BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS004G06

Length=424
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHG08985.1|  DnaJ subfamily C member 7                               147   1e-38   Gossypium arboreum [tree cotton]
ref|XP_002275599.1|  PREDICTED: uncharacterized protein LOC100264117    140   3e-36   Vitis vinifera
ref|XP_009616156.1|  PREDICTED: uncharacterized protein LOC104108746    139   1e-35   Nicotiana tomentosiformis
ref|XP_009768383.1|  PREDICTED: uncharacterized protein LOC104219395    137   2e-35   Nicotiana sylvestris
ref|XP_009768189.1|  PREDICTED: uncharacterized protein LOC104219243    138   3e-35   Nicotiana sylvestris
ref|XP_010268035.1|  PREDICTED: uncharacterized protein LOC104605111    137   3e-35   Nelumbo nucifera [Indian lotus]
ref|XP_010259351.1|  PREDICTED: uncharacterized protein LOC104598816    135   3e-34   Nelumbo nucifera [Indian lotus]
ref|XP_009616219.1|  PREDICTED: uncharacterized protein LOC104108800    132   3e-33   Nicotiana tomentosiformis
ref|XP_009790563.1|  PREDICTED: uncharacterized protein LOC104238005    132   4e-33   Nicotiana sylvestris
ref|XP_010542840.1|  PREDICTED: uncharacterized protein LOC104815...    131   5e-33   Tarenaya hassleriana [spider flower]
ref|XP_010542842.1|  PREDICTED: uncharacterized protein LOC104815...    130   6e-33   Tarenaya hassleriana [spider flower]
emb|CDY07094.1|  BnaCnng01090D                                          129   3e-32   
ref|XP_002874939.1|  DNAJ heat shock N-terminal domain-containing...    129   3e-32   
ref|XP_011079570.1|  PREDICTED: uncharacterized protein LOC105163060    128   7e-32   Sesamum indicum [beniseed]
ref|NP_192119.2|  Heat shock protein DnaJ with tetratricopeptide ...    128   7e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007199776.1|  hypothetical protein PRUPE_ppa003704mg             128   9e-32   
emb|CDY67245.1|  BnaAnng23890D                                          127   1e-31   Brassica napus [oilseed rape]
ref|XP_009111317.1|  PREDICTED: uncharacterized protein LOC103836775    127   1e-31   Brassica rapa
ref|XP_008235190.1|  PREDICTED: uncharacterized protein LOC103334043    127   2e-31   
gb|KHN19224.1|  hypothetical protein glysoja_041576                     125   6e-31   Glycine soja [wild soybean]
ref|XP_003521588.1|  PREDICTED: dnaJ homolog subfamily C member 3...    125   7e-31   Glycine max [soybeans]
ref|NP_182266.1|  tetratricopeptide repeat-containing protein           124   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396409.1|  hypothetical protein EUTSA_v10028558mg             125   1e-30   Eutrema salsugineum [saltwater cress]
ref|XP_006286487.1|  hypothetical protein CARUB_v10000583mg             125   1e-30   
ref|XP_010456075.1|  PREDICTED: uncharacterized protein LOC104737571    124   2e-30   Camelina sativa [gold-of-pleasure]
gb|KFK37483.1|  hypothetical protein AALP_AA4G263300                    124   2e-30   Arabis alpina [alpine rockcress]
ref|XP_006349200.1|  PREDICTED: uncharacterized protein LOC102603...    125   2e-30   Solanum tuberosum [potatoes]
ref|XP_004229402.1|  PREDICTED: uncharacterized protein LOC101245693    125   2e-30   Solanum lycopersicum
ref|XP_010429191.1|  PREDICTED: uncharacterized protein LOC104713...    124   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_004135998.1|  PREDICTED: uncharacterized protein LOC101222380    124   2e-30   
emb|CDP17084.1|  unnamed protein product                                124   2e-30   Coffea canephora [robusta coffee]
ref|XP_008451491.1|  PREDICTED: uncharacterized protein LOC103492765    124   2e-30   Cucumis melo [Oriental melon]
ref|XP_010429181.1|  PREDICTED: uncharacterized protein LOC104713...    124   2e-30   Camelina sativa [gold-of-pleasure]
gb|KGN45006.1|  hypothetical protein Csa_7G407590                       124   3e-30   Cucumis sativus [cucumbers]
ref|XP_010422635.1|  PREDICTED: uncharacterized protein LOC104707890    123   3e-30   Camelina sativa [gold-of-pleasure]
gb|KDP28241.1|  hypothetical protein JCGZ_14012                         124   3e-30   Jatropha curcas
ref|XP_006349199.1|  PREDICTED: uncharacterized protein LOC102603...    124   3e-30   
ref|XP_009134446.1|  PREDICTED: uncharacterized protein LOC103858777    123   3e-30   Brassica rapa
ref|XP_002880302.1|  DNAJ heat shock N-terminal domain-containing...    123   4e-30   
ref|XP_007051076.1|  Heat shock protein DnaJ with tetratricopepti...    124   4e-30   
gb|KJB09454.1|  hypothetical protein B456_001G143300                    123   6e-30   Gossypium raimondii
ref|XP_010468947.1|  PREDICTED: uncharacterized protein LOC104749068    122   7e-30   Camelina sativa [gold-of-pleasure]
ref|XP_003591422.1|  hypothetical protein MTR_1g087270                  123   7e-30   Medicago truncatula
emb|CDX91806.1|  BnaC03g31080D                                          122   8e-30   
ref|XP_010413274.1|  PREDICTED: uncharacterized protein LOC104699631    122   8e-30   Camelina sativa [gold-of-pleasure]
ref|XP_004172783.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    122   9e-30   
ref|XP_006402368.1|  hypothetical protein EUTSA_v10005872mg             122   9e-30   Eutrema salsugineum [saltwater cress]
emb|CDX80104.1|  BnaA05g00520D                                          122   1e-29   
ref|XP_009142535.1|  PREDICTED: uncharacterized protein LOC103866379    122   1e-29   Brassica rapa
emb|CDX90954.1|  BnaA03g26340D                                          122   1e-29   
ref|XP_010512643.1|  PREDICTED: uncharacterized protein LOC104788582    122   2e-29   Camelina sativa [gold-of-pleasure]
emb|CDY55382.1|  BnaC04g52000D                                          121   2e-29   Brassica napus [oilseed rape]
ref|XP_010523979.1|  PREDICTED: uncharacterized protein LOC104802196    121   3e-29   Tarenaya hassleriana [spider flower]
ref|XP_011041432.1|  PREDICTED: uncharacterized protein LOC105137405    121   3e-29   Populus euphratica
ref|XP_011042234.1|  PREDICTED: uncharacterized protein LOC105137967    114   1e-28   Populus euphratica
gb|KFK30725.1|  hypothetical protein AALP_AA6G019200                    119   1e-28   Arabis alpina [alpine rockcress]
gb|KHG28204.1|  DnaJ subfamily C member 7                               119   1e-28   Gossypium arboreum [tree cotton]
ref|XP_009378699.1|  PREDICTED: uncharacterized protein LOC103967...    119   2e-28   Pyrus x bretschneideri [bai li]
ref|XP_010069868.1|  PREDICTED: uncharacterized protein LOC104456711    120   2e-28   Eucalyptus grandis [rose gum]
ref|XP_010544976.1|  PREDICTED: uncharacterized protein LOC104817463    119   2e-28   Tarenaya hassleriana [spider flower]
gb|KDO87034.1|  hypothetical protein CISIN_1g0080392mg                  113   2e-28   Citrus sinensis [apfelsine]
gb|KJB49845.1|  hypothetical protein B456_008G140700                    119   2e-28   Gossypium raimondii
ref|XP_006397939.1|  hypothetical protein EUTSA_v10001383mg             118   3e-28   Eutrema salsugineum [saltwater cress]
emb|CDY11427.1|  BnaA09g39930D                                          118   3e-28   Brassica napus [oilseed rape]
ref|XP_010038279.1|  PREDICTED: uncharacterized protein LOC104426813    119   3e-28   Eucalyptus grandis [rose gum]
ref|NP_191816.1|  tetratricopeptide repeat-containing protein           118   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002320311.2|  DNAJ heat shock N-terminal domain-containing...    118   3e-28   
gb|KHG03065.1|  DnaJ subfamily C member 7                               117   5e-28   Gossypium arboreum [tree cotton]
emb|CDX76643.1|  BnaC08g32290D                                          117   6e-28   
ref|XP_009382507.1|  PREDICTED: uncharacterized protein LOC103970452    117   6e-28   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB41823.1|  hypothetical protein B456_007G123400                    117   6e-28   Gossypium raimondii
ref|XP_006855297.1|  hypothetical protein AMTR_s00057p00052440          117   8e-28   Amborella trichopoda
ref|XP_002515301.1|  heat shock protein binding protein, putative       117   9e-28   
ref|XP_008386730.1|  PREDICTED: uncharacterized protein LOC103449222    117   9e-28   Malus domestica [apple tree]
ref|XP_008350098.1|  PREDICTED: uncharacterized protein LOC103413409    117   1e-27   
ref|XP_008369054.1|  PREDICTED: uncharacterized protein LOC103432...    117   1e-27   
ref|XP_002302757.2|  DNAJ heat shock N-terminal domain-containing...    117   1e-27   
ref|XP_009116918.1|  PREDICTED: uncharacterized protein LOC103842063    116   2e-27   Brassica rapa
ref|XP_009339787.1|  PREDICTED: uncharacterized protein LOC103931979    116   2e-27   Pyrus x bretschneideri [bai li]
ref|XP_009401632.1|  PREDICTED: uncharacterized protein LOC103985610    116   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002876678.1|  DNAJ heat shock N-terminal domain-containing...    115   2e-27   
ref|XP_004156824.1|  PREDICTED: uncharacterized protein LOC101230027    115   4e-27   
ref|XP_004152231.1|  PREDICTED: uncharacterized protein LOC101221887    115   5e-27   Cucumis sativus [cucumbers]
ref|XP_010087254.1|  hypothetical protein L484_009763                   115   5e-27   Morus notabilis
ref|XP_006290836.1|  hypothetical protein CARUB_v10016946mg             114   7e-27   Capsella rubella
ref|XP_006492317.1|  PREDICTED: uncharacterized protein LOC102625...    114   8e-27   Citrus sinensis [apfelsine]
ref|XP_011042235.1|  PREDICTED: uncharacterized protein LOC105137969    114   8e-27   Populus euphratica
ref|XP_009411639.1|  PREDICTED: uncharacterized protein LOC103993339    114   9e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006444469.1|  hypothetical protein CICLE_v10019452mg             114   1e-26   Citrus clementina [clementine]
gb|KFK35426.1|  hypothetical protein AALP_AA5G283000                    113   2e-26   Arabis alpina [alpine rockcress]
gb|KJB24404.1|  hypothetical protein B456_004G143900                    112   8e-26   Gossypium raimondii
ref|XP_010921523.1|  PREDICTED: uncharacterized protein LOC105045059    112   8e-26   Elaeis guineensis
ref|XP_004495910.1|  PREDICTED: uncharacterized protein LOC101505533    110   2e-25   
gb|KHN43469.1|  hypothetical protein glysoja_002052                     105   2e-25   Glycine soja [wild soybean]
ref|XP_006307197.1|  hypothetical protein CARUB_v10008788mg             110   3e-25   
ref|XP_004494413.1|  PREDICTED: uncharacterized protein LOC101497500    110   3e-25   Cicer arietinum [garbanzo]
ref|XP_008454300.1|  PREDICTED: uncharacterized protein LOC103494740    110   3e-25   Cucumis melo [Oriental melon]
ref|XP_004240574.1|  PREDICTED: uncharacterized protein LOC101267897    110   4e-25   Solanum lycopersicum
gb|KHG09476.1|  DnaJ subfamily C member 7                               109   5e-25   Gossypium arboreum [tree cotton]
ref|XP_009384418.1|  PREDICTED: uncharacterized protein LOC103971973    109   6e-25   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAC78702.1|  hypothetical protein                                    109   7e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010481139.1|  PREDICTED: uncharacterized protein LOC104759976    108   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010938305.1|  PREDICTED: uncharacterized protein LOC105057403    108   1e-24   Elaeis guineensis
ref|XP_008781076.1|  PREDICTED: uncharacterized protein LOC103700952    108   2e-24   Phoenix dactylifera
ref|XP_010679356.1|  PREDICTED: uncharacterized protein LOC104894747    108   2e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011082426.1|  PREDICTED: uncharacterized protein LOC105165197    107   2e-24   Sesamum indicum [beniseed]
ref|XP_006355839.1|  PREDICTED: uncharacterized protein LOC102596254    107   3e-24   Solanum tuberosum [potatoes]
gb|EYU46799.1|  hypothetical protein MIMGU_mgv1a003430mg                107   3e-24   Erythranthe guttata [common monkey flower]
ref|XP_003625953.1|  hypothetical protein MTR_7g109360                  107   3e-24   Medicago truncatula
ref|XP_009416222.1|  PREDICTED: uncharacterized protein LOC103996892    105   1e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003554542.1|  PREDICTED: uncharacterized protein LOC100808420    105   1e-23   Glycine max [soybeans]
ref|XP_007163166.1|  hypothetical protein PHAVU_001G212000g             105   1e-23   Phaseolus vulgaris [French bean]
gb|EPS60430.1|  hypothetical protein M569_14373                         103   6e-23   Genlisea aurea
ref|NP_171765.1|  tetratricopeptide repeat domain-containing protein    101   5e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889411.1|  DNAJ heat shock N-terminal domain-containing...  99.8    1e-21   
ref|XP_008786230.1|  PREDICTED: uncharacterized protein LOC103704641    100   2e-21   Phoenix dactylifera
ref|XP_007145158.1|  hypothetical protein PHAVU_007G215200g           99.8    2e-21   Phaseolus vulgaris [French bean]
ref|XP_009378700.1|  PREDICTED: uncharacterized protein LOC103967...  99.4    3e-21   Pyrus x bretschneideri [bai li]
ref|XP_008369055.1|  PREDICTED: uncharacterized protein LOC103432...  97.4    2e-20   
ref|XP_010474676.1|  PREDICTED: uncharacterized protein LOC104754236  95.9    3e-20   Camelina sativa [gold-of-pleasure]
ref|XP_003603082.1|  hypothetical protein MTR_3g102140                92.4    5e-19   
ref|XP_004984639.1|  PREDICTED: uncharacterized protein LOC101760132  92.8    6e-19   Setaria italica
gb|EAY89683.1|  hypothetical protein OsI_11218                        92.4    1e-18   Oryza sativa Indica Group [Indian rice]
ref|NP_001049877.1|  Os03g0304500                                     92.4    1e-18   
emb|CAN62070.1|  hypothetical protein VITISV_036192                   90.9    2e-18   Vitis vinifera
ref|XP_010457248.1|  PREDICTED: uncharacterized protein LOC104738...  90.9    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_006649953.1|  PREDICTED: uncharacterized protein LOC102720...  91.3    3e-18   
ref|XP_006649952.1|  PREDICTED: uncharacterized protein LOC102720...  91.3    3e-18   Oryza brachyantha
ref|XP_003558094.1|  PREDICTED: uncharacterized protein LOC100838122  85.1    3e-16   Brachypodium distachyon [annual false brome]
ref|XP_007210762.1|  hypothetical protein PRUPE_ppa020535mg           79.3    2e-15   
gb|EPS61606.1|  hypothetical protein M569_13189                       81.3    5e-15   Genlisea aurea
gb|KHN30647.1|  Putative beta-D-xylosidase 2                          81.3    6e-15   Glycine soja [wild soybean]
ref|XP_010457249.1|  PREDICTED: uncharacterized protein LOC104738...  77.4    1e-13   
emb|CAE03145.2|  OSJNBa0081L15.7                                      61.6    4e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EEE66051.1|  hypothetical protein OsJ_22041                        60.8    6e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EEE66049.1|  hypothetical protein OsJ_22038                        61.2    7e-09   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001173991.1|  Os04g0483700                                     61.2    7e-09   
ref|XP_002462475.1|  hypothetical protein SORBIDRAFT_02g026285        62.4    8e-09   
ref|XP_002465385.1|  hypothetical protein SORBIDRAFT_01g037630        63.5    8e-09   Sorghum bicolor [broomcorn]
dbj|BAJ99790.1|  predicted protein                                    63.2    8e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAD37386.1|  hypothetical protein                                 61.2    9e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82726.1|  hypothetical protein OsI_27419                        63.2    1e-08   Oryza sativa Indica Group [Indian rice]
ref|NP_001060708.1|  Os07g0689800                                     62.8    1e-08   
gb|EAZ05220.1|  hypothetical protein OsI_27418                        62.8    1e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_008654810.1|  PREDICTED: trans-splicing factor Raa3, chlor...  62.8    1e-08   Zea mays [maize]
ref|XP_008671203.1|  PREDICTED: uncharacterized protein LOC103648532  62.4    2e-08   
gb|KEH19986.1|  DNAJ heat shock amino-terminal domain protein, pu...  51.2    4e-06   Medicago truncatula
gb|KEH19985.1|  transmembrane protein, putative                       52.0    2e-05   Medicago truncatula
ref|XP_008796162.1|  PREDICTED: uncharacterized protein LOC103711...  48.1    8e-04   Phoenix dactylifera
ref|XP_008796161.1|  PREDICTED: uncharacterized protein LOC103711...  48.1    8e-04   Phoenix dactylifera



>gb|KHG08985.1| DnaJ subfamily C member 7 [Gossypium arboreum]
Length=585

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRL  328
            M+ SPC +G ++K+HWWLTNRK+ DKY+KDA+ LIA+Q+   +ASALN+LDAAL+LSPRL
Sbjct  1    MAVSPCLSGNDQKKHWWLTNRKLVDKYIKDARCLIATQEHNEVASALNLLDAALVLSPRL  60

Query  329  ELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            E+A+ELKAR+LL+LRRF+DV DMLQDYIPSLK
Sbjct  61   EIALELKARSLLYLRRFRDVVDMLQDYIPSLK  92



>ref|XP_002275599.1| PREDICTED: uncharacterized protein LOC100264117 [Vitis vinifera]
 emb|CBI36934.3| unnamed protein product [Vitis vinifera]
Length=558

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 80/92 (87%), Gaps = 1/92 (1%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRL  328
            M+ SP  AGGEKK HWWL N+KI DKYVKDA+ LIA+Q+   +A+ALN+LDAAL LSPR 
Sbjct  1    MATSPSVAGGEKK-HWWLRNKKIVDKYVKDARCLIATQEQSEIATALNLLDAALGLSPRF  59

Query  329  ELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            E+A+ELKAR+LL+LRRFKDVADMLQDYIPSLK
Sbjct  60   EVALELKARSLLYLRRFKDVADMLQDYIPSLK  91



>ref|XP_009616156.1| PREDICTED: uncharacterized protein LOC104108746 [Nicotiana tomentosiformis]
Length=610

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 80/94 (85%), Gaps = 1/94 (1%)
 Frame = +2

Query  143  TTMSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSP  322
            T M+ SP  +  EKK HWW++NRKI DKY+KDAK+LIA+Q+P  +ASA+N+LDAAL LSP
Sbjct  8    TNMAASPSISCSEKK-HWWISNRKIVDKYIKDAKLLIATQEPNEIASAVNLLDAALSLSP  66

Query  323  RLELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            R ELA+ELK R+LL+LRRFKDVA MLQDYIPSLK
Sbjct  67   RFELALELKTRSLLYLRRFKDVAGMLQDYIPSLK  100



>ref|XP_009768383.1| PREDICTED: uncharacterized protein LOC104219395 [Nicotiana sylvestris]
Length=405

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 80/94 (85%), Gaps = 1/94 (1%)
 Frame = +2

Query  143  TTMSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSP  322
            T M+ SP     EKK HWW++NRK+ DKY+KDAK+LIA+Q+P  +ASA+N+LDAAL LSP
Sbjct  8    TNMAASPSIYCSEKK-HWWISNRKMVDKYIKDAKLLIATQEPNEIASAVNLLDAALSLSP  66

Query  323  RLELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            R ELA+ELKAR+LL+LRRFKDVA MLQDYIPSLK
Sbjct  67   RFELALELKARSLLYLRRFKDVAGMLQDYIPSLK  100



>ref|XP_009768189.1| PREDICTED: uncharacterized protein LOC104219243 [Nicotiana sylvestris]
Length=611

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 80/94 (85%), Gaps = 1/94 (1%)
 Frame = +2

Query  143  TTMSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSP  322
            T M+ SP     EKK HWW++NRK+ DKY+KDAK+LIA+Q+P  +ASA+N+LDAAL LSP
Sbjct  8    TNMAASPSIYCSEKK-HWWISNRKMVDKYIKDAKLLIATQEPNEIASAVNLLDAALSLSP  66

Query  323  RLELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            R ELA+ELKAR+LL+LRRFKDVA MLQDYIPSLK
Sbjct  67   RFELALELKARSLLYLRRFKDVAGMLQDYIPSLK  100



>ref|XP_010268035.1| PREDICTED: uncharacterized protein LOC104605111 [Nelumbo nucifera]
Length=588

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 79/92 (86%), Gaps = 1/92 (1%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRL  328
            MS SP  AG EKK HWWL NRKI DKYVKDA+VLIA+Q+   +ASALN+LDAAL LSPRL
Sbjct  1    MSTSPSLAGVEKK-HWWLRNRKIVDKYVKDARVLIATQEQSEIASALNLLDAALSLSPRL  59

Query  329  ELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            E A+ELKAR+LL+LRRFK+VADMLQ+YIPS K
Sbjct  60   ESALELKARSLLYLRRFKEVADMLQEYIPSYK  91



>ref|XP_010259351.1| PREDICTED: uncharacterized protein LOC104598816 [Nelumbo nucifera]
Length=583

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 82/92 (89%), Gaps = 1/92 (1%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRL  328
            MS SP  AG EKK +WW++NRKIADKYVKDA+ L+A+Q+   +ASALN+LDAAL+LSPRL
Sbjct  1    MSTSPSLAGVEKK-NWWVSNRKIADKYVKDARALLATQEQSEIASALNLLDAALVLSPRL  59

Query  329  ELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            ELA+ELKAR+LL+LRRFK+VADMLQ++IPS K
Sbjct  60   ELALELKARSLLYLRRFKEVADMLQEHIPSYK  91



>ref|XP_009616219.1| PREDICTED: uncharacterized protein LOC104108800 [Nicotiana tomentosiformis]
Length=580

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 83/101 (82%), Gaps = 1/101 (1%)
 Frame = +2

Query  122  VIQSELGTTMSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLD  301
            ++     +TM+ SP  + GEKK HWW++N+KI +KY+KDAK+LIA+Q+   +ASAL +L+
Sbjct  1    MVNEPCTSTMAASPTLSCGEKK-HWWISNKKIVEKYIKDAKILIATQETNEIASALGLLE  59

Query  302  AALLLSPRLELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            AAL+LSPRLE+A+ELKAR LL+LR FKDVA MLQDYIPSL+
Sbjct  60   AALVLSPRLEIALELKARCLLYLRCFKDVAYMLQDYIPSLR  100



>ref|XP_009790563.1| PREDICTED: uncharacterized protein LOC104238005 [Nicotiana sylvestris]
Length=585

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 81/94 (86%), Gaps = 1/94 (1%)
 Frame = +2

Query  143  TTMSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSP  322
            +TM+ SP  + GEKK HWW++N+KI +KY+KDAK+LIA+Q+   +ASAL +L+AAL+LSP
Sbjct  8    STMAASPTLSCGEKK-HWWISNKKIVEKYIKDAKILIATQETNEIASALGLLEAALVLSP  66

Query  323  RLELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            RLE+A+ELKAR LL+LR FKDVA MLQDYIPSL+
Sbjct  67   RLEIALELKARCLLYLRCFKDVAYMLQDYIPSLR  100



>ref|XP_010542840.1| PREDICTED: uncharacterized protein LOC104815921 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010542841.1| PREDICTED: uncharacterized protein LOC104815921 isoform X2 [Tarenaya 
hassleriana]
Length=534

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 77/92 (84%), Gaps = 1/92 (1%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRL  328
            M+  P   GGEKK HWWL NRKI +KY+KDA+ LI++QDP  +ASAL  LDAAL LSPR 
Sbjct  1    MAVHPFLNGGEKK-HWWLRNRKIVEKYMKDARSLISTQDPEDVASALRFLDAALSLSPRY  59

Query  329  ELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            ELA+E+KAR+LL+LRRFKDVADMLQD+IPSL+
Sbjct  60   ELALEIKARSLLYLRRFKDVADMLQDHIPSLR  91



>ref|XP_010542842.1| PREDICTED: uncharacterized protein LOC104815921 isoform X3 [Tarenaya 
hassleriana]
Length=518

 Score =   130 bits (328),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 77/92 (84%), Gaps = 1/92 (1%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRL  328
            M+  P   GGEKK HWWL NRKI +KY+KDA+ LI++QDP  +ASAL  LDAAL LSPR 
Sbjct  1    MAVHPFLNGGEKK-HWWLRNRKIVEKYMKDARSLISTQDPEDVASALRFLDAALSLSPRY  59

Query  329  ELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            ELA+E+KAR+LL+LRRFKDVADMLQD+IPSL+
Sbjct  60   ELALEIKARSLLYLRRFKDVADMLQDHIPSLR  91



>emb|CDY07094.1| BnaCnng01090D [Brassica napus]
Length=517

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  182  KKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTL  361
            +K+HWWL N+KI DKYVK+AK LIASQDP  + SALN+LD+AL +SPR ELA+ELKAR+L
Sbjct  6    EKKHWWLRNKKIVDKYVKEAKNLIASQDPNDVESALNLLDSALSVSPRYELALELKARSL  65

Query  362  LFLRRFKDVADMLQDYIPSLK  424
            L+LRRFKDVADML DYIPSLK
Sbjct  66   LYLRRFKDVADMLHDYIPSLK  86



>ref|XP_002874939.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH51198.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
Length=544

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 74/83 (89%), Gaps = 1/83 (1%)
 Frame = +2

Query  176  GEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKAR  355
            GEKK HWWL N+KI DKY+K+AK LIASQDP  + SALN+L++AL +SPR ELA+ELKAR
Sbjct  5    GEKK-HWWLRNKKIVDKYMKEAKNLIASQDPNDVKSALNLLESALSVSPRYELALELKAR  63

Query  356  TLLFLRRFKDVADMLQDYIPSLK  424
            +LL+LRRFKDVADMLQDYIPSLK
Sbjct  64   SLLYLRRFKDVADMLQDYIPSLK  86



>ref|XP_011079570.1| PREDICTED: uncharacterized protein LOC105163060 [Sesamum indicum]
Length=583

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 77/89 (87%), Gaps = 1/89 (1%)
 Frame = +2

Query  158  SPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELA  337
            +P   GGEKK HWWLTNRK+ ++YV++AK+LIA+QD   +A+AL +L+AAL ++PR+E+A
Sbjct  13   TPSIVGGEKK-HWWLTNRKMVERYVREAKMLIATQDKSEIAAALGILEAALSMAPRMEVA  71

Query  338  MELKARTLLFLRRFKDVADMLQDYIPSLK  424
            +ELKAR LL LRRFK+VADMLQDYIPSLK
Sbjct  72   LELKARCLLHLRRFKEVADMLQDYIPSLK  100



>ref|NP_192119.2| Heat shock protein DnaJ with tetratricopeptide repeat [Arabidopsis 
thaliana]
 gb|AAO42881.1| At4g02100 [Arabidopsis thaliana]
 dbj|BAE99548.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE82124.1| Heat shock protein DnaJ with tetratricopeptide repeat [Arabidopsis 
thaliana]
Length=546

 Score =   128 bits (321),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 74/83 (89%), Gaps = 1/83 (1%)
 Frame = +2

Query  176  GEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKAR  355
            GEKK HWWL N+KI DKY+K+AK LIASQDP  + SALN+L++AL +SPR ELA+ELKAR
Sbjct  5    GEKK-HWWLRNKKIVDKYMKEAKSLIASQDPNDVKSALNLLESALSVSPRYELALELKAR  63

Query  356  TLLFLRRFKDVADMLQDYIPSLK  424
            +LL+LRR+KDVADMLQDYIPSLK
Sbjct  64   SLLYLRRYKDVADMLQDYIPSLK  86



>ref|XP_007199776.1| hypothetical protein PRUPE_ppa003704mg [Prunus persica]
 gb|EMJ00975.1| hypothetical protein PRUPE_ppa003704mg [Prunus persica]
Length=555

 Score =   128 bits (321),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 76/89 (85%), Gaps = 1/89 (1%)
 Frame = +2

Query  158  SPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELA  337
            SPC +  EKK HWWL++RKI +KY++DA+ LIA+ +   +ASA+ +LDAAL +SPRLE A
Sbjct  5    SPCLSSNEKK-HWWLSSRKIVEKYMRDARSLIATHEQSEIASAVGLLDAALAISPRLEQA  63

Query  338  MELKARTLLFLRRFKDVADMLQDYIPSLK  424
            +ELKAR+LL+LRRFKDVADMLQDYIPSLK
Sbjct  64   LELKARSLLYLRRFKDVADMLQDYIPSLK  92



>emb|CDY67245.1| BnaAnng23890D [Brassica napus]
Length=517

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  182  KKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTL  361
            +K+HWWL N+KI DKY+K+AK LIASQDP  + SALN+LD+AL +SPR ELA+ELKAR+L
Sbjct  6    EKKHWWLRNKKIVDKYMKEAKNLIASQDPNDVESALNLLDSALSVSPRYELALELKARSL  65

Query  362  LFLRRFKDVADMLQDYIPSLK  424
            L+LRRFKDVADML DYIPSLK
Sbjct  66   LYLRRFKDVADMLHDYIPSLK  86



>ref|XP_009111317.1| PREDICTED: uncharacterized protein LOC103836775 [Brassica rapa]
Length=515

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  182  KKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTL  361
            +K+HWWL N+KI DKY+K+AK LIASQDP  + SALN+LD+AL +SPR ELA+ELKAR+L
Sbjct  6    EKKHWWLRNKKIVDKYMKEAKNLIASQDPNDVESALNLLDSALSVSPRYELALELKARSL  65

Query  362  LFLRRFKDVADMLQDYIPSLK  424
            L+LRRFKDVADML DYIPSLK
Sbjct  66   LYLRRFKDVADMLHDYIPSLK  86



>ref|XP_008235190.1| PREDICTED: uncharacterized protein LOC103334043 [Prunus mume]
Length=612

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 76/89 (85%), Gaps = 1/89 (1%)
 Frame = +2

Query  158  SPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELA  337
            SPC +  EKK HWWL++RKI +KY++DA+ LIA+ +   +ASA+ +LDAAL +SPRLE A
Sbjct  23   SPCLSSNEKK-HWWLSSRKIVEKYMRDARSLIATHEQSEIASAVGLLDAALAISPRLEQA  81

Query  338  MELKARTLLFLRRFKDVADMLQDYIPSLK  424
            +ELKAR+LL+LRRFKDVADMLQDYIPSLK
Sbjct  82   LELKARSLLYLRRFKDVADMLQDYIPSLK  110



>gb|KHN19224.1| hypothetical protein glysoja_041576 [Glycine soja]
Length=573

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  182  KKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTL  361
            +K+HWWLTNRKI +KY+KDA+ LIA+QD   +ASALN++DAAL +SPR + A+EL+AR L
Sbjct  12   EKKHWWLTNRKIVEKYIKDARSLIATQDQSEIASALNLVDAALAISPRFDQALELRARAL  71

Query  362  LFLRRFKDVADMLQDYIPSLK  424
            L+LRRFK+VADMLQDYIPSL+
Sbjct  72   LYLRRFKEVADMLQDYIPSLR  92



>ref|XP_003521588.1| PREDICTED: dnaJ homolog subfamily C member 3 homolog [Glycine 
max]
Length=570

 Score =   125 bits (315),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  182  KKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTL  361
            +K+HWWLTNRKI +KY+KDA+ LIA+QD   +ASALN++DAAL +SPR + A+EL+AR L
Sbjct  12   EKKHWWLTNRKIVEKYIKDARSLIATQDQSEIASALNLVDAALAISPRFDQALELRARAL  71

Query  362  LFLRRFKDVADMLQDYIPSLK  424
            L+LRRFK+VADMLQDYIPSL+
Sbjct  72   LYLRRFKEVADMLQDYIPSLR  92



>ref|NP_182266.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana]
 gb|AAC62866.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20427.1| unknown protein [Arabidopsis thaliana]
 gb|AAN72168.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE99041.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC10841.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=526

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  185  KQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLL  364
            K+HWW T+RK+ DKY+KDA  L+AS++   +ASAL++LDAAL +SPRLE A+ELKAR+LL
Sbjct  11   KKHWWFTHRKLVDKYIKDATTLMASEEANDVASALHLLDAALSISPRLETALELKARSLL  70

Query  365  FLRRFKDVADMLQDYIPSLK  424
            FLRRFKDVADMLQDYIPSLK
Sbjct  71   FLRRFKDVADMLQDYIPSLK  90



>ref|XP_006396409.1| hypothetical protein EUTSA_v10028558mg [Eutrema salsugineum]
 gb|ESQ37862.1| hypothetical protein EUTSA_v10028558mg [Eutrema salsugineum]
Length=550

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 74/83 (89%), Gaps = 1/83 (1%)
 Frame = +2

Query  176  GEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKAR  355
            GEKK HWWL N+KI DKY+K+A+ LIASQDP  + SAL+++++AL +SPR ELA+ELKAR
Sbjct  5    GEKK-HWWLRNKKIVDKYMKEARNLIASQDPNDVKSALSLIESALSVSPRYELALELKAR  63

Query  356  TLLFLRRFKDVADMLQDYIPSLK  424
            +LL+LRRFKDVADMLQDYIPSLK
Sbjct  64   SLLYLRRFKDVADMLQDYIPSLK  86



>ref|XP_006286487.1| hypothetical protein CARUB_v10000583mg, partial [Capsella rubella]
 gb|EOA19385.1| hypothetical protein CARUB_v10000583mg, partial [Capsella rubella]
Length=570

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 73/83 (88%), Gaps = 1/83 (1%)
 Frame = +2

Query  176  GEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKAR  355
            GEKK HWWL N+KI DKY+K+AK LIASQDP  + SAL++L++AL +SPR ELA+ELKAR
Sbjct  39   GEKK-HWWLRNKKIVDKYMKEAKNLIASQDPNDVKSALDLLESALSVSPRYELALELKAR  97

Query  356  TLLFLRRFKDVADMLQDYIPSLK  424
            +LL+LRRFKDVADML DYIPSLK
Sbjct  98   SLLYLRRFKDVADMLHDYIPSLK  120



>ref|XP_010456075.1| PREDICTED: uncharacterized protein LOC104737571 [Camelina sativa]
Length=545

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 1/83 (1%)
 Frame = +2

Query  176  GEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKAR  355
            GEKK HWWL N+KI DKY+K+A+ LIASQDP  + SAL++L++AL +SPR ELA+ELKAR
Sbjct  5    GEKK-HWWLRNKKIVDKYMKEARNLIASQDPNDVTSALDLLESALSVSPRYELALELKAR  63

Query  356  TLLFLRRFKDVADMLQDYIPSLK  424
            +LL+LRRFKDVADML DYIPSLK
Sbjct  64   SLLYLRRFKDVADMLHDYIPSLK  86



>gb|KFK37483.1| hypothetical protein AALP_AA4G263300 [Arabis alpina]
Length=535

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  185  KQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLL  364
            K+HWW T RK+ +KYVKDA+ LIAS++   +ASA+++LDAAL LSPRLE A+ELKAR+LL
Sbjct  11   KKHWWFTQRKLVEKYVKDARTLIASEESNDVASAIHLLDAALSLSPRLETALELKARSLL  70

Query  365  FLRRFKDVADMLQDYIPSLK  424
            FLRRFK+VADMLQDYIPSLK
Sbjct  71   FLRRFKEVADMLQDYIPSLK  90



>ref|XP_006349200.1| PREDICTED: uncharacterized protein LOC102603853 isoform X2 [Solanum 
tuberosum]
Length=633

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = +2

Query  143  TTMSESPCFA-GGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLS  319
            +TM+ SP  +    +K+HWW++NRKI DKY+KDAK LIA+Q+P  +ASA+N+LDAAL L 
Sbjct  7    STMAASPNSSISCSEKKHWWISNRKIVDKYIKDAKFLIATQEPNEIASAVNLLDAALALL  66

Query  320  PRLELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            PR ELA+ELKAR+LL+LRRFKDVADMLQDYIPSLK
Sbjct  67   PRFELALELKARSLLYLRRFKDVADMLQDYIPSLK  101



>ref|XP_004229402.1| PREDICTED: uncharacterized protein LOC101245693 [Solanum lycopersicum]
Length=616

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = +2

Query  143  TTMSESPCFA-GGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLS  319
            +TM+ SP  +    +K+HWW++NRKI DKY+KDAK LIA+Q+P  +ASA+N+LDAAL L 
Sbjct  7    STMAASPNSSISCSEKKHWWISNRKIVDKYIKDAKFLIATQEPNEIASAVNLLDAALALL  66

Query  320  PRLELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            PR ELA+ELKAR+LL+LRRFKDVADMLQDYIPSLK
Sbjct  67   PRFELALELKARSLLYLRRFKDVADMLQDYIPSLK  101



>ref|XP_010429191.1| PREDICTED: uncharacterized protein LOC104713698 isoform X2 [Camelina 
sativa]
Length=554

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 1/83 (1%)
 Frame = +2

Query  176  GEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKAR  355
            GEKK HWWL N+KI DKY+K+A+ LIASQDP  + SAL++L++AL +SPR ELA+ELKAR
Sbjct  5    GEKK-HWWLRNKKIVDKYMKEARNLIASQDPNDVKSALDLLESALSVSPRYELALELKAR  63

Query  356  TLLFLRRFKDVADMLQDYIPSLK  424
            +LL+LRRFKDVADML DYIPSLK
Sbjct  64   SLLYLRRFKDVADMLHDYIPSLK  86



>ref|XP_004135998.1| PREDICTED: uncharacterized protein LOC101222380 [Cucumis sativus]
Length=508

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  185  KQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLL  364
            K++WWLTNRKI DKYVKDA+ LIA+Q+   +++ALN++DAAL LSPRLE A+ELKAR LL
Sbjct  11   KKNWWLTNRKIVDKYVKDARTLIATQEHREVSAALNLIDAALALSPRLEQALELKARALL  70

Query  365  FLRRFKDVADMLQDYIPSLK  424
             LRRFKDVADMLQDYIPS K
Sbjct  71   CLRRFKDVADMLQDYIPSFK  90



>emb|CDP17084.1| unnamed protein product [Coffea canephora]
Length=582

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 74/85 (87%), Gaps = 1/85 (1%)
 Frame = +2

Query  173  GGEKKQHWWLTNRKIADKYVKDAKVLIAS-QDPGAMASALNVLDAALLLSPRLELAMELK  349
             G+ ++HWW+TN+KI DKY+KDAKVL+ + QD   + SALN+LDAAL LSPRL+LA+ LK
Sbjct  16   AGDNRKHWWVTNKKIVDKYLKDAKVLLGTRQDQSEILSALNLLDAALELSPRLDLALHLK  75

Query  350  ARTLLFLRRFKDVADMLQDYIPSLK  424
            AR+LL+LRRF+DVADMLQDYIPSLK
Sbjct  76   ARSLLYLRRFRDVADMLQDYIPSLK  100



>ref|XP_008451491.1| PREDICTED: uncharacterized protein LOC103492765 [Cucumis melo]
Length=578

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  185  KQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLL  364
            K++WWLTNRKI DKYVKDA+ LIA+Q+   +++ALN++DAAL LSPRLE A+ELKAR LL
Sbjct  11   KKNWWLTNRKIVDKYVKDARTLIATQEHREVSAALNLIDAALALSPRLEQALELKARALL  70

Query  365  FLRRFKDVADMLQDYIPSLK  424
             LRRFKDVADMLQDYIPS K
Sbjct  71   CLRRFKDVADMLQDYIPSFK  90



>ref|XP_010429181.1| PREDICTED: uncharacterized protein LOC104713698 isoform X1 [Camelina 
sativa]
Length=564

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 1/83 (1%)
 Frame = +2

Query  176  GEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKAR  355
            GEKK HWWL N+KI DKY+K+A+ LIASQDP  + SAL++L++AL +SPR ELA+ELKAR
Sbjct  5    GEKK-HWWLRNKKIVDKYMKEARNLIASQDPNDVKSALDLLESALSVSPRYELALELKAR  63

Query  356  TLLFLRRFKDVADMLQDYIPSLK  424
            +LL+LRRFKDVADML DYIPSLK
Sbjct  64   SLLYLRRFKDVADMLHDYIPSLK  86



>gb|KGN45006.1| hypothetical protein Csa_7G407590 [Cucumis sativus]
Length=580

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  185  KQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLL  364
            K++WWLTNRKI DKYVKDA+ LIA+Q+   +++ALN++DAAL LSPRLE A+ELKAR LL
Sbjct  11   KKNWWLTNRKIVDKYVKDARTLIATQEHREVSAALNLIDAALALSPRLEQALELKARALL  70

Query  365  FLRRFKDVADMLQDYIPSLK  424
             LRRFKDVADMLQDYIPS K
Sbjct  71   CLRRFKDVADMLQDYIPSFK  90



>ref|XP_010422635.1| PREDICTED: uncharacterized protein LOC104707890 [Camelina sativa]
Length=548

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 1/83 (1%)
 Frame = +2

Query  176  GEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKAR  355
            GEKK HWWL N+KI DKY+K+A+ LIASQDP  + SAL++L++AL +SPR ELA+ELKAR
Sbjct  5    GEKK-HWWLRNKKIVDKYMKEARNLIASQDPNDVKSALDLLESALSVSPRYELALELKAR  63

Query  356  TLLFLRRFKDVADMLQDYIPSLK  424
            +LL+LRRFKDVADML DYIPSLK
Sbjct  64   SLLYLRRFKDVADMLHDYIPSLK  86



>gb|KDP28241.1| hypothetical protein JCGZ_14012 [Jatropha curcas]
Length=578

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 80/92 (87%), Gaps = 1/92 (1%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRL  328
            M+ SPC +G EKK HWWL+NRKI DKY+KDA+ LIA+Q+   + SALN+LDAAL +SPR 
Sbjct  1    MATSPCLSGSEKK-HWWLSNRKIVDKYIKDARNLIATQEQSDIVSALNLLDAALAVSPRF  59

Query  329  ELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            E+A+ELKAR+LL+LRRFKDVADMLQDYIPSLK
Sbjct  60   EVALELKARSLLYLRRFKDVADMLQDYIPSLK  91



>ref|XP_006349199.1| PREDICTED: uncharacterized protein LOC102603853 isoform X1 [Solanum 
tuberosum]
Length=640

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = +2

Query  143  TTMSESPCFA-GGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLS  319
            +TM+ SP  +    +K+HWW++NRKI DKY+KDAK LIA+Q+P  +ASA+N+LDAAL L 
Sbjct  7    STMAASPNSSISCSEKKHWWISNRKIVDKYIKDAKFLIATQEPNEIASAVNLLDAALALL  66

Query  320  PRLELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            PR ELA+ELKAR+LL+LRRFKDVADMLQDYIPSLK
Sbjct  67   PRFELALELKARSLLYLRRFKDVADMLQDYIPSLK  101



>ref|XP_009134446.1| PREDICTED: uncharacterized protein LOC103858777 [Brassica rapa]
Length=539

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 1/83 (1%)
 Frame = +2

Query  176  GEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKAR  355
            GEKK HWWL N+KI DKY+K+AK LIAS+DP  + SAL++L++AL +SPR ELA+ELKAR
Sbjct  5    GEKK-HWWLRNKKIVDKYMKEAKNLIASKDPNDVESALSLLESALSVSPRYELALELKAR  63

Query  356  TLLFLRRFKDVADMLQDYIPSLK  424
            +LL+LRRFKDVADML DYIPSLK
Sbjct  64   SLLYLRRFKDVADMLHDYIPSLK  86



>ref|XP_002880302.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH56561.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
Length=525

 Score =   123 bits (308),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  185  KQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLL  364
            K+HWW T+RK+ DKY+KDA  L+AS++   +ASAL +LDAAL +SPRLE A+ELKAR+LL
Sbjct  8    KKHWWFTHRKLVDKYIKDATTLMASEEANDVASALPLLDAALSISPRLETALELKARSLL  67

Query  365  FLRRFKDVADMLQDYIPSLK  424
            FLRRFKDVADMLQDYIPSLK
Sbjct  68   FLRRFKDVADMLQDYIPSLK  87



>ref|XP_007051076.1| Heat shock protein DnaJ with tetratricopeptide repeat isoform 
1 [Theobroma cacao]
 ref|XP_007051077.1| Heat shock protein DnaJ with tetratricopeptide repeat isoform 
1 [Theobroma cacao]
 gb|EOX95233.1| Heat shock protein DnaJ with tetratricopeptide repeat isoform 
1 [Theobroma cacao]
 gb|EOX95234.1| Heat shock protein DnaJ with tetratricopeptide repeat isoform 
1 [Theobroma cacao]
Length=587

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRL  328
            M+ SPC +G ++K+HWWL+NRK+ DKY+KDA+ LIA+Q+   +ASAL++LDAAL LSPR 
Sbjct  1    MAVSPCLSGSDQKKHWWLSNRKLVDKYIKDARCLIATQEQNEIASALHLLDAALALSPRF  60

Query  329  ELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            E+A+ELKAR+LL+LRRFKDVADMLQDYIPSLK
Sbjct  61   EIALELKARSLLYLRRFKDVADMLQDYIPSLK  92



>gb|KJB09454.1| hypothetical protein B456_001G143300 [Gossypium raimondii]
Length=585

 Score =   123 bits (309),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRL  328
            M+ SPC +G ++K+HWWLTNRK+ DKY+KDA+ LIA+Q+   +ASALN+LDAAL LSPRL
Sbjct  1    MAVSPCLSGNDQKKHWWLTNRKLVDKYIKDARCLIATQEHNEVASALNLLDAALALSPRL  60

Query  329  ELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            E+A+ELKAR+LL+LRRF+DV DMLQDYIPSLK
Sbjct  61   EVALELKARSLLYLRRFRDVVDMLQDYIPSLK  92



>ref|XP_010468947.1| PREDICTED: uncharacterized protein LOC104749068 [Camelina sativa]
Length=562

 Score =   122 bits (307),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 76/92 (83%), Gaps = 1/92 (1%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRL  328
            M+  P    G+KK HWW T++K+ DKY+KDA+ LIAS++   +ASAL++LDAAL +SPR 
Sbjct  1    MAVYPEVLNGDKK-HWWFTHKKLVDKYIKDARSLIASEEQNDVASALHLLDAALSISPRS  59

Query  329  ELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            E+A+ELKAR+LLFLRRFKDV DMLQDYIPSLK
Sbjct  60   EIALELKARSLLFLRRFKDVVDMLQDYIPSLK  91



>ref|XP_003591422.1| hypothetical protein MTR_1g087270 [Medicago truncatula]
 gb|AES61673.1| DNAJ heat shock amino-terminal domain protein [Medicago truncatula]
Length=593

 Score =   123 bits (308),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  179  EKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKART  358
            EKKQHWWLTNRKI +KY+KDA+ LIA+Q+   + SA+++LD+AL +SP  + A+E+KAR+
Sbjct  12   EKKQHWWLTNRKIVEKYIKDARTLIATQERNEIVSAISLLDSALAISPSSDQALEMKARS  71

Query  359  LLFLRRFKDVADMLQDYIPSLK  424
            LL+LRRFKDVA+MLQDYIPSLK
Sbjct  72   LLYLRRFKDVANMLQDYIPSLK  93



>emb|CDX91806.1| BnaC03g31080D [Brassica napus]
Length=540

 Score =   122 bits (306),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 1/83 (1%)
 Frame = +2

Query  176  GEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKAR  355
            GEKK HWWL N+KI DKY+K+AK LIAS+DP  + SAL++L++AL +SPR ELA+ELKAR
Sbjct  5    GEKK-HWWLRNKKIVDKYMKEAKNLIASKDPNDVESALSLLESALSVSPRYELALELKAR  63

Query  356  TLLFLRRFKDVADMLQDYIPSLK  424
            +LL+LRRFKDVADML DYIPSLK
Sbjct  64   SLLYLRRFKDVADMLYDYIPSLK  86



>ref|XP_010413274.1| PREDICTED: uncharacterized protein LOC104699631 [Camelina sativa]
Length=562

 Score =   122 bits (307),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 76/92 (83%), Gaps = 1/92 (1%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRL  328
            M+  P    G+KK HWW T++K+ DKY+KDA+ LIAS++   +ASAL++LDAAL +SPR 
Sbjct  1    MAVYPEVLNGDKK-HWWFTHKKLVDKYIKDARSLIASEEQNDVASALHLLDAALSISPRS  59

Query  329  ELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            E+A+ELKAR+LLFLRRFKDV DMLQDYIPSLK
Sbjct  60   EIALELKARSLLFLRRFKDVVDMLQDYIPSLK  91



>ref|XP_004172783.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101230551 
[Cucumis sativus]
Length=580

 Score =   122 bits (307),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  185  KQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLL  364
            K++WWLTNR+I DKYVKDA+ LIA+Q+   +++ALN++DAAL LSPRLE A+ELKAR LL
Sbjct  11   KKNWWLTNREIVDKYVKDARTLIATQEHREVSAALNLIDAALALSPRLEQALELKARALL  70

Query  365  FLRRFKDVADMLQDYIPSLK  424
             LRRFKDVADMLQDYIPS K
Sbjct  71   CLRRFKDVADMLQDYIPSFK  90



>ref|XP_006402368.1| hypothetical protein EUTSA_v10005872mg [Eutrema salsugineum]
 gb|ESQ43821.1| hypothetical protein EUTSA_v10005872mg [Eutrema salsugineum]
Length=545

 Score =   122 bits (306),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 75/92 (82%), Gaps = 2/92 (2%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRL  328
            M+  P   GG  K+HWW T++K+ DKY+KDA  L+AS+D  A ASA+++LDAAL +SP L
Sbjct  1    MAVYPLRDGG--KKHWWFTHKKLVDKYIKDATSLMASEDQTAAASAIHILDAALSISPSL  58

Query  329  ELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            E+A+ELKAR LLFLRRFKDVA+MLQDYIPSLK
Sbjct  59   EIALELKARALLFLRRFKDVANMLQDYIPSLK  90



>emb|CDX80104.1| BnaA05g00520D [Brassica napus]
Length=543

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  185  KQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLL  364
            K+HWW T RK+ DKY+KDAK L+AS++   + SAL++LDAAL +SPRLE A+ELKAR+LL
Sbjct  11   KKHWWFTQRKLVDKYIKDAKTLMASEELNDVTSALHLLDAALSMSPRLETALELKARSLL  70

Query  365  FLRRFKDVADMLQDYIPSLK  424
            FLRRFK+VADMLQDYIPSLK
Sbjct  71   FLRRFKEVADMLQDYIPSLK  90



>ref|XP_009142535.1| PREDICTED: uncharacterized protein LOC103866379 [Brassica rapa]
Length=567

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  185  KQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLL  364
            K+HWW T RK+ DKY+KDAK L+AS++   + SAL++LDAAL +SPRLE A+ELKAR+LL
Sbjct  11   KKHWWFTQRKLVDKYIKDAKTLMASEELNDVTSALHLLDAALSMSPRLETALELKARSLL  70

Query  365  FLRRFKDVADMLQDYIPSLK  424
            FLRRFK+VADMLQDYIPSLK
Sbjct  71   FLRRFKEVADMLQDYIPSLK  90



>emb|CDX90954.1| BnaA03g26340D [Brassica napus]
Length=539

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 73/83 (88%), Gaps = 1/83 (1%)
 Frame = +2

Query  176  GEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKAR  355
            GEKK HWWL N+KI DKY+K+AK LIAS+DP  + SAL++L++AL +SPR ELA+ELKAR
Sbjct  5    GEKK-HWWLRNKKIVDKYMKEAKNLIASKDPNDVESALSLLESALSVSPRYELALELKAR  63

Query  356  TLLFLRRFKDVADMLQDYIPSLK  424
            +LL+LRRFKDVADML D+IPSLK
Sbjct  64   SLLYLRRFKDVADMLHDHIPSLK  86



>ref|XP_010512643.1| PREDICTED: uncharacterized protein LOC104788582 [Camelina sativa]
Length=553

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 72/84 (86%), Gaps = 1/84 (1%)
 Frame = +2

Query  173  GGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKA  352
             GEKK HWW T++K+ DKY+KDA+ LI S++   +ASAL++LDAAL +SPR E+A+ELKA
Sbjct  8    NGEKK-HWWFTHKKLVDKYIKDARSLIESEEQNDVASALHLLDAALSISPRSEIALELKA  66

Query  353  RTLLFLRRFKDVADMLQDYIPSLK  424
            R+LLFLRRFKDV DMLQDYIPSLK
Sbjct  67   RSLLFLRRFKDVVDMLQDYIPSLK  90



>emb|CDY55382.1| BnaC04g52000D [Brassica napus]
Length=540

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  185  KQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLL  364
            K+HWW T RK+ DKY+KDAK L+AS++   + SA+++LDAAL +SPRLE A+ELKAR+LL
Sbjct  11   KKHWWFTQRKLVDKYIKDAKTLMASEELNDVTSAVHLLDAALSMSPRLETALELKARSLL  70

Query  365  FLRRFKDVADMLQDYIPSLK  424
            FLRRFK+VADMLQDYIPSLK
Sbjct  71   FLRRFKEVADMLQDYIPSLK  90



>ref|XP_010523979.1| PREDICTED: uncharacterized protein LOC104802196 [Tarenaya hassleriana]
Length=550

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +2

Query  185  KQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLL  364
            K+HWW T+RK+ DKY+KDA+ LIA++D   +ASA+++L+AAL LSPRLE A+ELKAR+LL
Sbjct  11   KKHWWFTHRKLVDKYIKDARTLIATEDQNDVASAVHLLNAALALSPRLETALELKARSLL  70

Query  365  FLRRFKDVADMLQDYIP  415
            FLRRFKDVADMLQDYIP
Sbjct  71   FLRRFKDVADMLQDYIP  87



>ref|XP_011041432.1| PREDICTED: uncharacterized protein LOC105137405 [Populus euphratica]
Length=587

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 80/93 (86%), Gaps = 1/93 (1%)
 Frame = +2

Query  146  TMSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPR  325
            T S SPC +G EKK HWWL+NRKI DKYVKDA+ LIASQ+   +ASALN+LDAAL LSPR
Sbjct  15   TTSTSPCLSGNEKK-HWWLSNRKIVDKYVKDARNLIASQEKSEIASALNLLDAALALSPR  73

Query  326  LELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
             E+A+ELKAR+LL+L RFKDVADMLQDYIPSLK
Sbjct  74   FEVALELKARSLLYLGRFKDVADMLQDYIPSLK  106



>ref|XP_011042234.1| PREDICTED: uncharacterized protein LOC105137967 [Populus euphratica]
Length=156

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 79/91 (87%), Gaps = 1/91 (1%)
 Frame = +2

Query  152  SESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLE  331
            S SPC +  +KK HWWL+NRKI DKY+KDA+ LIASQ+   +ASAL +LDAAL LSPRLE
Sbjct  4    STSPCPSMNDKK-HWWLSNRKIVDKYIKDARNLIASQEQSEIASALKLLDAALALSPRLE  62

Query  332  LAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            +A+ELKAR+LL+LRRFK+VADMLQDYIPSLK
Sbjct  63   VALELKARSLLYLRRFKEVADMLQDYIPSLK  93



>gb|KFK30725.1| hypothetical protein AALP_AA6G019200 [Arabis alpina]
Length=530

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 73/83 (88%), Gaps = 1/83 (1%)
 Frame = +2

Query  176  GEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKAR  355
            G+KK HWWL N+KI DKY+K+A+ LI++QDP  + SAL+++++AL +SPR E+A+ELKAR
Sbjct  5    GDKK-HWWLRNKKIVDKYMKEARNLISNQDPNDVKSALDLIESALSVSPRYEIALELKAR  63

Query  356  TLLFLRRFKDVADMLQDYIPSLK  424
            +LL+LRRF DVADMLQDYIPSLK
Sbjct  64   SLLYLRRFNDVADMLQDYIPSLK  86



>gb|KHG28204.1| DnaJ subfamily C member 7 [Gossypium arboreum]
Length=575

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRL  328
            M+ SPC +  ++K+HWWL+NRK+ DKY+KDA+ LIA+ +   + SALN+LDAAL +SPR+
Sbjct  1    MAVSPCLSVNDQKKHWWLSNRKVVDKYIKDARSLIATHEQSEIVSALNLLDAALAISPRI  60

Query  329  ELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            E+A+ELKAR+LL+LRRFKDVAD+LQDYIPSLK
Sbjct  61   EVALELKARSLLYLRRFKDVADLLQDYIPSLK  92



>ref|XP_009378699.1| PREDICTED: uncharacterized protein LOC103967162 isoform X1 [Pyrus 
x bretschneideri]
Length=610

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  182  KKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTL  361
            +K+HWWL+ RKI +KY+KDA+ LIA+ +   +ASA+ +LDAAL +SPRLE A+ELKAR+L
Sbjct  30   EKKHWWLSTRKIVEKYMKDARSLIATHEYSEVASAVGLLDAALAISPRLEEALELKARSL  89

Query  362  LFLRRFKDVADMLQDYIPSLK  424
            L+LRRFK+VADMLQDYIPSLK
Sbjct  90   LYLRRFKEVADMLQDYIPSLK  110



>ref|XP_010069868.1| PREDICTED: uncharacterized protein LOC104456711 [Eucalyptus grandis]
 gb|KCW58372.1| hypothetical protein EUGRSUZ_H01056 [Eucalyptus grandis]
Length=630

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 77/91 (85%), Gaps = 1/91 (1%)
 Frame = +2

Query  152  SESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLE  331
            S SPC  GGEKK HWWLTNRK   KY+KDAK L+A+Q+ G +ASAL++LD AL LSPRLE
Sbjct  31   SSSPCLTGGEKK-HWWLTNRKAVGKYIKDAKNLMATQEAGEIASALSLLDLALALSPRLE  89

Query  332  LAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            LA+ELKAR LL LRRFKDVADMLQDYIPSLK
Sbjct  90   LALELKARCLLQLRRFKDVADMLQDYIPSLK  120



>ref|XP_010544976.1| PREDICTED: uncharacterized protein LOC104817463 [Tarenaya hassleriana]
Length=556

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  185  KQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLL  364
            K+HWW ++RK+ +KY+KDA+ LIAS+D   +ASA+++LDAAL  SPRLE A+ELKAR+LL
Sbjct  11   KKHWWFSHRKLVEKYIKDARALIASEDHDNVASAVHLLDAALAFSPRLETALELKARSLL  70

Query  365  FLRRFKDVADMLQDYIPSL  421
            FLRRFKDVADMLQ YIPS+
Sbjct  71   FLRRFKDVADMLQGYIPSI  89



>gb|KDO87034.1| hypothetical protein CISIN_1g0080392mg, partial [Citrus sinensis]
Length=160

 Score =   113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 79/92 (86%), Gaps = 1/92 (1%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRL  328
            M+ SP     EKK HWWL+NRKI DKY++DA+ LIA+Q+   +ASAL++LDAAL LSPRL
Sbjct  1    MATSPALTCTEKK-HWWLSNRKIVDKYIRDARTLIATQEHSEIASALSLLDAALALSPRL  59

Query  329  ELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            ELA+ELKAR+LL+LRRFKDVADMLQDYIPSLK
Sbjct  60   ELALELKARSLLYLRRFKDVADMLQDYIPSLK  91



>gb|KJB49845.1| hypothetical protein B456_008G140700 [Gossypium raimondii]
Length=575

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRL  328
            M+ SPC +  ++K+HWWL+NRK+ DKY+KDA+ LIA+ +   + SALN+LDAAL +SPR 
Sbjct  1    MAVSPCLSVNDQKKHWWLSNRKVVDKYIKDARSLIATHEQSEIVSALNLLDAALAISPRF  60

Query  329  ELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            E+A+ELKAR+LL+LRRFKDVAD+LQDYIPSLK
Sbjct  61   EVALELKARSLLYLRRFKDVADLLQDYIPSLK  92



>ref|XP_006397939.1| hypothetical protein EUTSA_v10001383mg [Eutrema salsugineum]
 gb|ESQ39392.1| hypothetical protein EUTSA_v10001383mg [Eutrema salsugineum]
Length=554

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  185  KQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLL  364
            K+HWW T RK+ DKY+KDA+ L+AS++   + SA+++LDAAL +SPRLE A+ELKAR+LL
Sbjct  11   KKHWWFTQRKLVDKYIKDARTLMASEELNDVTSAVHLLDAALSISPRLETALELKARSLL  70

Query  365  FLRRFKDVADMLQDYIPSLK  424
            FLRRFK+VADML DYIPSLK
Sbjct  71   FLRRFKEVADMLHDYIPSLK  90



>emb|CDY11427.1| BnaA09g39930D [Brassica napus]
Length=556

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +2

Query  179  EKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKART  358
            + K HWW T++K+ D Y+KDAK L+AS+D    ASA+++LDAAL +SPR E+A+ELKAR 
Sbjct  9    DNKMHWWFTHKKLVDNYIKDAKSLMASEDQNDAASAIHILDAALTISPRSEIALELKARA  68

Query  359  LLFLRRFKDVADMLQDYIPSLK  424
            LLFLRR+KDVA+MLQDYIPSLK
Sbjct  69   LLFLRRYKDVANMLQDYIPSLK  90



>ref|XP_010038279.1| PREDICTED: uncharacterized protein LOC104426813 [Eucalyptus grandis]
 gb|KCW50105.1| hypothetical protein EUGRSUZ_K03539 [Eucalyptus grandis]
Length=603

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  182  KKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTL  361
            +++ WWL+NRKI DK ++DA+ LIA+++   +ASA+++LD+AL LSPR ELA+ELKAR+L
Sbjct  40   ERKPWWLSNRKIVDKCIRDARNLIATREKSEVASAISLLDSALALSPRFELALELKARSL  99

Query  362  LFLRRFKDVADMLQDYIPSLK  424
            LFLRRFKDVADMLQDYIPSLK
Sbjct  100  LFLRRFKDVADMLQDYIPSLK  120



>ref|NP_191816.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana]
 gb|AAL31887.1|AF419555_1 AT3g62570/T12C14_270 [Arabidopsis thaliana]
 gb|AAN73304.1| At3g62570/T12C14_270 [Arabidopsis thaliana]
 gb|AEE80365.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=552

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  185  KQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLL  364
            K+HWW T++KI DKY+KDA+ L+ S++   +ASA+++LDAAL +SPR E A+ELKAR+LL
Sbjct  11   KKHWWFTHKKIVDKYIKDARSLMESEEQNDVASAIHLLDAALSISPRSETALELKARSLL  70

Query  365  FLRRFKDVADMLQDYIPSLK  424
            FLRRFKDV DMLQDYIPSLK
Sbjct  71   FLRRFKDVVDMLQDYIPSLK  90



>ref|XP_002320311.2| DNAJ heat shock N-terminal domain-containing family protein [Populus 
trichocarpa]
 gb|EEE98626.2| DNAJ heat shock N-terminal domain-containing family protein [Populus 
trichocarpa]
Length=547

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 78/88 (89%), Gaps = 1/88 (1%)
 Frame = +2

Query  161  PCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAM  340
            PC +G EKK HWWL+NRKI DKY+KDA+ LIASQ+   +ASALN+LDAAL LSPR E+A+
Sbjct  20   PCLSGNEKK-HWWLSNRKIVDKYIKDARNLIASQEMSEIASALNLLDAALALSPRFEVAL  78

Query  341  ELKARTLLFLRRFKDVADMLQDYIPSLK  424
            ELKAR+LL+LRRFKDVADMLQDYIPSLK
Sbjct  79   ELKARSLLYLRRFKDVADMLQDYIPSLK  106



>gb|KHG03065.1| DnaJ subfamily C member 7 [Gossypium arboreum]
Length=571

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRL  328
            M+ SPC +  ++K+HWW++NRK+ +KYVKDA+ L+A+Q+   MASALN+LDAAL LSPR 
Sbjct  1    MAVSPCLSANDQKKHWWVSNRKLVEKYVKDARCLMATQEQSEMASALNLLDAALALSPRF  60

Query  329  ELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            E+A+ELKAR LL+LRRFKDVADMLQDYIPS+K
Sbjct  61   EIALELKARCLLYLRRFKDVADMLQDYIPSIK  92



>emb|CDX76643.1| BnaC08g32290D [Brassica napus]
Length=556

 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +2

Query  179  EKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKART  358
            + K HWW T++K+ D Y+KDAK L+AS+D    ASA+++LDAAL +SPR E+A+ELKAR 
Sbjct  9    DNKMHWWFTHKKLVDNYIKDAKSLMASEDQNDAASAIHILDAALSISPRSEIALELKARA  68

Query  359  LLFLRRFKDVADMLQDYIPSLK  424
            LLFLRR+KDVA+MLQDYIPSLK
Sbjct  69   LLFLRRYKDVANMLQDYIPSLK  90



>ref|XP_009382507.1| PREDICTED: uncharacterized protein LOC103970452 [Musa acuminata 
subsp. malaccensis]
Length=564

 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 2/91 (2%)
 Frame = +2

Query  152  SESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLE  331
            + SPC A   +++HWWL NRK+ DK +++A+ LI +Q+   +++A+ +LDAAL LSPRLE
Sbjct  3    ASSPCLA--TERKHWWLINRKVVDKNLREARALITTQEQSNVSTAVGLLDAALALSPRLE  60

Query  332  LAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
             A+ELKAR+LLFLRRF++VADMLQDYIPS K
Sbjct  61   AALELKARSLLFLRRFREVADMLQDYIPSYK  91



>gb|KJB41823.1| hypothetical protein B456_007G123400 [Gossypium raimondii]
Length=570

 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRL  328
            M+ SPC +  ++K+HWW++NRK+ +KYVKDA+ L+A+Q+   MASALN+LDAAL LSPR 
Sbjct  1    MAVSPCLSANDQKKHWWVSNRKLVEKYVKDARCLMATQEQSEMASALNLLDAALALSPRF  60

Query  329  ELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            E+A+ELKAR LL+LRRFKDVADMLQDYIPS+K
Sbjct  61   EIALELKARCLLYLRRFKDVADMLQDYIPSIK  92



>ref|XP_006855297.1| hypothetical protein AMTR_s00057p00052440 [Amborella trichopoda]
 gb|ERN16764.1| hypothetical protein AMTR_s00057p00052440 [Amborella trichopoda]
Length=526

 Score =   117 bits (292),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 76/92 (83%), Gaps = 2/92 (2%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRL  328
            MS SP      +K+ WWL+N+K+A+K++KDA+VL++SQDP  +++ALN+LDAAL L P+ 
Sbjct  1    MSSSP--TSQAEKKPWWLSNKKVAEKHLKDARVLLSSQDPTDISTALNLLDAALSLYPKW  58

Query  329  ELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            ELAMELKARTLL+LRRFKD+A MLQD IPS K
Sbjct  59   ELAMELKARTLLYLRRFKDIAIMLQDDIPSFK  90



>ref|XP_002515301.1| heat shock protein binding protein, putative [Ricinus communis]
 gb|EEF47285.1| heat shock protein binding protein, putative [Ricinus communis]
Length=587

 Score =   117 bits (293),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 80/92 (87%), Gaps = 1/92 (1%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRL  328
            M+ SPC    EKK HWWLTNRK+  KY+KDA+ LIA+Q+ G +ASALN+LDAAL LSPRL
Sbjct  1    MATSPCSNATEKK-HWWLTNRKVVYKYIKDARNLIATQEHGDIASALNLLDAALALSPRL  59

Query  329  ELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            E+A+ELKAR+LL+LRRFKDVADMLQDYIPSLK
Sbjct  60   EVALELKARSLLYLRRFKDVADMLQDYIPSLK  91



>ref|XP_008386730.1| PREDICTED: uncharacterized protein LOC103449222 [Malus domestica]
Length=608

 Score =   117 bits (294),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  182  KKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTL  361
            +K+HWWL+ RK+ +KY+KDA+ LIA+ +   +ASA+ +LDAAL ++PRLE A+ELKAR+L
Sbjct  30   EKKHWWLSTRKVVEKYMKDARSLIATNEHSEIASAVGLLDAALSITPRLEEALELKARSL  89

Query  362  LFLRRFKDVADMLQDYIPSLK  424
            L+LRRFK+VADMLQDYIPSLK
Sbjct  90   LYLRRFKEVADMLQDYIPSLK  110



>ref|XP_008350098.1| PREDICTED: uncharacterized protein LOC103413409 [Malus domestica]
Length=594

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  182  KKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTL  361
            +K+HWWL+ RK+ +KY+KDA+ LIA+ +   +ASA+ +LDAAL ++PRLE A+ELKAR+L
Sbjct  16   EKKHWWLSTRKVVEKYMKDARSLIATNEHSEIASAVGLLDAALSITPRLEEALELKARSL  75

Query  362  LFLRRFKDVADMLQDYIPSLK  424
            L+LRRFK+VADMLQDYIPSLK
Sbjct  76   LYLRRFKEVADMLQDYIPSLK  96



>ref|XP_008369054.1| PREDICTED: uncharacterized protein LOC103432634 isoform X1 [Malus 
domestica]
Length=614

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  182  KKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTL  361
            +K+HWWL+ RKI +KY+KDA+ LIA+ +   +ASA+ +LDAAL +SPRLE A+ELKAR+L
Sbjct  30   EKKHWWLSTRKIVEKYMKDARSLIATHEYSEVASAVGLLDAALAVSPRLEEALELKARSL  89

Query  362  LFLRRFKDVADMLQDYIPSL  421
            L+LRRFK+VADMLQDYIPSL
Sbjct  90   LYLRRFKEVADMLQDYIPSL  109



>ref|XP_002302757.2| DNAJ heat shock N-terminal domain-containing family protein [Populus 
trichocarpa]
 gb|EEE82030.2| DNAJ heat shock N-terminal domain-containing family protein [Populus 
trichocarpa]
Length=565

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 79/91 (87%), Gaps = 1/91 (1%)
 Frame = +2

Query  152  SESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLE  331
            S SPC +  EKK HWWL+NRKI DKY+KDA+ LIAS++   +ASAL +LDAAL LSPRLE
Sbjct  4    STSPCLSMNEKK-HWWLSNRKIVDKYIKDARNLIASEEQSEIASALKLLDAALALSPRLE  62

Query  332  LAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            +A+ELKAR+LL+LRRFK+VADMLQDYIPSLK
Sbjct  63   VALELKARSLLYLRRFKEVADMLQDYIPSLK  93



>ref|XP_009116918.1| PREDICTED: uncharacterized protein LOC103842063 [Brassica rapa]
Length=556

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  179  EKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKART  358
            + K HWW T++K+ D Y+KDAK L+AS+D    ASA+++LDAAL +SPR E+A+ELKAR 
Sbjct  9    DNKMHWWFTHKKLVDNYIKDAKSLMASEDQNDAASAIHILDAALSISPRSEIALELKARA  68

Query  359  LLFLRRFKDVADMLQDYIPSL  421
            LLFLRR+KDVA+MLQDYIPSL
Sbjct  69   LLFLRRYKDVANMLQDYIPSL  89



>ref|XP_009339787.1| PREDICTED: uncharacterized protein LOC103931979 [Pyrus x bretschneideri]
Length=618

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  182  KKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTL  361
            +K+HWWL+ RK+ +KY+KDA+ LIA+ +   +ASA+ +LDAAL +SP LE A+ELKAR+L
Sbjct  30   EKKHWWLSTRKVVEKYMKDARSLIATNEHSEIASAVGLLDAALSISPHLEEALELKARSL  89

Query  362  LFLRRFKDVADMLQDYIPSLK  424
            L+LRRFK+VADMLQDYIPSLK
Sbjct  90   LYLRRFKEVADMLQDYIPSLK  110



>ref|XP_009401632.1| PREDICTED: uncharacterized protein LOC103985610 [Musa acuminata 
subsp. malaccensis]
Length=560

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 74/89 (83%), Gaps = 2/89 (2%)
 Frame = +2

Query  158  SPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELA  337
            SP  A   +K+HWWL+NRK+ DKY+++A+ LIA+Q+   +A+A+ +LDA L+ SPRLE A
Sbjct  5    SPSLAA--EKKHWWLSNRKVVDKYLREARSLIATQELSNVAAAVGLLDATLVHSPRLEAA  62

Query  338  MELKARTLLFLRRFKDVADMLQDYIPSLK  424
            +EL+AR+LLFLRRF++VADMLQDYIPS K
Sbjct  63   LELRARSLLFLRRFREVADMLQDYIPSYK  91



>ref|XP_002876678.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH52937.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
Length=551

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  185  KQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLL  364
            K+HWW T++KI DKY++DA+ L++S++   +ASA+++LDAAL +SPR E A+ELKAR+LL
Sbjct  11   KKHWWFTHKKIVDKYIQDARSLMSSEEQNDVASAIHLLDAALSISPRSETALELKARSLL  70

Query  365  FLRRFKDVADMLQDYIPSLK  424
            FLRRFKDV +MLQDYIPSLK
Sbjct  71   FLRRFKDVVNMLQDYIPSLK  90



>ref|XP_004156824.1| PREDICTED: uncharacterized protein LOC101230027 [Cucumis sativus]
Length=558

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 75/89 (84%), Gaps = 1/89 (1%)
 Frame = +2

Query  158  SPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELA  337
            SP  A  EKKQ WWL+++++A++YVKDA+ LIAS     + SALN+LDAAL+L+PR E A
Sbjct  5    SPSLALTEKKQ-WWLSHKQMANRYVKDARCLIASGGENEVVSALNLLDAALVLAPRYEQA  63

Query  338  MELKARTLLFLRRFKDVADMLQDYIPSLK  424
            +ELKAR+LL+LRR+KDVADMLQ+Y+PS++
Sbjct  64   LELKARSLLYLRRYKDVADMLQEYLPSMR  92



>ref|XP_004152231.1| PREDICTED: uncharacterized protein LOC101221887 [Cucumis sativus]
 gb|KGN52845.1| hypothetical protein Csa_4G003100 [Cucumis sativus]
Length=558

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 75/89 (84%), Gaps = 1/89 (1%)
 Frame = +2

Query  158  SPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELA  337
            SP  A  EKKQ WWL+++++A++YVKDA+ LIAS     + SALN+LDAAL+L+PR E A
Sbjct  5    SPSLALTEKKQ-WWLSHKQMANRYVKDARCLIASGGENEVVSALNLLDAALVLAPRYEQA  63

Query  338  MELKARTLLFLRRFKDVADMLQDYIPSLK  424
            +ELKAR+LL+LRR+KDVADMLQ+Y+PS++
Sbjct  64   LELKARSLLYLRRYKDVADMLQEYLPSMR  92



>ref|XP_010087254.1| hypothetical protein L484_009763 [Morus notabilis]
 gb|EXB28604.1| hypothetical protein L484_009763 [Morus notabilis]
Length=569

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 78/89 (88%), Gaps = 1/89 (1%)
 Frame = +2

Query  158  SPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELA  337
            SPC +  EKK HWWL+NRKI DKY+KDA+ LIA+Q+   +ASALN+L+AAL LSPRLE A
Sbjct  5    SPCLSSNEKK-HWWLSNRKIVDKYIKDARNLIATQEQSEVASALNLLEAALALSPRLEQA  63

Query  338  MELKARTLLFLRRFKDVADMLQDYIPSLK  424
            +ELKA++LL+LRRFKDVADMLQDYIPSLK
Sbjct  64   LELKAKSLLYLRRFKDVADMLQDYIPSLK  92



>ref|XP_006290836.1| hypothetical protein CARUB_v10016946mg [Capsella rubella]
 gb|EOA23734.1| hypothetical protein CARUB_v10016946mg [Capsella rubella]
Length=560

 Score =   114 bits (286),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  185  KQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLL  364
            K+HWW T++KI DKY+KDA+ LIAS++   +ASA+++LDAAL +SP  E A+ELKAR+LL
Sbjct  11   KKHWWFTHKKIVDKYIKDARSLIASEEQNDVASAIHLLDAALSISPISETALELKARSLL  70

Query  365  FLRRFKDVADMLQDYIPSLK  424
            FLRR+KDV D+LQDYIPSLK
Sbjct  71   FLRRYKDVVDLLQDYIPSLK  90



>ref|XP_006492317.1| PREDICTED: uncharacterized protein LOC102625036 isoform X2 [Citrus 
sinensis]
Length=543

 Score =   114 bits (285),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 79/92 (86%), Gaps = 1/92 (1%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRL  328
            M+ SP     EKK HWWL+NRKI DKY++DA+ LIA+Q+   +ASAL++LDAAL LSPRL
Sbjct  1    MATSPALTCTEKK-HWWLSNRKIVDKYIRDARTLIATQEHSEIASALSLLDAALALSPRL  59

Query  329  ELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            ELA+ELKAR+LL+LRRFKDVADMLQDYIPSLK
Sbjct  60   ELALELKARSLLYLRRFKDVADMLQDYIPSLK  91



>ref|XP_011042235.1| PREDICTED: uncharacterized protein LOC105137969 [Populus euphratica]
Length=575

 Score =   114 bits (286),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 79/91 (87%), Gaps = 1/91 (1%)
 Frame = +2

Query  152  SESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLE  331
            S SPC +  +KK HWWL+NRKI DKY+KDA+ LIASQ+   +ASAL +LDAAL LSPRLE
Sbjct  4    STSPCPSMNDKK-HWWLSNRKIVDKYIKDARNLIASQEQSEIASALKLLDAALALSPRLE  62

Query  332  LAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            +A+ELKAR+LL+LRRFK+VADMLQDYIPSLK
Sbjct  63   VALELKARSLLYLRRFKEVADMLQDYIPSLK  93



>ref|XP_009411639.1| PREDICTED: uncharacterized protein LOC103993339 [Musa acuminata 
subsp. malaccensis]
Length=557

 Score =   114 bits (285),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 73/89 (82%), Gaps = 2/89 (2%)
 Frame = +2

Query  158  SPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELA  337
            SP  A   +++HWWL+NRK+ DK +++A+VLIA+Q+   ++ A+ +LDAAL LSPRLE A
Sbjct  5    SPSLAA--ERKHWWLSNRKVVDKNLREARVLIATQEQSNVSKAVGLLDAALALSPRLEAA  62

Query  338  MELKARTLLFLRRFKDVADMLQDYIPSLK  424
            +ELKAR+LLFL RF++VADMLQDYIPS K
Sbjct  63   LELKARSLLFLHRFREVADMLQDYIPSHK  91



>ref|XP_006444469.1| hypothetical protein CICLE_v10019452mg [Citrus clementina]
 ref|XP_006492316.1| PREDICTED: uncharacterized protein LOC102625036 isoform X1 [Citrus 
sinensis]
 gb|ESR57709.1| hypothetical protein CICLE_v10019452mg [Citrus clementina]
Length=580

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 79/92 (86%), Gaps = 1/92 (1%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRL  328
            M+ SP     EKK HWWL+NRKI DKY++DA+ LIA+Q+   +ASAL++LDAAL LSPRL
Sbjct  1    MATSPALTCTEKK-HWWLSNRKIVDKYIRDARTLIATQEHSEIASALSLLDAALALSPRL  59

Query  329  ELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            ELA+ELKAR+LL+LRRFKDVADMLQDYIPSLK
Sbjct  60   ELALELKARSLLYLRRFKDVADMLQDYIPSLK  91



>gb|KFK35426.1| hypothetical protein AALP_AA5G283000 [Arabis alpina]
Length=546

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  185  KQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLL  364
            K+HWW T++K+ DKY+KDA+ L+ S++     SA+ +LDAAL +SPR E A+ELKAR LL
Sbjct  11   KKHWWFTHKKLVDKYIKDARSLMESEEQNDYVSAIQLLDAALSISPRFETALELKARALL  70

Query  365  FLRRFKDVADMLQDYIPSLK  424
            FLRR+KDVA+MLQDYIPSLK
Sbjct  71   FLRRYKDVANMLQDYIPSLK  90



>gb|KJB24404.1| hypothetical protein B456_004G143900 [Gossypium raimondii]
Length=568

 Score =   112 bits (279),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRL  328
            M+ SP     + K+HWW+TNRK+ DKYVKDA+ LIA+++   + SAL +LDAAL LSPR 
Sbjct  1    MAVSPSSIATDHKKHWWVTNRKLVDKYVKDARFLIATRERNDVTSALVLLDAALALSPRS  60

Query  329  ELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            ELA+ELKAR+LL+LRRF+DVADMLQDYIPSLK
Sbjct  61   ELALELKARSLLYLRRFRDVADMLQDYIPSLK  92



>ref|XP_010921523.1| PREDICTED: uncharacterized protein LOC105045059 [Elaeis guineensis]
Length=577

 Score =   112 bits (279),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 78/92 (85%), Gaps = 2/92 (2%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRL  328
            MS SP  +   +K+HWWL+NRKI DKYV+DA+ LIA+Q+P  +++A+ +LDAAL LSPRL
Sbjct  1    MSGSPSLSA--EKKHWWLSNRKIVDKYVRDARSLIATQEPSDVSAAVALLDAALALSPRL  58

Query  329  ELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            E+A+ELKAR+LLFLRRF++VADMLQDYIP  K
Sbjct  59   EVALELKARSLLFLRRFREVADMLQDYIPGYK  90



>ref|XP_004495910.1| PREDICTED: uncharacterized protein LOC101505533 [Cicer arietinum]
Length=587

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRL  328
            M+ +  F    +K+HWWLTNRKIA+KY+KDA+ LIA+Q+   + SAL++LDAAL +SPRL
Sbjct  1    MAVTTTFLSATEKKHWWLTNRKIAEKYIKDARSLIATQERNEIVSALSLLDAALAISPRL  60

Query  329  ELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            + A+ELKAR+LL+LRRFKDVA MLQDYIPSLK
Sbjct  61   DQALELKARSLLYLRRFKDVATMLQDYIPSLK  92



>gb|KHN43469.1| hypothetical protein glysoja_002052 [Glycine soja]
Length=157

 Score =   105 bits (261),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  182  KKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTL  361
            +K+HWWLTNRKI +KY+KDA+ LIA+QD   +ASALN+LDAAL +SPR + A+EL+AR L
Sbjct  12   EKKHWWLTNRKIVEKYIKDARSLIATQDQSEIASALNLLDAALAISPRFDQALELRARAL  71

Query  362  LFLRRFKDVADMLQDYIPSLK  424
            L+LRRFK+VADMLQDYIPSL+
Sbjct  72   LYLRRFKEVADMLQDYIPSLR  92



>ref|XP_006307197.1| hypothetical protein CARUB_v10008788mg, partial [Capsella rubella]
 gb|EOA40095.1| hypothetical protein CARUB_v10008788mg, partial [Capsella rubella]
Length=542

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 69/98 (70%), Gaps = 10/98 (10%)
 Frame = +2

Query  158  SPCFAGGEKKQH----------WWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAA  307
            S CF   E + H          WW+ NRK  DKY+K+AK L+ SQDP  +  AL+ L++A
Sbjct  18   SHCFFSDEFENHNTAAMAIHHPWWMRNRKKVDKYMKNAKSLLTSQDPNDVVGALSHLNSA  77

Query  308  LLLSPRLELAMELKARTLLFLRRFKDVADMLQDYIPSL  421
            L LSPR ELA+ELKAR+LL+LRRFKDVAD+L DYIP+L
Sbjct  78   LSLSPRHELALELKARSLLYLRRFKDVADLLHDYIPTL  115



>ref|XP_004494413.1| PREDICTED: uncharacterized protein LOC101497500 [Cicer arietinum]
Length=562

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 74/89 (83%), Gaps = 1/89 (1%)
 Frame = +2

Query  158  SPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELA  337
            +P     EKK HWWLTNRKI +KY+KDA+ LIA+Q+   + SALN+LDAAL +SPR + A
Sbjct  5    TPSLTATEKK-HWWLTNRKIVEKYIKDARSLIATQEQNEIVSALNLLDAALAISPRYDQA  63

Query  338  MELKARTLLFLRRFKDVADMLQDYIPSLK  424
            +ELKAR+LL+LRRFKDVADMLQDYIPSL+
Sbjct  64   LELKARSLLYLRRFKDVADMLQDYIPSLR  92



>ref|XP_008454300.1| PREDICTED: uncharacterized protein LOC103494740 [Cucumis melo]
Length=561

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = +2

Query  179  EKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKART  358
            EKKQ WWL+++++A++YVKDAK LI +     + SALN+LDAAL+L+PR E A+ELKAR+
Sbjct  15   EKKQ-WWLSHKQMANRYVKDAKYLIGAGGENEVVSALNLLDAALVLAPRYEQALELKARS  73

Query  359  LLFLRRFKDVADMLQDYIPSLK  424
            LL+LRR+KDVADMLQ+Y+PS++
Sbjct  74   LLYLRRYKDVADMLQEYLPSMR  95



>ref|XP_004240574.1| PREDICTED: uncharacterized protein LOC101267897 [Solanum lycopersicum]
Length=575

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRL  328
            M+ SP F    +K+ WW+TN+KI ++Y++DAK+LIA+Q+P  ++SAL +++AAL +SPR 
Sbjct  1    MAASPPFLASAEKKPWWVTNKKIVERYIRDAKILIATQEPNEISSALALVEAALAISPRF  60

Query  329  ELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            ELA+ELKAR+LL+LR FKDVA ML+DYIPSLK
Sbjct  61   ELALELKARSLLYLRCFKDVAYMLKDYIPSLK  92



>gb|KHG09476.1| DnaJ subfamily C member 7 [Gossypium arboreum]
Length=567

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRL  328
            M+ SP     + K+HWW+TNRK+ DKYVKDA+ LIA+++   +ASAL +LDAAL LSPR 
Sbjct  1    MAVSPSSIATDHKKHWWVTNRKLVDKYVKDARSLIATRERNDVASALVLLDAALALSPRS  60

Query  329  ELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            ELA+ELKAR+LL+LRRF+DVADMLQDYIPSLK
Sbjct  61   ELALELKARSLLYLRRFRDVADMLQDYIPSLK  92



>ref|XP_009384418.1| PREDICTED: uncharacterized protein LOC103971973 [Musa acuminata 
subsp. malaccensis]
Length=563

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  182  KKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTL  361
            +K+ WWL+N+K+ DKY+++A+VL+++Q+   +++A+ +LD AL +SPR E A+EL+AR+L
Sbjct  11   EKKRWWLSNKKVVDKYLREARVLVSTQEQSNVSAAVGLLDVALAISPRHEAALELRARSL  70

Query  362  LFLRRFKDVADMLQDYIPSLK  424
            LFLRRF++VADMLQDYIPS K
Sbjct  71   LFLRRFREVADMLQDYIPSFK  91



>gb|AAC78702.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB80703.1| hypothetical protein [Arabidopsis thaliana]
Length=571

 Score =   109 bits (272),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  179  EKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKART  358
            E+ Q      + I DKY+K+AK LIASQDP  + SALN+L++AL +SPR ELA+ELKAR+
Sbjct  30   ERIQRTSSKGKSIVDKYMKEAKSLIASQDPNDVKSALNLLESALSVSPRYELALELKARS  89

Query  359  LLFLRRFKDVADMLQDYIPSLK  424
            LL+LRR+KDVADMLQDYIPSLK
Sbjct  90   LLYLRRYKDVADMLQDYIPSLK  111



>ref|XP_010481139.1| PREDICTED: uncharacterized protein LOC104759976 [Camelina sativa]
Length=515

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +2

Query  194  WWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLLFLR  373
            WW+ NRK  DKY+K+AK L+ SQDP  + SAL++L++   LSPR ELA+ELKAR+LL+LR
Sbjct  6    WWMRNRKKVDKYMKEAKSLLTSQDPNDILSALSLLNSTFSLSPRHELALELKARSLLYLR  65

Query  374  RFKDVADMLQDYIPSLK  424
            RFKDVAD+L DYIPSL+
Sbjct  66   RFKDVADLLHDYIPSLR  82



>ref|XP_010938305.1| PREDICTED: uncharacterized protein LOC105057403 [Elaeis guineensis]
Length=577

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 78/92 (85%), Gaps = 2/92 (2%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRL  328
            MS SP  +   +K+ WWL+NRKI DKYV+DA+ LIA+Q+P  +++A+ +LDAAL LSPRL
Sbjct  1    MSGSPSLSA--EKKRWWLSNRKIVDKYVRDARSLIATQEPSDVSAAVALLDAALALSPRL  58

Query  329  ELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            E+A+ELKAR+LLFLRR+++VADMLQDYIPS K
Sbjct  59   EVALELKARSLLFLRRYREVADMLQDYIPSYK  90



>ref|XP_008781076.1| PREDICTED: uncharacterized protein LOC103700952 [Phoenix dactylifera]
Length=581

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 77/92 (84%), Gaps = 2/92 (2%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRL  328
            MS SP  +   +K+HWWL NR+I DKYV+DA+ LIA+Q+P  +++A+ +LDAAL LSPRL
Sbjct  1    MSGSPSLSA--EKKHWWLRNRQIVDKYVRDARSLIATQEPSDVSAAVALLDAALALSPRL  58

Query  329  ELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            E A+ELKAR+LLFLRRF++VADMLQ+YIPS K
Sbjct  59   EAALELKARSLLFLRRFREVADMLQEYIPSYK  90



>ref|XP_010679356.1| PREDICTED: uncharacterized protein LOC104894747 [Beta vulgaris 
subsp. vulgaris]
Length=608

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  182  KKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTL  361
            +K+HWWL+ +K+ DKYV++A+V+I++++   + SAL++L+ AL LSP+ ELA+EL+AR L
Sbjct  25   EKKHWWLSTKKVVDKYVREARVMISTREENELNSALSLLEVALSLSPKYELALELRARCL  84

Query  362  LFLRRFKDVADMLQDYIPSLK  424
            L+ RR+K+VADMLQDYIPS K
Sbjct  85   LYTRRYKEVADMLQDYIPSYK  105



>ref|XP_011082426.1| PREDICTED: uncharacterized protein LOC105165197 [Sesamum indicum]
Length=570

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 76/89 (85%), Gaps = 1/89 (1%)
 Frame = +2

Query  158  SPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELA  337
            SP    GEKK HWWLTN+K+ ++YV++AK+LIA+QD   + +AL +L+AAL L+PR+E+A
Sbjct  5    SPSPPAGEKK-HWWLTNKKMVERYVREAKMLIATQDESEIEAALGLLEAALALAPRMEVA  63

Query  338  MELKARTLLFLRRFKDVADMLQDYIPSLK  424
            +ELKAR LL+LRRFK+VADMLQDYIPSLK
Sbjct  64   LELKARCLLYLRRFKEVADMLQDYIPSLK  92



>ref|XP_006355839.1| PREDICTED: uncharacterized protein LOC102596254 [Solanum tuberosum]
Length=572

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRL  328
            M+ SP F    +K+ WW++N+KI ++Y++DAK+LIA+Q+P  ++SAL +++AAL +SPR 
Sbjct  1    MAASPPFLACGEKKPWWVSNKKIVERYIRDAKILIATQEPNEISSALALVEAALAISPRF  60

Query  329  ELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            ELA+ELKAR+LL+LR FKDVA ML+DYIPSLK
Sbjct  61   ELALELKARSLLYLRCFKDVAYMLKDYIPSLK  92



>gb|EYU46799.1| hypothetical protein MIMGU_mgv1a003430mg [Erythranthe guttata]
Length=586

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 76/89 (85%), Gaps = 1/89 (1%)
 Frame = +2

Query  158  SPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELA  337
            SP  AGGEKK HWWLTNRK+ ++YV++AK+LIA+ +   + +AL +L+AAL ++PR+E A
Sbjct  13   SPSLAGGEKK-HWWLTNRKMVERYVREAKMLIATHEQSEIGAALGLLEAALSVAPRMEAA  71

Query  338  MELKARTLLFLRRFKDVADMLQDYIPSLK  424
            +E+KAR LL+LRRFK+VADMLQ++IPSLK
Sbjct  72   LEMKARCLLYLRRFKEVADMLQEHIPSLK  100



>ref|XP_003625953.1| hypothetical protein MTR_7g109360 [Medicago truncatula]
 gb|AES82171.1| DnaJ heat shock amino-terminal domain protein [Medicago truncatula]
Length=574

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +2

Query  182  KKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTL  361
            +K+HWWLTNRKI +KY+KDA+ LIA+Q+   + SALN+LDAAL +SPRL+ A+EL+AR+L
Sbjct  12   EKKHWWLTNRKIVEKYIKDARSLIATQEQSEILSALNLLDAALAISPRLDQALELRARSL  71

Query  362  LFLRRFKDVADMLQDYIPSLK  424
            L+LRRFKDVADMLQDYIPSL+
Sbjct  72   LYLRRFKDVADMLQDYIPSLR  92



>ref|XP_009416222.1| PREDICTED: uncharacterized protein LOC103996892 [Musa acuminata 
subsp. malaccensis]
Length=531

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +2

Query  179  EKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKART  358
            E+K  WWL+NRK+  KY++DA+ L+A+++   +++A+ +LDAAL++SP  E A+ELKAR+
Sbjct  9    EEKTRWWLSNRKLVRKYLRDARSLVATRELPKVSTAVGLLDAALVVSPLHEAALELKARS  68

Query  359  LLFLRRFKDVADMLQDYIPSLK  424
            LLFLRRF++VADMLQDYIPS K
Sbjct  69   LLFLRRFREVADMLQDYIPSCK  90



>ref|XP_003554542.1| PREDICTED: uncharacterized protein LOC100808420 [Glycine max]
Length=570

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  182  KKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTL  361
            +K+HWWLTNRKI +KY+KDA+ LIA+QD   +ASALN+LDAAL +SPR + A+EL+AR L
Sbjct  12   EKKHWWLTNRKIVEKYIKDARSLIATQDQSEIASALNLLDAALAISPRFDQALELRARAL  71

Query  362  LFLRRFKDVADMLQDYIPSLK  424
            L+LRRFK+VADMLQDYIPSL+
Sbjct  72   LYLRRFKEVADMLQDYIPSLR  92



>ref|XP_007163166.1| hypothetical protein PHAVU_001G212000g [Phaseolus vulgaris]
 gb|ESW35160.1| hypothetical protein PHAVU_001G212000g [Phaseolus vulgaris]
Length=584

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  185  KQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLL  364
            K+HWWLTNRKI +KY+KDA+ LIA+QD   +ASALN+LDAAL +SPRL+ A+EL+AR LL
Sbjct  13   KRHWWLTNRKIVEKYIKDARSLIATQDQREIASALNLLDAALAISPRLDHALELRARALL  72

Query  365  FLRRFKDVADMLQDYIPSLK  424
            +LRRFK+VADMLQDYIPSL+
Sbjct  73   YLRRFKEVADMLQDYIPSLR  92



>gb|EPS60430.1| hypothetical protein M569_14373, partial [Genlisea aurea]
Length=535

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 72/93 (77%), Gaps = 3/93 (3%)
 Frame = +2

Query  146  TMSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPR  325
            T S SP   G  +K+HWW +NRK+ ++YV++A++L+AS++   +A+A+ +LDAAL   PR
Sbjct  10   TGSLSP---GAGEKRHWWNSNRKVVERYVREARMLLASREQRDVAAAVGLLDAALAADPR  66

Query  326  LELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            +E+A+E+KAR LL LRRFKDVADML + IPS K
Sbjct  67   MEMALEMKARCLLSLRRFKDVADMLYESIPSFK  99



>ref|NP_171765.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
 gb|AAG10635.1|AC022521_13 Hypothetical protein [Arabidopsis thaliana]
 gb|AEE27454.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
Length=513

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +2

Query  194  WWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLLFLR  373
            WW  NRK  DKY+K+AK LI SQDP  + SAL++L++ L +SP  ELA+ELKAR+LL+LR
Sbjct  6    WWKRNRKKVDKYMKNAKDLITSQDPNDIVSALSLLNSTLSISPHHELALELKARSLLYLR  65

Query  374  RFKDVADMLQDYIPSLK  424
            RFKDVA +L +YIPSL+
Sbjct  66   RFKDVAVLLHNYIPSLR  82



>ref|XP_002889411.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH65670.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
Length=507

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +2

Query  194  WWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLLFLR  373
            WW  NRK  DKY+K+AK LI SQDP  + SAL++L+  L +SP  ELA+ELKAR+LL+LR
Sbjct  6    WWKRNRKKVDKYMKNAKDLITSQDPNDIVSALSLLNLTLSISPHHELALELKARSLLYLR  65

Query  374  RFKDVADMLQDYIPSLK  424
            RF+DVA +L DYIPSL+
Sbjct  66   RFEDVAVLLHDYIPSLR  82



>ref|XP_008786230.1| PREDICTED: uncharacterized protein LOC103704641 [Phoenix dactylifera]
Length=575

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  182  KKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTL  361
            +K+HWWL NRKI DKYV+DA+ LIA+Q+P  +++A+ +LDAAL LSP  E A+ELKAR+L
Sbjct  10   EKKHWWLRNRKIVDKYVRDARSLIATQEPSDVSAAVALLDAALALSPHREAALELKARSL  69

Query  362  LFLRRFKDVADMLQDYIPSLK  424
            LFLRR+++VADMLQ YIPS K
Sbjct  70   LFLRRYREVADMLQQYIPSYK  90



>ref|XP_007145158.1| hypothetical protein PHAVU_007G215200g [Phaseolus vulgaris]
 gb|ESW17152.1| hypothetical protein PHAVU_007G215200g [Phaseolus vulgaris]
Length=543

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +2

Query  167  FAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMEL  346
            +    +K+HWWLTNRK+ +KY++DA+ L+A+Q+   +ASALN+LDAAL + PRL+ A+EL
Sbjct  7    YLNATEKKHWWLTNRKVVEKYIRDARSLMATQEQSEIASALNLLDAALAIYPRLDEALEL  66

Query  347  KARTLLFLRRFKDVADMLQDYIPSLK  424
            +AR LL LRRFK+VADMLQDYIPSLK
Sbjct  67   RARCLLCLRRFKEVADMLQDYIPSLK  92



>ref|XP_009378700.1| PREDICTED: uncharacterized protein LOC103967162 isoform X2 [Pyrus 
x bretschneideri]
Length=577

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +2

Query  212  KIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLLFLRRFKDVA  391
            +I +KY+KDA+ LIA+ +   +ASA+ +LDAAL +SPRLE A+ELKAR+LL+LRRFK+VA
Sbjct  7    QIVEKYMKDARSLIATHEYSEVASAVGLLDAALAISPRLEEALELKARSLLYLRRFKEVA  66

Query  392  DMLQDYIPSLK  424
            DMLQDYIPSLK
Sbjct  67   DMLQDYIPSLK  77



>ref|XP_008369055.1| PREDICTED: uncharacterized protein LOC103432634 isoform X2 [Malus 
domestica]
Length=577

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +2

Query  212  KIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLLFLRRFKDVA  391
            +I +KY+KDA+ LIA+ +   +ASA+ +LDAAL +SPRLE A+ELKAR+LL+LRRFK+VA
Sbjct  3    QIVEKYMKDARSLIATHEYSEVASAVGLLDAALAVSPRLEEALELKARSLLYLRRFKEVA  62

Query  392  DMLQDYIPSL  421
            DMLQDYIPSL
Sbjct  63   DMLQDYIPSL  72



>ref|XP_010474676.1| PREDICTED: uncharacterized protein LOC104754236 [Camelina sativa]
Length=511

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +2

Query  194  WWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLLFLR  373
            WW+ NRK  DKY+K+AK L+ SQDP  + SALN+L++ L LSPR ELA+ELKAR+LL+LR
Sbjct  6    WWMRNRKKVDKYMKEAKSLLTSQDPNDVVSALNLLNSTLSLSPRHELALELKARSLLYLR  65

Query  374  RFKDVADMLQDYIPSLK  424
            RFKDVA +LQDYIPSL+
Sbjct  66   RFKDVAVLLQDYIPSLR  82



>ref|XP_003603082.1| hypothetical protein MTR_3g102140 [Medicago truncatula]
 gb|AES73333.1| DNAJ heat shock amino-terminal domain protein [Medicago truncatula]
Length=480

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 48/93 (52%), Positives = 67/93 (72%), Gaps = 1/93 (1%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHW-WLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPR  325
            ++ S   +   K +HW W T+ +I  + +KDA+ LIA+Q P  +  AL++LD AL +SP 
Sbjct  3    ITASTPHSNATKIKHWLWHTDSQIVKRNIKDARTLIATQKPIEINLALSLLDEALAISPC  62

Query  326  LELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
             + A+EL+AR+LL LRRFKDVADMLQDYIP+LK
Sbjct  63   SDQALELRARSLLCLRRFKDVADMLQDYIPNLK  95



>ref|XP_004984639.1| PREDICTED: uncharacterized protein LOC101760132 [Setaria italica]
Length=622

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 67/83 (81%), Gaps = 3/83 (4%)
 Frame = +2

Query  179  EKKQHWWLTNRKIADKYVKDAK-VLIASQDPGA--MASALNVLDAALLLSPRLELAMELK  349
            EKK+ W L+NRK+ DKY+++A+ +L+A+ + G     +AL ++DAAL LSPR+E A+EL+
Sbjct  11   EKKRKWLLSNRKVIDKYLREARAILVAAPESGGGDAVAALGLVDAALELSPRMEAALELR  70

Query  350  ARTLLFLRRFKDVADMLQDYIPS  418
            AR LL LRR+++VA+ML+DYIPS
Sbjct  71   ARALLVLRRYREVAEMLRDYIPS  93



>gb|EAY89683.1| hypothetical protein OsI_11218 [Oryza sativa Indica Group]
Length=668

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 64/83 (77%), Gaps = 3/83 (4%)
 Frame = +2

Query  179  EKKQHWWLTNRKIADKYVKDAKVLIASQ---DPGAMASALNVLDAALLLSPRLELAMELK  349
            EKK+ W L+NRK+ DKY+++A+ ++A+      G   +AL ++DAAL LSPR+E A+EL+
Sbjct  11   EKKRKWLLSNRKVIDKYLREARAILATAPEAGGGDAVAALGLVDAALELSPRMESALELR  70

Query  350  ARTLLFLRRFKDVADMLQDYIPS  418
             R LL LRR++DVA+ML+DYIPS
Sbjct  71   GRALLSLRRYRDVAEMLRDYIPS  93



>ref|NP_001049877.1| Os03g0304500 [Oryza sativa Japonica Group]
 gb|ABF95513.1| TPR Domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11791.1| Os03g0304500 [Oryza sativa Japonica Group]
 gb|EAZ26640.1| hypothetical protein OsJ_10545 [Oryza sativa Japonica Group]
 dbj|BAG94995.1| unnamed protein product [Oryza sativa Japonica Group]
Length=668

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 64/83 (77%), Gaps = 3/83 (4%)
 Frame = +2

Query  179  EKKQHWWLTNRKIADKYVKDAKVLIASQ---DPGAMASALNVLDAALLLSPRLELAMELK  349
            EKK+ W L+NRK+ DKY+++A+ ++A+      G   +AL ++DAAL LSPR+E A+EL+
Sbjct  11   EKKRKWLLSNRKVIDKYLREARAILATAPEAGGGDAVAALGLVDAALELSPRMESALELR  70

Query  350  ARTLLFLRRFKDVADMLQDYIPS  418
             R LL LRR++DVA+ML+DYIPS
Sbjct  71   GRALLSLRRYRDVAEMLRDYIPS  93



>emb|CAN62070.1| hypothetical protein VITISV_036192 [Vitis vinifera]
Length=542

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 62/93 (67%), Gaps = 19/93 (20%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVL-DAALLLSPR  325
            M+ SP  AGGEKK HWWL N+K                   A +  L++  +AAL LSPR
Sbjct  1    MATSPSVAGGEKK-HWWLRNKK-----------------NRARSQQLSISWNAALGLSPR  42

Query  326  LELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
             E+A+ELKAR+LL+LRRFKDVADMLQDYIPSLK
Sbjct  43   FEVALELKARSLLYLRRFKDVADMLQDYIPSLK  75



>ref|XP_010457248.1| PREDICTED: uncharacterized protein LOC104738746 isoform X1 [Camelina 
sativa]
Length=559

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +2

Query  194  WWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLLFLR  373
            WW+ NRK  DKY+K+AK L+ SQDP  + SAL++L++ L LSPR ELA+ELKAR+LL+L 
Sbjct  53   WWMRNRKKVDKYMKEAKSLLTSQDPNDVVSALSLLNSTLSLSPRHELALELKARSLLYLL  112

Query  374  RFKDVADMLQDYIPSLK  424
            RFKDVAD+L DYIPSL+
Sbjct  113  RFKDVADLLHDYIPSLR  129



>ref|XP_006649953.1| PREDICTED: uncharacterized protein LOC102720029 isoform X2 [Oryza 
brachyantha]
Length=669

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 64/83 (77%), Gaps = 3/83 (4%)
 Frame = +2

Query  179  EKKQHWWLTNRKIADKYVKDAKVLIASQ---DPGAMASALNVLDAALLLSPRLELAMELK  349
            EKK+ W L+NRK+ DKY+++A+ ++A+      G   +AL ++DAAL LSPR+E A+EL+
Sbjct  11   EKKRKWLLSNRKVIDKYLREARAILAAAPEAGSGDAVAALGLVDAALELSPRMEAALELR  70

Query  350  ARTLLFLRRFKDVADMLQDYIPS  418
             R LL LRR+++VA+ML+DYIPS
Sbjct  71   GRALLALRRYREVAEMLRDYIPS  93



>ref|XP_006649952.1| PREDICTED: uncharacterized protein LOC102720029 isoform X1 [Oryza 
brachyantha]
Length=683

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 64/83 (77%), Gaps = 3/83 (4%)
 Frame = +2

Query  179  EKKQHWWLTNRKIADKYVKDAKVLIASQ---DPGAMASALNVLDAALLLSPRLELAMELK  349
            EKK+ W L+NRK+ DKY+++A+ ++A+      G   +AL ++DAAL LSPR+E A+EL+
Sbjct  11   EKKRKWLLSNRKVIDKYLREARAILAAAPEAGSGDAVAALGLVDAALELSPRMEAALELR  70

Query  350  ARTLLFLRRFKDVADMLQDYIPS  418
             R LL LRR+++VA+ML+DYIPS
Sbjct  71   GRALLALRRYREVAEMLRDYIPS  93



>ref|XP_003558094.1| PREDICTED: uncharacterized protein LOC100838122 [Brachypodium 
distachyon]
Length=612

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 69/94 (73%), Gaps = 4/94 (4%)
 Frame = +2

Query  149  MSESPCFAGGEKKQHWWLT-NRKIADKYVKDAK-VLIASQDPGA--MASALNVLDAALLL  316
            M+ S   A  EKK+ W L+ NRK+ D+Y+++A+ +L A+ + G     +AL ++D AL L
Sbjct  1    MAVSSPSAAPEKKRKWLLSSNRKVIDRYLREARAILTAAPESGGGDAVAALGLVDTALEL  60

Query  317  SPRLELAMELKARTLLFLRRFKDVADMLQDYIPS  418
            SPR+E A+EL+AR LL LRR+++VA+ML+DYIPS
Sbjct  61   SPRMEAALELRARALLSLRRYREVAEMLRDYIPS  94



>ref|XP_007210762.1| hypothetical protein PRUPE_ppa020535mg, partial [Prunus persica]
 gb|EMJ11961.1| hypothetical protein PRUPE_ppa020535mg, partial [Prunus persica]
Length=166

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  275  MASALNVLDAALLLSPRLELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            +ASA+ +LDAAL +SPRLE A+ELKAR+LL LRRFKDVADMLQDYIPSLK
Sbjct  24   IASAVGLLDAALAISPRLEQALELKARSLLNLRRFKDVADMLQDYIPSLK  73



>gb|EPS61606.1| hypothetical protein M569_13189, partial [Genlisea aurea]
Length=507

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 64/81 (79%), Gaps = 4/81 (5%)
 Frame = +2

Query  182  KKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTL  361
            KK  WWL+++++ +++V++A++L+       +A+A+ +LDAAL+ +PR+E+A+E+KAR L
Sbjct  1    KKAAWWLSSKRMVERHVREARILMGRD----VAAAMGLLDAALIAAPRMEMAIEMKARCL  56

Query  362  LFLRRFKDVADMLQDYIPSLK  424
            L LRR+++VA+ML + +PS +
Sbjct  57   LSLRRYREVAEMLYESVPSFR  77



>gb|KHN30647.1| Putative beta-D-xylosidase 2 [Glycine soja]
Length=582

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 46/70 (66%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +2

Query  215  IADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLLFLRRFKDVAD  394
            I +KY++DA+ LIA+Q+   + SALN+LDAAL + PRL+ A+EL+AR LL+LRRFKDVAD
Sbjct  283  IVEKYMRDARSLIATQEQSEIGSALNLLDAALAIYPRLDEALELRARCLLYLRRFKDVAD  342

Query  395  MLQDYIPSLK  424
            MLQDYIPSL+
Sbjct  343  MLQDYIPSLR  352



>ref|XP_010457249.1| PREDICTED: uncharacterized protein LOC104738746 isoform X2 [Camelina 
sativa]
Length=514

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +2

Query  221  DKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLLFLRRFKDVADML  400
            DKY+K+AK L+ SQDP  + SAL++L++ L LSPR ELA+ELKAR+LL+L RFKDVAD+L
Sbjct  17   DKYMKEAKSLLTSQDPNDVVSALSLLNSTLSLSPRHELALELKARSLLYLLRFKDVADLL  76

Query  401  QDYIPSLK  424
             DYIPSL+
Sbjct  77   HDYIPSLR  84



>emb|CAE03145.2| OSJNBa0081L15.7 [Oryza sativa Japonica Group]
 emb|CAH67475.1| H0805A05.5 [Oryza sativa Indica Group]
Length=222

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +2

Query  263  DPGAMASALNVLDAALLLSPRLELAMELKARTLLFLRRFKDVADMLQDYIPSL  421
            D  A  +AL +++A L LSPR+E A+EL+A +LL  RR++ VADML+DYIPS 
Sbjct  80   DHSAATTALGLVEAVLELSPRMEAALELRACSLLAFRRYRGVADMLRDYIPSC  132



>gb|EEE66051.1| hypothetical protein OsJ_22041 [Oryza sativa Japonica Group]
Length=175

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  263  DPGAMASALNVLDAALLLSPRLELAMELKARTLLFLRRFKDVADMLQDYIPS  418
            D  A  +AL +++A L LSPR+E A+EL+A +LL  RR++ VADML+DYIPS
Sbjct  80   DHSAATTALGLVEAVLELSPRMEAALELRACSLLAFRRYRGVADMLRDYIPS  131



>gb|EEE66049.1| hypothetical protein OsJ_22038 [Oryza sativa Japonica Group]
Length=215

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  263  DPGAMASALNVLDAALLLSPRLELAMELKARTLLFLRRFKDVADMLQDYIPS  418
            D  A  +AL +++A L LSPR+E A+EL+A +LL  RR++ VADML+DYIPS
Sbjct  80   DHSAATTALGLVEAVLELSPRMEAALELRACSLLAFRRYRGVADMLRDYIPS  131



>ref|NP_001173991.1| Os04g0483700 [Oryza sativa Japonica Group]
 dbj|BAH92719.1| Os04g0483700 [Oryza sativa Japonica Group]
Length=215

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  263  DPGAMASALNVLDAALLLSPRLELAMELKARTLLFLRRFKDVADMLQDYIPS  418
            D  A  +AL +++A L LSPR+E A+EL+A +LL  RR++ VADML+DYIPS
Sbjct  80   DHSAATTALGLVEAVLELSPRMEAALELRACSLLAFRRYRGVADMLRDYIPS  131



>ref|XP_002462475.1| hypothetical protein SORBIDRAFT_02g026285 [Sorghum bicolor]
 gb|EER98996.1| hypothetical protein SORBIDRAFT_02g026285 [Sorghum bicolor]
Length=313

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  287  LNVLDAALLLSPRLELAMELKARTLLFLRRFKDVADMLQDYIPS  418
            L ++DAAL LSPR+E A+EL+AR+LL LRR+++V +ML+DYIPS
Sbjct  141  LGMVDAALELSPRMEAALELRARSLLALRRYREVVEMLRDYIPS  184



>ref|XP_002465385.1| hypothetical protein SORBIDRAFT_01g037630 [Sorghum bicolor]
 gb|EER92383.1| hypothetical protein SORBIDRAFT_01g037630 [Sorghum bicolor]
Length=626

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 65/83 (78%), Gaps = 3/83 (4%)
 Frame = +2

Query  179  EKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMA---SALNVLDAALLLSPRLELAMELK  349
            EKK+ W L+NRK+ DKY+++A+ ++A+   G      +AL ++DAAL LSPR+E A+EL+
Sbjct  11   EKKRKWLLSNRKVIDKYLREARKILAAAPEGGGGDAVAALGLVDAALELSPRMEAALELR  70

Query  350  ARTLLFLRRFKDVADMLQDYIPS  418
            AR LL LRR+++VA+ML+DYIPS
Sbjct  71   ARALLALRRYREVAEMLRDYIPS  93



>dbj|BAJ99790.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=593

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 65/84 (77%), Gaps = 3/84 (4%)
 Frame = +2

Query  179  EKKQHWWLTNRKIADKYVKDAKVLIAS---QDPGAMASALNVLDAALLLSPRLELAMELK  349
            EKK+ W L+NRK+ D+Y+++A+ ++A+      G   +AL ++DAAL LSPR+E A+EL+
Sbjct  11   EKKRKWLLSNRKVIDRYLREARAILATAPESGGGDAVAALGLIDAALELSPRMEAALELR  70

Query  350  ARTLLFLRRFKDVADMLQDYIPSL  421
            AR LL LRR+++VA+ML+DYIPS 
Sbjct  71   ARALLALRRYREVAEMLRDYIPSC  94



>dbj|BAD37386.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD37711.1| hypothetical protein [Oryza sativa Japonica Group]
Length=253

 Score = 61.2 bits (147),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +2

Query  263  DPGAMASALNVLDAALLLSPRLELAMELKARTLLFLRRFKDVADMLQDYIPSL  421
            D  A  +AL +++A L LSPR+E A+EL+A +LL  RR++ VADML+DYIPS 
Sbjct  80   DHSAATTALGLVEAVLELSPRMEAALELRACSLLAFRRYRGVADMLRDYIPSC  132



>gb|EEC82726.1| hypothetical protein OsI_27419 [Oryza sativa Indica Group]
Length=603

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  272  AMASALNVLDAALLLSPRLELAMELKARTLLFLRRFKDVADMLQDYIPSL  421
            A  +AL +++A L +SPR+E A+EL+AR+LL LRR++ VADML+DYIPS 
Sbjct  49   AATAALGLVEAVLEMSPRMEAALELRARSLLALRRYRAVADMLRDYIPSC  98



>ref|NP_001060708.1| Os07g0689800 [Oryza sativa Japonica Group]
 dbj|BAC83507.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22622.1| Os07g0689800 [Oryza sativa Japonica Group]
 dbj|BAG92384.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67856.1| hypothetical protein OsJ_25662 [Oryza sativa Japonica Group]
Length=603

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  272  AMASALNVLDAALLLSPRLELAMELKARTLLFLRRFKDVADMLQDYIPSL  421
            A  +AL +++A L +SPR+E A+EL+AR+LL LRR++ VADML+DYIPS 
Sbjct  49   AATAALGLVEAVLEMSPRMEAALELRARSLLALRRYRAVADMLRDYIPSC  98



>gb|EAZ05220.1| hypothetical protein OsI_27418 [Oryza sativa Indica Group]
Length=463

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  272  AMASALNVLDAALLLSPRLELAMELKARTLLFLRRFKDVADMLQDYIPS  418
            A  +AL +++A L +SPR+E A+EL+AR+LL LRR++ VADML+DYIPS
Sbjct  94   AATAALGLVEAVLEMSPRMEAALELRARSLLALRRYRAVADMLRDYIPS  142



>ref|XP_008654810.1| PREDICTED: trans-splicing factor Raa3, chloroplastic-like isoform 
X1 [Zea mays]
 tpg|DAA44995.1| TPA: hypothetical protein ZEAMMB73_388715 [Zea mays]
Length=628

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 66/83 (80%), Gaps = 3/83 (4%)
 Frame = +2

Query  179  EKKQHWWLTNRKIADKYVKDA-KVLIASQDPGA--MASALNVLDAALLLSPRLELAMELK  349
            EKK+ W L+NRK+ DKY+++A K+L A+ + G     +AL ++DAAL LSPR+E A+EL+
Sbjct  11   EKKRKWLLSNRKVTDKYLREARKILAAAPECGGGDAVAALGLVDAALELSPRMEAALELR  70

Query  350  ARTLLFLRRFKDVADMLQDYIPS  418
            AR LL LRR+++VA+ML+DYIPS
Sbjct  71   ARALLALRRYREVAEMLRDYIPS  93



>ref|XP_008671203.1| PREDICTED: uncharacterized protein LOC103648532 [Zea mays]
Length=595

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  272  AMASALNVLDAALLLSPRLELAMELKARTLLFLRRFKDVADMLQDYIPS  418
            +++S  +  DAAL LSPR+E A+EL+AR  L LRR+ +VA+ML+DYIPS
Sbjct  110  SVSSCGSFFDAALELSPRMEAALELRARAFLALRRYSEVAEMLRDYIPS  158



>gb|KEH19986.1| DNAJ heat shock amino-terminal domain protein, putative [Medicago 
truncatula]
Length=70

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  290  NVLDAALLLSPRLELAMELKARTLLFLRRFKDVADMLQDYIPSLK  424
            N+LD AL +SP  + A++L+A ++L LRRFKD+ +MLQ+Y P LK
Sbjct  17   NLLDEALAISPFSDQALQLRAMSMLCLRRFKDLENMLQEYTPKLK  61



>gb|KEH19985.1| transmembrane protein, putative, partial [Medicago truncatula]
Length=247

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +2

Query  215  IADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLLFLRRFKDV  388
            I +  +KDA+ LIA Q P  +   +++LD AL ++P  + A++L+ R+LLFL RFKDV
Sbjct  145  IVEGNIKDARTLIAMQKPREIVLVVSLLDEALAITPCSDQALKLRMRSLLFLIRFKDV  202



>ref|XP_008796162.1| PREDICTED: uncharacterized protein LOC103711698 isoform X2 [Phoenix 
dactylifera]
Length=1816

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 25/72 (35%), Positives = 43/72 (60%), Gaps = 1/72 (1%)
 Frame = +2

Query  209   RKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLLFLRRFKDV  388
             +++AD Y+  AK LI  + P  +  AL ++  AL +SP  E  ME+KA  LL L ++++V
Sbjct  1378  QQVAD-YIVQAKELIRKRTPNEVTKALQLISEALSISPHSENLMEMKAEALLMLHKYEEV  1436

Query  389   ADMLQDYIPSLK  424
               + ++ + S K
Sbjct  1437  IQLCEESLDSAK  1448



>ref|XP_008796161.1| PREDICTED: uncharacterized protein LOC103711698 isoform X1 [Phoenix 
dactylifera]
Length=1825

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 25/72 (35%), Positives = 43/72 (60%), Gaps = 1/72 (1%)
 Frame = +2

Query  209   RKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLLFLRRFKDV  388
             +++AD Y+  AK LI  + P  +  AL ++  AL +SP  E  ME+KA  LL L ++++V
Sbjct  1378  QQVAD-YIVQAKELIRKRTPNEVTKALQLISEALSISPHSENLMEMKAEALLMLHKYEEV  1436

Query  389   ADMLQDYIPSLK  424
               + ++ + S K
Sbjct  1437  IQLCEESLDSAK  1448



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555628969350