENHDFLR+AINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTACLLNENHDFLRIAINTVRNDII  117



>ref|XP_006484962.1| PREDICTED: AP-2 complex subunit alpha-1-like [Citrus sinensis]
Length=1025

 Score =   244 bits (624),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/117 (97%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNC NKEQERLRVDKELGNIRTRFKNEKGL+PYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCPNKEQERLRVDKELGNIRTRFKNEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>ref|XP_010243374.1| PREDICTED: AP-2 complex subunit alpha-1-like [Nelumbo nucifera]
Length=1023

 Score =   244 bits (624),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/117 (97%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISD+RNCQNKEQERLRVDKELGNIRTRFKNEKGL+PYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDVRNCQNKEQERLRVDKELGNIRTRFKNEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRL INTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLVINTVRNDII  117



>gb|KDO45618.1| hypothetical protein CISIN_1g001845mg [Citrus sinensis]
Length=1006

 Score =   244 bits (624),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/117 (97%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNC NKEQERLRVDKELGNIRTRFKNEKGL+PYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCPNKEQERLRVDKELGNIRTRFKNEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>ref|XP_011044304.1| PREDICTED: AP-2 complex subunit alpha-1-like [Populus euphratica]
Length=1020

 Score =   244 bits (623),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/117 (98%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTS LLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSSLLNENHDFLRLAINTVRNDII  117



>ref|XP_006424356.1| hypothetical protein CICLE_v10027737mg [Citrus clementina]
 gb|ESR37596.1| hypothetical protein CICLE_v10027737mg [Citrus clementina]
Length=1014

 Score =   244 bits (623),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/117 (97%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNC NKEQERLRVDKELGNIRTRFKNEKGL+PYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCPNKEQERLRVDKELGNIRTRFKNEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>gb|AFW89827.1| hypothetical protein ZEAMMB73_923918 [Zea mays]
Length=432

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/117 (93%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISD+RNC NKEQERLRVDKELGNIRTRFKNEKGL+PYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDVRNCHNKEQERLRVDKELGNIRTRFKNEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHME VSLISAPKYPEKQVGYIVTSCLLNEN+DFLR+ INTVRNDII
Sbjct  61   IYMLGYDVDFGHMETVSLISAPKYPEKQVGYIVTSCLLNENNDFLRMVINTVRNDII  117



>ref|XP_006851762.1| hypothetical protein AMTR_s00040p00228310 [Amborella trichopoda]
 gb|ERN13229.1| hypothetical protein AMTR_s00040p00228310 [Amborella trichopoda]
Length=1020

 Score =   244 bits (622),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/117 (97%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISD+RNCQNKEQER RVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDVRNCQNKEQERQRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRL INTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLVINTVRNDII  117



>ref|XP_007015979.1| Alpha-adaptin isoform 6 [Theobroma cacao]
 gb|EOY33598.1| Alpha-adaptin isoform 6 [Theobroma cacao]
Length=855

 Score =   243 bits (619),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/117 (96%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MA+ GMRGLSVFISDIRNCQNKEQERLRVDKELGN+RTRFKNEKGL+PYEKKKYVWKMLY
Sbjct  1    MAMHGMRGLSVFISDIRNCQNKEQERLRVDKELGNVRTRFKNEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>ref|XP_010031445.1| PREDICTED: AP-2 complex subunit alpha-1-like [Eucalyptus grandis]
 gb|KCW50744.1| hypothetical protein EUGRSUZ_J00415 [Eucalyptus grandis]
Length=1015

 Score =   244 bits (622),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/117 (97%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGN+RTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNVRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I MLGYDVDFGHME VSLISAPKYPEKQVGYIVT+CLLNENHDFLRLAINTVRNDII
Sbjct  61   IHMLGYDVDFGHMETVSLISAPKYPEKQVGYIVTACLLNENHDFLRLAINTVRNDII  117



>ref|XP_007015977.1| Alpha-adaptin isoform 4 [Theobroma cacao]
 gb|EOY33596.1| Alpha-adaptin isoform 4 [Theobroma cacao]
Length=948

 Score =   243 bits (620),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/117 (96%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MA+ GMRGLSVFISDIRNCQNKEQERLRVDKELGN+RTRFKNEKGL+PYEKKKYVWKMLY
Sbjct  1    MAMHGMRGLSVFISDIRNCQNKEQERLRVDKELGNVRTRFKNEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>ref|XP_007015976.1| Alpha-adaptin isoform 3 [Theobroma cacao]
 gb|EOY33595.1| Alpha-adaptin isoform 3 [Theobroma cacao]
Length=950

 Score =   243 bits (619),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/117 (96%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MA+ GMRGLSVFISDIRNCQNKEQERLRVDKELGN+RTRFKNEKGL+PYEKKKYVWKMLY
Sbjct  1    MAMHGMRGLSVFISDIRNCQNKEQERLRVDKELGNVRTRFKNEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>ref|XP_008385466.1| PREDICTED: AP-2 complex subunit alpha-1-like [Malus domestica]
Length=1020

 Score =   243 bits (620),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/117 (95%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISD+RNC NKEQERLRVDKELGN+RTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDVRNCPNKEQERLRVDKELGNVRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVT+CLLNENHDFLR AINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTACLLNENHDFLRJAINTVRNDII  117



>ref|XP_007015974.1| Adaptor protein complex AP-2, alpha subunit isoform 1 [Theobroma 
cacao]
 ref|XP_007015975.1| Alpha-adaptin isoform 1 [Theobroma cacao]
 gb|EOY33593.1| Adaptor protein complex AP-2, alpha subunit isoform 1 [Theobroma 
cacao]
 gb|EOY33594.1| Alpha-adaptin isoform 1 [Theobroma cacao]
Length=1024

 Score =   243 bits (620),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 112/117 (96%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MA+ GMRGLSVFISDIRNCQNKEQERLRVDKELGN+RTRFKNEKGL+PYEKKKYVWKMLY
Sbjct  1    MAMHGMRGLSVFISDIRNCQNKEQERLRVDKELGNVRTRFKNEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>ref|XP_007015978.1| Alpha-adaptin isoform 5 [Theobroma cacao]
 gb|EOY33597.1| Alpha-adaptin isoform 5 [Theobroma cacao]
Length=997

 Score =   243 bits (619),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 112/117 (96%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MA+ GMRGLSVFISDIRNCQNKEQERLRVDKELGN+RTRFKNEKGL+PYEKKKYVWKMLY
Sbjct  1    MAMHGMRGLSVFISDIRNCQNKEQERLRVDKELGNVRTRFKNEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>ref|XP_006349071.1| PREDICTED: AP-2 complex subunit alpha-1-like isoform X1 [Solanum 
tuberosum]
Length=1019

 Score =   243 bits (619),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 113/117 (97%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISD+RNCQNKE ERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDVRNCQNKELERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI+
Sbjct  61   IHMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDIV  117



>gb|KDP34356.1| hypothetical protein JCGZ_11239 [Jatropha curcas]
Length=1021

 Score =   242 bits (618),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/117 (97%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNC NKEQERLRVDKELGNIRTRFK+EKGL+PYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCPNKEQERLRVDKELGNIRTRFKHEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>ref|XP_003540215.2| PREDICTED: AP-2 complex subunit alpha-1-like isoform X1 [Glycine 
max]
Length=1020

 Score =   242 bits (617),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/117 (97%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MA+SGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEK LTPYEKKKYVWKMLY
Sbjct  1    MAMSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKALTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTS LLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSSLLNENHDFLRLAINTVRNDII  117



>gb|KHN27686.1| AP-2 complex subunit alpha-2 [Glycine soja]
Length=1028

 Score =   242 bits (617),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/117 (97%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MA+SGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEK LTPYEKKKYVWKMLY
Sbjct  1    MAMSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKALTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTS LLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSSLLNENHDFLRLAINTVRNDII  117



>ref|XP_007150117.1| hypothetical protein PHAVU_005G128200g [Phaseolus vulgaris]
 ref|XP_007150118.1| hypothetical protein PHAVU_005G128200g [Phaseolus vulgaris]
 gb|ESW22111.1| hypothetical protein PHAVU_005G128200g [Phaseolus vulgaris]
 gb|ESW22112.1| hypothetical protein PHAVU_005G128200g [Phaseolus vulgaris]
Length=1020

 Score =   242 bits (617),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/117 (97%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MA+SGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEK LTPYEKKKYVWKMLY
Sbjct  1    MAMSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKALTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTS LLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSSLLNENHDFLRLAINTVRNDII  117



>ref|XP_003551082.1| PREDICTED: AP-2 complex subunit alpha-1-like isoform X1 [Glycine 
max]
 gb|KHN21467.1| AP-2 complex subunit alpha-2 [Glycine soja]
Length=1020

 Score =   242 bits (617),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/117 (97%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MA+SGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEK LTPYEKKKYVWKMLY
Sbjct  1    MAMSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKALTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTS LLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSSLLNENHDFLRLAINTVRNDII  117



>ref|XP_002312889.2| adaptin family protein [Populus trichocarpa]
 gb|EEE86844.2| adaptin family protein [Populus trichocarpa]
Length=1018

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/117 (97%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNC NKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCPNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTS LLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSSLLNENHDFLRLAINTVRNDII  117



>ref|XP_004487540.1| PREDICTED: AP-2 complex subunit alpha-1-like [Cicer arietinum]
Length=1024

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/117 (97%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MA+SGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEK LTPYEKKKYVWKMLY
Sbjct  1    MAMSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKALTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTS LLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSSLLNENHDFLRLAINTVRNDII  117



>gb|KEH38922.1| adaptor protein complex AP-2, alpha subunit [Medicago truncatula]
Length=1026

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/117 (97%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MA+SGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEK LTPYEKKKYVWKMLY
Sbjct  1    MAMSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKALTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTS LLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSSLLNENHDFLRLAINTVRNDII  117



>ref|XP_008796857.1| PREDICTED: AP-2 complex subunit alpha-1-like [Phoenix dactylifera]
Length=1022

 Score =   241 bits (615),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/117 (96%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGH EAVSLISAPKYPEKQVGYIVTSCLLNE+HDFLR+ INTVRNDII
Sbjct  61   IYMLGYDVDFGHTEAVSLISAPKYPEKQVGYIVTSCLLNESHDFLRMVINTVRNDII  117



>ref|XP_009402639.1| PREDICTED: AP-2 complex subunit alpha-1-like [Musa acuminata 
subsp. malaccensis]
Length=1025

 Score =   241 bits (614),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/117 (94%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISD+RNCQNKEQERLRVDKELGNIRTRFKNEKGL+PYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDVRNCQNKEQERLRVDKELGNIRTRFKNEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGH EAVSLISAPKYPEKQVGYIVTSCLLNENHDFLR+ INTVRNDI+
Sbjct  61   IYMLGYDVDFGHTEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRMVINTVRNDIV  117



>emb|CDY20343.1| BnaC01g23970D [Brassica napus]
Length=312

 Score =   228 bits (580),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            +SGMRGLSVFISDIRNCQNKE ERLRVDKELGNIRT FKN+KGLTPY+KKKYVWKMLYI 
Sbjct  1    MSGMRGLSVFISDIRNCQNKEAERLRVDKELGNIRTCFKNDKGLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAIN VRNDII
Sbjct  61   MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINAVRNDII  115



>gb|KJB35288.1| hypothetical protein B456_006G108500 [Gossypium raimondii]
Length=757

 Score =   238 bits (607),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/117 (93%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MA+ GMRGLSVFISDIRNCQNKEQER R+DKELGN+R RFKNEKGL+PYEKKKYVWKMLY
Sbjct  1    MAMHGMRGLSVFISDIRNCQNKEQERQRIDKELGNVRNRFKNEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>ref|XP_009622880.1| PREDICTED: AP-2 complex subunit alpha-1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=945

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/117 (95%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFIS+IRNCQNKEQERL VDKELG++RTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISNIRNCQNKEQERLCVDKELGSLRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI+
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDIV  117



>gb|KHG23077.1| AP-2 complex subunit alpha-2 -like protein [Gossypium arboreum]
Length=1019

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/117 (94%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MA+ GMRGLS+FISDIRNCQNKEQERLRVDKELGNIR RFK EKGLTPY+KKKYVWKMLY
Sbjct  1    MAMHGMRGLSIFISDIRNCQNKEQERLRVDKELGNIRNRFKKEKGLTPYDKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>ref|XP_008673054.1| PREDICTED: uncharacterized protein LOC100280063 isoform X1 [Zea 
mays]
Length=1046

 Score =   238 bits (607),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/117 (94%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNC NKEQERLRVDKELGNIRTRFKNEKGL+PYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCHNKEQERLRVDKELGNIRTRFKNEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHME VSLISAPKYPEKQVGYIVTSCLLNEN+DFLR+ INTVRNDII
Sbjct  61   IYMLGYDVDFGHMETVSLISAPKYPEKQVGYIVTSCLLNENNDFLRMVINTVRNDII  117



>ref|XP_004986017.1| PREDICTED: AP-2 complex subunit alpha-2-like isoform X2 [Setaria 
italica]
Length=1024

 Score =   238 bits (607),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/117 (94%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNC NKEQERLRVDKELGNIRTRFKNEKGL+PYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCHNKEQERLRVDKELGNIRTRFKNEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHME VSLISAPKYPEKQVGYIVTSCLLNEN+DFLR+ INTVRNDII
Sbjct  61   IYMLGYDVDFGHMETVSLISAPKYPEKQVGYIVTSCLLNENNDFLRMVINTVRNDII  117



>gb|KJB35291.1| hypothetical protein B456_006G108500 [Gossypium raimondii]
Length=928

 Score =   237 bits (605),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/117 (93%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MA+ GMRGLSVFISDIRNCQNKEQER R+DKELGN+R RFKNEKGL+PYEKKKYVWKMLY
Sbjct  1    MAMHGMRGLSVFISDIRNCQNKEQERQRIDKELGNVRNRFKNEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>ref|XP_006649257.1| PREDICTED: AP-2 complex subunit alpha-2-like [Oryza brachyantha]
Length=1040

 Score =   238 bits (607),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/117 (94%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNC NKEQERLRVDKELGNIRTRFKNEKGL+PYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCHNKEQERLRVDKELGNIRTRFKNEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHME VSLISAPKYPEKQVGYIVTSCLLNEN+DFLR+ INTVRNDII
Sbjct  61   IYMLGYDVDFGHMETVSLISAPKYPEKQVGYIVTSCLLNENNDFLRMVINTVRNDII  117



>ref|XP_002468657.1| hypothetical protein SORBIDRAFT_01g049780 [Sorghum bicolor]
 gb|EER95655.1| hypothetical protein SORBIDRAFT_01g049780 [Sorghum bicolor]
Length=1016

 Score =   238 bits (606),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/117 (94%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNC NKEQERLRVDKELGNIRTRFKNEKGL+PYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCHNKEQERLRVDKELGNIRTRFKNEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHME VSLISAPKYPEKQVGYIVTSCLLNEN+DFLR+ INTVRNDII
Sbjct  61   IYMLGYDVDFGHMETVSLISAPKYPEKQVGYIVTSCLLNENNDFLRMVINTVRNDII  117



>ref|XP_004986016.1| PREDICTED: AP-2 complex subunit alpha-2-like isoform X1 [Setaria 
italica]
Length=1043

 Score =   238 bits (606),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/117 (94%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNC NKEQERLRVDKELGNIRTRFKNEKGL+PYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCHNKEQERLRVDKELGNIRTRFKNEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHME VSLISAPKYPEKQVGYIVTSCLLNEN+DFLR+ INTVRNDII
Sbjct  61   IYMLGYDVDFGHMETVSLISAPKYPEKQVGYIVTSCLLNENNDFLRMVINTVRNDII  117



>gb|KHG21469.1| AP-2 complex subunit alpha-1 -like protein [Gossypium arboreum]
Length=1022

 Score =   238 bits (606),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/117 (93%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MA+ GMRGLSVFISDIRNCQNKEQER R+DKELGN+R RFKNEKGL+PYEKKKYVWKMLY
Sbjct  1    MAMHGMRGLSVFISDIRNCQNKEQERQRIDKELGNVRNRFKNEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>gb|KJB35290.1| hypothetical protein B456_006G108500 [Gossypium raimondii]
Length=1001

 Score =   238 bits (606),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/117 (93%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MA+ GMRGLSVFISDIRNCQNKEQER R+DKELGN+R RFKNEKGL+PYEKKKYVWKMLY
Sbjct  1    MAMHGMRGLSVFISDIRNCQNKEQERQRIDKELGNVRNRFKNEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>gb|KJB35287.1| hypothetical protein B456_006G108500 [Gossypium raimondii]
 gb|KJB35289.1| hypothetical protein B456_006G108500 [Gossypium raimondii]
Length=1022

 Score =   238 bits (606),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/117 (93%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MA+ GMRGLSVFISDIRNCQNKEQER R+DKELGN+R RFKNEKGL+PYEKKKYVWKMLY
Sbjct  1    MAMHGMRGLSVFISDIRNCQNKEQERQRIDKELGNVRNRFKNEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>ref|XP_009799205.1| PREDICTED: AP-2 complex subunit alpha-1-like isoform X2 [Nicotiana 
sylvestris]
Length=1022

 Score =   238 bits (606),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/117 (94%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFIS+IRNCQNKEQERL VDK+LG++RTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISNIRNCQNKEQERLCVDKQLGSLRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI+
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDIV  117



>gb|EEE58196.1| hypothetical protein OsJ_09142 [Oryza sativa Japonica Group]
Length=1006

 Score =   237 bits (605),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/117 (94%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNC NKEQERLRVDKELGNIRTRFKNEKGL+PYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCHNKEQERLRVDKELGNIRTRFKNEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHME VSLISAPKYPEKQVGYIVTSCLLNEN+DFLR+ INTVRNDII
Sbjct  61   IYMLGYDVDFGHMETVSLISAPKYPEKQVGYIVTSCLLNENNDFLRMVINTVRNDII  117



>gb|ABF93610.1| Adaptin N terminal region family protein, expressed [Oryza sativa 
Japonica Group]
Length=958

 Score =   237 bits (605),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/117 (94%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNC NKEQERLRVDKELGNIRTRFKNEKGL+PYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCHNKEQERLRVDKELGNIRTRFKNEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHME VSLISAPKYPEKQVGYIVTSCLLNEN+DFLR+ INTVRNDII
Sbjct  61   IYMLGYDVDFGHMETVSLISAPKYPEKQVGYIVTSCLLNENNDFLRMVINTVRNDII  117



>gb|ABF93611.1| Adaptin N terminal region family protein, expressed [Oryza sativa 
Japonica Group]
Length=887

 Score =   236 bits (603),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 110/117 (94%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNC NKEQERLRVDKELGNIRTRFKNEKGL+PYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCHNKEQERLRVDKELGNIRTRFKNEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHME VSLISAPKYPEKQVGYIVTSCLLNEN+DFLR+ INTVRNDII
Sbjct  61   IYMLGYDVDFGHMETVSLISAPKYPEKQVGYIVTSCLLNENNDFLRMVINTVRNDII  117



>gb|KJB21675.1| hypothetical protein B456_004G008000 [Gossypium raimondii]
Length=1019

 Score =   237 bits (605),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 109/117 (93%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MA+ GMRGLS+FISD+RNCQNKEQERLRVDKELGNIR RFK EKGLTPY+KKKYVWKMLY
Sbjct  1    MAMHGMRGLSIFISDMRNCQNKEQERLRVDKELGNIRNRFKKEKGLTPYDKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  117



>ref|XP_008658924.1| PREDICTED: uncharacterized protein LOC100384187 isoform X1 [Zea 
mays]
Length=1045

 Score =   237 bits (605),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 109/117 (93%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISD+RNC NKEQERLRVDKELGNIRTRFKNEKGL+PYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDVRNCHNKEQERLRVDKELGNIRTRFKNEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHME VSLISAPKYPEKQVGYIVTSCLLNEN+DFLR+ INTVRNDII
Sbjct  61   IYMLGYDVDFGHMETVSLISAPKYPEKQVGYIVTSCLLNENNDFLRMVINTVRNDII  117



>ref|XP_006384679.1| adaptin family protein [Populus trichocarpa]
 gb|ERP62476.1| adaptin family protein [Populus trichocarpa]
Length=1014

 Score =   236 bits (603),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/117 (97%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFK+EKGLT YEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKSEKGLTHYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTS LLNENHDFLRLAINTVRNDII
Sbjct  61   IHMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSSLLNENHDFLRLAINTVRNDII  117



>ref|XP_010689981.1| PREDICTED: AP-2 complex subunit alpha-1-like [Beta vulgaris subsp. 
vulgaris]
Length=1020

 Score =   236 bits (603),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/117 (94%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNCQNKEQER R+DKELGNIRT+FK+EKGL+PYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCQNKEQERSRIDKELGNIRTKFKHEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTS LLNENHDFLRLAINTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSSLLNENHDFLRLAINTVRNDII  117



>ref|XP_011005769.1| PREDICTED: AP-2 complex subunit alpha-1-like [Populus euphratica]
Length=1014

 Score =   236 bits (601),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/117 (96%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFK+EKGLT YEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKSEKGLTHYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTS LLNENHDFLRLAIN VRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSSLLNENHDFLRLAINAVRNDII  117



>ref|XP_010229321.1| PREDICTED: AP-2 complex subunit alpha-2-like [Brachypodium distachyon]
Length=1044

 Score =   236 bits (601),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/117 (94%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNC NKEQERLRVDKELGNIRTRFKNEKGL+PYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCHNKEQERLRVDKELGNIRTRFKNEKGLSPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I MLGYDVDFGHME VSLISAPKYPEKQVGYIVTSCLLNEN+DFLR+ INTVRNDII
Sbjct  61   IHMLGYDVDFGHMETVSLISAPKYPEKQVGYIVTSCLLNENNDFLRMVINTVRNDII  117



>ref|XP_006349072.1| PREDICTED: AP-2 complex subunit alpha-1-like isoform X2 [Solanum 
tuberosum]
Length=1019

 Score =   234 bits (597),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 110/117 (94%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFIS IRNCQNKE ERL VDKELGN+RTRFKN+KGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISSIRNCQNKELERLCVDKELGNLRTRFKNDKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI+
Sbjct  61   IHMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDIV  117



>ref|XP_010278258.1| PREDICTED: AP-2 complex subunit alpha-1-like isoform X1 [Nelumbo 
nucifera]
Length=1015

 Score =   234 bits (597),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 109/117 (93%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MA+SGMRGLSVFISDIRNCQNKEQERLRVDKELGNIR RFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MAMSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRNRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHME VSLISAPKY EKQVGYIVTSC+LNENHDFLRL IN VRNDII
Sbjct  61   IYMLGYDVDFGHMEVVSLISAPKYAEKQVGYIVTSCMLNENHDFLRLIINCVRNDII  117



>ref|XP_008791689.1| PREDICTED: AP-2 complex subunit alpha-2-like [Phoenix dactylifera]
Length=1022

 Score =   233 bits (593),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/117 (91%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MAL GMRGLSVFISD+RNCQNKEQERLR+DKELGNIRTRFKNEKGLTP EKKKYVWKMLY
Sbjct  1    MALLGMRGLSVFISDVRNCQNKEQERLRIDKELGNIRTRFKNEKGLTPNEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEA+SLISAPKYPEKQVGYIVTSCLLNE+H+FLR+ INTVRNDII
Sbjct  61   IYMLGYDVDFGHMEALSLISAPKYPEKQVGYIVTSCLLNESHEFLRMVINTVRNDII  117



>ref|XP_009400885.1| PREDICTED: AP-2 complex subunit alpha-1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1020

 Score =   232 bits (592),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/117 (91%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MAL+GMRGLSVFISD+RNCQNKEQERLRVDKELGNIRTRFKNEK LT Y+KKKYVWKMLY
Sbjct  1    MALTGMRGLSVFISDVRNCQNKEQERLRVDKELGNIRTRFKNEKALTHYKKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLL ENH+FLR+ INTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLTENHEFLRMVINTVRNDII  117



>ref|XP_009400884.1| PREDICTED: AP-2 complex subunit alpha-1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1025

 Score =   232 bits (592),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/117 (91%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MAL+GMRGLSVFISD+RNCQNKEQERLRVDKELGNIRTRFKNEK LT Y+KKKYVWKMLY
Sbjct  1    MALTGMRGLSVFISDVRNCQNKEQERLRVDKELGNIRTRFKNEKALTHYKKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLL ENH+FLR+ INTVRNDII
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLTENHEFLRMVINTVRNDII  117



>gb|EMS45713.1| AP-2 complex subunit alpha-1 [Triticum urartu]
Length=1010

 Score =   232 bits (592),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/117 (93%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNC NKEQERLRVDKELGNIRTRFKNEKGL+ YEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCHNKEQERLRVDKELGNIRTRFKNEKGLSHYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I MLGYDVDFGHME VSLISAPKYPEKQVGYIVTSCLLNEN+DFLR+ INTVRNDII
Sbjct  61   IHMLGYDVDFGHMETVSLISAPKYPEKQVGYIVTSCLLNENNDFLRMVINTVRNDII  117



>ref|XP_010456643.1| PREDICTED: AP-2 complex subunit alpha-2-like [Camelina sativa]
Length=861

 Score =   231 bits (589),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 109/115 (95%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            +SGMRGLSVFISDIRNCQNKE ERLRVDKELGNIRT FKNEK LTPY+KKKYVWKMLYI 
Sbjct  1    MSGMRGLSVFISDIRNCQNKEAERLRVDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  115



>ref|XP_010421069.1| PREDICTED: AP-2 complex subunit alpha-2-like isoform X1 [Camelina 
sativa]
Length=1013

 Score =   231 bits (588),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/115 (95%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            +SGMRGLSVFISDIRNCQNKE ERLRVDKELGNIRT FKNEK LTPY+KKKYVWKMLYI 
Sbjct  1    MSGMRGLSVFISDIRNCQNKEAERLRVDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  115



>ref|XP_010421070.1| PREDICTED: AP-2 complex subunit alpha-2-like isoform X2 [Camelina 
sativa]
Length=1008

 Score =   231 bits (588),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/115 (95%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            +SGMRGLSVFISDIRNCQNKE ERLRVDKELGNIRT FKNEK LTPY+KKKYVWKMLYI 
Sbjct  1    MSGMRGLSVFISDIRNCQNKEAERLRVDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  115



>ref|XP_010493371.1| PREDICTED: AP-2 complex subunit alpha-1 isoform X1 [Camelina 
sativa]
Length=1016

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/115 (95%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            +SGMRGLSVFISDIRNCQNKE ERLRVDKELGNIRT FKNEK LTPY+KKKYVWKMLYI 
Sbjct  1    MSGMRGLSVFISDIRNCQNKEAERLRVDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  115



>ref|XP_010493372.1| PREDICTED: AP-2 complex subunit alpha-2 isoform X2 [Camelina 
sativa]
Length=1011

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/115 (95%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            +SGMRGLSVFISDIRNCQNKE ERLRVDKELGNIRT FKNEK LTPY+KKKYVWKMLYI 
Sbjct  1    MSGMRGLSVFISDIRNCQNKEAERLRVDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  115



>ref|XP_009149701.1| PREDICTED: AP-2 complex subunit alpha-2-like [Brassica rapa]
Length=1014

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            +SGMRGLSVFISDIRNCQNKE ERLRVDKELGNIRT FKN+KGLTPY+KKKYVWKMLYI 
Sbjct  1    MSGMRGLSVFISDIRNCQNKEAERLRVDKELGNIRTCFKNDKGLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAIN VRNDII
Sbjct  61   MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINAVRNDII  115



>ref|XP_002977233.1| hypothetical protein SELMODRAFT_443442 [Selaginella moellendorffii]
 gb|EFJ21842.1| hypothetical protein SELMODRAFT_443442 [Selaginella moellendorffii]
Length=958

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISD+RNCQNKE ER RVDKEL NIRT+FKN+KGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDVRNCQNKELERARVDKELANIRTKFKNDKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            IFMLGYDVDFGHMEAVSLISAPKY EKQVGYIVTS LLNENHDFLRL INTVRNDII
Sbjct  61   IFMLGYDVDFGHMEAVSLISAPKYAEKQVGYIVTSSLLNENHDFLRLVINTVRNDII  117



>ref|XP_002965386.1| hypothetical protein SELMODRAFT_230624 [Selaginella moellendorffii]
 gb|EFJ34224.1| hypothetical protein SELMODRAFT_230624 [Selaginella moellendorffii]
Length=997

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISD+RNCQNKE ER RVDKEL NIRT+FKN+KGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDVRNCQNKELERARVDKELANIRTKFKNDKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            IFMLGYDVDFGHMEAVSLISAPKY EKQVGYIVTS LLNENHDFLRL INTVRNDII
Sbjct  61   IFMLGYDVDFGHMEAVSLISAPKYAEKQVGYIVTSSLLNENHDFLRLVINTVRNDII  117



>ref|XP_006289512.1| hypothetical protein CARUB_v10003049mg [Capsella rubella]
 gb|EOA22410.1| hypothetical protein CARUB_v10003049mg [Capsella rubella]
Length=1015

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            ++GMRGLSVFISDIRNCQNKE ERLRVDKELGNIRT FKNEK LTPY+KKKYVWKMLYI 
Sbjct  1    MTGMRGLSVFISDIRNCQNKEAERLRVDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  115



>emb|CDY29719.1| BnaAnng03410D [Brassica napus]
Length=981

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            +SGMRGLSVFISDIRNCQNKE ERLRVDKELGNIRT FKN+KGLTPY+KKKYVWKMLYI 
Sbjct  1    MSGMRGLSVFISDIRNCQNKEAERLRVDKELGNIRTCFKNDKGLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAIN VRNDII
Sbjct  61   MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINAVRNDII  115



>ref|XP_006400781.1| hypothetical protein EUTSA_v10012556mg [Eutrema salsugineum]
 gb|ESQ42234.1| hypothetical protein EUTSA_v10012556mg [Eutrema salsugineum]
Length=1012

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            ++GMRGLSVFISDIRNCQNKE ERLRVDKELGNIRT FKNEK LTPY+KKKYVWKMLYI 
Sbjct  1    MTGMRGLSVFISDIRNCQNKEAERLRVDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  115



>ref|XP_006400780.1| hypothetical protein EUTSA_v10012556mg [Eutrema salsugineum]
 gb|ESQ42233.1| hypothetical protein EUTSA_v10012556mg [Eutrema salsugineum]
Length=1011

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            ++GMRGLSVFISDIRNCQNKE ERLRVDKELGNIRT FKNEK LTPY+KKKYVWKMLYI 
Sbjct  1    MTGMRGLSVFISDIRNCQNKEAERLRVDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  115



>gb|KFK39913.1| hypothetical protein AALP_AA3G305400 [Arabis alpina]
Length=1015

 Score =   229 bits (584),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            ++GMRGLSVFISDIRNCQNKE ERLRVDKELGN+RT FKNEK LTPY+KKKYVWKMLYI 
Sbjct  1    MTGMRGLSVFISDIRNCQNKEAERLRVDKELGNVRTCFKNEKVLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII
Sbjct  61   MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  115



>emb|CDX92339.1| BnaA10g13780D [Brassica napus]
Length=1007

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            ++GMRGLSVFISDIRNCQNKE ERLRVDKELGNIRT FKNEK LTPY+KKKYVWKMLYI 
Sbjct  1    MTGMRGLSVFISDIRNCQNKEAERLRVDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFL+LAINTVRNDII
Sbjct  61   MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLKLAINTVRNDII  115



>ref|XP_009120644.1| PREDICTED: AP-2 complex subunit alpha-1 isoform X1 [Brassica 
rapa]
Length=1008

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            ++GMRGLSVFISDIRNCQNKE ERLRVDKELGNIRT FKNEK LTPY+KKKYVWKMLYI 
Sbjct  1    MTGMRGLSVFISDIRNCQNKEAERLRVDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFL+LAINTVRNDII
Sbjct  61   MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLKLAINTVRNDII  115



>emb|CDY26951.1| BnaC09g36320D [Brassica napus]
Length=1008

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            ++GMRGLSVFISDIRNCQNKE ERLRVDKELGNIRT FKNEK LTPY+KKKYVWKMLYI 
Sbjct  1    MTGMRGLSVFISDIRNCQNKEAERLRVDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFL+LAINTVRNDII
Sbjct  61   MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLKLAINTVRNDII  115



>ref|XP_009120645.1| PREDICTED: AP-2 complex subunit alpha-1 isoform X2 [Brassica 
rapa]
Length=1007

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            ++GMRGLSVFISDIRNCQNKE ERLRVDKELGNIRT FKNEK LTPY+KKKYVWKMLYI 
Sbjct  1    MTGMRGLSVFISDIRNCQNKEAERLRVDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFL+LAINTVRNDII
Sbjct  61   MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLKLAINTVRNDII  115



>dbj|BAH57126.1| AT5G22770 [Arabidopsis thaliana]
Length=932

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            ++GMRGLSVFISD+RNCQNKE ERLRVDKELGNIRT FKNEK LTPY+KKKYVWKMLYI 
Sbjct  1    MTGMRGLSVFISDVRNCQNKEAERLRVDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFL+LAINTVRNDII
Sbjct  61   MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLKLAINTVRNDII  115



>ref|NP_197670.1| AP-2 complex subunit alpha-2 [Arabidopsis thaliana]
 sp|Q8LPK4.1|AP2A2_ARATH RecName: Full=AP-2 complex subunit alpha-2; AltName: Full=Adaptor 
protein complex AP-2 subunit alpha-2; AltName: Full=Adaptor-related 
protein complex 2 subunit alpha-2; AltName: Full=Alpha-adaptin 
2; AltName: Full=Clathrin assembly protein complex 
2 alpha-C large chain; Short=At-aC-Ad; Short=At-alphaC-Ad 
[Arabidopsis thaliana]
 gb|AAM20497.1| alpha-adaptin C-like protein [Arabidopsis thaliana]
 gb|AED93075.1| AP-2 complex subunit alpha-2 [Arabidopsis thaliana]
Length=1013

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            ++GMRGLSVFISD+RNCQNKE ERLRVDKELGNIRT FKNEK LTPY+KKKYVWKMLYI 
Sbjct  1    MTGMRGLSVFISDVRNCQNKEAERLRVDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFL+LAINTVRNDII
Sbjct  61   MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLKLAINTVRNDII  115



>ref|NP_197669.1| alpha-adaptin [Arabidopsis thaliana]
 ref|NP_851057.1| alpha-adaptin [Arabidopsis thaliana]
 ref|NP_851058.1| alpha-adaptin [Arabidopsis thaliana]
 sp|Q8LPL6.1|AP2A1_ARATH RecName: Full=AP-2 complex subunit alpha-1; AltName: Full=Adaptor 
protein complex AP-2 subunit alpha-1; AltName: Full=Adaptor-related 
protein complex 2 subunit alpha-1; AltName: Full=Alpha-adaptin 
1; AltName: Full=Clathrin assembly protein complex 
2 alpha large chain 1; Short=At-a-Ad; Short=At-alpha-Ad 
[Arabidopsis thaliana]
 gb|AAM20420.1| alpha-adaptin [Arabidopsis thaliana]
 gb|AED93072.1| alpha-adaptin [Arabidopsis thaliana]
 gb|AED93073.1| alpha-adaptin [Arabidopsis thaliana]
 gb|AED93074.1| alpha-adaptin [Arabidopsis thaliana]
Length=1012

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            ++GMRGLSVFISD+RNCQNKE ERLRVDKELGNIRT FKNEK LTPY+KKKYVWKMLYI 
Sbjct  1    MTGMRGLSVFISDVRNCQNKEAERLRVDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFL+LAINTVRNDII
Sbjct  61   MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLKLAINTVRNDII  115



>dbj|BAB11683.1| alpha-adaptin [Arabidopsis thaliana]
Length=1016

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            ++GMRGLSVFISD+RNCQNKE ERLRVDKELGNIRT FKNEK LTPY+KKKYVWKMLYI 
Sbjct  1    MTGMRGLSVFISDVRNCQNKEAERLRVDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFL+LAINTVRNDII
Sbjct  61   MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLKLAINTVRNDII  115



>dbj|BAB10137.1| alpha-adaptin C homolog [Arabidopsis thaliana]
Length=1037

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            ++GMRGLSVFISD+RNCQNKE ERLRVDKELGNIRT FKNEK LTPY+KKKYVWKMLYI 
Sbjct  1    MTGMRGLSVFISDVRNCQNKEAERLRVDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFL+LAINTVRNDII
Sbjct  61   MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLKLAINTVRNDII  115



>dbj|BAH56772.1| AT5G22770 [Arabidopsis thaliana]
Length=1013

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            ++GMRGLSVFISD+RNCQNKE ERLRVDKELGNIRT FKNEK LTPY+KKKYVWKMLYI 
Sbjct  1    MTGMRGLSVFISDVRNCQNKEAERLRVDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFL+LAINTVRNDII
Sbjct  61   MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLKLAINTVRNDII  115



>ref|XP_002874085.1| hypothetical protein ARALYDRAFT_489126 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50344.1| hypothetical protein ARALYDRAFT_489126 [Arabidopsis lyrata subsp. 
lyrata]
Length=1016

 Score =   227 bits (578),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            ++GMRGLSVFISD+RNCQNKE ERLRVDKELGNIRT FKN+K LTPY+KKKYVWKMLYI 
Sbjct  1    MTGMRGLSVFISDVRNCQNKEAERLRVDKELGNIRTCFKNDKVLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFL+LAINTVRNDII
Sbjct  61   MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLKLAINTVRNDII  115



>ref|XP_001785715.1| predicted protein [Physcomitrella patens]
 gb|EDQ49474.1| predicted protein [Physcomitrella patens]
Length=1055

 Score =   227 bits (578),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLS FISD+RNCQNKE ER RVDKEL NIRTRFKN+KGLT YEKKKYVWKMLY
Sbjct  1    MALSGMRGLSTFISDVRNCQNKEAERSRVDKELANIRTRFKNDKGLTVYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYD+DFGHME VSLISAPKYPEKQVGYIVTSCLLNENHDFL+L INTVRNDII
Sbjct  61   IYMLGYDMDFGHMETVSLISAPKYPEKQVGYIVTSCLLNENHDFLKLVINTVRNDII  117



>ref|XP_001774103.1| predicted protein [Physcomitrella patens]
 gb|EDQ61155.1| predicted protein [Physcomitrella patens]
Length=1009

 Score =   226 bits (577),  Expect = 5e-65, Method: Composition-based stats.
 Identities = 101/117 (86%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISD+RNCQNKEQER+RVDKEL NIRTRFKNE+GL+ YEKKKYVWK+LY
Sbjct  1    MALSGMRGLSVFISDVRNCQNKEQERVRVDKELANIRTRFKNERGLSVYEKKKYVWKILY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I+MLGYDVDFGHME ++LISAPKY EKQVGYIVTSCLLNENH+FL+L INTVRNDI+
Sbjct  61   IYMLGYDVDFGHMETMALISAPKYAEKQVGYIVTSCLLNENHNFLQLVINTVRNDIV  117



>ref|XP_010493370.1| PREDICTED: AP-2 complex subunit alpha-2-like [Camelina sativa]
Length=1014

 Score =   226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            ++GMRGLSVFISDIRNCQNKE ERLRVDKELGNIRT FKNEK LTPY+KKKYVWKMLYI 
Sbjct  1    MTGMRGLSVFISDIRNCQNKEAERLRVDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNEN+DFL+LAINTVRNDII
Sbjct  61   MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENNDFLKLAINTVRNDII  115



>ref|XP_010454540.1| PREDICTED: AP-2 complex subunit alpha-2-like [Camelina sativa]
Length=1014

 Score =   225 bits (574),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            ++GMRGLSVFISDIRNCQNKE ERLRVDKELGNIRT FKNEK LTPY+KKKYVWKMLYI 
Sbjct  1    MTGMRGLSVFISDIRNCQNKEAERLRVDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNEN+DFL+LAINTVRNDII
Sbjct  61   MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENNDFLKLAINTVRNDII  115



>ref|XP_010541300.1| PREDICTED: AP-2 complex subunit alpha-2-like isoform X1 [Tarenaya 
hassleriana]
Length=1011

 Score =   225 bits (574),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            ++G+RGLSVFISDIRNCQNKEQERLRVDKELGNIRT FKNEK LTPY+KKKYVWKMLYI+
Sbjct  1    MTGIRGLSVFISDIRNCQNKEQERLRVDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIY  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            +LGYDVDFGHME VSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAIN VRNDII
Sbjct  61   VLGYDVDFGHMEPVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINMVRNDII  115



>ref|XP_010541302.1| PREDICTED: AP-2 complex subunit alpha-2-like isoform X3 [Tarenaya 
hassleriana]
Length=855

 Score =   224 bits (572),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            ++G+RGLSVFISDIRNCQNKEQERLRVDKELGNIRT FKNEK LTPY+KKKYVWKMLYI+
Sbjct  1    MTGIRGLSVFISDIRNCQNKEQERLRVDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIY  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            +LGYDVDFGHME VSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAIN VRNDII
Sbjct  61   VLGYDVDFGHMEPVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINMVRNDII  115



>ref|XP_010421071.1| PREDICTED: AP-2 complex subunit alpha-2-like [Camelina sativa]
Length=1014

 Score =   225 bits (574),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            ++GMRGLSVFISDIRNCQNKE ERLRVDKELGNIRT FKNEK LTPY+KKKYVWKMLYI 
Sbjct  1    MTGMRGLSVFISDIRNCQNKEAERLRVDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNEN+DFL+LAINTVRNDII
Sbjct  61   MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENNDFLKLAINTVRNDII  115



>ref|XP_010541301.1| PREDICTED: AP-2 complex subunit alpha-2-like isoform X2 [Tarenaya 
hassleriana]
Length=1010

 Score =   225 bits (574),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            ++G+RGLSVFISDIRNCQNKEQERLRVDKELGNIRT FKNEK LTPY+KKKYVWKMLYI+
Sbjct  1    MTGIRGLSVFISDIRNCQNKEQERLRVDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIY  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            +LGYDVDFGHME VSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAIN VRNDII
Sbjct  61   VLGYDVDFGHMEPVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINMVRNDII  115



>ref|XP_010535654.1| PREDICTED: AP-2 complex subunit alpha-2-like isoform X3 [Tarenaya 
hassleriana]
Length=1015

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            ++GMRGLSVFISDIRNCQNKE ERLR+DKELGNIRT FKNEK LTPY+KKKYVWKMLYI 
Sbjct  1    MTGMRGLSVFISDIRNCQNKELERLRIDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            +LGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNEN+DFLRLAINTVRNDII
Sbjct  61   LLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENNDFLRLAINTVRNDII  115



>ref|XP_010535655.1| PREDICTED: AP-2 complex subunit alpha-2-like isoform X4 [Tarenaya 
hassleriana]
Length=1014

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            ++GMRGLSVFISDIRNCQNKE ERLR+DKELGNIRT FKNEK LTPY+KKKYVWKMLYI 
Sbjct  1    MTGMRGLSVFISDIRNCQNKELERLRIDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            +LGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNEN+DFLRLAINTVRNDII
Sbjct  61   LLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENNDFLRLAINTVRNDII  115



>ref|XP_010535652.1| PREDICTED: AP-2 complex subunit alpha-2-like isoform X1 [Tarenaya 
hassleriana]
Length=1016

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            ++GMRGLSVFISDIRNCQNKE ERLR+DKELGNIRT FKNEK LTPY+KKKYVWKMLYI 
Sbjct  1    MTGMRGLSVFISDIRNCQNKELERLRIDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            +LGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNEN+DFLRLAINTVRNDII
Sbjct  61   LLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENNDFLRLAINTVRNDII  115



>ref|XP_010535653.1| PREDICTED: AP-2 complex subunit alpha-2-like isoform X2 [Tarenaya 
hassleriana]
Length=1015

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            ++GMRGLSVFISDIRNCQNKE ERLR+DKELGNIRT FKNEK LTPY+KKKYVWKMLYI 
Sbjct  1    MTGMRGLSVFISDIRNCQNKELERLRIDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            +LGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNEN+DFLRLAINTVRNDII
Sbjct  61   LLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENNDFLRLAINTVRNDII  115



>ref|XP_001757190.1| predicted protein [Physcomitrella patens]
 gb|EDQ78049.1| predicted protein [Physcomitrella patens]
Length=1017

 Score =   224 bits (570),  Expect = 4e-64, Method: Composition-based stats.
 Identities = 101/112 (90%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = +2

Query  287  MRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFMLG  466
            MRGLSVFISD+RNCQNKEQER+RVDKEL NIRTRFKNE+GL+ YEKKKYVWKMLYI+MLG
Sbjct  1    MRGLSVFISDVRNCQNKEQERVRVDKELANIRTRFKNERGLSVYEKKKYVWKMLYIYMLG  60

Query  467  YDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            YDVDFGHME V LISAPKY EKQVGYIVTSCLLNENHDFLRL INTVRNDII
Sbjct  61   YDVDFGHMETVQLISAPKYAEKQVGYIVTSCLLNENHDFLRLVINTVRNDII  112



>ref|XP_010520400.1| PREDICTED: AP-2 complex subunit alpha-2 isoform X2 [Tarenaya 
hassleriana]
Length=1011

 Score =   224 bits (570),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            ++GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRT FKNEK LTPY+KKKYVWKMLYI 
Sbjct  1    MTGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            MLGYDVDFGH+EAVSL+SAPKYPEKQVGYIVTSCLLNEN+DFLRLAIN VRNDII
Sbjct  61   MLGYDVDFGHVEAVSLLSAPKYPEKQVGYIVTSCLLNENNDFLRLAINMVRNDII  115



>ref|XP_010520399.1| PREDICTED: AP-2 complex subunit alpha-1 isoform X1 [Tarenaya 
hassleriana]
Length=1012

 Score =   224 bits (570),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            ++GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRT FKNEK LTPY+KKKYVWKMLYI 
Sbjct  1    MTGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIH  60

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            MLGYDVDFGH+EAVSL+SAPKYPEKQVGYIVTSCLLNEN+DFLRLAIN VRNDII
Sbjct  61   MLGYDVDFGHVEAVSLLSAPKYPEKQVGYIVTSCLLNENNDFLRLAINMVRNDII  115



>gb|EMT20136.1| hypothetical protein F775_52366 [Aegilops tauschii]
Length=1019

 Score =   218 bits (555),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 112/142 (79%), Gaps = 25/142 (18%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEK----------------  403
            MALSGMRGLSVFISDIRNC NKEQERLRVDKELGNIRTRFKNEK                
Sbjct  1    MALSGMRGLSVFISDIRNCHNKEQERLRVDKELGNIRTRFKNEKLALSDFVGFCLVCGAK  60

Query  404  ---------GLTPYEKKKYVWKMLYIFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTS  556
                     GL+ YEKKKYVWKMLYI MLGYDVDFGHME VSLISAPKYPEKQVGYIVTS
Sbjct  61   FRCKCETVLGLSHYEKKKYVWKMLYIHMLGYDVDFGHMETVSLISAPKYPEKQVGYIVTS  120

Query  557  CLLNENHDFLRLAINTVRNDII  622
            CLLNEN+DFLR+ INTVRNDII
Sbjct  121  CLLNENNDFLRMVINTVRNDII  142



>ref|XP_010100166.1| AP-2 complex subunit alpha-2 [Morus notabilis]
 gb|EXB81617.1| AP-2 complex subunit alpha-2 [Morus notabilis]
Length=1070

 Score =   216 bits (549),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 115/168 (68%), Gaps = 51/168 (30%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEK----------------  403
            MALSGMRGLSVFISDIRNC NKEQERLRVDKELGN+RTRFKNEK                
Sbjct  1    MALSGMRGLSVFISDIRNCPNKEQERLRVDKELGNVRTRFKNEKLPNQFRENSHSPFLPP  60

Query  404  -----------------------------------GLTPYEKKKYVWKMLYIFMLGYDVD  478
                                               GLT YEKKKYVWKMLYI+MLGYDVD
Sbjct  61   LVIFLIAVWIVVFLLLSCHLLHAIDELPYLVEKELGLTHYEKKKYVWKMLYIYMLGYDVD  120

Query  479  FGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            FGHMEAVSLISAPKYPEKQVGYIVT+CLLNENHDFLRLAINTVRNDII
Sbjct  121  FGHMEAVSLISAPKYPEKQVGYIVTACLLNENHDFLRLAINTVRNDII  168



>tpg|DAA42890.1| TPA: hypothetical protein ZEAMMB73_876815 [Zea mays]
Length=1107

 Score =   214 bits (544),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 114/169 (67%), Gaps = 52/169 (31%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEK----------------  403
            MALSGMRGLSVFISDIRNC NKEQERLRVDKELGNIRTRFKNEK                
Sbjct  1    MALSGMRGLSVFISDIRNCHNKEQERLRVDKELGNIRTRFKNEKSCVRGMSAMGLRLQSS  60

Query  404  ------------------------------------GLTPYEKKKYVWKMLYIFMLGYDV  475
                                                GL+PYEKKKYVWKMLYI+MLGYDV
Sbjct  61   VSAEPSMETCGASVAELKSETASWTDGRWGELDRKQGLSPYEKKKYVWKMLYIYMLGYDV  120

Query  476  DFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            DFGHME VSLISAPKYPEKQVGYIVTSCLLNEN+DFLR+ INTVRNDII
Sbjct  121  DFGHMETVSLISAPKYPEKQVGYIVTSCLLNENNDFLRMVINTVRNDII  169



>dbj|BAF36329.1| hypothetical protein [Ipomoea trifida]
Length=241

 Score =   189 bits (480),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGN+RTRFKNEKGLTPYEKKKYVWKMLY
Sbjct  1    MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNVRTRFKNEKGLTPYEKKKYVWKMLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYI  547
            I+MLGYDVDFGHMEAVSLISAPKYPEKQVG I
Sbjct  61   IYMLGYDVDFGHMEAVSLISAPKYPEKQVGNI  92



>ref|XP_003060967.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54617.1| predicted protein [Micromonas pusilla CCMP1545]
Length=1107

 Score =   173 bits (438),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 78/116 (67%), Positives = 97/116 (84%), Gaps = 1/116 (1%)
 Frame = +2

Query  275  ALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYI  454
             ++G+RGL++FI D+RN ++KE E  RV+KEL NIR++FKN KGL+ YEKKKYVWK+LYI
Sbjct  14   GVAGLRGLNIFIQDVRNSKSKEAELERVEKELANIRSKFKN-KGLSSYEKKKYVWKLLYI  72

Query  455  FMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            FMLGY+VDFGHM+ + LISA K+ EKQVGY  TS LLNE H+FLRL IN+VR DII
Sbjct  73   FMLGYEVDFGHMQVIGLISATKFAEKQVGYTATSVLLNETHEFLRLVINSVREDII  128



>emb|CEG00199.1| Clathrin alpha-adaptin/coatomer adaptor,appendage, C-terminal 
subdomain [Ostreococcus tauri]
Length=1039

 Score =   171 bits (433),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 97/116 (84%), Gaps = 1/116 (1%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRF-KNEKGLTPYEKKKYVWKMLYI  454
            L GMRGL+VF+ D+RNC NKEQERLRV+KEL NIR +F K  + LTPYE+KKYV K+LY+
Sbjct  5    LGGMRGLTVFVQDVRNCANKEQERLRVEKELANIRRKFNKTHRALTPYERKKYVLKLLYV  64

Query  455  FMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            +MLGY+VDFGH EA+ LISA  Y EKQVGY+ TS +LNE ++FLR+AIN+VR D+I
Sbjct  65   YMLGYNVDFGHTEALKLISASTYGEKQVGYMTTSVILNERNEFLRMAINSVRRDVI  120



>ref|XP_001422806.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABP01165.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=979

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 95/116 (82%), Gaps = 1/116 (1%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRF-KNEKGLTPYEKKKYVWKMLYI  454
            L GMRGL+VF+ D+RNC NKEQER RV+KEL NIR +F K  + LT YE+KKYV K+LYI
Sbjct  5    LGGMRGLTVFVQDVRNCSNKEQERARVEKELANIRRKFNKTHRALTAYERKKYVLKLLYI  64

Query  455  FMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            +MLGY+VDFGH EA+ LISA  Y EKQVGY+ TS +LNE ++FLR+AIN++R D+I
Sbjct  65   YMLGYNVDFGHTEALKLISASSYAEKQVGYMTTSVILNERNEFLRMAINSIRTDVI  120



>ref|XP_001421149.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO99442.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=971

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 94/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRF-KNEKGLTPYEKKKYVWKMLYIFM  460
            GMRGL+VF+ D+RNC NKEQER RV+KEL NIR +F K  + LT YE+KKYV K+LYI+M
Sbjct  1    GMRGLTVFVQDVRNCSNKEQERARVEKELANIRRKFNKTHRALTAYERKKYVLKLLYIYM  60

Query  461  LGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            LGY+VDFGH EA+ LISA  Y EKQVGY+ TS +LNE ++FLR+AIN++R D+I
Sbjct  61   LGYNVDFGHTEALKLISASSYAEKQVGYMTTSVILNERNEFLRMAINSIRTDVI  114



>ref|XP_005650803.1| Adaptor protein complex AP-2 alpha subunit [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26259.1| Adaptor protein complex AP-2 alpha subunit [Coccomyxa subellipsoidea 
C-169]
Length=1023

 Score =   164 bits (415),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  LSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIF  457
            L  MRGL VFI+DIRNCQ+KEQE+ RVDKELG IR +F +   +T Y++KKYVWK+LYIF
Sbjct  4    LVNMRGLQVFIADIRNCQSKEQEKTRVDKELGKIRKKFASGNAITEYDRKKYVWKLLYIF  63

Query  458  MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            MLGY+V+FGH +A  LI A KY EKQVGY+  + LLNE  +FLRL IN+VRND+I
Sbjct  64   MLGYEVEFGHKQAADLIPATKYAEKQVGYMACAILLNEKDEFLRLIINSVRNDLI  118



>gb|ABF57312.1| adaptor-related protein complex 2, short form [Bos taurus]
Length=158

 Score =   151 bits (381),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_002736877.1| PREDICTED: AP-2 complex subunit alpha-like, partial [Saccoglossus 
kowalevskii]
Length=291

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L++EN D ++L I  ++ND+I
Sbjct  68   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVSENSDLMKLIIQNIKNDLI  120



>ref|XP_002979139.1| hypothetical protein SELMODRAFT_233268 [Selaginella moellendorffii]
 gb|EFJ19547.1| hypothetical protein SELMODRAFT_233268 [Selaginella moellendorffii]
Length=861

 Score =   158 bits (399),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  MALSGMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLY  451
            MA++ MRGL +FI+D+RNCQ+K+QE  RV+KEL  IR +F  EK L+ YEKKKYVWK+LY
Sbjct  1    MAMASMRGLQMFITDVRNCQSKDQEMARVEKELNKIRMKFSYEKSLSSYEKKKYVWKLLY  60

Query  452  IFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            I +LGY +DFGH E +SL+ + KY EKQVGY+V  CLL+ENH+FL L    +R DII
Sbjct  61   IHILGYQLDFGHREVLSLVGSHKYAEKQVGYMVAGCLLHENHEFLNLITKAIRLDII  117



>gb|KIZ06051.1| AP-2 complex subunit alpha [Monoraphidium neglectum]
Length=318

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = +2

Query  287  MRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEK-GLTPYEKKKYVWKMLYIFML  463
            +RGL +FISDIR CQN+E E  RVDKEL  IR +F +EK  LT Y++KKYVWK+LYI+ML
Sbjct  57   IRGLQMFISDIRACQNRESEARRVDKELAKIRAKFGDEKKALTAYDRKKYVWKLLYIYML  116

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            GYDV+FGH +A  LI A KY EKQVGY+  S L+NE  +FLRL+IN + +D+I
Sbjct  117  GYDVEFGHKQACDLIPAAKYSEKQVGYMACSILMNEKDEFLRLSINAIHSDLI  169



>gb|EPS69642.1| hypothetical protein M569_05122, partial [Genlisea aurea]
Length=726

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/72 (99%), Positives = 72/72 (100%), Gaps = 0/72 (0%)
 Frame = +2

Query  407  LTPYEKKKYVWKMLYIFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFL  586
            LTPYEKKKYVWKMLYI+MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFL
Sbjct  1    LTPYEKKKYVWKMLYIYMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFL  60

Query  587  RLAINTVRNDII  622
            RLAINTVRNDII
Sbjct  61   RLAINTVRNDII  72



>ref|XP_005840878.1| Adaptor protein complex 2 subunit alpha 1 [Guillardia theta CCMP2712]
 gb|EKX53898.1| Adaptor protein complex 2 subunit alpha 1 [Guillardia theta CCMP2712]
Length=966

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
             MRGL+ FI DIRNC NKE+ER RVDKE+ NIR  FK    LT Y+KKKYVWKMLYI++L
Sbjct  2    AMRGLTQFIGDIRNCANKEEERKRVDKEMANIRKHFKEATKLTAYQKKKYVWKMLYIYVL  61

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            GY+VDFGHMEA++LI+A  Y EK VGY+    LL+E ++FLRL IN+V+ND++
Sbjct  62   GYEVDFGHMEALNLITAQGYSEKMVGYLACVLLLSETNEFLRLIINSVKNDLM  114



>ref|XP_001690919.1| alpha-adaptin [Chlamydomonas reinhardtii]
 gb|EDP05365.1| alpha-adaptin [Chlamydomonas reinhardtii]
Length=953

 Score =   157 bits (397),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 68/111 (61%), Positives = 87/111 (78%), Gaps = 0/111 (0%)
 Frame = +2

Query  287  MRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFMLG  466
            MRGL VFISDIR CQNKEQE+ RV+KEL  IR +F  +K L+ Y+++KY+WK+LYI+MLG
Sbjct  7    MRGLQVFISDIRACQNKEQEQRRVEKELAKIRAKFGEDKSLSGYDRRKYIWKLLYIYMLG  66

Query  467  YDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            +D+DFGH +A  LI  PKY +KQVGY+  S LL EN +FLRLAIN +  D+
Sbjct  67   FDIDFGHKQACDLIPMPKYSDKQVGYMACSLLLQENDEFLRLAINAIHLDL  117



>emb|CDQ77671.1| unnamed protein product [Oncorhynchus mykiss]
Length=322

 Score =   150 bits (379),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_008252165.1| PREDICTED: AP-2 complex subunit alpha-2-like, partial [Oryctolagus 
cuniculus]
Length=288

 Score =   149 bits (376),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ +Y EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNRYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_002502851.1| alpha-adaptin protein [Micromonas sp. RCC299]
 gb|ACO64109.1| alpha-adaptin protein [Micromonas sp. RCC299]
Length=1016

 Score =   156 bits (394),  Expect = 7e-40, Method: Composition-based stats.
 Identities = 72/113 (64%), Positives = 91/113 (81%), Gaps = 1/113 (1%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFI DIRN  +KE E+ RVDKEL NIR +F+N   L+ Y+KKKYV K+LY++ML
Sbjct  18   GMRGLNVFIQDIRNAPSKEHEQKRVDKELANIRKKFRNTD-LSSYDKKKYVLKLLYMYML  76

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            GYD++FGH   VSLI+A K+ EKQVGY  T+ LLNE+H+FLR+ IN+VR DII
Sbjct  77   GYDIEFGHTMVVSLINATKFEEKQVGYTATAVLLNESHEFLRMVINSVREDII  129



>dbj|BAG50999.1| unnamed protein product [Homo sapiens]
Length=353

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ +Y EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNRYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_003745666.1| PREDICTED: AP-2 complex subunit alpha-like [Metaseiulus occidentalis]
Length=929

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            G+RGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GIRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S LL+EN+D +RL I +V+ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLLDENNDLMRLIIQSVKNDL  119



>ref|XP_006802381.1| PREDICTED: AP-2 complex subunit alpha-2-like [Neolamprologus 
brichardi]
Length=759

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSDLIRLINNAIKNDL  120



>pdb|4NEE|G Chain G, Crystal Structure Of Ap-2 Alpha/simga2 Complex Bound 
To Hiv-1 Nef
 pdb|4NEE|B Chain B, Crystal Structure Of Ap-2 Alpha/simga2 Complex Bound 
To Hiv-1 Nef
 pdb|4NEE|J Chain J, Crystal Structure Of Ap-2 Alpha/simga2 Complex Bound 
To Hiv-1 Nef
 pdb|4NEE|A Chain A, Crystal Structure Of Ap-2 Alpha/simga2 Complex Bound 
To Hiv-1 Nef
Length=398

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  11   GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  70

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ +Y EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  71   GHDIDFGHMEAVNLLSSNRYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  122



>ref|XP_008111809.1| PREDICTED: AP-2 complex subunit alpha-1 isoform X3 [Anolis carolinensis]
Length=1012

 Score =   154 bits (389),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 102/143 (71%), Gaps = 2/143 (1%)
 Frame = +2

Query  197  LCGNV-GSRRNWEPPLSWIGSER-PGEMALSGMRGLSVFISDIRNCQNKEQERLRVDKEL  370
            L G V G+ RN   P S   +   P      GMRGL+VFISDIRNC++KE E  R++KEL
Sbjct  10   LLGQVSGAERNGASPGSRSSTATMPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKEL  69

Query  371  GNIRTRFKNEKGLTPYEKKKYVWKMLYIFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIV  550
             NIR++FK +K L  Y KKKYV K+L+IF+LG+D+DFGHMEAV+L+S+ KY EKQ+GY+ 
Sbjct  70   ANIRSKFKGDKALDGYSKKKYVCKLLFIFLLGHDIDFGHMEAVNLLSSNKYTEKQIGYLF  129

Query  551  TSCLLNENHDFLRLAINTVRNDI  619
             S L+N N + +RL  N ++ND+
Sbjct  130  ISVLVNSNSELIRLINNAIKNDL  152



>ref|XP_008111810.1| PREDICTED: AP-2 complex subunit alpha-1 isoform X6 [Anolis carolinensis]
Length=966

 Score =   154 bits (389),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 102/143 (71%), Gaps = 2/143 (1%)
 Frame = +2

Query  197  LCGNV-GSRRNWEPPLSWIGSER-PGEMALSGMRGLSVFISDIRNCQNKEQERLRVDKEL  370
            L G V G+ RN   P S   +   P      GMRGL+VFISDIRNC++KE E  R++KEL
Sbjct  10   LLGQVSGAERNGASPGSRSSTATMPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKEL  69

Query  371  GNIRTRFKNEKGLTPYEKKKYVWKMLYIFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIV  550
             NIR++FK +K L  Y KKKYV K+L+IF+LG+D+DFGHMEAV+L+S+ KY EKQ+GY+ 
Sbjct  70   ANIRSKFKGDKALDGYSKKKYVCKLLFIFLLGHDIDFGHMEAVNLLSSNKYTEKQIGYLF  129

Query  551  TSCLLNENHDFLRLAINTVRNDI  619
             S L+N N + +RL  N ++ND+
Sbjct  130  ISVLVNSNSELIRLINNAIKNDL  152



>ref|XP_003222740.2| PREDICTED: AP-2 complex subunit alpha-1 isoform X4 [Anolis carolinensis]
Length=991

 Score =   154 bits (389),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 102/143 (71%), Gaps = 2/143 (1%)
 Frame = +2

Query  197  LCGNV-GSRRNWEPPLSWIGSER-PGEMALSGMRGLSVFISDIRNCQNKEQERLRVDKEL  370
            L G V G+ RN   P S   +   P      GMRGL+VFISDIRNC++KE E  R++KEL
Sbjct  10   LLGQVSGAERNGASPGSRSSTATMPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKEL  69

Query  371  GNIRTRFKNEKGLTPYEKKKYVWKMLYIFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIV  550
             NIR++FK +K L  Y KKKYV K+L+IF+LG+D+DFGHMEAV+L+S+ KY EKQ+GY+ 
Sbjct  70   ANIRSKFKGDKALDGYSKKKYVCKLLFIFLLGHDIDFGHMEAVNLLSSNKYTEKQIGYLF  129

Query  551  TSCLLNENHDFLRLAINTVRNDI  619
             S L+N N + +RL  N ++ND+
Sbjct  130  ISVLVNSNSELIRLINNAIKNDL  152



>ref|XP_003222739.2| PREDICTED: AP-2 complex subunit alpha-1 isoform X5 [Anolis carolinensis]
Length=967

 Score =   154 bits (389),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 102/143 (71%), Gaps = 2/143 (1%)
 Frame = +2

Query  197  LCGNV-GSRRNWEPPLSWIGSER-PGEMALSGMRGLSVFISDIRNCQNKEQERLRVDKEL  370
            L G V G+ RN   P S   +   P      GMRGL+VFISDIRNC++KE E  R++KEL
Sbjct  10   LLGQVSGAERNGASPGSRSSTATMPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKEL  69

Query  371  GNIRTRFKNEKGLTPYEKKKYVWKMLYIFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIV  550
             NIR++FK +K L  Y KKKYV K+L+IF+LG+D+DFGHMEAV+L+S+ KY EKQ+GY+ 
Sbjct  70   ANIRSKFKGDKALDGYSKKKYVCKLLFIFLLGHDIDFGHMEAVNLLSSNKYTEKQIGYLF  129

Query  551  TSCLLNENHDFLRLAINTVRNDI  619
             S L+N N + +RL  N ++ND+
Sbjct  130  ISVLVNSNSELIRLINNAIKNDL  152



>ref|XP_008111807.1| PREDICTED: AP-2 complex subunit alpha-1 isoform X1 [Anolis carolinensis]
Length=1013

 Score =   154 bits (389),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 102/143 (71%), Gaps = 2/143 (1%)
 Frame = +2

Query  197  LCGNV-GSRRNWEPPLSWIGSER-PGEMALSGMRGLSVFISDIRNCQNKEQERLRVDKEL  370
            L G V G+ RN   P S   +   P      GMRGL+VFISDIRNC++KE E  R++KEL
Sbjct  10   LLGQVSGAERNGASPGSRSSTATMPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKEL  69

Query  371  GNIRTRFKNEKGLTPYEKKKYVWKMLYIFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIV  550
             NIR++FK +K L  Y KKKYV K+L+IF+LG+D+DFGHMEAV+L+S+ KY EKQ+GY+ 
Sbjct  70   ANIRSKFKGDKALDGYSKKKYVCKLLFIFLLGHDIDFGHMEAVNLLSSNKYTEKQIGYLF  129

Query  551  TSCLLNENHDFLRLAINTVRNDI  619
             S L+N N + +RL  N ++ND+
Sbjct  130  ISVLVNSNSELIRLINNAIKNDL  152



>ref|XP_008111808.1| PREDICTED: AP-2 complex subunit alpha-1 isoform X2 [Anolis carolinensis]
Length=1012

 Score =   154 bits (389),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 102/143 (71%), Gaps = 2/143 (1%)
 Frame = +2

Query  197  LCGNV-GSRRNWEPPLSWIGSER-PGEMALSGMRGLSVFISDIRNCQNKEQERLRVDKEL  370
            L G V G+ RN   P S   +   P      GMRGL+VFISDIRNC++KE E  R++KEL
Sbjct  10   LLGQVSGAERNGASPGSRSSTATMPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKEL  69

Query  371  GNIRTRFKNEKGLTPYEKKKYVWKMLYIFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIV  550
             NIR++FK +K L  Y KKKYV K+L+IF+LG+D+DFGHMEAV+L+S+ KY EKQ+GY+ 
Sbjct  70   ANIRSKFKGDKALDGYSKKKYVCKLLFIFLLGHDIDFGHMEAVNLLSSNKYTEKQIGYLF  129

Query  551  TSCLLNENHDFLRLAINTVRNDI  619
             S L+N N + +RL  N ++ND+
Sbjct  130  ISVLVNSNSELIRLINNAIKNDL  152



>ref|NP_001090846.1| adaptor-related protein complex 2, alpha 1 subunit [Xenopus (Silurana) 
tropicalis]
 gb|AAI22996.1| ap2a1 protein [Xenopus (Silurana) tropicalis]
Length=956

 Score =   154 bits (388),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL IN ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLIINAIKNDL  120



>ref|NP_476819.2| adaptor protein complex 2, alpha subunit, isoform A [Drosophila 
melanogaster]
 ref|XP_001968166.1| GG24651 [Drosophila erecta]
 ref|XP_002077634.1| GD22960 [Drosophila simulans]
 sp|P91926.1|AP2A_DROME RecName: Full=AP-2 complex subunit alpha; AltName: Full=Alpha-adaptin 
[Drosophila melanogaster]
 emb|CAA71991.1| alpha-adaptin [Drosophila melanogaster]
 gb|AAF56103.2| adaptor protein complex 2, alpha subunit, isoform A [Drosophila 
melanogaster]
 gb|ACD81853.1| LD25254p [Drosophila melanogaster]
 gb|EDV57225.1| GG24651 [Drosophila erecta]
 gb|EDX03219.1| GD22960 [Drosophila simulans]
Length=940

 Score =   154 bits (388),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEVKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D +RL I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIRLIIQSIKNDL  119



>ref|XP_002041575.1| GM16671 [Drosophila sechellia]
 gb|EDW45391.1| GM16671 [Drosophila sechellia]
Length=940

 Score =   154 bits (388),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEVKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D +RL I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIRLIIQSIKNDL  119



>ref|XP_001988543.1| GH10520 [Drosophila grimshawi]
 gb|EDW03410.1| GH10520 [Drosophila grimshawi]
Length=936

 Score =   154 bits (388),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEVKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D +RL I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIRLIIQSIKNDL  119



>ref|XP_001356441.1| GA18063 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002014589.1| GL19265 [Drosophila persimilis]
 sp|Q29N38.1|AP2A_DROPS RecName: Full=AP-2 complex subunit alpha; AltName: Full=Alpha-adaptin 
[Drosophila pseudoobscura pseudoobscura]
 gb|EAL33505.1| GA18063 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW28585.1| GL19265 [Drosophila persimilis]
Length=939

 Score =   154 bits (388),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEVKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D +RL I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIRLIIQSIKNDL  119



>ref|XP_002003665.1| GI18037 [Drosophila mojavensis]
 gb|EDW13107.1| GI18037 [Drosophila mojavensis]
Length=936

 Score =   154 bits (388),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEVKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D +RL I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIRLIIQSIKNDL  119



>ref|XP_002066736.1| GK24645 [Drosophila willistoni]
 gb|EDW77722.1| GK24645 [Drosophila willistoni]
Length=944

 Score =   153 bits (387),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEVKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D +RL I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIRLIIQSIKNDL  119



>emb|CDJ95459.1| Clathrin coatomer adaptor domain containing protein, partial 
[Haemonchus contortus]
Length=487

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEMKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+ +N D ++L +  +RND+
Sbjct  68   GNDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLIEQNSDLMKLIVQAIRNDL  119



>ref|XP_002052827.1| GJ19747 [Drosophila virilis]
 gb|EDW64982.1| GJ19747 [Drosophila virilis]
Length=936

 Score =   153 bits (387),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEVKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D +RL I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIRLIIQSIKNDL  119



>ref|XP_005001814.1| PREDICTED: AP-2 complex subunit alpha-1 isoform X5 [Cavia porcellus]
Length=1064

 Score =   154 bits (388),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_002087423.1| GE16139 [Drosophila yakuba]
 gb|EDW87135.1| GE16139 [Drosophila yakuba]
Length=940

 Score =   153 bits (387),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEVKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D +RL I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIRLIIQSIKNDL  119



>emb|CAA73533.1| alpha-adaptin [Drosophila melanogaster]
Length=939

 Score =   153 bits (387),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEVKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D +RL I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIRLIIQSIKNDL  119



>gb|EFX80034.1| hypothetical protein DAPPUDRAFT_212220 [Daphnia pulex]
Length=943

 Score =   153 bits (387),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D +RL I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNTNSDLIRLIIQSIKNDL  119



>ref|XP_004767314.1| PREDICTED: AP-2 complex subunit alpha-1 isoform X4 [Mustela putorius 
furo]
 ref|XP_004811709.1| PREDICTED: AP-2 complex subunit alpha-1 isoform X2 [Mustela putorius 
furo]
Length=1106

 Score =   154 bits (388),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_005802713.1| PREDICTED: LOW QUALITY PROTEIN: AP-2 complex subunit alpha-2-like 
[Xiphophorus maculatus]
Length=941

 Score =   153 bits (387),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKESEVKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSDLIRLINNAIKNDL  120



>ref|XP_005186395.1| PREDICTED: AP-2 complex subunit alpha [Musca domestica]
Length=932

 Score =   153 bits (387),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEVKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D +RL I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIRLIIQSIKNDL  119



>ref|XP_004767313.1| PREDICTED: AP-2 complex subunit alpha-1 isoform X3 [Mustela putorius 
furo]
 ref|XP_004811708.1| PREDICTED: AP-2 complex subunit alpha-1 isoform X1 [Mustela putorius 
furo]
Length=1128

 Score =   154 bits (388),  Expect = 6e-39, Method: Composition-based stats.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_001965376.1| GF24806 [Drosophila ananassae]
 gb|EDV33510.1| GF24806 [Drosophila ananassae]
Length=938

 Score =   153 bits (387),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEVKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D +RL I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIRLIIQSIKNDL  119



>ref|XP_004767312.1| PREDICTED: AP-2 complex subunit alpha-1 isoform X2 [Mustela putorius 
furo]
Length=1151

 Score =   154 bits (388),  Expect = 6e-39, Method: Composition-based stats.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_011199623.1| PREDICTED: AP-2 complex subunit alpha [Bactrocera dorsalis]
 ref|XP_011199624.1| PREDICTED: AP-2 complex subunit alpha [Bactrocera dorsalis]
 ref|XP_011199625.1| PREDICTED: AP-2 complex subunit alpha [Bactrocera dorsalis]
Length=929

 Score =   153 bits (387),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEVKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D +RL I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIRLIIQSIKNDL  119



>ref|XP_004536312.1| PREDICTED: AP-2 complex subunit alpha-like isoform X1 [Ceratitis 
capitata]
 ref|XP_004536313.1| PREDICTED: AP-2 complex subunit alpha-like isoform X2 [Ceratitis 
capitata]
 ref|XP_004536314.1| PREDICTED: AP-2 complex subunit alpha-like isoform X3 [Ceratitis 
capitata]
Length=929

 Score =   153 bits (387),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEVKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D +RL I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIRLIIQSIKNDL  119



>ref|XP_002433752.1| AP-2 complex subunit alpha-1, putative [Ixodes scapularis]
 gb|EEC05152.1| AP-2 complex subunit alpha-1, putative [Ixodes scapularis]
Length=940

 Score =   153 bits (387),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            G+RGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GIRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S LLNEN + +RL I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLLNENSELMRLIIQSIKNDL  119



>ref|XP_004767311.1| PREDICTED: AP-2 complex subunit alpha-1 isoform X1 [Mustela putorius 
furo]
Length=1226

 Score =   154 bits (388),  Expect = 6e-39, Method: Composition-based stats.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_011186748.1| PREDICTED: AP-2 complex subunit alpha [Bactrocera cucurbitae]
 ref|XP_011186749.1| PREDICTED: AP-2 complex subunit alpha [Bactrocera cucurbitae]
 ref|XP_011186751.1| PREDICTED: AP-2 complex subunit alpha [Bactrocera cucurbitae]
Length=929

 Score =   153 bits (386),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEVKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D +RL I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIRLIIQSIKNDL  119



>emb|CAJ83860.1| daptor-related protein complex 2, alpha 2 subunit [Xenopus (Silurana) 
tropicalis]
Length=631

 Score =   150 bits (380),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_004694071.1| PREDICTED: AP-2 complex subunit alpha-1 [Condylura cristata]
Length=503

 Score =   150 bits (378),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_011492851.1| PREDICTED: AP-2 complex subunit alpha-2-like [Oryzias latipes]
Length=873

 Score =   152 bits (385),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEVKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSDLIRLINNAIKNDL  120



>ref|XP_008281654.1| PREDICTED: AP-2 complex subunit alpha-2 isoform X2 [Stegastes 
partitus]
Length=926

 Score =   152 bits (385),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEVKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D +RL  N ++ND++
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSDLIRLINNGIKNDLL  121



>emb|CDQ70588.1| unnamed protein product [Oncorhynchus mykiss]
Length=1037

 Score =   153 bits (386),  Expect = 9e-39, Method: Composition-based stats.
 Identities = 67/112 (60%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D + L  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSDLISLINNAIKNDL  120



>dbj|BAG63408.1| unnamed protein product [Homo sapiens]
Length=494

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_008281653.1| PREDICTED: AP-2 complex subunit alpha-2 isoform X1 [Stegastes 
partitus]
Length=956

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEVKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D +RL  N ++ND++
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSDLIRLINNGIKNDLL  121



>emb|CDQ72264.1| unnamed protein product [Oncorhynchus mykiss]
Length=678

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_005924073.1| PREDICTED: AP-2 complex subunit alpha-2-like [Haplochromis burtoni]
Length=866

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSDLIRLINNGIKNDL  120



>gb|ETN58439.1| adaptin, alpha/gamma/epsilon [Anopheles darlingi]
Length=934

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D ++L I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIKLIIQSIKNDL  119



>ref|XP_005726473.1| PREDICTED: AP-2 complex subunit alpha-2-like [Pundamilia nyererei]
Length=928

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSDLIRLINNGIKNDL  120



>ref|XP_011498394.1| PREDICTED: LOW QUALITY PROTEIN: AP-2 complex subunit alpha [Ceratosolen 
solmsi marchali]
Length=934

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D ++L I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIKLIIQSIKNDL  119



>ref|XP_310153.4| AGAP009538-PA [Anopheles gambiae str. PEST]
 sp|Q7QG73.4|AP2A_ANOGA RecName: Full=AP-2 complex subunit alpha; AltName: Full=Alpha-adaptin 
[Anopheles gambiae]
 gb|EAA05923.4| AGAP009538-PA [Anopheles gambiae str. PEST]
Length=934

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D ++L I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIKLIIQSIKNDL  119



>gb|KFM77968.1| AP-2 complex subunit alpha-2, partial [Stegodyphus mimosarum]
Length=952

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK ++ L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDRALDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N++ +RL I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLMNANNELMRLIIQSIKNDL  119



>ref|XP_011139196.1| PREDICTED: AP-2 complex subunit alpha [Harpegnathos saltator]
Length=939

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D ++L I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIKLIIQSIKNDL  119



>ref|XP_008546428.1| PREDICTED: AP-2 complex subunit alpha [Microplitis demolitor]
Length=946

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D ++L I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIKLIIQSIKNDL  119



>ref|NP_001136323.1| adaptor-related protein complex 2, alpha 2 subunit [Nasonia vitripennis]
 ref|XP_008216397.1| PREDICTED: adaptor-related protein complex 2, alpha 2 subunit 
isoform X1 [Nasonia vitripennis]
Length=939

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D ++L I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIKLIIQSIKNDL  119



>ref|XP_394621.2| PREDICTED: AP-2 complex subunit alpha isoformX1 [Apis mellifera]
 ref|XP_003693883.1| PREDICTED: LOW QUALITY PROTEIN: AP-2 complex subunit alpha-like 
[Apis florea]
 ref|XP_006615876.1| PREDICTED: AP-2 complex subunit alpha-like [Apis dorsata]
Length=937

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D ++L I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIKLIIQSIKNDL  119



>pdb|2JKR|A Chain A, Ap2 Clathrin Adaptor Core With Dileucine Peptide Rm( 
Phosphos)qikrllse
 pdb|2JKR|L Chain L, Ap2 Clathrin Adaptor Core With Dileucine Peptide Rm( 
Phosphos)qikrllse
 pdb|2JKT|A Chain A, Ap2 Clathrin Adaptor Core With Cd4 Dileucine Peptide 
Rm( Phosphos)eikrllse  Q To E Mutant
 pdb|2JKT|L Chain L, Ap2 Clathrin Adaptor Core With Cd4 Dileucine Peptide 
Rm( Phosphos)eikrllse  Q To E Mutant
Length=623

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ +Y EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNRYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_003978707.1| PREDICTED: AP-2 complex subunit alpha-2-like [Takifugu rubripes]
Length=949

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEVKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSDLIRLINNGIKNDL  120



>ref|XP_004091849.1| PREDICTED: LOW QUALITY PROTEIN: AP-2 complex subunit alpha-2 
[Nomascus leucogenys]
Length=1582

 Score =   152 bits (385),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 66/112 (59%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  462  GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  521

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ +Y EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  522  GHDIDFGHMEAVNLLSSNRYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  573



>pdb|2VGL|A Chain A, Ap2 Clathrin Adaptor Core
 pdb|2XA7|A Chain A, Ap2 Clathrin Adaptor Core In Active Complex With Cargo 
Peptides
Length=621

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ +Y EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNRYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_003703257.1| PREDICTED: AP-2 complex subunit alpha-like [Megachile rotundata]
Length=937

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D ++L I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIKLIIQSIKNDL  119



>ref|XP_003491577.1| PREDICTED: AP-2 complex subunit alpha-like [Bombus impatiens]
Length=937

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D ++L I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIKLIIQSIKNDL  119



>ref|XP_004932148.1| PREDICTED: AP-2 complex subunit alpha-like [Bombyx mori]
Length=929

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D ++L I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIKLIIQSIKNDL  119



>pdb|4UQI|A Chain A, Ap2 Controls Clathrin Polymerization With A Membrane- 
Activated Switch
Length=628

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ +Y EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNRYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_003402975.1| PREDICTED: AP-2 complex subunit alpha-like [Bombus terrestris]
Length=937

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D ++L I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIKLIIQSIKNDL  119



>gb|EHJ66702.1| hypothetical protein KGM_03658 [Danaus plexippus]
Length=928

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D ++L I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIKLIIQSIKNDL  119



>ref|XP_011299658.1| PREDICTED: AP-2 complex subunit alpha isoform X1 [Fopius arisanus]
 ref|XP_011299668.1| PREDICTED: AP-2 complex subunit alpha isoform X1 [Fopius arisanus]
Length=939

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D ++L I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIKLIIQSIKNDL  119



>ref|XP_011164254.1| PREDICTED: AP-2 complex subunit alpha [Solenopsis invicta]
 ref|XP_011164255.1| PREDICTED: AP-2 complex subunit alpha [Solenopsis invicta]
Length=939

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D ++L I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIKLIIQSIKNDL  119



>ref|XP_003802841.1| PREDICTED: AP-2 complex subunit alpha-2 [Otolemur garnettii]
Length=1110

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 102/139 (73%), Gaps = 3/139 (2%)
 Frame = +2

Query  212  GSRRNWEPPLSWIGSERPGEMALS---GMRGLSVFISDIRNCQNKEQERLRVDKELGNIR  382
            GS R+   P S   S R    A+S   GMRGL+VFISDIRNC++KE E  R++KEL NIR
Sbjct  154  GSPRSSSGPASRGRSGRRKMPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKELANIR  213

Query  383  TRFKNEKGLTPYEKKKYVWKMLYIFMLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCL  562
            ++FK +K L  Y KKKYV K+L+IF+LG+D+DFGHMEAV+L+S+ +Y EKQ+GY+  S L
Sbjct  214  SKFKGDKALDGYSKKKYVCKLLFIFLLGHDIDFGHMEAVNLLSSNRYTEKQIGYLFISVL  273

Query  563  LNENHDFLRLAINTVRNDI  619
            +N N + +RL  N ++ND+
Sbjct  274  VNSNSELIRLINNAIKNDL  292



>ref|XP_010732260.1| PREDICTED: AP-2 complex subunit alpha-2 isoform X1 [Larimichthys 
crocea]
Length=926

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSDLIRLINNGIKNDL  120



>ref|XP_011253598.1| PREDICTED: AP-2 complex subunit alpha isoform X2 [Camponotus 
floridanus]
Length=939

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D ++L I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIKLIIQSIKNDL  119



>ref|XP_011055344.1| PREDICTED: AP-2 complex subunit alpha [Acromyrmex echinatior]
 ref|XP_011055345.1| PREDICTED: AP-2 complex subunit alpha [Acromyrmex echinatior]
 ref|XP_011055346.1| PREDICTED: AP-2 complex subunit alpha [Acromyrmex echinatior]
 gb|EGI64876.1| AP-2 complex subunit alpha [Acromyrmex echinatior]
Length=940

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D ++L I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIKLIIQSIKNDL  119



>ref|XP_011334710.1| PREDICTED: AP-2 complex subunit alpha [Cerapachys biroi]
Length=938

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D ++L I +++ND+
Sbjct  68   GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIKLIIQSIKNDL  119



>ref|XP_008308524.1| PREDICTED: AP-2 complex subunit alpha-2 isoform X2 [Cynoglossus 
semilaevis]
Length=930

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKY+ K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYICKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSDLIRLINNGIKNDL  120



>ref|XP_010732261.1| PREDICTED: AP-2 complex subunit alpha-2 isoform X2 [Larimichthys 
crocea]
Length=934

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSDLIRLINNGIKNDL  120



>ref|XP_008308523.1| PREDICTED: AP-2 complex subunit alpha-2 isoform X1 [Cynoglossus 
semilaevis]
Length=960

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKY+ K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYICKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSDLIRLINNGIKNDL  120



>ref|XP_007568308.1| PREDICTED: AP-2 complex subunit alpha-2 [Poecilia formosa]
Length=926

 Score =   151 bits (381),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEVKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_008403154.1| PREDICTED: AP-2 complex subunit alpha-2 isoform X2 [Poecilia 
reticulata]
Length=926

 Score =   151 bits (381),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEVKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_007074351.1| PREDICTED: AP-2 complex subunit alpha-1 [Panthera tigris altaica]
Length=725

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_002829637.3| PREDICTED: AP-2 complex subunit alpha-1 [Pongo abelii]
Length=749

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_011253597.1| PREDICTED: AP-2 complex subunit alpha isoform X1 [Camponotus 
floridanus]
 gb|EFN70172.1| AP-2 complex subunit alpha [Camponotus floridanus]
Length=1025

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  94   GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  153

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D ++L I +++ND+
Sbjct  154  GHDIDFGHMEAVNLLSSNKYSEKQIGYLFISVLVNTNSDLIKLIIQSIKNDL  205



>ref|XP_009051374.1| hypothetical protein LOTGIDRAFT_203023 [Lottia gigantea]
 gb|ESO97508.1| hypothetical protein LOTGIDRAFT_203023 [Lottia gigantea]
Length=961

 Score =   151 bits (381),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y+KKKYV K+L+IF+L
Sbjct  8    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLL  67

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDII  622
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L++ ++D ++L I  +RND++
Sbjct  68   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLISASNDLMKLVIQCIRNDLV  120



>ref|XP_008403153.1| PREDICTED: AP-2 complex subunit alpha-2 isoform X1 [Poecilia 
reticulata]
Length=955

 Score =   151 bits (381),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEVKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>emb|CAF95181.1| unnamed protein product [Tetraodon nigroviridis]
Length=995

 Score =   151 bits (381),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N D +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSDLIRLINNGIKNDL  120



>ref|NP_001001209.1| adaptor-related protein complex 2, alpha 2 subunit [Xenopus (Silurana) 
tropicalis]
 gb|AAH67918.1| adaptor-related protein complex 2, alpha 2 subunit [Xenopus (Silurana) 
tropicalis]
Length=939

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_008413234.1| PREDICTED: AP-2 complex subunit alpha-1-like isoform X2 [Poecilia 
reticulata]
Length=962

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_008413236.1| PREDICTED: AP-2 complex subunit alpha-2-like isoform X3 [Poecilia 
reticulata]
Length=941

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_007543249.1| PREDICTED: AP-2 complex subunit alpha-2-like isoform X3 [Poecilia 
formosa]
Length=941

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_008173941.1| PREDICTED: AP-2 complex subunit alpha-1 isoform X4 [Chrysemys 
picta bellii]
Length=936

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_005461661.1| PREDICTED: AP-2 complex subunit alpha-2-like isoform X6 [Oreochromis 
niloticus]
Length=941

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_010900568.1| PREDICTED: AP-2 complex subunit alpha-2-like isoform X6 [Esox 
lucius]
Length=938

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_005461660.1| PREDICTED: AP-2 complex subunit alpha-2-like isoform X5 [Oreochromis 
niloticus]
Length=942

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_005164121.2| PREDICTED: AP-2 complex subunit alpha-1 isoform X4 [Danio rerio]
Length=939

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_003976086.1| PREDICTED: AP-2 complex subunit alpha-2-like isoform 1 [Takifugu 
rubripes]
Length=941

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_003456913.1| PREDICTED: AP-2 complex subunit alpha-2-like isoformX2 [Oreochromis 
niloticus]
Length=936

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_005749708.1| PREDICTED: AP-2 complex subunit alpha-2-like isoform X3 [Pundamilia 
nyererei]
 ref|XP_005949602.1| PREDICTED: AP-2 complex subunit alpha-2-like isoform X3 [Haplochromis 
burtoni]
Length=964

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_005749711.1| PREDICTED: AP-2 complex subunit alpha-2-like isoform X6 [Pundamilia 
nyererei]
 ref|XP_005949605.1| PREDICTED: AP-2 complex subunit alpha-2-like isoform X6 [Haplochromis 
burtoni]
Length=941

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_009297844.1| PREDICTED: AP-2 complex subunit alpha-1 isoform X6 [Danio rerio]
Length=935

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_005164120.2| PREDICTED: AP-2 complex subunit alpha-1 isoform X3 [Danio rerio]
Length=963

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_008106455.1| PREDICTED: AP-2 complex subunit alpha-2 [Anolis carolinensis]
Length=965

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_005749710.1| PREDICTED: AP-2 complex subunit alpha-2-like isoform X5 [Pundamilia 
nyererei]
 ref|XP_005949604.1| PREDICTED: AP-2 complex subunit alpha-2-like isoform X5 [Haplochromis 
burtoni]
Length=943

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_005280822.1| PREDICTED: AP-2 complex subunit alpha-1 isoform X2 [Chrysemys 
picta bellii]
Length=958

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>gb|ELK28574.1| AP-2 complex subunit alpha-1 [Myotis davidii]
Length=778

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_010900567.1| PREDICTED: AP-2 complex subunit alpha-2-like isoform X5 [Esox 
lucius]
Length=942

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_004573167.1| PREDICTED: AP-2 complex subunit alpha-2-like isoform X3 [Maylandia 
zebra]
Length=941

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_009297843.1| PREDICTED: AP-2 complex subunit alpha-1 isoform X5 [Danio rerio]
Length=959

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_007543248.1| PREDICTED: AP-2 complex subunit alpha-1-like isoform X2 [Poecilia 
formosa]
Length=962

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_004573166.1| PREDICTED: AP-2 complex subunit alpha-2-like isoform X2 [Maylandia 
zebra]
Length=962

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_003976089.1| PREDICTED: AP-2 complex subunit alpha-2-like isoform 4 [Takifugu 
rubripes]
Length=935

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_003976087.1| PREDICTED: AP-2 complex subunit alpha-2-like isoform 2 [Takifugu 
rubripes]
Length=955

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_005749712.1| PREDICTED: AP-2 complex subunit alpha-2-like isoform X7 [Pundamilia 
nyererei]
 ref|XP_005949606.1| PREDICTED: AP-2 complex subunit alpha-2-like isoform X7 [Haplochromis 
burtoni]
Length=936

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|NP_001089303.1| adaptor-related protein complex 2, alpha 2 subunit [Xenopus laevis]
 gb|AAH91638.1| MGC99219 protein [Xenopus laevis]
Length=939

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_008173939.1| PREDICTED: AP-2 complex subunit alpha-1 isoform X1 [Chrysemys 
picta bellii]
Length=963

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_003456912.1| PREDICTED: AP-2 complex subunit alpha-2-like isoformX1 [Oreochromis 
niloticus]
Length=955

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



>ref|XP_009297842.1| PREDICTED: AP-2 complex subunit alpha-1 isoform X1 [Danio rerio]
Length=984

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  284  GMRGLSVFISDIRNCQNKEQERLRVDKELGNIRTRFKNEKGLTPYEKKKYVWKMLYIFML  463
            GMRGL+VFISDIRNC++KE E  R++KEL NIR++FK +K L  Y KKKYV K+L+IF+L
Sbjct  9    GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLL  68

Query  464  GYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLRLAINTVRNDI  619
            G+D+DFGHMEAV+L+S+ KY EKQ+GY+  S L+N N + +RL  N ++ND+
Sbjct  69   GHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL  120



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950