BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS004B05

Length=416
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009612011.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    158   5e-42   Nicotiana tomentosiformis
ref|XP_006351808.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    155   7e-41   Solanum tuberosum [potatoes]
ref|XP_004230547.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    152   1e-39   
ref|XP_009762535.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    149   1e-38   Nicotiana sylvestris
dbj|BAQ02862.1|  alpha-L-Arabinofuranosidase/beta-D-Xylopyrianosi...    144   1e-38   Nicotiana tabacum [American tobacco]
ref|XP_011092407.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    143   1e-36   Sesamum indicum [beniseed]
emb|CAN77623.1|  hypothetical protein VITISV_007589                     133   3e-36   Vitis vinifera
gb|KDO56532.1|  hypothetical protein CISIN_1g0476211mg                  135   3e-36   Citrus sinensis [apfelsine]
ref|XP_009801214.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    142   4e-36   Nicotiana sylvestris
ref|XP_009628814.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    140   9e-36   Nicotiana tomentosiformis
emb|CAJ65922.1|  xylan 1,4-beta-xylosidase                              139   3e-35   Populus tremula x Populus alba [gray poplar]
ref|XP_002298197.2|  beta-glucosidase family protein                    139   3e-35   
emb|CAJ65921.1|  xylan 1,4-beta-xylosidase                              137   2e-34   Populus tremula x Populus alba [gray poplar]
ref|XP_002303181.1|  beta-glucosidase family protein                    137   2e-34   
ref|XP_011015574.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    137   2e-34   Populus euphratica
ref|XP_011046123.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    136   3e-34   Populus euphratica
ref|XP_006493288.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    136   3e-34   Citrus sinensis [apfelsine]
ref|XP_011004967.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    136   4e-34   Populus euphratica
ref|XP_006432467.1|  hypothetical protein CICLE_v10000355mg             136   4e-34   Citrus clementina [clementine]
ref|XP_008344154.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    135   6e-34   
ref|XP_008339210.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    134   2e-33   
ref|XP_010546362.1|  PREDICTED: beta-D-xylosidase 4                     134   2e-33   Tarenaya hassleriana [spider flower]
ref|XP_009347830.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    134   2e-33   
ref|XP_009354080.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    134   3e-33   Pyrus x bretschneideri [bai li]
ref|XP_010243340.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    134   3e-33   Nelumbo nucifera [Indian lotus]
ref|XP_002513707.1|  Beta-glucosidase, putative                         134   3e-33   Ricinus communis
ref|XP_007148433.1|  hypothetical protein PHAVU_006G208200g             133   4e-33   Phaseolus vulgaris [French bean]
ref|XP_009379698.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    133   4e-33   
gb|EPS65933.1|  hypothetical protein M569_08842                         133   4e-33   Genlisea aurea
gb|KDP30704.1|  hypothetical protein JCGZ_16402                         133   5e-33   Jatropha curcas
sp|A5JTQ3.1|XYL2_MEDSV  RecName: Full=Beta-xylosidase/alpha-L-ara...    133   5e-33   Medicago sativa subsp. x varia
emb|CBI40687.3|  unnamed protein product                                132   6e-33   Vitis vinifera
ref|XP_006341844.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    132   7e-33   Solanum tuberosum [potatoes]
ref|XP_002264183.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    132   8e-33   Vitis vinifera
ref|NP_001233910.1|  beta-D-xylosidase 1 precursor                      132   8e-33   Solanum lycopersicum
gb|KEH31243.1|  beta-xylosidase/alpha-L-arabinofuranosidase-like ...    132   1e-32   Medicago truncatula
ref|XP_002268626.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    131   2e-32   Vitis vinifera
ref|XP_003547598.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    131   2e-32   Glycine max [soybeans]
ref|XP_004504774.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    131   3e-32   Cicer arietinum [garbanzo]
ref|XP_009112141.1|  PREDICTED: beta-D-xylosidase 4-like                130   3e-32   Brassica rapa
emb|CDY18705.1|  BnaA09g06900D                                          130   3e-32   Brassica napus [oilseed rape]
ref|XP_010520456.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    130   6e-32   
ref|XP_003531557.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    129   8e-32   Glycine max [soybeans]
ref|XP_007043027.1|  Beta-D-xylosidase 4                                129   9e-32   
gb|KFK28148.1|  hypothetical protein AALP_AA8G478800                    129   1e-31   Arabis alpina [alpine rockcress]
ref|XP_010103839.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2      129   1e-31   Morus notabilis
emb|CDY46812.1|  BnaC02g43200D                                          129   1e-31   Brassica napus [oilseed rape]
gb|KHG10349.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           129   1e-31   Gossypium arboreum [tree cotton]
gb|KJB31995.1|  hypothetical protein B456_005G218000                    129   1e-31   Gossypium raimondii
ref|XP_010261102.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    129   2e-31   Nelumbo nucifera [Indian lotus]
gb|EYU35409.1|  hypothetical protein MIMGU_mgv1a001738mg                129   2e-31   Erythranthe guttata [common monkey flower]
ref|XP_006280038.1|  hypothetical protein CARUB_v10025915mg             129   2e-31   Capsella rubella
ref|XP_006394136.1|  hypothetical protein EUTSA_v10003678mg             128   2e-31   Eutrema salsugineum [saltwater cress]
emb|CDX81229.1|  BnaC09g06400D                                          128   2e-31   
ref|XP_010065531.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    128   3e-31   Eucalyptus grandis [rose gum]
ref|XP_007225245.1|  hypothetical protein PRUPE_ppa001692mg             128   3e-31   Prunus persica
ref|XP_007159080.1|  hypothetical protein PHAVU_002G206800g             127   5e-31   Phaseolus vulgaris [French bean]
ref|XP_010065527.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    127   6e-31   Eucalyptus grandis [rose gum]
ref|XP_010444394.1|  PREDICTED: beta-D-xylosidase 4-like                127   8e-31   Camelina sativa [gold-of-pleasure]
ref|XP_004300692.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    127   9e-31   Fragaria vesca subsp. vesca
ref|XP_011465594.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    127   9e-31   Fragaria vesca subsp. vesca
ref|XP_009130462.1|  PREDICTED: beta-D-xylosidase 4-like                126   9e-31   Brassica rapa
emb|CDY31313.1|  BnaA02g34280D                                          126   1e-30   Brassica napus [oilseed rape]
ref|XP_002866623.1|  beta-xylosidase 4                                  126   1e-30   Arabidopsis lyrata subsp. lyrata
ref|NP_201262.1|  beta-D-xylosidase 4                                   126   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010461983.1|  PREDICTED: beta-D-xylosidase 4-like                126   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010484241.1|  PREDICTED: beta-D-xylosidase 4                     125   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_008218886.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    125   2e-30   Prunus mume [ume]
gb|KCW63061.1|  hypothetical protein EUGRSUZ_G006532                    117   3e-30   Eucalyptus grandis [rose gum]
ref|XP_011087838.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    125   3e-30   Sesamum indicum [beniseed]
ref|XP_009401393.1|  PREDICTED: beta-D-xylosidase 4-like                124   4e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008784548.1|  PREDICTED: LOW QUALITY PROTEIN: beta-xylosid...    124   6e-30   
ref|XP_011087839.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    124   8e-30   Sesamum indicum [beniseed]
ref|XP_010065529.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    124   8e-30   Eucalyptus grandis [rose gum]
ref|XP_003593145.1|  Beta-xylosidase/alpha-L-arabinofuranosidase        123   2e-29   Medicago truncatula
ref|XP_009150540.1|  PREDICTED: beta-D-xylosidase 4                     123   2e-29   Brassica rapa
emb|CDY56487.1|  BnaCnng30450D                                          122   2e-29   Brassica napus [oilseed rape]
emb|CDY51290.1|  BnaA06g23560D                                          122   2e-29   Brassica napus [oilseed rape]
dbj|BAE44362.1|  alpha-L-arabinofuranosidase                            122   3e-29   Raphanus sativus
ref|XP_004485551.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    122   3e-29   Cicer arietinum [garbanzo]
ref|XP_006827121.1|  hypothetical protein AMTR_s00010p00246460          122   5e-29   Amborella trichopoda
ref|XP_004136861.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    121   6e-29   
sp|A5JTQ2.1|XYL1_MEDSV  RecName: Full=Beta-xylosidase/alpha-L-ara...    121   9e-29   Medicago sativa subsp. x varia
ref|XP_008455235.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    121   1e-28   Cucumis melo [Oriental melon]
ref|XP_004155509.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    121   1e-28   
gb|KFK25272.1|  hypothetical protein AALP_AA8G090500                    120   1e-28   Arabis alpina [alpine rockcress]
ref|XP_010937054.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    120   2e-28   Elaeis guineensis
ref|NP_196535.1|  beta-xylosidase 3                                     119   4e-28   Arabidopsis thaliana [mouse-ear cress]
gb|KHN06823.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           115   4e-28   Glycine soja [wild soybean]
ref|XP_003524073.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    118   6e-28   
ref|XP_009403180.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    118   7e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004301992.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    118   9e-28   Fragaria vesca subsp. vesca
ref|XP_002873418.1|  beta-xylosidase 3                                  118   1e-27   Arabidopsis lyrata subsp. lyrata
emb|CDY52884.1|  BnaC06g27770D                                          114   1e-27   Brassica napus [oilseed rape]
gb|KHG02719.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           118   1e-27   Gossypium arboreum [tree cotton]
gb|KJB77499.1|  hypothetical protein B456_012G140300                    118   1e-27   Gossypium raimondii
ref|XP_010065530.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    117   1e-27   Eucalyptus grandis [rose gum]
ref|XP_010452969.1|  PREDICTED: beta-D-xylosidase 3-like                117   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_003531047.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    117   2e-27   Glycine max [soybeans]
ref|XP_006399455.1|  hypothetical protein EUTSA_v10012739mg             117   3e-27   Eutrema salsugineum [saltwater cress]
ref|XP_010422950.1|  PREDICTED: beta-D-xylosidase 3 isoform X1          116   4e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010422951.1|  PREDICTED: beta-D-xylosidase 3 isoform X2          116   4e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010687471.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    116   5e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010491609.1|  PREDICTED: beta-D-xylosidase 4-like                116   5e-27   Camelina sativa [gold-of-pleasure]
ref|XP_009629820.1|  PREDICTED: beta-D-xylosidase 1-like isoform X1     108   8e-27   Nicotiana tomentosiformis
ref|XP_009629821.1|  PREDICTED: beta-D-xylosidase 1-like isoform X2     108   9e-27   Nicotiana tomentosiformis
ref|XP_010491611.1|  PREDICTED: beta-D-xylosidase 3-like isoform X2     115   1e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010491610.1|  PREDICTED: beta-D-xylosidase 3-like isoform X1     115   1e-26   Camelina sativa [gold-of-pleasure]
emb|CDY21595.1|  BnaC09g46970D                                          114   2e-26   Brassica napus [oilseed rape]
gb|EYU23815.1|  hypothetical protein MIMGU_mgv1a0042532mg               110   6e-26   Erythranthe guttata [common monkey flower]
ref|XP_003615012.1|  Auxin-induced beta-glucosidase                     107   6e-26   
gb|EYU18507.1|  hypothetical protein MIMGU_mgv1a001685mg                112   7e-26   Erythranthe guttata [common monkey flower]
gb|EYU18508.1|  hypothetical protein MIMGU_mgv1a001685mg                112   7e-26   Erythranthe guttata [common monkey flower]
emb|CDX96113.1|  BnaA07g26180D                                          113   8e-26   
emb|CDY01780.1|  BnaC06g28200D                                          112   8e-26   
ref|XP_010424711.1|  PREDICTED: beta-D-xylosidase 4-like                112   8e-26   
gb|EMT32951.1|  Beta-D-xylosidase 4                                     112   1e-25   
dbj|BAJ89945.1|  predicted protein                                      110   2e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009105246.1|  PREDICTED: beta-D-xylosidase 3-like                111   2e-25   Brassica rapa
emb|CDX97115.1|  BnaC09g45100D                                          111   2e-25   
ref|XP_006855294.1|  hypothetical protein AMTR_s00057p00049120          111   2e-25   Amborella trichopoda
emb|CDY35825.1|  BnaC09g37570D                                          111   3e-25   Brassica napus [oilseed rape]
emb|CDX69892.1|  BnaA10g22410D                                          111   3e-25   
ref|XP_009122535.1|  PREDICTED: beta-D-xylosidase 3-like                111   3e-25   Brassica rapa
ref|XP_003615011.1|  Beta-D-xylosidase                                  104   4e-25   
ref|XP_009804071.1|  PREDICTED: beta-D-xylosidase 1 isoform X2          110   4e-25   Nicotiana sylvestris
dbj|BAJ90315.1|  predicted protein                                      110   5e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90420.1|  predicted protein                                      110   5e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABR17218.1|  unknown                                                 103   6e-25   Picea sitchensis
ref|XP_002963750.1|  hypothetical protein SELMODRAFT_80102              110   6e-25   Selaginella moellendorffii
ref|XP_009804070.1|  PREDICTED: beta-D-xylosidase 1 isoform X1          110   6e-25   Nicotiana sylvestris
emb|CAJ86028.1|  B0414F07.1                                             107   8e-25   Oryza sativa [red rice]
gb|AAK38481.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase iso...    109   1e-24   Hordeum vulgare [barley]
ref|XP_010068200.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    109   1e-24   Eucalyptus grandis [rose gum]
gb|KJB16241.1|  hypothetical protein B456_002G219100                    108   2e-24   Gossypium raimondii
ref|XP_002974833.1|  hypothetical protein SELMODRAFT_101733             108   2e-24   Selaginella moellendorffii
ref|XP_002306583.2|  hypothetical protein POPTR_0005s16660g             108   3e-24   Populus trichocarpa [western balsam poplar]
ref|XP_008445351.1|  PREDICTED: probable beta-D-xylosidase 7            108   3e-24   Cucumis melo [Oriental melon]
ref|XP_002515300.1|  Beta-glucosidase, putative                         108   3e-24   Ricinus communis
ref|XP_011011483.1|  PREDICTED: probable beta-D-xylosidase 7            108   4e-24   Populus euphratica
gb|AES97966.2|  glycoside hydrolase family 3 protein                    107   4e-24   Medicago truncatula
ref|XP_003615008.1|  Xylan 1 4-beta-xylosidase                          107   4e-24   
ref|XP_002285805.1|  PREDICTED: probable beta-D-xylosidase 7            107   7e-24   Vitis vinifera
ref|XP_003615003.1|  Xylan 1 4-beta-xylosidase                          107   7e-24   Medicago truncatula
emb|CAE03635.1|  OSJNBb0003B01.27                                       107   9e-24   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054038.1|  Os04g0640700                                       107   9e-24   
emb|CBI19138.3|  unnamed protein product                                107   1e-23   Vitis vinifera
ref|XP_002302285.1|  glycosyl hydrolase family 3 family protein         106   1e-23   
ref|XP_010269208.1|  PREDICTED: probable beta-D-xylosidase 7            106   1e-23   Nelumbo nucifera [Indian lotus]
gb|AAF17692.1|AC009243_19  F28K19.27                                    105   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177929.1|  putative beta-D-xylosidase 7                          105   2e-23   Arabidopsis thaliana [mouse-ear cress]
gb|KHN30647.1|  Putative beta-D-xylosidase 2                            105   2e-23   Glycine soja [wild soybean]
ref|XP_004976989.1|  PREDICTED: beta-D-xylosidase 4-like isoform X2     105   2e-23   Setaria italica
ref|XP_002448619.1|  hypothetical protein SORBIDRAFT_06g030270          105   3e-23   Sorghum bicolor [broomcorn]
gb|EYU44008.1|  hypothetical protein MIMGU_mgv1a0207571mg               100   3e-23   Erythranthe guttata [common monkey flower]
ref|XP_006301942.1|  hypothetical protein CARUB_v10022420mg             105   3e-23   Capsella rubella
ref|XP_004500608.1|  PREDICTED: probable beta-D-xylosidase 7-like       105   3e-23   
ref|NP_001266114.1|  SlArf/Xyl4 protein precursor                       105   3e-23   Solanum lycopersicum
gb|KEH28065.1|  glycoside hydrolase family 3 amino-terminal domai...    104   4e-23   Medicago truncatula
ref|XP_002980053.1|  hypothetical protein SELMODRAFT_112087             105   4e-23   Selaginella moellendorffii
gb|KFK42187.1|  hypothetical protein AALP_AA2G222800                    105   5e-23   Arabis alpina [alpine rockcress]
gb|KJB59941.1|  hypothetical protein B456_009G282000                    104   5e-23   Gossypium raimondii
ref|XP_011016184.1|  PREDICTED: probable beta-D-xylosidase 7            105   5e-23   Populus euphratica
ref|XP_010472005.1|  PREDICTED: probable beta-D-xylosidase 7            104   5e-23   Camelina sativa [gold-of-pleasure]
gb|AES97964.2|  glycoside hydrolase family 3 amino-terminal domai...    104   6e-23   Medicago truncatula
ref|XP_006354009.1|  PREDICTED: probable beta-D-xylosidase 7-like       104   6e-23   Solanum tuberosum [potatoes]
gb|EYU46800.1|  hypothetical protein MIMGU_mgv1a018473mg                104   7e-23   Erythranthe guttata [common monkey flower]
gb|EYU18509.1|  hypothetical protein MIMGU_mgv1a001665mg                104   7e-23   Erythranthe guttata [common monkey flower]
ref|XP_006390030.1|  hypothetical protein EUTSA_v10018160mg             104   7e-23   Eutrema salsugineum [saltwater cress]
ref|XP_002987446.1|  hypothetical protein SELMODRAFT_426206             104   7e-23   Selaginella moellendorffii
ref|XP_010676938.1|  PREDICTED: probable beta-D-xylosidase 7            104   8e-23   Beta vulgaris subsp. vulgaris [field beet]
gb|AFW59619.1|  putative O-Glycosyl hydrolase superfamily protein       102   8e-23   
ref|XP_003625957.1|  Beta-xylosidase                                    104   8e-23   Medicago truncatula
gb|KDP28242.1|  hypothetical protein JCGZ_14013                         104   8e-23   Jatropha curcas
gb|KJB59940.1|  hypothetical protein B456_009G282000                    104   8e-23   Gossypium raimondii
gb|KHG13360.1|  putative beta-D-xylosidase 7 -like protein              104   8e-23   Gossypium arboreum [tree cotton]
ref|XP_008234021.1|  PREDICTED: probable beta-D-xylosidase 7            104   8e-23   Prunus mume [ume]
ref|XP_004976988.1|  PREDICTED: beta-D-xylosidase 4-like isoform X1     104   9e-23   
ref|XP_010416771.1|  PREDICTED: probable beta-D-xylosidase 7            103   9e-23   Camelina sativa [gold-of-pleasure]
ref|XP_011074159.1|  PREDICTED: probable beta-D-xylosidase 7            103   1e-22   Sesamum indicum [beniseed]
ref|XP_004513829.1|  PREDICTED: probable beta-D-xylosidase 7-like       103   1e-22   Cicer arietinum [garbanzo]
ref|XP_006826952.1|  hypothetical protein AMTR_s00010p00188970          103   1e-22   Amborella trichopoda
ref|XP_002987447.1|  hypothetical protein SELMODRAFT_426207             103   1e-22   
ref|XP_002980054.1|  hypothetical protein SELMODRAFT_419541             103   1e-22   
ref|XP_010457247.1|  PREDICTED: probable beta-D-xylosidase 2            103   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_002885319.1|  beta-1,4-xylosidase                                103   2e-22   
ref|XP_010113184.1|  putative beta-D-xylosidase 5                       100   2e-22   Morus notabilis
ref|XP_007136230.1|  hypothetical protein PHAVU_009G029300g             102   2e-22   Phaseolus vulgaris [French bean]
gb|KDP44489.1|  hypothetical protein JCGZ_16322                         102   3e-22   Jatropha curcas
gb|KCW68842.1|  hypothetical protein EUGRSUZ_F02442                     102   3e-22   Eucalyptus grandis [rose gum]
ref|XP_009596711.1|  PREDICTED: probable beta-D-xylosidase 7          96.3    3e-22   Nicotiana tomentosiformis
gb|EYU23224.1|  hypothetical protein MIMGU_mgv1a001695mg                102   3e-22   Erythranthe guttata [common monkey flower]
ref|XP_006287090.1|  hypothetical protein CARUB_v10000252mg             102   3e-22   
ref|XP_010064766.1|  PREDICTED: probable beta-D-xylosidase 7            102   3e-22   Eucalyptus grandis [rose gum]
ref|XP_003519750.1|  PREDICTED: probable beta-D-xylosidase 2-like       102   3e-22   Glycine max [soybeans]
ref|NP_001266104.1|  SlArf/Xyl1 protein precursor                       102   3e-22   
ref|XP_004170761.1|  PREDICTED: beta-D-xylosidase 1-like              98.6    3e-22   
ref|XP_007018823.1|  Glycosyl hydrolase family protein isoform 1        103   3e-22   
ref|XP_006300771.1|  hypothetical protein CARUB_v10019845mg             102   3e-22   Capsella rubella
ref|XP_007018825.1|  Glycosyl hydrolase family protein isoform 3        103   4e-22   
ref|XP_007018824.1|  Glycosyl hydrolase family protein isoform 2        103   4e-22   
ref|XP_004163321.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    102   4e-22   
emb|CDP17081.1|  unnamed protein product                                102   4e-22   Coffea canephora [robusta coffee]
ref|XP_003544783.1|  PREDICTED: probable beta-D-xylosidase 7-like       102   4e-22   Glycine max [soybeans]
ref|XP_004150696.1|  PREDICTED: probable beta-D-xylosidase 7-like       102   4e-22   Cucumis sativus [cucumbers]
dbj|BAB02547.1|  beta-1,4-xylosidase                                    102   4e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007145157.1|  hypothetical protein PHAVU_007G215100g             102   4e-22   Phaseolus vulgaris [French bean]
ref|XP_002513892.1|  Periplasmic beta-glucosidase precursor, puta...    102   4e-22   Ricinus communis
ref|XP_008386729.1|  PREDICTED: probable beta-D-xylosidase 2            102   4e-22   
ref|XP_008661822.1|  PREDICTED: uncharacterized protein LOC100279...    102   5e-22   
ref|XP_007042636.1|  Glycosyl hydrolase family protein                  102   5e-22   
gb|KJB77632.1|  hypothetical protein B456_012G147500                    102   5e-22   Gossypium raimondii
ref|XP_011041424.1|  PREDICTED: probable beta-D-xylosidase 2            102   5e-22   Populus euphratica
ref|XP_007018826.1|  Glycosyl hydrolase family protein                  102   5e-22   
ref|XP_011015623.1|  PREDICTED: probable beta-D-xylosidase 2            102   5e-22   Populus euphratica
gb|KHG24361.1|  Beta-D-xylosidase 1 -like protein                     98.2    6e-22   Gossypium arboreum [tree cotton]
ref|XP_009757165.1|  PREDICTED: probable beta-D-xylosidase 2            101   6e-22   Nicotiana sylvestris
ref|XP_007225247.1|  hypothetical protein PRUPE_ppa001675mg             101   6e-22   Prunus persica
ref|XP_002889174.1|  glycosyl hydrolase family 3 protein                101   7e-22   Arabidopsis lyrata subsp. lyrata
ref|XP_011100796.1|  PREDICTED: beta-D-xylosidase 1                     101   7e-22   Sesamum indicum [beniseed]
ref|XP_003535953.1|  PREDICTED: probable beta-D-xylosidase 2            101   8e-22   Glycine max [soybeans]
ref|XP_003638778.1|  Xylan 1 4-beta-xylosidase                          101   8e-22   
ref|XP_009339788.1|  PREDICTED: probable beta-D-xylosidase 2            101   8e-22   Pyrus x bretschneideri [bai li]
gb|KHN08645.1|  Putative beta-D-xylosidase 2                            101   8e-22   Glycine soja [wild soybean]
ref|XP_002320310.2|  hypothetical protein POPTR_0014s11730g             101   8e-22   
ref|XP_006653810.1|  PREDICTED: beta-D-xylosidase 4-like                101   9e-22   
emb|CDP18762.1|  unnamed protein product                                100   9e-22   Coffea canephora [robusta coffee]
ref|XP_010428909.1|  PREDICTED: probable beta-D-xylosidase 7 isof...    101   9e-22   Camelina sativa [gold-of-pleasure]
ref|XP_008384517.1|  PREDICTED: probable beta-D-xylosidase 5            101   1e-21   
ref|XP_006399554.1|  hypothetical protein EUTSA_v10012725mg             101   1e-21   Eutrema salsugineum [saltwater cress]
gb|ACD93208.1|  beta xylosidase                                         101   1e-21   Camellia sinensis [black tea]
ref|XP_002527511.1|  Beta-glucosidase, putative                         101   1e-21   Ricinus communis
ref|XP_003592512.1|  Xylosidase                                         101   1e-21   Medicago truncatula
ref|NP_188596.1|  putative beta-D-xylosidase 5                          100   1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873465.1|  glycosyl hydrolase family 3 protein                100   1e-21   Arabidopsis lyrata subsp. lyrata
gb|KHN43468.1|  Putative beta-D-xylosidase 2                            100   1e-21   Glycine soja [wild soybean]
gb|EPS70883.1|  hypothetical protein M569_03875                         100   1e-21   Genlisea aurea
emb|CDY00033.1|  BnaC09g02680D                                          100   1e-21   
gb|KJB29303.1|  hypothetical protein B456_005G093200                    100   1e-21   Gossypium raimondii
gb|KJB29304.1|  hypothetical protein B456_005G093200                    100   1e-21   Gossypium raimondii
ref|XP_010534139.1|  PREDICTED: probable beta-D-xylosidase 7          94.7    1e-21   Tarenaya hassleriana [spider flower]
ref|XP_010481135.1|  PREDICTED: probable beta-D-xylosidase 2            100   2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_004300463.1|  PREDICTED: probable beta-D-xylosidase 2            100   2e-21   Fragaria vesca subsp. vesca
ref|XP_010111676.1|  putative beta-D-xylosidase 5                       100   2e-21   
emb|CDY15255.1|  BnaC05g01340D                                          100   2e-21   Brassica napus [oilseed rape]
ref|XP_003580652.1|  PREDICTED: beta-D-xylosidase 4-like                100   2e-21   Brachypodium distachyon [annual false brome]
ref|XP_010914548.1|  PREDICTED: probable beta-D-xylosidase 2            100   2e-21   Elaeis guineensis
ref|XP_003534261.1|  PREDICTED: probable beta-D-xylosidase 6-like       100   2e-21   Glycine max [soybeans]
ref|XP_010657638.1|  PREDICTED: beta-D-xylosidase 4-like              96.7    2e-21   
ref|XP_009378701.1|  PREDICTED: probable beta-D-xylosidase 2            100   2e-21   Pyrus x bretschneideri [bai li]
gb|KDO80914.1|  hypothetical protein CISIN_1g004054mg                 99.8    2e-21   Citrus sinensis [apfelsine]
gb|EYU23228.1|  hypothetical protein MIMGU_mgv1a018779mg              99.8    2e-21   Erythranthe guttata [common monkey flower]
gb|EYU23223.1|  hypothetical protein MIMGU_mgv1a001417mg                100   2e-21   Erythranthe guttata [common monkey flower]
ref|XP_011042236.1|  PREDICTED: probable beta-D-xylosidase 2            100   2e-21   Populus euphratica
ref|XP_006352077.1|  PREDICTED: beta-D-xylosidase 1-like                100   2e-21   Solanum tuberosum [potatoes]
ref|XP_009593976.1|  PREDICTED: probable beta-D-xylosidase 2            100   3e-21   Nicotiana tomentosiformis
ref|XP_009111875.1|  PREDICTED: beta-D-xylosidase 1-like                100   3e-21   Brassica rapa
gb|KDP20227.1|  hypothetical protein JCGZ_09859                       99.8    3e-21   Jatropha curcas
ref|XP_002889410.1|  hypothetical protein ARALYDRAFT_470222           99.8    3e-21   
ref|XP_010687347.1|  PREDICTED: probable beta-D-xylosidase 5          99.8    3e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003591420.1|  Beta xylosidase                                  99.8    3e-21   Medicago truncatula
emb|CDX97026.1|  BnaC09g45990D                                        99.8    3e-21   
gb|KFK42620.1|  hypothetical protein AALP_AA1G019000                  99.8    3e-21   Arabis alpina [alpine rockcress]
gb|KJB38536.1|  hypothetical protein B456_006G259500                  99.4    3e-21   Gossypium raimondii
emb|CDX89954.1|  BnaA10g01280D                                        99.8    3e-21   
ref|XP_009119616.1|  PREDICTED: probable beta-D-xylosidase 2          99.8    3e-21   Brassica rapa
ref|XP_002519194.1|  Periplasmic beta-glucosidase precursor, puta...  99.8    3e-21   Ricinus communis
gb|EYU23226.1|  hypothetical protein MIMGU_mgv1a025071mg              99.8    3e-21   Erythranthe guttata [common monkey flower]
ref|XP_010259348.1|  PREDICTED: putative beta-D-xylosidase            99.8    3e-21   Nelumbo nucifera [Indian lotus]
ref|XP_006306829.1|  hypothetical protein CARUB_v10008371mg           99.8    4e-21   Capsella rubella
ref|XP_006434020.1|  hypothetical protein CICLE_v10000352mg           99.4    4e-21   Citrus clementina [clementine]
gb|KDO80913.1|  hypothetical protein CISIN_1g004054mg                 99.4    4e-21   Citrus sinensis [apfelsine]
ref|XP_006472631.1|  PREDICTED: probable beta-D-xylosidase 7-like     99.4    4e-21   Citrus sinensis [apfelsine]
ref|XP_009404942.1|  PREDICTED: probable beta-D-xylosidase 6          99.8    4e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007035744.1|  Periplasmic beta-glucosidase, putative           99.4    4e-21   
ref|NP_001266107.1|  SlArf/Xyl2 protein precursor                     99.4    4e-21   Solanum lycopersicum
gb|AAS17751.2|  beta xylosidase                                       99.4    4e-21   Fragaria x ananassa
ref|XP_011020382.1|  PREDICTED: putative beta-D-xylosidase            99.4    4e-21   Populus euphratica
ref|XP_004295104.1|  PREDICTED: putative beta-D-xylosidase            99.4    5e-21   Fragaria vesca subsp. vesca
gb|EYU33328.1|  hypothetical protein MIMGU_mgv1a001688mg              99.4    5e-21   
gb|KJB44020.1|  hypothetical protein B456_007G230000                  99.4    5e-21   
ref|XP_003542472.1|  PREDICTED: probable beta-D-xylosidase 7-like     99.4    5e-21   
ref|XP_010507856.1|  PREDICTED: probable beta-D-xylosidase 5          99.4    5e-21   
gb|KHN19223.1|  Putative beta-D-xylosidase 2                          99.0    5e-21   
gb|KDO87029.1|  hypothetical protein CISIN_1g0041902mg                93.2    5e-21   
ref|XP_008808663.1|  PREDICTED: beta-D-xylosidase 1-like              99.0    5e-21   
ref|XP_007163167.1|  hypothetical protein PHAVU_001G212100g           99.0    5e-21   
gb|KJB38535.1|  hypothetical protein B456_006G259500                  99.0    6e-21   
emb|CDY58860.1|  BnaCnng33860D                                        99.0    6e-21   
gb|EYU33325.1|  hypothetical protein MIMGU_mgv1a001753mg              99.0    6e-21   
gb|KHG14371.1|  Beta-D-xylosidase 1 -like protein                     99.0    6e-21   
ref|XP_006418321.1|  hypothetical protein EUTSA_v10006876mg           99.0    6e-21   
ref|XP_006406478.1|  hypothetical protein EUTSA_v10022061mg           99.0    6e-21   
ref|XP_003520749.2|  PREDICTED: probable beta-D-xylosidase 2-like     99.0    7e-21   
ref|XP_010453089.1|  PREDICTED: probable beta-D-xylosidase 6          99.0    7e-21   
gb|KCW68841.1|  hypothetical protein EUGRSUZ_F02441                   98.2    7e-21   
ref|XP_011082425.1|  PREDICTED: probable beta-D-xylosidase 2          99.0    7e-21   
emb|CDP01028.1|  unnamed protein product                              98.6    7e-21   
ref|XP_007200259.1|  hypothetical protein PRUPE_ppa015037mg           99.0    7e-21   
ref|XP_008454299.1|  PREDICTED: probable beta-D-xylosidase 2 isof...  98.6    7e-21   
ref|XP_008236322.1|  PREDICTED: probable beta-D-xylosidase 5          99.0    7e-21   
ref|XP_010466113.1|  PREDICTED: probable beta-D-xylosidase 5          98.6    7e-21   
ref|XP_002302758.2|  hypothetical protein POPTR_0002s19830g           98.6    8e-21   
gb|KJB09457.1|  hypothetical protein B456_001G143600                  98.6    8e-21   
ref|XP_002311398.2|  beta-D-xylosidase family protein                 98.6    8e-21   
ref|NP_563659.1|  probable beta-D-xylosidase 2                        98.6    8e-21   
emb|CDY67410.1|  BnaCnng54810D                                        97.8    8e-21   
ref|XP_008454298.1|  PREDICTED: probable beta-D-xylosidase 2 isof...  98.6    8e-21   
gb|KHG05051.1|  putative beta-D-xylosidase 2 -like protein            98.6    8e-21   
gb|AAG10624.1|AC022521_2  Similar to xylosidase                       98.6    9e-21   
ref|XP_006349198.1|  PREDICTED: probable beta-D-xylosidase 2-like     98.6    9e-21   
ref|XP_006830079.1|  hypothetical protein AMTR_s00125p00113140        98.6    9e-21   
ref|XP_004151112.1|  PREDICTED: beta-D-xylosidase 1-like              98.2    1e-20   
gb|KDP20226.1|  hypothetical protein JCGZ_09858                       98.2    1e-20   
ref|XP_011030348.1|  PREDICTED: probable beta-D-xylosidase 5          98.2    1e-20   
ref|XP_011012436.1|  PREDICTED: probable beta-D-xylosidase 5          98.2    1e-20   
ref|XP_008236665.1|  PREDICTED: probable beta-D-xylosidase 6 isof...  98.2    1e-20   
ref|XP_009782574.1|  PREDICTED: probable beta-D-xylosidase 7          98.2    1e-20   
ref|XP_006298950.1|  hypothetical protein CARUB_v10015075mg           97.8    1e-20   
ref|XP_009145766.1|  PREDICTED: probable beta-D-xylosidase 5          98.2    1e-20   
ref|XP_001775759.1|  predicted protein                                98.2    1e-20   
gb|KJB72795.1|  hypothetical protein B456_011G198200                  97.8    1e-20   
ref|XP_009369955.1|  PREDICTED: putative beta-D-xylosidase            97.8    1e-20   
ref|XP_009592501.1|  PREDICTED: probable beta-D-xylosidase 7          97.8    1e-20   
gb|KDO78723.1|  hypothetical protein CISIN_1g003606mg                 97.8    1e-20   
ref|XP_006466365.1|  PREDICTED: probable beta-D-xylosidase 6-like     97.8    1e-20   
ref|XP_006426203.1|  hypothetical protein CICLE_v10024911mg           97.8    1e-20   
emb|CAJ41429.1|  beta (1,4)-xylosidase                                97.8    1e-20   
emb|CDY49607.1|  BnaA09g03310D                                        97.8    1e-20   
ref|XP_008362602.1|  PREDICTED: probable beta-D-xylosidase 7          95.5    1e-20   
ref|XP_010679361.1|  PREDICTED: probable beta-D-xylosidase 2          97.8    1e-20   
gb|EYU23824.1|  hypothetical protein MIMGU_mgv1a020334mg              97.8    2e-20   
gb|KDO78722.1|  hypothetical protein CISIN_1g003606mg                 97.8    2e-20   
ref|XP_003594795.1|  Beta xylosidase                                  97.8    2e-20   
ref|XP_002302284.2|  glycosyl hydrolase family 3 family protein       97.8    2e-20   
ref|XP_003554544.1|  PREDICTED: probable beta-D-xylosidase 2-like     97.8    2e-20   
ref|XP_002276351.1|  PREDICTED: putative beta-D-xylosidase            97.8    2e-20   
ref|XP_006354074.1|  PREDICTED: probable beta-D-xylosidase 7-like     97.8    2e-20   
ref|XP_009106451.1|  PREDICTED: probable beta-D-xylosidase 7          97.4    2e-20   
ref|XP_004301317.1|  PREDICTED: probable beta-D-xylosidase 7          97.4    2e-20   
ref|XP_011099456.1|  PREDICTED: probable beta-D-xylosidase 6          97.4    2e-20   
ref|XP_010061816.1|  PREDICTED: probable beta-D-xylosidase 7          97.4    2e-20   
emb|CBI22910.3|  unnamed protein product                              97.4    2e-20   
ref|XP_007047697.1|  Glycosyl hydrolase family protein                97.4    2e-20   
ref|XP_011079568.1|  PREDICTED: probable beta-D-xylosidase 2          97.4    2e-20   
emb|CDX87482.1|  BnaA07g33910D                                        97.4    2e-20   
ref|XP_006354008.1|  PREDICTED: probable beta-D-xylosidase 7-like     97.4    2e-20   
gb|KJB29307.1|  hypothetical protein B456_005G093300                  97.4    2e-20   
gb|EYU25657.1|  hypothetical protein MIMGU_mgv11b023706mg             92.0    2e-20   
ref|XP_010087253.1|  putative beta-D-xylosidase 2                     97.4    2e-20   
ref|XP_006369735.1|  glycosyl hydrolase family 3 family protein       97.4    2e-20   
ref|XP_006858943.1|  hypothetical protein AMTR_s00068p00088730        97.4    2e-20   
ref|XP_009122041.1|  PREDICTED: probable beta-D-xylosidase 6          97.1    2e-20   
gb|KJB59094.1|  hypothetical protein B456_009G239100                  97.4    2e-20   
emb|CAN72807.1|  hypothetical protein VITISV_033721                   93.6    3e-20   
ref|XP_006354073.1|  PREDICTED: probable beta-D-xylosidase 7-like     97.1    3e-20   
emb|CDY33913.1|  BnaA02g30740D                                        97.1    3e-20   
ref|XP_009383731.1|  PREDICTED: probable beta-D-xylosidase 2          97.1    3e-20   
ref|XP_003612944.1|  Beta-D-xylosidase                                97.1    3e-20   
emb|CDY05634.1|  BnaC02g39030D                                        97.1    3e-20   
ref|XP_009603126.1|  PREDICTED: probable beta-D-xylosidase 5          97.1    3e-20   
ref|NP_196618.1|  putative beta-D-xylosidase 6                        97.1    3e-20   
dbj|BAG28345.1|  arabinofuranosidase                                  97.1    3e-20   
ref|XP_004494414.1|  PREDICTED: probable beta-D-xylosidase 2-like     96.7    3e-20   
ref|XP_009779847.1|  PREDICTED: probable beta-D-xylosidase 5          96.7    3e-20   
gb|KDO49896.1|  hypothetical protein CISIN_1g003980mg                 96.7    3e-20   
ref|XP_006419427.1|  hypothetical protein CICLE_v10004369mg           96.7    3e-20   
ref|XP_010937520.1|  PREDICTED: uncharacterized protein LOC105056876  97.4    3e-20   
ref|XP_006487370.1|  PREDICTED: probable beta-D-xylosidase 5-like     96.7    4e-20   
ref|XP_009599906.1|  PREDICTED: probable beta-D-xylosidase 7          96.7    4e-20   
ref|XP_004156823.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  96.7    4e-20   
ref|XP_009782575.1|  PREDICTED: probable beta-D-xylosidase 7          96.7    4e-20   
ref|XP_006488872.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...  96.7    4e-20   
ref|XP_010268028.1|  PREDICTED: probable beta-D-xylosidase 2          96.7    4e-20   
ref|XP_002270249.1|  PREDICTED: probable beta-D-xylosidase 2 isof...  96.7    4e-20   
ref|XP_004136155.1|  PREDICTED: probable beta-D-xylosidase 2-like     96.7    4e-20   
gb|ABY48135.1|  beta-D-xylosidase                                     96.7    4e-20   
ref|XP_004162442.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  96.7    4e-20   
ref|XP_009348894.1|  PREDICTED: putative beta-D-xylosidase            96.7    4e-20   
ref|XP_008341125.1|  PREDICTED: putative beta-D-xylosidase            96.3    4e-20   
emb|CDO98788.1|  unnamed protein product                              96.3    4e-20   
ref|XP_011016128.1|  PREDICTED: probable beta-D-xylosidase 7          96.3    4e-20   
ref|XP_008390557.1|  PREDICTED: putative beta-D-xylosidase            96.3    4e-20   
ref|XP_007225668.1|  hypothetical protein PRUPE_ppa001718mg           96.3    5e-20   
gb|KFK26586.1|  hypothetical protein AALP_AA8G267600                  96.3    5e-20   
emb|CDX88410.1|  BnaC06g38540D                                        96.3    5e-20   
ref|XP_006423474.1|  hypothetical protein CICLE_v10027856mg           96.3    5e-20   
dbj|BAF00595.1|  xylosidase                                           93.6    5e-20   
ref|XP_008223305.1|  PREDICTED: putative beta-D-xylosidase            96.3    5e-20   
ref|XP_008808189.1|  PREDICTED: probable beta-D-xylosidase 7          96.3    5e-20   
ref|XP_009369659.1|  PREDICTED: probable beta-D-xylosidase 7          96.3    5e-20   
gb|AFU54452.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase         96.3    5e-20   
gb|KDO87027.1|  hypothetical protein CISIN_1g0041902mg                92.4    5e-20   
gb|AFU54451.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase         96.3    5e-20   
ref|XP_009782577.1|  PREDICTED: probable beta-D-xylosidase 7 isof...  95.5    6e-20   
ref|XP_010664313.1|  PREDICTED: probable beta-D-xylosidase 7          96.3    6e-20   
ref|XP_009129779.1|  PREDICTED: beta-D-xylosidase 1-like              96.3    6e-20   
ref|XP_010676949.1|  PREDICTED: probable beta-D-xylosidase 7          96.3    6e-20   
emb|CDP01027.1|  unnamed protein product                              96.7    6e-20   
ref|XP_008235191.1|  PREDICTED: probable beta-D-xylosidase 2          95.9    6e-20   
ref|XP_002264114.2|  PREDICTED: probable beta-D-xylosidase 5          95.9    6e-20   
ref|XP_008375790.1|  PREDICTED: probable beta-D-xylosidase 7          95.9    7e-20   
ref|XP_002451244.1|  hypothetical protein SORBIDRAFT_05g026400        95.9    7e-20   
ref|XP_010094323.1|  Beta-D-xylosidase 1                              95.9    7e-20   
ref|XP_006605998.1|  PREDICTED: probable beta-D-xylosidase 5-like     95.9    7e-20   
emb|CAN82161.1|  hypothetical protein VITISV_035506                   95.9    8e-20   
ref|XP_004152230.1|  PREDICTED: probable beta-D-xylosidase 2-like     95.9    8e-20   
emb|CBI22460.3|  unnamed protein product                              95.9    8e-20   
ref|XP_009400278.1|  PREDICTED: probable beta-D-xylosidase 6          95.9    8e-20   
ref|NP_001266109.1|  SlArf/Xyl3 protein precursor                     95.5    8e-20   
ref|XP_010671663.1|  PREDICTED: beta-D-xylosidase 1                   95.5    9e-20   
gb|EPS60429.1|  hypothetical protein M569_14372                       95.5    9e-20   
ref|XP_003567059.2|  PREDICTED: beta-D-xylosidase 1-like              95.5    1e-19   
gb|KHG30322.1|  putative beta-D-xylosidase 7 -like protein            94.4    1e-19   
ref|XP_004238520.1|  PREDICTED: probable beta-D-xylosidase 7          95.5    1e-19   
ref|XP_004487789.1|  PREDICTED: beta-D-xylosidase 1-like              95.5    1e-19   
ref|XP_006581546.1|  PREDICTED: probable beta-D-xylosidase 7-like...  94.7    1e-19   
gb|KDP27887.1|  hypothetical protein JCGZ_18967                       95.1    1e-19   
gb|EYU23074.1|  hypothetical protein MIMGU_mgv1a019840mg              95.1    1e-19   
ref|NP_001145980.1|  putative O-Glycosyl hydrolase superfamily pr...  95.1    1e-19   
ref|XP_003526589.1|  PREDICTED: probable beta-D-xylosidase 7-like...  95.1    1e-19   
ref|XP_008458374.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...  95.1    1e-19   
ref|XP_006448620.1|  hypothetical protein CICLE_v10018262mg           95.1    1e-19   
gb|KFK25328.1|  hypothetical protein AALP_AA8G098500                  95.1    1e-19   
gb|EYU33329.1|  hypothetical protein MIMGU_mgv1a001598mg              95.1    1e-19   
ref|XP_004143540.1|  PREDICTED: probable beta-D-xylosidase 6-like     95.1    1e-19   
ref|XP_006395069.1|  hypothetical protein EUTSA_v10003681mg           94.7    2e-19   
gb|KCW58370.1|  hypothetical protein EUGRSUZ_H010552                  89.4    2e-19   
ref|XP_009151303.1|  PREDICTED: beta-D-xylosidase 1                   94.7    2e-19   
ref|XP_009782576.1|  PREDICTED: probable beta-D-xylosidase 7 isof...  94.7    2e-19   
emb|CDX85405.1|  BnaC07g27160D                                        94.7    2e-19   
ref|XP_004160150.1|  PREDICTED: probable beta-D-xylosidase 6-like     94.7    2e-19   
ref|XP_003546334.1|  PREDICTED: beta-D-xylosidase 1-like              94.7    2e-19   
ref|XP_010491733.1|  PREDICTED: probable beta-D-xylosidase 6          94.7    2e-19   
ref|XP_002513887.1|  hypothetical protein RCOM_1034150                91.3    2e-19   
ref|XP_007200621.1|  hypothetical protein PRUPE_ppa001656mg           94.4    2e-19   
ref|XP_008385726.1|  PREDICTED: probable beta-D-xylosidase 6          94.4    2e-19   
ref|XP_003533205.2|  PREDICTED: beta-D-xylosidase 1-like              94.4    2e-19   
ref|XP_007138975.1|  hypothetical protein PHAVU_009G254300g           94.4    2e-19   
ref|XP_010683056.1|  PREDICTED: probable beta-D-xylosidase 6          94.4    3e-19   
ref|XP_002316021.1|  beta-D-xylosidase family protein                 94.0    3e-19   
emb|CDX69822.1|  BnaA10g21710D                                        94.0    3e-19   
dbj|BAQ19511.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase        94.0    3e-19   
ref|XP_008236660.1|  PREDICTED: probable beta-D-xylosidase 6 isof...  94.0    3e-19   
ref|NP_199747.1|  bifunctional {beta}-D-xylosidase/{alpha}-L-arab...  94.0    3e-19   
ref|XP_007158321.1|  hypothetical protein PHAVU_002G142900g           94.0    3e-19   
ref|XP_010546993.1|  PREDICTED: beta-D-xylosidase 1-like isoform X1   94.0    3e-19   
ref|XP_010482214.1|  PREDICTED: beta-D-xylosidase 1-like              94.0    3e-19   
ref|XP_010440503.1|  PREDICTED: beta-D-xylosidase 1                   94.0    4e-19   
ref|XP_006280043.1|  hypothetical protein CARUB_v10025920mg           93.6    4e-19   
ref|XP_008451490.1|  PREDICTED: probable beta-D-xylosidase 2          93.6    4e-19   
gb|AAP83934.1|  auxin-induced beta-glucosidase                        93.6    4e-19   
ref|XP_007206430.1|  hypothetical protein PRUPE_ppa001583mg           93.6    5e-19   
gb|KHG02565.1|  putative beta-D-xylosidase 7                          93.6    5e-19   
gb|AHA84290.1|  beta-D-xylosidase                                     90.1    5e-19   
ref|XP_009390583.1|  PREDICTED: probable beta-D-xylosidase 7          93.2    5e-19   
dbj|BAO45878.1|  beta-D-xylosidase                                    93.2    6e-19   
emb|CDP02677.1|  unnamed protein product                              93.2    6e-19   
gb|KHG02566.1|  putative beta-D-xylosidase 7                          93.2    6e-19   
gb|ABA95273.1|  Beta-D-xylosidase, putative, expressed                93.2    6e-19   
ref|XP_002865732.1|  beta-xylosidase 1                                93.2    6e-19   
ref|XP_010522822.1|  PREDICTED: probable beta-D-xylosidase 2          93.2    6e-19   
ref|XP_006444470.1|  hypothetical protein CICLE_v10018959mg           93.2    7e-19   
ref|XP_011098370.1|  PREDICTED: probable beta-D-xylosidase 7          93.2    7e-19   
gb|EYU39877.1|  hypothetical protein MIMGU_mgv1a018879mg              92.8    7e-19   
ref|XP_007051080.1|  Beta-xylosidase 2                                92.8    8e-19   
ref|XP_002977427.1|  hypothetical protein SELMODRAFT_106899           92.8    8e-19   
ref|XP_002975008.1|  hypothetical protein SELMODRAFT_103038           92.8    8e-19   
gb|KHN12900.1|  Beta-D-xylosidase 1                                   92.8    8e-19   
ref|XP_010693351.1|  PREDICTED: probable beta-D-xylosidase 7          92.8    9e-19   
ref|XP_010918501.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  92.8    9e-19   
ref|XP_002264031.2|  PREDICTED: probable beta-D-xylosidase 6          92.4    1e-18   
ref|XP_011009934.1|  PREDICTED: putative beta-D-xylosidase            92.4    1e-18   
ref|XP_002513891.1|  hypothetical protein RCOM_1034290                90.1    1e-18   
gb|EYU33327.1|  hypothetical protein MIMGU_mgv1a001678mg              92.4    1e-18   
ref|XP_006448621.1|  hypothetical protein CICLE_v10014325mg           92.4    1e-18   
gb|EAY81823.1|  hypothetical protein OsI_36995                        92.4    1e-18   
emb|CBI25718.3|  unnamed protein product                              92.4    1e-18   
ref|NP_001068441.1|  Os11g0673200                                     92.4    1e-18   
dbj|BAF79669.1|  beta-D-xylosidase                                    92.4    1e-18   
ref|XP_008353169.1|  PREDICTED: putative beta-D-xylosidase            92.4    1e-18   
gb|EYU26759.1|  hypothetical protein MIMGU_mgv1a0244552mg             87.0    1e-18   
ref|NP_001067710.2|  Os11g0291500                                     87.0    1e-18   
ref|NP_001280797.1|  putative beta-D-xylosidase precursor             92.4    1e-18   
ref|XP_006468650.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  92.4    1e-18   
gb|AGR44452.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase 2       92.4    1e-18   
dbj|BAD98523.1|  alpha-L-arabinofuranosidase / beta-D-xylosidase      92.0    1e-18   
ref|XP_007140931.1|  hypothetical protein PHAVU_008G153300g           92.0    1e-18   
gb|KJB49844.1|  hypothetical protein B456_008G140600                  92.0    1e-18   
gb|KCW61272.1|  hypothetical protein EUGRSUZ_H04033                   92.0    1e-18   
ref|XP_010254644.1|  PREDICTED: probable beta-D-xylosidase 6          92.0    2e-18   
ref|XP_010024778.1|  PREDICTED: putative beta-D-xylosidase            92.0    2e-18   
gb|KJB16242.1|  hypothetical protein B456_002G219200                  92.0    2e-18   
ref|XP_004979939.1|  PREDICTED: probable beta-D-xylosidase 2-like     92.0    2e-18   
gb|KJB16243.1|  hypothetical protein B456_002G219200                  91.7    2e-18   
ref|XP_008440505.1|  PREDICTED: probable beta-D-xylosidase 6          91.7    2e-18   
gb|EYU44551.1|  hypothetical protein MIMGU_mgv1a001559mg              91.7    2e-18   
gb|KDP45919.1|  hypothetical protein JCGZ_15479                       87.4    2e-18   
emb|CBI25987.3|  unnamed protein product                              91.3    3e-18   
ref|XP_002274591.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  91.3    3e-18   



>ref|XP_009612011.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 {ECO:0000303|PubMed:17615411, 
ECO:0000312|EMBL:ABQ45228.1}-like 
[Nicotiana tomentosiformis]
Length=778

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +3

Query  111  PVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNES  290
            PV +QT PV+ACD   NPG+K+  FC+  LDV +RV DLVKRLTL EKIT+LVNTAG+ S
Sbjct  31   PVLAQTSPVFACDVANNPGVKNFAFCDVSLDVSSRVNDLVKRLTLEEKITMLVNTAGSVS  90

Query  291  RLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            RLGIPTYEWW EALHG+ YTGPGV F GVVP ATSFP P+LT
Sbjct  91   RLGIPTYEWWSEALHGISYTGPGVKFNGVVPGATSFPQPILT  132



>ref|XP_006351808.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Solanum tuberosum]
Length=778

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = +3

Query  111  PVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNES  290
            PV +QT  V+ACDT  NP LKS PFC+  L V  RV DLVKRLTL EKIT+LVNTAGN S
Sbjct  34   PVSAQTSAVFACDTATNPSLKSFPFCDVSLGVSARVKDLVKRLTLQEKITMLVNTAGNVS  93

Query  291  RLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            RLGIP YEWW EALHG+ YTGPGV F  +VP ATSFP P+LT
Sbjct  94   RLGIPKYEWWSEALHGISYTGPGVKFNNIVPHATSFPQPILT  135



>ref|XP_004230547.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Solanum 
lycopersicum]
Length=778

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = +3

Query  111  PVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNES  290
            PV +QT  V+ACDT  NP LKS PFC+  L V  RV DLVKRLTL EKI++LVNTAG+ S
Sbjct  34   PVSAQTSAVFACDTANNPSLKSFPFCDVSLGVSDRVNDLVKRLTLQEKISMLVNTAGSVS  93

Query  291  RLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            RLGIP YEWW EALHG+ YTGPGV F  +VP ATSFP P+LT
Sbjct  94   RLGIPKYEWWSEALHGISYTGPGVKFNNIVPHATSFPQPILT  135



>ref|XP_009762535.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nicotiana sylvestris]
Length=779

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 80/103 (78%), Gaps = 1/103 (1%)
 Frame = +3

Query  111  PVQSQT-GPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNE  287
            PV +QT  P +ACD   NPG+K+  FC+  LDV  RV DLVKRLTL EKIT+LVNTAG+ 
Sbjct  31   PVLAQTTSPAFACDVANNPGVKNFGFCDVSLDVSARVNDLVKRLTLEEKITMLVNTAGSV  90

Query  288  SRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            SRLGIP YEWW EALHG+ YTGPGV F GVVP ATSFP P+LT
Sbjct  91   SRLGIPKYEWWSEALHGISYTGPGVKFNGVVPGATSFPQPILT  133



>dbj|BAQ02862.1| alpha-L-Arabinofuranosidase/beta-D-Xylopyrianosidase, partial 
[Nicotiana tabacum]
Length=368

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 79/103 (77%), Gaps = 1/103 (1%)
 Frame = +3

Query  111  PVQSQT-GPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNE  287
            PV +QT  P +ACD   NPG+K+  FC+  LDV  RV DLVKRLTL EKIT+LVNTAG+ 
Sbjct  31   PVLAQTTSPAFACDVANNPGVKNFGFCDVSLDVSARVNDLVKRLTLEEKITMLVNTAGSV  90

Query  288  SRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            SRLGIP YEWW EALHG+ YTGPGV F GVVP ATSFP  +LT
Sbjct  91   SRLGIPKYEWWSEALHGISYTGPGVKFNGVVPGATSFPPTILT  133



>ref|XP_011092407.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = +3

Query  102  IIGPVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAG  281
            I  PV +QT P +ACD   NPGLK+  FC+Q LDVK+RVADLV RLTL EKI  LVNTA 
Sbjct  21   ISRPVFAQTKPAFACDVSNNPGLKNFSFCDQSLDVKSRVADLVGRLTLQEKIGWLVNTAK  80

Query  282  NESRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
              SRLGIP Y+WW EALHG+ Y GPG  F+G+VP ATSFP  +LT
Sbjct  81   GVSRLGIPDYQWWSEALHGVSYVGPGTKFSGLVPGATSFPQVILT  125



>emb|CAN77623.1| hypothetical protein VITISV_007589 [Vitis vinifera]
Length=167

 Score =   133 bits (335),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 71/101 (70%), Gaps = 0/101 (0%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V +Q+ PV+ACD   NP L    FCN  L+   RVADLVKRLTL EK+  LVN+A + SR
Sbjct  31   VLAQSSPVFACDVENNPTLGQFGFCNTSLETAARVADLVKRLTLEEKVGFLVNSAASVSR  90

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+ Y GPG +F  VVP ATSFP  +LT
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFNSVVPGATSFPQVILT  131



>gb|KDO56532.1| hypothetical protein CISIN_1g0476211mg, partial [Citrus sinensis]
Length=250

 Score =   135 bits (341),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            PV+ACD V NP L SL FCN  L +  RV DLVKRLTL EKIT LV++AG+ SRLGIP Y
Sbjct  36   PVFACDVVSNPSLASLGFCNTSLGIDLRVGDLVKRLTLQEKITFLVDSAGSVSRLGIPKY  95

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EWW EALHG+ Y GPG +F+ VVP ATSFP  +LT
Sbjct  96   EWWSEALHGVSYVGPGTHFSNVVPGATSFPQVILT  130



>ref|XP_009801214.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nicotiana sylvestris]
Length=784

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = +3

Query  111  PVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNES  290
            PV +Q  PV+ACD   NPGL +L FC+  L V+TRV+DLV+RLTL EKI  LV+ AG  S
Sbjct  40   PVLAQNSPVFACDITSNPGLANLTFCDASLTVETRVSDLVQRLTLSEKIGFLVSGAGGVS  99

Query  291  RLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            RLGIP YEWW EALHG+ YTGPGV+F+G+VP ATSFP  +LT
Sbjct  100  RLGIPRYEWWSEALHGVSYTGPGVHFSGLVPGATSFPQVILT  141



>ref|XP_009628814.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 {ECO:0000303|PubMed:17615411, 
ECO:0000312|EMBL:ABQ45228.1}-like 
[Nicotiana tomentosiformis]
Length=781

 Score =   140 bits (354),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = +3

Query  111  PVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNES  290
            PV +Q  PV+ACD   NPGL +L FC+  L V+TRV DLV+RLTL EKI  LV+ AG  S
Sbjct  37   PVLAQNSPVFACDITSNPGLANLTFCDASLTVETRVNDLVQRLTLSEKIGFLVSGAGGVS  96

Query  291  RLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            RLGIP YEWW EALHG+ YTGPGV+F+G++P ATSFP  +LT
Sbjct  97   RLGIPRYEWWSEALHGVSYTGPGVHFSGLIPAATSFPQVILT  138



>emb|CAJ65922.1| xylan 1,4-beta-xylosidase [Populus tremula x Populus alba]
Length=757

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V +Q+ PV+ACD V NP L S  FCN  L V  RV DLVKRLTL EKI  LVN+AG+ SR
Sbjct  33   VLAQSSPVFACDVVSNPSLASFGFCNTSLGVSDRVVDLVKRLTLQEKILFLVNSAGSVSR  92

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+ Y GPG +F+ VVP ATSFP  +LT
Sbjct  93   LGIPKYEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILT  133



>ref|XP_002298197.2| beta-glucosidase family protein [Populus trichocarpa]
 gb|EEE83002.2| beta-glucosidase family protein [Populus trichocarpa]
Length=778

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V +Q+ PV+ACD V NP L S  FCN  L V  RV DLVKRLTL EKI  LVN+AG+ SR
Sbjct  33   VLAQSSPVFACDVVSNPSLASFGFCNTSLGVSDRVVDLVKRLTLQEKILFLVNSAGSVSR  92

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+ Y GPG +F+ VVP ATSFP  +LT
Sbjct  93   LGIPKYEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILT  133



>emb|CAJ65921.1| xylan 1,4-beta-xylosidase [Populus tremula x Populus alba]
Length=704

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V +Q+ PV+ACD V NP L SL FCN  + +  RV DLVKRLTL EKI  LVN+AGN SR
Sbjct  31   VSAQSSPVFACDVVSNPSLASLGFCNTSIGINDRVVDLVKRLTLQEKIVFLVNSAGNVSR  90

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+ Y GPG +F+  V  ATSFP  +LT
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFSDDVAGATSFPQVILT  131



>ref|XP_002303181.1| beta-glucosidase family protein [Populus trichocarpa]
 gb|EEE78160.1| beta-glucosidase family protein [Populus trichocarpa]
Length=773

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V +Q+ PV+ACD V NP L SL FCN  + +  RV DLVKRLTL EKI  LVN+AGN SR
Sbjct  30   VSAQSSPVFACDVVSNPSLASLGFCNTSIGINDRVVDLVKRLTLQEKIVFLVNSAGNVSR  89

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+ Y GPG +F+  V  ATSFP  +LT
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTHFSDDVAGATSFPQVILT  130



>ref|XP_011015574.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Populus euphratica]
Length=776

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V +Q+ PV+ACD V NP L S  FCN  L V  RV DLV RLTL EKI  LVN+AG+ SR
Sbjct  33   VLAQSSPVFACDVVSNPSLASFGFCNTSLGVSDRVVDLVGRLTLQEKILFLVNSAGSVSR  92

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+ Y GPG +F+ VVP ATSFP  +LT
Sbjct  93   LGIPRYEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILT  133



>ref|XP_011046123.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Populus euphratica]
Length=776

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V +Q+ PV+ACD V NP L S  FCN  L V  RV DLV RLTL EKI  LVN+AG+ SR
Sbjct  33   VLAQSSPVFACDVVSNPSLASFGFCNTSLGVSDRVVDLVGRLTLQEKILFLVNSAGSVSR  92

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+ Y GPG +F+ VVP ATSFP  +LT
Sbjct  93   LGIPRYEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILT  133



>ref|XP_006493288.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Citrus sinensis]
Length=773

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            PV+ACD V NP L SL FCN  L +  RV DLVKRLTL EKIT LV++AG+ SRLGIP Y
Sbjct  36   PVFACDVVSNPSLASLGFCNTSLGIDLRVGDLVKRLTLQEKITFLVDSAGSVSRLGIPKY  95

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EWW EALHG+ Y GPG +F+ VVP ATSFP  +LT
Sbjct  96   EWWSEALHGVSYVGPGTHFSNVVPGATSFPQVILT  130



>ref|XP_011004967.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Populus euphratica]
Length=775

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V +Q+ PV+ACD V+NP L SL FCN    +  RV DLVKRLTL EKI  LVN+AGN SR
Sbjct  32   VSAQSSPVFACDVVRNPSLASLGFCNTSSGINDRVVDLVKRLTLQEKILFLVNSAGNVSR  91

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+ Y GPG +F+  V  ATSFP  +LT
Sbjct  92   LGIPKYEWWSEALHGVSYVGPGTHFSNDVAGATSFPQVILT  132



>ref|XP_006432467.1| hypothetical protein CICLE_v10000355mg [Citrus clementina]
 gb|ESR45707.1| hypothetical protein CICLE_v10000355mg [Citrus clementina]
Length=773

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            PV+ACD V NP L SL FCN  L +  RV DLVKRLTL EKIT LV++AG+ SRLGIP Y
Sbjct  36   PVFACDVVSNPSLASLGFCNTSLGIDLRVGDLVKRLTLQEKITFLVDSAGSVSRLGIPKY  95

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EWW EALHG+ Y GPG +F+ VVP ATSFP  +LT
Sbjct  96   EWWSEALHGVSYVGPGTHFSNVVPGATSFPQVILT  130



>ref|XP_008344154.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Malus domestica]
Length=773

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V  Q+ PV+ACD   N  L S  FC+  L V  RVADLVKRLTLPEKI  LVN+AG+ SR
Sbjct  30   VLGQSSPVFACDVASNATLSSFAFCDTSLGVDARVADLVKRLTLPEKIGFLVNSAGSVSR  89

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+ Y GPG  F+ +VP ATSFP  +LT
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTXFSSLVPGATSFPQVILT  130



>ref|XP_008339210.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Malus domestica]
Length=773

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V  Q+ PV+AC+   N  L S  FC+  L V  RVADLVKRLTLPEKI  LVN+AG+ SR
Sbjct  30   VLGQSSPVFACNVASNATLSSFAFCDTSLGVDARVADLVKRLTLPEKIGFLVNSAGSVSR  89

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+ Y GPG  F+ +VP ATSFP  +LT
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILT  130



>ref|XP_010546362.1| PREDICTED: beta-D-xylosidase 4 [Tarenaya hassleriana]
Length=781

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = +3

Query  111  PVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNES  290
            P ++Q+ PV+ACD   NP L    FC++ L+V  RVADLV RLTL EKI  LVN A   S
Sbjct  23   PSEAQSSPVFACDVSGNPSLAGFGFCDKSLEVNDRVADLVGRLTLQEKIGFLVNRANGVS  82

Query  291  RLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            RLGIPTYEWW EALHG+ Y GPG  F+G VP ATSFP  +LT
Sbjct  83   RLGIPTYEWWSEALHGVSYVGPGTRFSGQVPGATSFPQVILT  124



>ref|XP_009347830.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Pyrus x bretschneideri]
Length=773

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V  Q+ PV+AC+   N  L S  FC+  L V  RVADLVKRLTLPEKI  LVN+AG+ SR
Sbjct  30   VLGQSSPVFACNVASNATLSSFAFCDTTLGVDARVADLVKRLTLPEKIGFLVNSAGSVSR  89

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+ Y GPG  F+ +VP ATSFP  +LT
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILT  130



>ref|XP_009354080.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Pyrus x bretschneideri]
Length=773

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V  Q+ PV+AC+   N  L S  FC+  L V  RVADLVKRLTLPEKI  LVN+AG+ SR
Sbjct  30   VLGQSSPVFACNVASNATLSSFAFCDTTLGVDARVADLVKRLTLPEKIGFLVNSAGSVSR  89

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+ Y GPG  F+ +VP ATSFP  +LT
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILT  130



>ref|XP_010243340.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nelumbo nucifera]
Length=771

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 72/99 (73%), Gaps = 0/99 (0%)
 Frame = +3

Query  120  SQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLG  299
            S   PV+ACD  KNPGL +  FCN  LD+  RV DLV+RLTL EKIT LV+ AG  +RLG
Sbjct  30   SGQSPVFACDVGKNPGLAAFGFCNTSLDIAARVNDLVERLTLQEKITFLVSKAGAVNRLG  89

Query  300  IPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            IP+YEWW EALHG+ Y GPG +F+  VP ATSFP  +LT
Sbjct  90   IPSYEWWSEALHGVSYVGPGTHFSSAVPGATSFPQVILT  128



>ref|XP_002513707.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF48654.1| Beta-glucosidase, putative [Ricinus communis]
Length=777

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V +Q+ PV+ACD   NP L S  FCN  L +  RV DLV RLTL EKI  LVN+AG+ SR
Sbjct  33   VLAQSSPVFACDVKSNPSLASFGFCNVSLGISDRVTDLVNRLTLQEKIGFLVNSAGSVSR  92

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+ Y GPG +F+ +VP ATSFP  +LT
Sbjct  93   LGIPKYEWWSEALHGVSYVGPGTHFSNIVPGATSFPQVILT  133



>ref|XP_007148433.1| hypothetical protein PHAVU_006G208200g [Phaseolus vulgaris]
 gb|ESW20427.1| hypothetical protein PHAVU_006G208200g [Phaseolus vulgaris]
Length=775

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V  QT  V+ACD  KNP L    FC++ L V+ RVADLVKRLTL EKI  LVN+A N SR
Sbjct  32   VSGQTSAVFACDVAKNPALAGYGFCDKSLSVEDRVADLVKRLTLQEKIGNLVNSAVNVSR  91

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+   GPG +F+ VVP ATSFP P+LT
Sbjct  92   LGIPKYEWWSEALHGVSNIGPGTHFSSVVPGATSFPMPILT  132



>ref|XP_009379698.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Pyrus x bretschneideri]
Length=773

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 70/101 (69%), Gaps = 0/101 (0%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V  Q+ PV+ACD   N  L S  FC+  L V  RV DLVKRLTLPEKI  LVN AG+ SR
Sbjct  30   VLGQSSPVFACDVASNATLSSFAFCDTSLGVDARVVDLVKRLTLPEKIGFLVNNAGSVSR  89

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+ Y GPG  F+ +VP ATSFP  +LT
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILT  130



>gb|EPS65933.1| hypothetical protein M569_08842, partial [Genlisea aurea]
Length=763

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P++ACD   +P LK+L FC+  LDVKTRV DLV RLTLPEK+  L N+A   SRLGIP Y
Sbjct  20   PIFACDVSADPALKTLAFCDSSLDVKTRVDDLVNRLTLPEKLGWLANSAKGVSRLGIPDY  79

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EWW E LHG+ YTGPGV FT +VP ATSFP  +LT
Sbjct  80   EWWSEVLHGVSYTGPGVRFTSLVPGATSFPQVILT  114



>gb|KDP30704.1| hypothetical protein JCGZ_16402 [Jatropha curcas]
Length=770

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V +Q  PV+ACD  KNP + S  FCN  L +  RV DLV+RLTL EKI+ LVN+AG+ SR
Sbjct  27   VVAQPSPVFACDVSKNPSVASFGFCNVSLGINERVVDLVERLTLQEKISFLVNSAGSVSR  86

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+ Y GPG +F+ +VP ATSFP  +LT
Sbjct  87   LGIPKYEWWSEALHGVSYVGPGTHFSSLVPGATSFPQVILT  127



>sp|A5JTQ3.1|XYL2_MEDSV RecName: Full=Beta-xylosidase/alpha-L-arabinofuranosidase 2; 
AltName: Full=Xylan 1,4-beta-xylosidase/Alpha-L-arabinofuranosidase 
2; Short=MsXyl2; Includes: RecName: Full=Beta-xylosidase; 
AltName: Full=1,4-beta-D-xylan xylohydrolase; AltName: 
Full=Xylan 1,4-beta-xylosidase; Includes: RecName: Full=Alpha-L-arabinofuranosidase; 
Short=Arabinosidase; Flags: Precursor 
[Medicago sativa subsp. x varia]
 gb|ABQ45228.1| beta-xylosidase/alpha-L-arabinosidase [Medicago sativa subsp. 
x varia]
Length=774

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +3

Query  108  GPVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNE  287
            G V SQT  V+ACD  KNP L +  FCN++L V  RV DLV+RLTL EK+  LVN+A + 
Sbjct  29   GRVSSQTSAVFACDVAKNPALANYGFCNKKLSVDARVKDLVRRLTLQEKVGNLVNSAVDV  88

Query  288  SRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLL  413
            SRLGIP YEWW EALHG+   GPG +F+ V+P ATSFP P+L
Sbjct  89   SRLGIPKYEWWSEALHGVSNIGPGTHFSNVIPGATSFPMPIL  130



>emb|CBI40687.3| unnamed protein product [Vitis vinifera]
Length=751

 Score =   132 bits (333),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 71/101 (70%), Gaps = 0/101 (0%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V +Q+ PV+ACD   NP L    FCN  L+   RVADLVKRLTL EKI  LVN+A + SR
Sbjct  31   VLAQSSPVFACDVENNPTLGQFGFCNTSLETAARVADLVKRLTLEEKIGFLVNSAASVSR  90

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+ Y GPG +F  VVP ATSFP  +LT
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFNSVVPGATSFPQVILT  131



>ref|XP_006341844.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Solanum tuberosum]
Length=806

 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +3

Query  111  PVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNES  290
            PV +Q  PV+ACD   NP L +L FC+  L V+ RV DLVKRLTL EKI  LV+ A   S
Sbjct  62   PVLAQNSPVFACDITSNPALGNLTFCDASLTVENRVNDLVKRLTLGEKIGFLVSGASGVS  121

Query  291  RLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            RLGIP YEWW EALHG+ YTGPGV+F+ +VP ATSFP  +LT
Sbjct  122  RLGIPKYEWWSEALHGVAYTGPGVHFSSLVPGATSFPQVILT  163



>ref|XP_002264183.2| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Vitis vinifera]
Length=774

 Score =   132 bits (333),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 71/101 (70%), Gaps = 0/101 (0%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V +Q+ PV+ACD   NP L    FCN  L+   RVADLVKRLTL EKI  LVN+A + SR
Sbjct  31   VLAQSSPVFACDVENNPTLGQFGFCNTSLETAARVADLVKRLTLEEKIGFLVNSAASVSR  90

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+ Y GPG +F  VVP ATSFP  +LT
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFNSVVPGATSFPQVILT  131



>ref|NP_001233910.1| beta-D-xylosidase 1 precursor [Solanum lycopersicum]
 dbj|BAC98298.1| LEXYL1 [Solanum lycopersicum]
Length=770

 Score =   132 bits (332),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 75/105 (71%), Gaps = 0/105 (0%)
 Frame = +3

Query  102  IIGPVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAG  281
            ++  V +Q  PV+ACD   NP L +L FC+  L V+ RV DLV RLTL EKI  LV+ AG
Sbjct  23   LLKQVLAQNSPVFACDVTSNPALGNLTFCDASLAVENRVNDLVNRLTLGEKIGFLVSGAG  82

Query  282  NESRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
              SRLGIP YEWW EALHG+ YTGPGV+FT +VP ATSFP  +LT
Sbjct  83   GVSRLGIPKYEWWSEALHGVAYTGPGVHFTSLVPGATSFPQVILT  127



>gb|KEH31243.1| beta-xylosidase/alpha-L-arabinofuranosidase-like protein [Medicago 
truncatula]
Length=774

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +3

Query  108  GPVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNE  287
            G V SQT  V+ACD  KNP L +  FCN++L V  RV DLV+RLTL EK+  LVN+A + 
Sbjct  29   GRVSSQTSAVFACDVAKNPALANYGFCNKKLSVDARVKDLVRRLTLQEKVGNLVNSAVDV  88

Query  288  SRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLL  413
            SRLGIP YEWW EALHG+   GPG +F+ V+P +TSFP P+L
Sbjct  89   SRLGIPKYEWWSEALHGVSNIGPGTHFSNVIPGSTSFPMPIL  130



>ref|XP_002268626.2| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Vitis 
vinifera]
 emb|CBI39114.3| unnamed protein product [Vitis vinifera]
Length=774

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 70/101 (69%), Gaps = 0/101 (0%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V  Q+ PV+ACD   NP L    FCN  L+   RVADLVKRLTL EKI  LVN+A + SR
Sbjct  31   VLGQSSPVFACDVENNPTLGQFGFCNTSLETAARVADLVKRLTLEEKIGFLVNSAASVSR  90

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+ Y GPG +F  +VP ATSFP  +LT
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFNSIVPGATSFPQVILT  131



>ref|XP_003547598.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Glycine max]
Length=776

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V  QT  V+ACD  KNP L    FC++ L V+ RVADLVKRLTL EKI  LVN+A + SR
Sbjct  33   VSGQTSAVFACDVAKNPALAGYGFCDKSLSVEDRVADLVKRLTLQEKIGSLVNSATSVSR  92

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+   GPG +F+ +VP ATSFP P+LT
Sbjct  93   LGIPKYEWWSEALHGVSNVGPGTHFSSLVPGATSFPMPILT  133



>ref|XP_004504774.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cicer arietinum]
Length=774

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +3

Query  108  GPVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNE  287
            G V SQT PV+ACD  KNP L +  FCN+ L V  RV+DLV RLTL EKI  LVN+A + 
Sbjct  29   GRVWSQTSPVFACDVGKNPALSNYRFCNKSLGVNARVSDLVSRLTLQEKIGNLVNSAVDV  88

Query  288  SRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLL  413
            SRLGIP YEWW EALHG+   GPG  F+ VVP +TSFP P+L
Sbjct  89   SRLGIPRYEWWSEALHGVSNVGPGTRFSNVVPGSTSFPMPIL  130



>ref|XP_009112141.1| PREDICTED: beta-D-xylosidase 4-like [Brassica rapa]
Length=776

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = +3

Query  117  QSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRL  296
             +QT PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI  LVN A   +RL
Sbjct  33   NAQTKPVFACDVDTNPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVNKANGVTRL  92

Query  297  GIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            GIPTYEWW EALHG+ Y GPG +F+G+VP ATSFP  +LT
Sbjct  93   GIPTYEWWSEALHGVSYVGPGTHFSGLVPGATSFPQVILT  132



>emb|CDY18705.1| BnaA09g06900D [Brassica napus]
Length=776

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = +3

Query  117  QSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRL  296
             +QT PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI  LVN A   +RL
Sbjct  33   NAQTKPVFACDVDTNPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVNKANGVTRL  92

Query  297  GIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            GIPTYEWW EALHG+ Y GPG +F+G+VP ATSFP  +LT
Sbjct  93   GIPTYEWWSEALHGVSYVGPGTHFSGLVPGATSFPQVILT  132



>ref|XP_010520456.1| PREDICTED: LOW QUALITY PROTEIN: beta-D-xylosidase 4 [Tarenaya 
hassleriana]
Length=750

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 70/102 (69%), Gaps = 0/102 (0%)
 Frame = +3

Query  111  PVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNES  290
            P  +Q+ PV+ACD   NP L    FCN  L ++ RVADLV RLTLPEKI  LV+ A   S
Sbjct  23   PSNAQSTPVFACDVAGNPSLAGFGFCNTSLGIEARVADLVGRLTLPEKIGFLVSGAKAVS  82

Query  291  RLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            RLGIP YEWW EALHG+ Y GPG  F+G VP ATSFP  +LT
Sbjct  83   RLGIPAYEWWSEALHGVSYVGPGTRFSGQVPGATSFPQVILT  124



>ref|XP_003531557.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Glycine max]
Length=776

 Score =   129 bits (325),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 61/101 (60%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V  QT  V+ACD  KNP L    FC++ L ++ RVADLVKRLTL EKI  LVN+A + SR
Sbjct  33   VSGQTSSVFACDVAKNPALAGYGFCDKSLSLEDRVADLVKRLTLQEKIGSLVNSATSVSR  92

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+   GPG +F+ +VP ATSFP P+LT
Sbjct  93   LGIPKYEWWSEALHGVSNVGPGTHFSSLVPGATSFPMPILT  133



>ref|XP_007043027.1| Beta-D-xylosidase 4 [Theobroma cacao]
 gb|EOX98858.1| Beta-D-xylosidase 4 [Theobroma cacao]
Length=787

 Score =   129 bits (325),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V  QT PV+ACD  KNP + S  FCN  L +++RVADLV+RLTL EKI  +V+ AG+ SR
Sbjct  44   VFGQTSPVFACDATKNPEVTSYDFCNASLGIESRVADLVQRLTLQEKILFIVSGAGSVSR  103

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+   GPG  F+ +VP ATSFP  +LT
Sbjct  104  LGIPKYEWWSEALHGVSNVGPGTKFSSLVPGATSFPQVILT  144



>gb|KFK28148.1| hypothetical protein AALP_AA8G478800 [Arabis alpina]
Length=779

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 71/99 (72%), Gaps = 0/99 (0%)
 Frame = +3

Query  120  SQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLG  299
            +QT PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI  LV+ A   +RLG
Sbjct  33   AQTSPVFACDVTGNPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLG  92

Query  300  IPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            IPTYEWW EALHG+ Y GPG +F+G VP ATSFP  +LT
Sbjct  93   IPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILT  131



>ref|XP_010103839.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Morus notabilis]
 gb|EXB97280.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Morus notabilis]
Length=778

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 72/104 (69%), Gaps = 1/104 (1%)
 Frame = +3

Query  108  GPVQSQ-TGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGN  284
            G V+ Q T P +ACD   NP L    FCN  L +++RV DLVKRLTL EKI  LVN+AG 
Sbjct  30   GGVRGQSTSPPFACDVGANPSLAGFGFCNASLGIESRVGDLVKRLTLQEKIGFLVNSAGA  89

Query  285  ESRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
             SRLGIP YEWW EALHG+ Y GPG  F+ VVP ATSFP  +LT
Sbjct  90   VSRLGIPKYEWWSEALHGVSYVGPGTRFSSVVPGATSFPQVILT  133



>emb|CDY46812.1| BnaC02g43200D [Brassica napus]
Length=778

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 70/99 (71%), Gaps = 0/99 (0%)
 Frame = +3

Query  120  SQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLG  299
            +Q+ PV+ACD   N  L S  FCN  L ++ RVADLV RLTL EKI  LVN A   +RLG
Sbjct  33   AQSTPVFACDVAGNSSLSSYGFCNAALKIEARVADLVGRLTLQEKIGFLVNKASGVTRLG  92

Query  300  IPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            IPTYEWW EALHG+ Y GPG +F+G VP ATSFP  +LT
Sbjct  93   IPTYEWWSEALHGVSYIGPGTHFSGQVPGATSFPQVILT  131



>gb|KHG10349.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Gossypium arboreum]
Length=779

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V +QT PV+ACD  K+P + S  FC+ +L    RVADLV RLTL EKI  +VN+AG+ SR
Sbjct  36   VLAQTSPVFACDATKDPKVASYGFCDTKLGTDARVADLVHRLTLQEKILFIVNSAGSVSR  95

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+   GPG  FT +VP ATSFP  +LT
Sbjct  96   LGIPKYEWWSEALHGVSNVGPGTKFTSLVPGATSFPQVILT  136



>gb|KJB31995.1| hypothetical protein B456_005G218000 [Gossypium raimondii]
Length=779

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V +QT PV+ACD  K+P + S  FC+ +L    RVADLV RLTL EKI  +VN+AG+ SR
Sbjct  36   VLAQTSPVFACDATKDPQVASYGFCDTKLGTDARVADLVHRLTLQEKILFIVNSAGSVSR  95

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+   GPG  FT +VP ATSFP  +LT
Sbjct  96   LGIPKYEWWSEALHGVSNVGPGTKFTSLVPGATSFPQVILT  136



>ref|XP_010261102.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nelumbo nucifera]
Length=773

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            PV+ACD  KN GL +  FCN    +  RV DLVKRLTL EKI  LVN AG  +RLGIP+Y
Sbjct  36   PVFACDVGKNSGLAAFGFCNSSWGIAARVDDLVKRLTLQEKIIFLVNKAGAVTRLGIPSY  95

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EWW EALHG+ Y GPG +F+ VVP ATSFP  +LT
Sbjct  96   EWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILT  130



>gb|EYU35409.1| hypothetical protein MIMGU_mgv1a001738mg [Erythranthe guttata]
Length=767

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 71/104 (68%), Gaps = 0/104 (0%)
 Frame = +3

Query  105  IGPVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGN  284
             GPV SQ  PV+ACD   NPGLK+  FC+  LDVK RV DLV RLTL EKI  LV+ A  
Sbjct  20   FGPVCSQAQPVFACDVSSNPGLKNFSFCDPSLDVKARVDDLVARLTLQEKIGWLVHAAKG  79

Query  285  ESRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
             SRLGIP+Y WW EALHG+   G G  FTG VP ATSFP  +LT
Sbjct  80   VSRLGIPSYGWWSEALHGVSDVGGGSRFTGPVPAATSFPQVILT  123



>ref|XP_006280038.1| hypothetical protein CARUB_v10025915mg [Capsella rubella]
 gb|EOA12936.1| hypothetical protein CARUB_v10025915mg [Capsella rubella]
Length=784

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 70/100 (70%), Gaps = 0/100 (0%)
 Frame = +3

Query  117  QSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRL  296
             +Q+ PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI  LV+ A   +RL
Sbjct  37   NAQSSPVFACDVAANPSLAAFGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRL  96

Query  297  GIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            GIPTYEWW EALHG+ Y GPG  F+G VP ATSFP  +LT
Sbjct  97   GIPTYEWWSEALHGVSYIGPGTRFSGQVPGATSFPQVILT  136



>ref|XP_006394136.1| hypothetical protein EUTSA_v10003678mg [Eutrema salsugineum]
 gb|ESQ31422.1| hypothetical protein EUTSA_v10003678mg [Eutrema salsugineum]
Length=780

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 70/100 (70%), Gaps = 0/100 (0%)
 Frame = +3

Query  117  QSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRL  296
             +Q+ PV+ACD   NP L +  FCN  L  + RVADLV RLTL EKI  LV+ A   SRL
Sbjct  33   NAQSSPVFACDVAGNPSLAAYGFCNTALKSEYRVADLVARLTLQEKIGFLVSKANGVSRL  92

Query  297  GIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            GIPTYEWW EALHG+ Y GPG +F+G VP ATSFP  +LT
Sbjct  93   GIPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILT  132



>emb|CDX81229.1| BnaC09g06400D [Brassica napus]
Length=776

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = +3

Query  117  QSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRL  296
             +Q+ P +ACD   NP L +  FCN  L ++ RVADLV RLTL EKI  LVN A   +RL
Sbjct  33   NAQSKPAFACDVDTNPSLAAYGFCNTDLKMEYRVADLVARLTLQEKIGFLVNKANGVTRL  92

Query  297  GIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            GIPTYEWW EALHG+ Y GPG +F+G+VP ATSFP  +LT
Sbjct  93   GIPTYEWWSEALHGVSYVGPGTHFSGLVPGATSFPQVILT  132



>ref|XP_010065531.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63059.1| hypothetical protein EUGRSUZ_G00651 [Eucalyptus grandis]
Length=789

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 70/102 (69%), Gaps = 1/102 (1%)
 Frame = +3

Query  114  VQSQTG-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNES  290
            V  QT  PV+ACD   +P L    FCN  L V+ RVADLV+RLTL EK+  LVN AGN  
Sbjct  32   VAGQTSKPVFACDVDSDPSLAGFGFCNASLGVEVRVADLVQRLTLQEKVGFLVNNAGNVD  91

Query  291  RLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            RLGIP YEWW EALHG+ Y GPG  F+ +VP ATSFP  +LT
Sbjct  92   RLGIPKYEWWSEALHGVSYLGPGTKFSSLVPGATSFPQVILT  133



>ref|XP_007225245.1| hypothetical protein PRUPE_ppa001692mg [Prunus persica]
 gb|EMJ26444.1| hypothetical protein PRUPE_ppa001692mg [Prunus persica]
Length=779

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 70/99 (71%), Gaps = 0/99 (0%)
 Frame = +3

Query  120  SQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLG  299
            +Q+ PV+ACD   N  + S  FC+  L +  RVADLVKRLTL EKI  LVN+AG+ SRLG
Sbjct  38   AQSSPVFACDVGSNASVSSFGFCDTSLAIDLRVADLVKRLTLQEKIGFLVNSAGSVSRLG  97

Query  300  IPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            IP YEWW EALHG+   GPG  FT VVP ATSFP  +LT
Sbjct  98   IPKYEWWSEALHGVSNVGPGTKFTNVVPGATSFPQVILT  136



>ref|XP_007159080.1| hypothetical protein PHAVU_002G206800g [Phaseolus vulgaris]
 gb|ESW31074.1| hypothetical protein PHAVU_002G206800g [Phaseolus vulgaris]
Length=773

 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 71/103 (69%), Gaps = 0/103 (0%)
 Frame = +3

Query  108  GPVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNE  287
            G V  QT  ++ACD  KNP L    FC++ L V+ RVADLV RLTL EKI  LVN A + 
Sbjct  28   GGVWGQTSAIFACDVEKNPALGGYAFCDKSLGVEERVADLVGRLTLQEKIGNLVNAAVDV  87

Query  288  SRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            SRLGIP YEWW EALHG+   GPG  F+ VVP ATSFP P+LT
Sbjct  88   SRLGIPKYEWWSEALHGVSNVGPGTRFSNVVPGATSFPMPILT  130



>ref|XP_010065527.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63057.1| hypothetical protein EUGRSUZ_G00649 [Eucalyptus grandis]
Length=790

 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            PV+ACD   NP L +  FCN  L V+ RVADLV+RLTL EK+  LV+ AGN  RLGIP Y
Sbjct  40   PVFACDVDGNPSLAAFGFCNTSLGVEARVADLVQRLTLQEKVGFLVSGAGNVDRLGIPKY  99

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EWW EALHG+ Y GPG  F+ +VP ATSFP  +LT
Sbjct  100  EWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILT  134



>ref|XP_010444394.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=776

 Score =   127 bits (318),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 69/98 (70%), Gaps = 0/98 (0%)
 Frame = +3

Query  123  QTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGI  302
             + PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI  LV+ A   +RLGI
Sbjct  31   SSSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLGI  90

Query  303  PTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            PTYEWW EALHG+ Y GPG +FTG VP ATSFP  +LT
Sbjct  91   PTYEWWSEALHGVSYIGPGTHFTGQVPGATSFPQVILT  128



>ref|XP_004300692.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=799

 Score =   127 bits (318),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 71/101 (70%), Gaps = 2/101 (2%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V S +G  +AC    N    S PFC++ L    RVADLV+RLTL EKIT LVN+AG+ SR
Sbjct  58   VSSVSGQSFACGESGNA--SSFPFCDKSLAADARVADLVQRLTLQEKITFLVNSAGSVSR  115

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+ Y GPG  F+ VVP ATSFP P+LT
Sbjct  116  LGIPKYEWWSEALHGVSYVGPGTRFSSVVPGATSFPQPILT  156



>ref|XP_011465594.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=799

 Score =   127 bits (318),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 71/101 (70%), Gaps = 2/101 (2%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V S +G  +AC    N    S PFC++ L    RVADLV+RLTL EKIT LVN+AG+ SR
Sbjct  58   VSSVSGQSFACGESGNA--SSFPFCDKSLAADARVADLVQRLTLQEKITFLVNSAGSVSR  115

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+ Y GPG  F+ VVP ATSFP P+LT
Sbjct  116  LGIPKYEWWSEALHGVSYVGPGTRFSSVVPGATSFPQPILT  156



>ref|XP_009130462.1| PREDICTED: beta-D-xylosidase 4-like [Brassica rapa]
Length=778

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 69/100 (69%), Gaps = 0/100 (0%)
 Frame = +3

Query  117  QSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRL  296
             +Q+ P +ACD   N  L +  FCN  L ++ RVADLV RLTL EKI  LVN A   +RL
Sbjct  32   NAQSTPAFACDVAGNSSLSAYGFCNAALKIEARVADLVGRLTLQEKIGFLVNKANGVTRL  91

Query  297  GIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            GIPTYEWW EALHG+ Y GPG +F+G VP ATSFP  +LT
Sbjct  92   GIPTYEWWSEALHGVSYIGPGTHFSGQVPGATSFPQVILT  131



>emb|CDY31313.1| BnaA02g34280D [Brassica napus]
Length=778

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 69/100 (69%), Gaps = 0/100 (0%)
 Frame = +3

Query  117  QSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRL  296
             +Q+ P +ACD   N  L +  FCN  L ++ RVADLV RLTL EKI  LVN A   +RL
Sbjct  32   NAQSTPAFACDVAGNSSLSAYGFCNAALKIEARVADLVGRLTLQEKIGFLVNKANGVTRL  91

Query  297  GIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            GIPTYEWW EALHG+ Y GPG +F+G VP ATSFP  +LT
Sbjct  92   GIPTYEWWSEALHGVSYIGPGTHFSGQVPGATSFPQVILT  131



>ref|XP_002866623.1| beta-xylosidase 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42882.1| beta-xylosidase 4 [Arabidopsis lyrata subsp. lyrata]
Length=784

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 70/100 (70%), Gaps = 0/100 (0%)
 Frame = +3

Query  117  QSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRL  296
             +Q+ PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI  LV+ A   +RL
Sbjct  37   NAQSSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRL  96

Query  297  GIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            GIPTYEWW EALHG+ Y GPG +F+  VP ATSFP  +LT
Sbjct  97   GIPTYEWWSEALHGVSYIGPGTHFSSQVPGATSFPQVILT  136



>ref|NP_201262.1| beta-D-xylosidase 4 [Arabidopsis thaliana]
 sp|Q9FLG1.1|BXL4_ARATH RecName: Full=Beta-D-xylosidase 4; Short=AtBXL4; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB11424.1| beta-xylosidase [Arabidopsis thaliana]
 gb|AED97922.1| beta-D-xylosidase 4 [Arabidopsis thaliana]
Length=784

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 70/100 (70%), Gaps = 0/100 (0%)
 Frame = +3

Query  117  QSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRL  296
             +Q+ PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI  LV+ A   +RL
Sbjct  37   NAQSSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRL  96

Query  297  GIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            GIPTYEWW EALHG+ Y GPG +F+  VP ATSFP  +LT
Sbjct  97   GIPTYEWWSEALHGVSYIGPGTHFSSQVPGATSFPQVILT  136



>ref|XP_010461983.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=776

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 69/98 (70%), Gaps = 0/98 (0%)
 Frame = +3

Query  123  QTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGI  302
             + PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI  LV+ A   +RLGI
Sbjct  31   SSSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLGI  90

Query  303  PTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            PTYEWW EALHG+ Y GPG +F+G VP ATSFP  +LT
Sbjct  91   PTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILT  128



>ref|XP_010484241.1| PREDICTED: beta-D-xylosidase 4 [Camelina sativa]
Length=785

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 69/98 (70%), Gaps = 0/98 (0%)
 Frame = +3

Query  123  QTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGI  302
             + PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI  LV+ A   +RLGI
Sbjct  40   SSSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLGI  99

Query  303  PTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            PTYEWW EALHG+ Y GPG +F+G VP ATSFP  +LT
Sbjct  100  PTYEWWSEALHGVSYIGPGTHFSGQVPGATSFPQVILT  137



>ref|XP_008218886.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Prunus 
mume]
Length=779

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 70/101 (69%), Gaps = 0/101 (0%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V +Q+ PV+AC+   N    S  FC+  L +  RVADLV+RLTL EKI  LVN+AG+ SR
Sbjct  36   VFAQSSPVFACNVASNASASSFGFCDTSLAIDLRVADLVQRLTLQEKIGFLVNSAGSVSR  95

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+   GPG  FT VVP ATSFP  +LT
Sbjct  96   LGIPKYEWWSEALHGVSNVGPGTKFTNVVPGATSFPQVILT  136



>gb|KCW63061.1| hypothetical protein EUGRSUZ_G006532, partial [Eucalyptus grandis]
Length=147

 Score =   117 bits (293),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 62/95 (65%), Gaps = 0/95 (0%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            PV+ACD   +P L    FCN  L V+ RV DLV+RLTL EK+  LVN A N  RLGIP Y
Sbjct  39   PVFACDVDSDPSLAGFGFCNTSLGVEARVVDLVQRLTLQEKVGFLVNNASNVDRLGIPKY  98

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
             WW EALHG+   GPG  F  +VP ATSFP  +LT
Sbjct  99   SWWSEALHGVSDVGPGTTFASLVPGATSFPQVILT  133



>ref|XP_011087838.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 70/102 (69%), Gaps = 0/102 (0%)
 Frame = +3

Query  111  PVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNES  290
            PV ++  PV+ACD   NPGL +  FC+  LD+KTR+ DLV RLTL EK   LV+ A   S
Sbjct  24   PVFAERKPVFACDVTSNPGLMNFSFCDPSLDLKTRMDDLVSRLTLQEKFGWLVSGARGVS  83

Query  291  RLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            RLGIP YEWW EALHG+ YTGPG  F   VP ATSFP  +LT
Sbjct  84   RLGIPNYEWWSEALHGVSYTGPGTKFASPVPGATSFPQVILT  125



>ref|XP_009401393.1| PREDICTED: beta-D-xylosidase 4-like [Musa acuminata subsp. malaccensis]
Length=770

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 70/101 (69%), Gaps = 1/101 (1%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V  QT PV+ACD   NP L S  FCN     + RVADLVKRLTL EK+  LVN A   SR
Sbjct  28   VAGQT-PVFACDVASNPSLGSYGFCNTSYGTEQRVADLVKRLTLQEKVGFLVNKATAVSR  86

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP+YEWW EALHG+ Y GPG +F+ +VP ATSFP  +LT
Sbjct  87   LGIPSYEWWSEALHGVSYVGPGTHFSTLVPGATSFPQVILT  127



>ref|XP_008784548.1| PREDICTED: LOW QUALITY PROTEIN: beta-xylosidase/alpha-L-arabinofuranosidase 
2-like [Phoenix dactylifera]
Length=773

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 71/101 (70%), Gaps = 1/101 (1%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V +QT P++ACDT  N  L S  FCN    ++ RV DLVKRLTL EK+  LVN A   SR
Sbjct  31   VLAQT-PIFACDTASNASLASFGFCNTSWGIEARVGDLVKRLTLEEKVGFLVNKAAAVSR  89

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP+YEWW EALHG+ + GPG +F+ +VP ATSFP  +LT
Sbjct  90   LGIPSYEWWSEALHGVSFVGPGTHFSSLVPGATSFPQVILT  130



>ref|XP_011087839.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   124 bits (310),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 71/103 (69%), Gaps = 0/103 (0%)
 Frame = +3

Query  108  GPVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNE  287
            GPV +Q  PV+ACD   NPGLK+  FC+  L +KTRV DLV RLTL EKI  LV+ +   
Sbjct  23   GPVFAQQKPVFACDVTDNPGLKNFRFCDLSLGLKTRVDDLVSRLTLQEKIGWLVSGSEGV  82

Query  288  SRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            SRLGIP Y+WW EALHG+ Y GPG  F+  +P AT FP  +LT
Sbjct  83   SRLGIPDYQWWSEALHGVSYGGPGTKFSSPIPAATIFPQVILT  125



>ref|XP_010065529.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63058.1| hypothetical protein EUGRSUZ_G00650 [Eucalyptus grandis]
Length=789

 Score =   124 bits (311),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 67/95 (71%), Gaps = 0/95 (0%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            PV+ACD   +P L    FCN  L V+ RVADLV+RLTL EK+  LVN AGN  RLGIP Y
Sbjct  39   PVFACDVGSDPSLAGFGFCNTSLGVEARVADLVQRLTLQEKVGFLVNNAGNVDRLGIPNY  98

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            +WW EALHG+ Y G G +F+ +VP ATSFP  +LT
Sbjct  99   KWWSEALHGVSYVGGGTSFSSLVPGATSFPQVILT  133



>ref|XP_003593145.1| Beta-xylosidase/alpha-L-arabinofuranosidase [Medicago truncatula]
 gb|AES63396.1| beta-xylosidase/alpha-L-arabinofuranosidase-like protein [Medicago 
truncatula]
Length=775

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 71/101 (70%), Gaps = 0/101 (0%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V  QT  V+ACD  KN  + S  FC++ L V+ RV+DLVKRLTL EKI  L N+A   SR
Sbjct  32   VYGQTSTVFACDVAKNTNVSSYGFCDKSLSVEDRVSDLVKRLTLQEKIGNLGNSAVEVSR  91

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+   GPG +F+ +VP ATSFP P+LT
Sbjct  92   LGIPKYEWWSEALHGVSNIGPGTHFSSLVPGATSFPMPILT  132



>ref|XP_009150540.1| PREDICTED: beta-D-xylosidase 4 [Brassica rapa]
Length=791

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 72/105 (69%), Gaps = 0/105 (0%)
 Frame = +3

Query  102  IIGPVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAG  281
            ++    +Q+ PV+ACD   NP L +  FCN  + ++ RVADLV RLTL EKI +L +   
Sbjct  38   LLDSSNAQSTPVFACDVAGNPSLAAYGFCNTAIKIEYRVADLVARLTLQEKIGVLTSKLH  97

Query  282  NESRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
              +RLGIPTYEWW EALHG+ Y GPG +F+G VP ATSFP  +LT
Sbjct  98   GVTRLGIPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILT  142



>emb|CDY56487.1| BnaCnng30450D [Brassica napus]
Length=791

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 70/100 (70%), Gaps = 0/100 (0%)
 Frame = +3

Query  117  QSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRL  296
             +Q+ PV+ACD   NP L +  FCN  + ++ RVADLV RLTL EKI +L +     +RL
Sbjct  43   NAQSTPVFACDVAGNPSLAAYGFCNTAIKIEYRVADLVARLTLQEKIGVLTSKLHGVTRL  102

Query  297  GIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            GIPTYEWW EALHG+ Y GPG +F+G VP ATSFP  +LT
Sbjct  103  GIPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILT  142



>emb|CDY51290.1| BnaA06g23560D [Brassica napus]
Length=780

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 72/105 (69%), Gaps = 0/105 (0%)
 Frame = +3

Query  102  IIGPVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAG  281
            ++    +Q+ PV+ACD   NP L +  FCN  + ++ RVADLV RLTL EKI +L +   
Sbjct  27   LLDSSNAQSTPVFACDVAGNPSLAAYGFCNTAIKIEYRVADLVARLTLQEKIGVLTSKLH  86

Query  282  NESRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
              +RLGIPTYEWW EALHG+ Y GPG +F+G VP ATSFP  +LT
Sbjct  87   GVTRLGIPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILT  131



>dbj|BAE44362.1| alpha-L-arabinofuranosidase [Raphanus sativus]
Length=780

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 71/105 (68%), Gaps = 0/105 (0%)
 Frame = +3

Query  102  IIGPVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAG  281
            ++    +Q+ PV+ACD   NP L +  FCN  + ++ RVADLV RLTL EKI +L +   
Sbjct  27   LLDSSNAQSTPVFACDVAGNPSLAAYGFCNTAIKIEYRVADLVARLTLQEKIGVLTSKLH  86

Query  282  NESRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
              +RLGIPTYEWW EALHG+ Y GPG  F+G VP ATSFP  +LT
Sbjct  87   GVARLGIPTYEWWSEALHGVSYVGPGTRFSGQVPGATSFPQVILT  131



>ref|XP_004485551.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Cicer arietinum]
Length=775

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 69/101 (68%), Gaps = 0/101 (0%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V  QT  V+ACD  KN  L    FC++ L VK RV DLVKRLTL EKI  L N+A   SR
Sbjct  32   VYGQTSTVFACDVAKNSSLAGYGFCDKSLSVKERVLDLVKRLTLKEKIGNLGNSAVEVSR  91

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+   GPG +F+ +VP ATSFP P+LT
Sbjct  92   LGIPKYEWWSEALHGISNIGPGTHFSTLVPGATSFPMPILT  132



>ref|XP_006827121.1| hypothetical protein AMTR_s00010p00246460 [Amborella trichopoda]
 gb|ERM94358.1| hypothetical protein AMTR_s00010p00246460 [Amborella trichopoda]
Length=769

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 65/91 (71%), Gaps = 0/91 (0%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            PV+ACDT K+P + S  FCN  L +  RV DLV+RLTL EKI  LVN     SRLGIP Y
Sbjct  30   PVFACDTSKDPSVGSYGFCNGSLGLSERVQDLVQRLTLSEKIGFLVNKGVGVSRLGIPAY  89

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPH  404
            EWW EALHG+ Y GPG +F+G+VP ATSFP 
Sbjct  90   EWWSEALHGVSYVGPGTHFSGLVPGATSFPQ  120



>ref|XP_004136861.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cucumis sativus]
 gb|KGN43688.1| hypothetical protein Csa_7G058620 [Cucumis sativus]
Length=782

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 66/99 (67%), Gaps = 0/99 (0%)
 Frame = +3

Query  120  SQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLG  299
            +Q+   +ACD   NP +    FC+  L  + RV DLVKRLTL EKI  L+N A N +RLG
Sbjct  41   AQSPTAFACDAETNPSVSGFAFCDSSLGFEARVEDLVKRLTLQEKIGFLINNARNVTRLG  100

Query  300  IPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            IP YEWW EALHG+ Y GPG  F+ VVP ATSFP  +LT
Sbjct  101  IPKYEWWSEALHGVSYVGPGTKFSNVVPGATSFPQVILT  139



>sp|A5JTQ2.1|XYL1_MEDSV RecName: Full=Beta-xylosidase/alpha-L-arabinofuranosidase 1; 
AltName: Full=Xylan 1,4-beta-xylosidase/Alpha-L-arabinofuranosidase 
1; Short=MsXyl1; Includes: RecName: Full=Beta-xylosidase; 
AltName: Full=1,4-beta-D-xylan xylohydrolase; AltName: 
Full=Xylan 1,4-beta-xylosidase; Includes: RecName: Full=Alpha-L-arabinofuranosidase; 
Short=Arabinosidase; Flags: Precursor, 
partial [Medicago sativa subsp. x varia]
 gb|ABQ45227.1| beta-xylosidase/alpha-L-arabinosidase [Medicago sativa subsp. 
x varia]
Length=774

 Score =   121 bits (303),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 70/101 (69%), Gaps = 0/101 (0%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V  QT  V+ACD  KN  + S  FC+  L V+ RV+DLVKRLTL EKI  L N+A   SR
Sbjct  31   VYGQTSTVFACDVAKNTNVSSYGFCDNSLSVEDRVSDLVKRLTLQEKIGNLGNSAVEVSR  90

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+   GPG +F+ +VP AT+FP P+LT
Sbjct  91   LGIPKYEWWSEALHGVSNIGPGTHFSSLVPGATNFPMPILT  131



>ref|XP_008455235.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Cucumis melo]
Length=791

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 66/99 (67%), Gaps = 0/99 (0%)
 Frame = +3

Query  120  SQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLG  299
            +Q+   +ACD   NP +    FC+  L  + RV DLVKRLTL EKI  L+N A N +RLG
Sbjct  50   AQSPTAFACDAGTNPSVSGFAFCDSSLGFEARVEDLVKRLTLQEKIGFLINNARNVTRLG  109

Query  300  IPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            IP YEWW EALHG+ Y GPG  F+ VVP ATSFP  +LT
Sbjct  110  IPKYEWWSEALHGVSYVGPGTKFSNVVPGATSFPQVILT  148



>ref|XP_004155509.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cucumis sativus]
Length=809

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 66/100 (66%), Gaps = 0/100 (0%)
 Frame = +3

Query  117  QSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRL  296
             +Q+   +ACD   NP +    FC+  L  + RV DLVKRLTL EKI  L+N A N +RL
Sbjct  67   SAQSPTAFACDAETNPSVSGFAFCDSSLGFEARVEDLVKRLTLQEKIGFLINNARNVTRL  126

Query  297  GIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            GIP YEWW EALHG+ Y GPG  F+ VVP ATSFP  +LT
Sbjct  127  GIPKYEWWSEALHGVSYVGPGTKFSNVVPGATSFPQVILT  166



>gb|KFK25272.1| hypothetical protein AALP_AA8G090500 [Arabis alpina]
Length=772

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 69/102 (68%), Gaps = 0/102 (0%)
 Frame = +3

Query  111  PVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNES  290
            P+ +++ PV+ACD  K+       FCN  LDV++RV+DLV RLTL EKI  LV+ A   S
Sbjct  27   PLNAKSSPVFACDVDKDISFSGFRFCNTELDVQSRVSDLVGRLTLEEKIGFLVSRAKGVS  86

Query  291  RLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            RLGIP Y WW EALHG+   GPG  F+G VP ATSFP  +LT
Sbjct  87   RLGIPDYNWWSEALHGVSNVGPGSYFSGQVPGATSFPQVILT  128



>ref|XP_010937054.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Elaeis guineensis]
Length=772

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 69/101 (68%), Gaps = 1/101 (1%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V +QT P++ACD   NP L +  FCN       RV DLV+RLTL EK+  LVN A   SR
Sbjct  30   VLAQT-PIFACDIASNPSLANFGFCNTSWGTAARVDDLVERLTLDEKVGFLVNKATAVSR  88

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP+YEWW EALHG+ Y GPG +F+ +VP ATSFP  +LT
Sbjct  89   LGIPSYEWWSEALHGVSYVGPGTHFSSLVPGATSFPQVILT  129



>ref|NP_196535.1| beta-xylosidase 3 [Arabidopsis thaliana]
 sp|Q9LXD6.1|BXL3_ARATH RecName: Full=Beta-D-xylosidase 3; Short=AtBXL3; AltName: Full=Alpha-L-arabinofuranosidase; 
Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB89357.1| beta-xylosidase-like protein [Arabidopsis thaliana]
 dbj|BAB09531.1| beta-xylosidase [Arabidopsis thaliana]
 gb|AAK96639.1| AT5g09730/F17I14_80 [Arabidopsis thaliana]
 gb|AED91439.1| beta-xylosidase 3 [Arabidopsis thaliana]
Length=773

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 66/100 (66%), Gaps = 0/100 (0%)
 Frame = +3

Query  117  QSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRL  296
             +Q+ PV+ACD   NP L  L FCN  L +K RV DLV RLTL EKI  L + A   SRL
Sbjct  27   NNQSSPVFACDVTGNPSLAGLRFCNAGLSIKARVTDLVGRLTLEEKIGFLTSKAIGVSRL  86

Query  297  GIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            GIP+Y+WW EALHG+   G G  FTG VP ATSFP  +LT
Sbjct  87   GIPSYKWWSEALHGVSNVGGGSRFTGQVPGATSFPQVILT  126



>gb|KHN06823.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Glycine soja]
Length=301

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            +ACD  K+P +    FC++ L V+ RV DLV RLTL EKI  LVN+AG+ SRLGIP YEW
Sbjct  12   FACDVGKSPAVAGYGFCDKSLGVEARVKDLVGRLTLQEKIGNLVNSAGDVSRLGIPRYEW  71

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+   G G  F+ VVP ATSFP P+LT
Sbjct  72   WSEALHGVSNVGLGTRFSNVVPGATSFPMPILT  104



>ref|XP_003524073.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Glycine max]
Length=613

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +3

Query  129  GPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPT  308
            G  +ACD  K+P +    FC++ L V+ RV DLV RLTL EKI  LVN+AG+ SRLGIP 
Sbjct  27   GQTFACDVGKSPAVAGYGFCDKSLGVEARVKDLVGRLTLQEKIGNLVNSAGDVSRLGIPR  86

Query  309  YEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            YEWW EALHG+   G G  F+ VVP ATSFP P+LT
Sbjct  87   YEWWSEALHGVSNVGLGTRFSNVVPGATSFPMPILT  122



>ref|XP_009403180.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Musa acuminata subsp. malaccensis]
Length=769

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 64/99 (65%), Gaps = 0/99 (0%)
 Frame = +3

Query  120  SQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLG  299
            S  GP++ACD   N  L    FCN     K RV DLVKRLTL EK+  LVN A    RLG
Sbjct  28   SGQGPIFACDVASNRSLAGFGFCNVSWGTKQRVKDLVKRLTLQEKVGFLVNKATAVPRLG  87

Query  300  IPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            IP+YEWW EALHG+ Y GPG  F+ +VP ATSFP  +LT
Sbjct  88   IPSYEWWSEALHGVSYVGPGTRFSTLVPGATSFPQVILT  126



>ref|XP_004301992.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X3 [Fragaria vesca subsp. vesca]
Length=774

 Score =   118 bits (295),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 71/102 (70%), Gaps = 3/102 (3%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V S +G  YAC    N   +S PFC++ L V  RVADLV+RLTL EKIT LV+ AGN SR
Sbjct  32   VSSVSGQSYACGDGFNA--RSFPFCDKSLAVDARVADLVQRLTLQEKITFLVDAAGNVSR  89

Query  294  LGIPTYEWWPEALHGLPYTGP-GVNFTGVVPPATSFPHPLLT  416
            LGIPTY+WW EALHG+   G  G  FT +VP ATSFP P+LT
Sbjct  90   LGIPTYQWWSEALHGVSKVGRGGTKFTELVPGATSFPQPILT  131



>ref|XP_002873418.1| beta-xylosidase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49677.1| beta-xylosidase 3 [Arabidopsis lyrata subsp. lyrata]
Length=780

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 68/100 (68%), Gaps = 0/100 (0%)
 Frame = +3

Query  117  QSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRL  296
             +Q+ PV+ACD   NP L  L FCN  L++K+RV DLV RLTL EKI  L + A   SRL
Sbjct  32   NAQSSPVFACDVTGNPSLAGLRFCNTGLNIKSRVTDLVGRLTLEEKIGFLGSNAIGVSRL  91

Query  297  GIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            GIP Y+WW EALHG+   G G +F+G VP ATSFP  +LT
Sbjct  92   GIPAYKWWSEALHGVSNVGGGSSFSGQVPGATSFPQVILT  131



>emb|CDY52884.1| BnaC06g27770D, partial [Brassica napus]
Length=318

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 68/106 (64%), Gaps = 1/106 (1%)
 Frame = +3

Query  102  IIGPVQSQTG-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTA  278
            I  P  +Q+  PV+ACD + NP L    FCN  L  + RV DLV RLTL EKI  LV+ A
Sbjct  27   ISKPSNAQSSSPVFACDVITNPSLAGYGFCNTGLKAEARVTDLVGRLTLVEKIGFLVSKA  86

Query  279  GNESRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
               SRLGIP Y WW EALHG+   G G +FTG+VP ATSFP  +LT
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGGGSSFTGLVPGATSFPQVILT  132



>gb|KHG02719.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Gossypium arboreum]
Length=776

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 69/105 (66%), Gaps = 3/105 (3%)
 Frame = +3

Query  102  IIGPVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAG  281
            ++G V      V+ACD  K+  +    FCN  L    RVADLV+RLTL EKI  +VN AG
Sbjct  29   VVGQVSQ---AVFACDATKDRKVVHYGFCNASLGRDARVADLVRRLTLQEKILNIVNGAG  85

Query  282  NESRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            N SRLGIP YEWW EALHG+   GPG NF+ +VP ATSFP  +LT
Sbjct  86   NISRLGIPKYEWWSEALHGVSNIGPGTNFSSLVPGATSFPQVILT  130



>gb|KJB77499.1| hypothetical protein B456_012G140300 [Gossypium raimondii]
Length=776

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 68/102 (67%), Gaps = 1/102 (1%)
 Frame = +3

Query  114  VQSQTGP-VYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNES  290
            V  Q  P V+ACD  K+  +    FCN  L    RVADLV+RLTL EKI  +VN AGN S
Sbjct  29   VVGQVSPAVFACDATKDRKVVHYGFCNASLGRDARVADLVRRLTLQEKILNIVNGAGNIS  88

Query  291  RLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            RLGIP YEWW EALHG+   GPG NF+ +VP ATSFP  +LT
Sbjct  89   RLGIPKYEWWSEALHGVSNVGPGTNFSSLVPGATSFPQVILT  130



>ref|XP_010065530.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
Length=789

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 62/95 (65%), Gaps = 0/95 (0%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            PV+ACD   +P L    FCN  L V+ RV DLV+RLTL EK+  LVN A N  RLGIP Y
Sbjct  39   PVFACDVDSDPSLAGFGFCNTSLGVEARVVDLVQRLTLQEKVGFLVNNASNVDRLGIPKY  98

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
             WW EALHG+   GPG  F  +VP ATSFP  +LT
Sbjct  99   SWWSEALHGVSDVGPGTTFASLVPGATSFPQVILT  133



>ref|XP_010452969.1| PREDICTED: beta-D-xylosidase 3-like [Camelina sativa]
Length=779

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 66/100 (66%), Gaps = 0/100 (0%)
 Frame = +3

Query  117  QSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRL  296
             +Q+ PV+ACD  +NP L +L FCN  L +K RV DLV RLTL EKI  L + A   SRL
Sbjct  32   NAQSSPVFACDVTRNPSLAALGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSKAVGVSRL  91

Query  297  GIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            GIP Y WW EALHG+   G G NF+G +  ATSFP  +LT
Sbjct  92   GIPDYNWWSEALHGVSNVGSGTNFSGQIRGATSFPQVILT  131



>ref|XP_003531047.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Glycine max]
Length=765

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +3

Query  129  GPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPT  308
            G  +ACD  K+P +    FC++ L V+ RV DLV RLTL EKI  LVN+A + SRLGIP 
Sbjct  27   GQTFACDVGKSPAVAGYGFCDKSLGVEARVKDLVGRLTLQEKIGNLVNSAVDVSRLGIPK  86

Query  309  YEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            YEWW EALHG+   GPG  F+ V+P ATSFP P+LT
Sbjct  87   YEWWSEALHGVSNVGPGTRFSNVIPGATSFPMPILT  122



>ref|XP_006399455.1| hypothetical protein EUTSA_v10012739mg [Eutrema salsugineum]
 gb|ESQ40908.1| hypothetical protein EUTSA_v10012739mg [Eutrema salsugineum]
Length=779

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 65/105 (62%), Gaps = 0/105 (0%)
 Frame = +3

Query  102  IIGPVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAG  281
            I  P  +Q+ PV+ACD   NP L    FCN  L  + RV DLV RLTL EKI  L + A 
Sbjct  27   ISEPSNAQSSPVFACDITGNPSLAGFGFCNTELKAEDRVTDLVGRLTLEEKIGFLGSRAN  86

Query  282  NESRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
              SRLGIP Y WW EALHG+   G G NF+G VP ATSFP  +LT
Sbjct  87   GVSRLGIPPYNWWSEALHGVSDVGHGTNFSGQVPGATSFPQVILT  131



>ref|XP_010422950.1| PREDICTED: beta-D-xylosidase 3 isoform X1 [Camelina sativa]
Length=794

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 65/100 (65%), Gaps = 0/100 (0%)
 Frame = +3

Query  117  QSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRL  296
             +Q+ PV+ACD   NP L +L FCN  L +K RV DLV RLTL EKI  L + A   SRL
Sbjct  47   NAQSSPVFACDVTGNPSLAALGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSKAVGVSRL  106

Query  297  GIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            GIP Y WW EALHG+ Y G G  F+G V  ATSFP  +LT
Sbjct  107  GIPAYNWWSEALHGVSYIGGGSGFSGQVHGATSFPQVILT  146



>ref|XP_010422951.1| PREDICTED: beta-D-xylosidase 3 isoform X2 [Camelina sativa]
Length=752

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 65/100 (65%), Gaps = 0/100 (0%)
 Frame = +3

Query  117  QSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRL  296
             +Q+ PV+ACD   NP L +L FCN  L +K RV DLV RLTL EKI  L + A   SRL
Sbjct  47   NAQSSPVFACDVTGNPSLAALGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSKAVGVSRL  106

Query  297  GIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            GIP Y WW EALHG+ Y G G  F+G V  ATSFP  +LT
Sbjct  107  GIPAYNWWSEALHGVSYIGGGSGFSGQVHGATSFPQVILT  146



>ref|XP_010687471.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Beta vulgaris subsp. vulgaris]
Length=777

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 64/95 (67%), Gaps = 0/95 (0%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P +ACDT  N  L SL FC+    V+ RVADL+ RLTL EKI  L++ A + +RLGIP Y
Sbjct  40   PAFACDTTSNASLSSLGFCDTSKSVEARVADLIGRLTLTEKIGYLISGAASVNRLGIPKY  99

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EWW EALHG+   GPG  FT VVP ATSFP  + T
Sbjct  100  EWWSEALHGVSNVGPGTRFTSVVPGATSFPQVITT  134



>ref|XP_010491609.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=780

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 67/102 (66%), Gaps = 0/102 (0%)
 Frame = +3

Query  111  PVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNES  290
            P  +Q+ P +AC+   N  L    FCN ++ +++RVADLV RLTL EKI  L ++    S
Sbjct  28   PSNAQSLPAFACNVAGNNSLAGFGFCNTKIKIESRVADLVGRLTLQEKIKFLGSSGNGAS  87

Query  291  RLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            RLGIPTYEWW EALHG+ + GP   F+ +VP AT FP  +LT
Sbjct  88   RLGIPTYEWWAEALHGVSFIGPATRFSKLVPSATCFPQVILT  129



>ref|XP_009629820.1| PREDICTED: beta-D-xylosidase 1-like isoform X1 [Nicotiana tomentosiformis]
Length=153

 Score =   108 bits (270),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +3

Query  123  QTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGI  302
            ++ P +ACD   N G ++LPFC   L +  RV DL++RLTL EKI LLVN A    RLG+
Sbjct  27   ESRPPFACDPA-NAGTRNLPFCKASLPIHVRVQDLIERLTLQEKIRLLVNNAAPVERLGV  85

Query  303  PTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
              YEWW EALHG+  TGPGV F G  P ATSFP  + T
Sbjct  86   NGYEWWSEALHGVSSTGPGVKFGGAFPSATSFPQVITT  123



>ref|XP_009629821.1| PREDICTED: beta-D-xylosidase 1-like isoform X2 [Nicotiana tomentosiformis]
Length=147

 Score =   108 bits (270),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +3

Query  123  QTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGI  302
            ++ P +ACD   N G ++LPFC   L +  RV DL++RLTL EKI LLVN A    RLG+
Sbjct  27   ESRPPFACDPA-NAGTRNLPFCKASLPIHVRVQDLIERLTLQEKIRLLVNNAAPVERLGV  85

Query  303  PTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
              YEWW EALHG+  TGPGV F G  P ATSFP  + T
Sbjct  86   NGYEWWSEALHGVSSTGPGVKFGGAFPSATSFPQVITT  123



>ref|XP_010491611.1| PREDICTED: beta-D-xylosidase 3-like isoform X2 [Camelina sativa]
Length=765

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 64/100 (64%), Gaps = 0/100 (0%)
 Frame = +3

Query  117  QSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRL  296
             +Q+ PV+ACD   NP L  L FCN  L +K RV DLV RLTL EKI  L + A   SRL
Sbjct  32   NAQSSPVFACDVTGNPSLAVLGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSRAVGVSRL  91

Query  297  GIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            GIP Y WW EALHG+ Y G G  F+G V  ATSFP  +LT
Sbjct  92   GIPDYNWWSEALHGVSYIGGGSGFSGQVRGATSFPQVILT  131



>ref|XP_010491610.1| PREDICTED: beta-D-xylosidase 3-like isoform X1 [Camelina sativa]
Length=779

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 64/100 (64%), Gaps = 0/100 (0%)
 Frame = +3

Query  117  QSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRL  296
             +Q+ PV+ACD   NP L  L FCN  L +K RV DLV RLTL EKI  L + A   SRL
Sbjct  32   NAQSSPVFACDVTGNPSLAVLGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSRAVGVSRL  91

Query  297  GIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            GIP Y WW EALHG+ Y G G  F+G V  ATSFP  +LT
Sbjct  92   GIPDYNWWSEALHGVSYIGGGSGFSGQVRGATSFPQVILT  131



>emb|CDY21595.1| BnaC09g46970D [Brassica napus]
Length=942

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 67/106 (63%), Gaps = 1/106 (1%)
 Frame = +3

Query  102  IIGPVQSQTG-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTA  278
            I  P  +Q+  P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI  LV+ A
Sbjct  27   ISKPSNAQSSSPKFACDVTKNPSLTGYGFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKA  86

Query  279  GNESRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
               SRLGIP Y WW EALHG+   G G NFTG VP ATSFP  +LT
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGGGSNFTGPVPGATSFPQVILT  132



>gb|EYU23815.1| hypothetical protein MIMGU_mgv1a0042532mg, partial [Erythranthe 
guttata]
Length=321

 Score =   110 bits (274),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 61/97 (63%), Gaps = 1/97 (1%)
 Frame = +3

Query  126  TGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIP  305
             GP ++CD   NP   SLPFCN RL + TR +DLV RLTL EK+  LVNTA    RL I 
Sbjct  29   NGPPFSCD-ASNPSTSSLPFCNTRLPITTRASDLVSRLTLDEKVQQLVNTAAAVPRLNIS  87

Query  306  TYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
             YEWW EALHG+   G GV F G V  AT FP  +LT
Sbjct  88   AYEWWSEALHGVSRHGRGVRFNGTVTSATMFPQIILT  124



>ref|XP_003615012.1| Auxin-induced beta-glucosidase, partial [Medicago truncatula]
Length=190

 Score =   107 bits (267),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P Y+CDT  NP  KSLPFCN  L +  R  D+V RLTL EKI+ LVNTA +  RLGIP+Y
Sbjct  34   PPYSCDTT-NPLTKSLPFCNLNLTITQRAKDIVSRLTLDEKISQLVNTAPSIPRLGIPSY  92

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            +WW EALHG+   G G+   G V  ATSFP  +LT
Sbjct  93   QWWDEALHGVANAGKGIRLNGSVAGATSFPQVILT  127



>gb|EYU18507.1| hypothetical protein MIMGU_mgv1a001685mg [Erythranthe guttata]
Length=773

 Score =   112 bits (281),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P +ACD  KNP LKS  FCN  LD+ TRVADLV +LTL EKI  +V+ +   +RLGIP Y
Sbjct  33   PPFACDVSKNPDLKSFTFCNPSLDIDTRVADLVNKLTLKEKIGWVVSGSEGVTRLGIPGY  92

Query  312  EWWPEALHGLPYTGPGVNF-TGVVPPATSFPHPLLT  416
            EWW EALHG+   GPGV F    VP ATSFP  +LT
Sbjct  93   EWWSEALHGIGSNGPGVVFDQNNVPAATSFPQVILT  128



>gb|EYU18508.1| hypothetical protein MIMGU_mgv1a001685mg [Erythranthe guttata]
Length=770

 Score =   112 bits (281),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P +ACD  KNP LKS  FCN  LD+ TRVADLV +LTL EKI  +V+ +   +RLGIP Y
Sbjct  33   PPFACDVSKNPDLKSFTFCNPSLDIDTRVADLVNKLTLKEKIGWVVSGSEGVTRLGIPGY  92

Query  312  EWWPEALHGLPYTGPGVNF-TGVVPPATSFPHPLLT  416
            EWW EALHG+   GPGV F    VP ATSFP  +LT
Sbjct  93   EWWSEALHGIGSNGPGVVFDQNNVPAATSFPQVILT  128



>emb|CDX96113.1| BnaA07g26180D [Brassica napus]
Length=1013

 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 68/106 (64%), Gaps = 1/106 (1%)
 Frame = +3

Query  102  IIGPVQSQTG-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTA  278
            I  P  +Q+  PV+ACD + NP L    FCN  L  + RV DLV RLTL EKI  LV+ +
Sbjct  27   ISKPSNAQSSSPVFACDVITNPSLAGYGFCNTGLKAEARVTDLVGRLTLVEKIGFLVSKS  86

Query  279  GNESRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
               SRLGIP Y WW EALHG+   G G +FTG+VP ATSFP  +LT
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGGGSSFTGLVPGATSFPQVILT  132



>emb|CDY01780.1| BnaC06g28200D [Brassica napus]
Length=776

 Score =   112 bits (281),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 62/97 (64%), Gaps = 0/97 (0%)
 Frame = +3

Query  126  TGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIP  305
            + P +ACD  +NP L    FCN  L  + RV DLV RLTL EKI  LV+ A   SRLGIP
Sbjct  36   SSPEFACDITRNPSLAGYGFCNTGLKAEARVTDLVGRLTLEEKIGFLVSKATGVSRLGIP  95

Query  306  TYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
             Y WW EALHG+   G G NFTG VP ATSFP  +LT
Sbjct  96   DYNWWSEALHGVSDVGGGSNFTGPVPGATSFPQVILT  132



>ref|XP_010424711.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=780

 Score =   112 bits (281),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 62/95 (65%), Gaps = 0/95 (0%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P +AC+   N  L    FCN +L ++ RVADLV RLTL EK+  L ++    SRLGIPTY
Sbjct  35   PAFACNVAGNNSLARFGFCNTKLKIERRVADLVGRLTLQEKVRFLGSSGNGASRLGIPTY  94

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EWW EALHG+ + GP   FT +VP AT FP  +LT
Sbjct  95   EWWAEALHGVSFIGPATRFTKLVPSATCFPQVILT  129



>gb|EMT32951.1| Beta-D-xylosidase 4 [Aegilops tauschii]
Length=970

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 64/101 (63%), Gaps = 2/101 (2%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
             ++QT PV+ACD   N  L    FCN++     R  DLV RLTL EK+  LVN      R
Sbjct  222  AEAQT-PVFACD-ASNATLAGYGFCNRKASASARAKDLVSRLTLAEKVGFLVNKQAALGR  279

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+ Y GPG  F+ +VP ATSFP P+LT
Sbjct  280  LGIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILT  320



>dbj|BAJ89945.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=525

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  108  GPVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNE  287
            G  ++Q  PV+ACD   N  L +  FCN++     R  DLV RLTL EK+  LVN     
Sbjct  28   GTAEAQA-PVFACD-ASNATLAAYGFCNRKATASARARDLVSRLTLAEKVGFLVNKQPAL  85

Query  288  SRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
             RLGIP YEWW EALHG+ Y GPG  F+ +VP ATSFP P+LT
Sbjct  86   GRLGIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILT  128



>ref|XP_009105246.1| PREDICTED: beta-D-xylosidase 3-like [Brassica rapa]
Length=774

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 67/106 (63%), Gaps = 1/106 (1%)
 Frame = +3

Query  102  IIGPVQSQTG-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTA  278
            I  P  +Q+  PV+ACD + NP L    FCN  L  + RV DLV RLTL EKI  LV+ +
Sbjct  27   ISKPSNAQSSSPVFACDVITNPSLAGYGFCNTGLKAEARVTDLVGRLTLVEKIGFLVSKS  86

Query  279  GNESRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
               SRLGIP Y WW EALHG+   G G +FTG+VP ATSFP   LT
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGGGSSFTGLVPGATSFPQVKLT  132



>emb|CDX97115.1| BnaC09g45100D [Brassica napus]
Length=695

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 66/106 (62%), Gaps = 1/106 (1%)
 Frame = +3

Query  102  IIGPVQSQTG-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTA  278
            I  P  +Q+  P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI  LV+ A
Sbjct  27   ITKPSNAQSSSPKFACDVTKNPSLAGYGFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKA  86

Query  279  GNESRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
               SRLGIP Y WW EALHG+   G G +F G VP ATSFP  +LT
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGDGSSFKGPVPGATSFPQVILT  132



>ref|XP_006855294.1| hypothetical protein AMTR_s00057p00049120 [Amborella trichopoda]
 gb|ERN16761.1| hypothetical protein AMTR_s00057p00049120 [Amborella trichopoda]
Length=768

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 67/102 (66%), Gaps = 4/102 (4%)
 Frame = +3

Query  111  PVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNES  290
            P   + GP +ACD      + S PFC++ L +  RV+DL++RLTLPEK  LLVN A   +
Sbjct  20   PAIVEPGPSFACDGQ----MGSFPFCDRSLPINARVSDLIRRLTLPEKTRLLVNNAEGLA  75

Query  291  RLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            RLG+P YEWW EALHG+   GPG  F G VP ATSFP  +LT
Sbjct  76   RLGVPHYEWWSEALHGVSNVGPGTRFGGNVPGATSFPQVILT  117



>emb|CDY35825.1| BnaC09g37570D [Brassica napus]
Length=774

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 66/106 (62%), Gaps = 1/106 (1%)
 Frame = +3

Query  102  IIGPVQSQTG-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTA  278
            I  P  +Q+  P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI  LV+ A
Sbjct  27   ISKPSNAQSSSPKFACDVTKNPSLAGYGFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKA  86

Query  279  GNESRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
               SRLGIP Y WW EALHG+   G G +F G VP ATSFP  +LT
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGDGSSFKGPVPGATSFPQVILT  132



>emb|CDX69892.1| BnaA10g22410D [Brassica napus]
Length=774

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 66/106 (62%), Gaps = 1/106 (1%)
 Frame = +3

Query  102  IIGPVQSQTG-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTA  278
            I  P  +Q+  P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI  LV+ A
Sbjct  27   ISKPSNAQSSSPKFACDVTKNPSLAGYGFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKA  86

Query  279  GNESRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
               SRLGIP Y WW EALHG+   G G +F G VP ATSFP  +LT
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGDGSSFKGPVPGATSFPQVILT  132



>ref|XP_009122535.1| PREDICTED: beta-D-xylosidase 3-like [Brassica rapa]
Length=774

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 62/98 (63%), Gaps = 0/98 (0%)
 Frame = +3

Query  123  QTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGI  302
             + P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI  LV+ A   SRLGI
Sbjct  35   SSSPKFACDDTKNPSLAGYRFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKATGVSRLGI  94

Query  303  PTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            P Y WW EALHG+   G G +F G VP ATSFP  +LT
Sbjct  95   PDYNWWSEALHGVSDVGDGSSFKGPVPGATSFPQVILT  132



>ref|XP_003615011.1| Beta-D-xylosidase [Medicago truncatula]
Length=155

 Score =   104 bits (259),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 62/95 (65%), Gaps = 1/95 (1%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P Y+CDT  NP  K  PFCN  L +  R  D+V RLTL EK++ LVNTA    RL IP+Y
Sbjct  34   PPYSCDT-SNPRTKLFPFCNLNLTITQRAKDIVSRLTLDEKVSQLVNTAPAIPRLDIPSY  92

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            +WW EALHG+ Y G G+   G +P ATSFP  +LT
Sbjct  93   QWWNEALHGVSYVGMGIILNGSIPAATSFPQVILT  127



>ref|XP_009804071.1| PREDICTED: beta-D-xylosidase 1 isoform X2 [Nicotiana sylvestris]
Length=665

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +3

Query  123  QTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGI  302
            ++ P +ACD   N G ++LPFC   L +  RV DL++RLTL EKI LLVN A    RLG+
Sbjct  27   ESRPAFACDPA-NAGTRNLPFCKTSLPIHVRVQDLIQRLTLQEKIRLLVNNAAPVERLGV  85

Query  303  PTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
              YEWW EALHG+  TGPGV F G  P ATSFP  + T
Sbjct  86   NGYEWWSEALHGVSSTGPGVKFGGAFPSATSFPQVITT  123



>dbj|BAJ90315.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=775

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  108  GPVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNE  287
            G  ++Q  PV+ACD   N  L +  FCN++     R  DLV RLTL EK+  LVN     
Sbjct  28   GTAEAQA-PVFACD-ASNATLAAYGFCNRKATASARARDLVSRLTLAEKVGFLVNKQPAL  85

Query  288  SRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
             RLGIP YEWW EALHG+ Y GPG  F+ +VP ATSFP P+LT
Sbjct  86   GRLGIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILT  128



>dbj|BAJ90420.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96778.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08165.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=775

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  108  GPVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNE  287
            G  ++Q  PV+ACD   N  L +  FCN++     R  DLV RLTL EK+  LVN     
Sbjct  28   GTAEAQA-PVFACD-ASNATLAAYGFCNRKATASARARDLVSRLTLAEKVGFLVNKQPAL  85

Query  288  SRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
             RLGIP YEWW EALHG+ Y GPG  F+ +VP ATSFP P+LT
Sbjct  86   GRLGIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILT  128



>gb|ABR17218.1| unknown [Picea sitchensis]
Length=151

 Score =   103 bits (258),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            + CD   + GL S PFCN  L +  R  DLV RLTL EK+  LVN A N SRLGIP YEW
Sbjct  29   FPCD--PSTGLNSFPFCNVSLPIADRAKDLVGRLTLQEKVQQLVNGASNISRLGIPMYEW  86

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+   GPG  F   VP ATSFP  +LT
Sbjct  87   WSEALHGVSDVGPGTRFGAPVPGATSFPQVILT  119



>ref|XP_002963750.1| hypothetical protein SELMODRAFT_80102 [Selaginella moellendorffii]
 gb|EFJ35621.1| hypothetical protein SELMODRAFT_80102 [Selaginella moellendorffii]
Length=785

 Score =   110 bits (275),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 52/97 (54%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = +3

Query  120  SQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLG  299
            S   P YACD   N  L S PFC+ +L V  RV DLV RLTL EK+  +VN A    RLG
Sbjct  31   STAQPRYACDVSSNASLGSFPFCDTKLGVDVRVQDLVSRLTLDEKVDEMVNAAQGIPRLG  90

Query  300  IPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPL  410
            +P+Y+WW EALHG+  + PGV F G+ P ATSFP P+
Sbjct  91   VPSYQWWQEALHGVA-SSPGVQFGGLAPAATSFPMPI  126



>ref|XP_009804070.1| PREDICTED: beta-D-xylosidase 1 isoform X1 [Nicotiana sylvestris]
Length=774

 Score =   110 bits (274),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +3

Query  123  QTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGI  302
            ++ P +ACD   N G ++LPFC   L +  RV DL++RLTL EKI LLVN A    RLG+
Sbjct  27   ESRPAFACDPA-NAGTRNLPFCKTSLPIHVRVQDLIQRLTLQEKIRLLVNNAAPVERLGV  85

Query  303  PTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
              YEWW EALHG+  TGPGV F G  P ATSFP  + T
Sbjct  86   NGYEWWSEALHGVSSTGPGVKFGGAFPSATSFPQVITT  123



>emb|CAJ86028.1| B0414F07.1 [Oryza sativa Indica Group]
Length=320

 Score =   107 bits (266),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 64/101 (63%), Gaps = 2/101 (2%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
             ++QT PV+ACD   N  +    FC++      R ADL+ RLTL EK+  LVN      R
Sbjct  24   ARAQT-PVFACDA-SNATVSGYGFCDRTKSSAARAADLLGRLTLAEKVGFLVNKQAALPR  81

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+ Y GPG  F+ +VP ATSFP P+LT
Sbjct  82   LGIPAYEWWSEALHGVSYVGPGTRFSTLVPGATSFPQPILT  122



>gb|AAK38481.1| alpha-L-arabinofuranosidase/beta-D-xylosidase isoenzyme ARA-I 
[Hordeum vulgare]
Length=777

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 61/95 (64%), Gaps = 1/95 (1%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            PV+ACD   N  L +  FCN++     R  DLV RLTL EK+  LVN      RLGIP Y
Sbjct  37   PVFACD-ASNATLAAYGFCNRKATASARARDLVSRLTLAEKVGFLVNKQPALGRLGIPAY  95

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EWW EALHG+ Y GPG  F+ +VP ATSFP P+LT
Sbjct  96   EWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILT  130



>ref|XP_010068200.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
Length=777

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 64/94 (68%), Gaps = 2/94 (2%)
 Frame = +3

Query  135  VYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYE  314
            V+ CD   +P L +  FCN    V+ RVADLVKRLTL EK+  L N AG+  RLGIP Y+
Sbjct  43   VFPCD--GDPSLSTFGFCNMSWGVEARVADLVKRLTLQEKVGFLGNHAGSVDRLGIPEYQ  100

Query  315  WWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            WW EALHG+ Y G G +F+ +VP ATSFP  +LT
Sbjct  101  WWSEALHGVSYIGGGTSFSSLVPGATSFPQVILT  134



>gb|KJB16241.1| hypothetical protein B456_002G219100 [Gossypium raimondii]
Length=769

 Score =   108 bits (271),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 53/100 (53%), Positives = 64/100 (64%), Gaps = 1/100 (1%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            V S T P ++CD+  +P  K+ PFC   L V  R  DLV RLTL EKI+ LVN+A    R
Sbjct  17   VASTTTPPFSCDS-SDPTTKNYPFCQSTLPVTQRARDLVSRLTLDEKISQLVNSAPAIPR  75

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLL  413
            LGIP YEWW EALHG+   GPG+ F G +  ATSFP  +L
Sbjct  76   LGIPAYEWWSEALHGVSNVGPGIKFDGTIKAATSFPQVIL  115



>ref|XP_002974833.1| hypothetical protein SELMODRAFT_101733 [Selaginella moellendorffii]
 gb|EFJ24353.1| hypothetical protein SELMODRAFT_101733 [Selaginella moellendorffii]
Length=784

 Score =   108 bits (271),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 50/93 (54%), Positives = 62/93 (67%), Gaps = 1/93 (1%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            YACD   N  L S PFC+ +L +  RV DLV RLTL EK+  +VN A    RLG+P+Y+W
Sbjct  36   YACDVSSNASLGSFPFCDTKLGIDVRVQDLVSRLTLDEKVDEMVNAAQGIPRLGVPSYQW  95

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+  + PGV F G+ P ATSFP P+ T
Sbjct  96   WQEALHGVA-SSPGVQFGGLAPAATSFPMPIAT  127



>ref|XP_002306583.2| hypothetical protein POPTR_0005s16660g [Populus trichocarpa]
 gb|EEE93579.2| hypothetical protein POPTR_0005s16660g [Populus trichocarpa]
Length=773

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = +3

Query  126  TGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIP  305
            T P ++CD+  NP  K+ PFC   L +  R  DLV RLTL EKI+ LVN+A    RLGIP
Sbjct  24   TQPPFSCDS-SNPSTKTFPFCKTTLPISQRANDLVSRLTLEEKISQLVNSAQPIPRLGIP  82

Query  306  TYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
             Y+WW EALHG+ Y GPG+ F G +  ATSFP  +L+
Sbjct  83   GYQWWSEALHGVAYAGPGIRFNGTIKRATSFPQVILS  119



>ref|XP_008445351.1| PREDICTED: probable beta-D-xylosidase 7 [Cucumis melo]
Length=783

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 64/99 (65%), Gaps = 1/99 (1%)
 Frame = +3

Query  120  SQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLG  299
            S + P YACD+  NP  K+LPFC   L +K R  DLV RLTL EK+  LVNTA    RLG
Sbjct  32   SSSQPPYACDS-SNPLTKTLPFCRTSLPIKLRARDLVSRLTLDEKVLQLVNTAPAIPRLG  90

Query  300  IPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            IP YEWW EALHG+   G G+   G +P ATSFP  +LT
Sbjct  91   IPAYEWWSEALHGVADVGYGIRLNGTIPAATSFPQVILT  129



>ref|XP_002515300.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF47284.1| Beta-glucosidase, putative [Ricinus communis]
Length=768

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 63/93 (68%), Gaps = 1/93 (1%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            +ACD+ K+   K+LPFC  +L ++ RV DL+ RLTL EK+ LLVN AG  SRLGI  YEW
Sbjct  28   FACDS-KDGTTKNLPFCQVKLPIQDRVKDLIGRLTLAEKVGLLVNNAGAVSRLGIKGYEW  86

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+   GPG  F G  P ATSFP  + T
Sbjct  87   WSEALHGVSNVGPGTKFGGSFPGATSFPQVITT  119



>ref|XP_011011483.1| PREDICTED: probable beta-D-xylosidase 7 [Populus euphratica]
Length=773

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = +3

Query  126  TGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIP  305
            T P ++CD+  NP  K+ PFC   L +  R  DLV RLTL EKI+ LVN+A    RLGIP
Sbjct  24   TQPPFSCDS-SNPTTKTFPFCKTTLPISQRATDLVSRLTLDEKISQLVNSAQPIPRLGIP  82

Query  306  TYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
             Y+WW EALHG+ Y GPG+ F G +  ATSFP  +L+
Sbjct  83   GYQWWSEALHGIAYAGPGIRFNGTIKRATSFPQVILS  119



>gb|AES97966.2| glycoside hydrolase family 3 protein [Medicago truncatula]
Length=782

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P Y+CDT  NP  KSLPFCN  L +  R  D+V RLTL EKI+ LVNTA +  RLGIP+Y
Sbjct  34   PPYSCDTT-NPLTKSLPFCNLNLTITQRAKDIVSRLTLDEKISQLVNTAPSIPRLGIPSY  92

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            +WW EALHG+   G G+   G V  ATSFP  +LT
Sbjct  93   QWWDEALHGVANAGKGIRLNGSVAGATSFPQVILT  127



>ref|XP_003615008.1| Xylan 1 4-beta-xylosidase [Medicago truncatula]
Length=798

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P Y+CDT  NP  KSLPFCN  L +  R  D+V RLTL EKI+ LVNTA +  RLGIP+Y
Sbjct  34   PPYSCDTT-NPLTKSLPFCNLNLTITQRAKDIVSRLTLDEKISQLVNTAPSIPRLGIPSY  92

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            +WW EALHG+   G G+   G V  ATSFP  +LT
Sbjct  93   QWWDEALHGVANAGKGIRLNGSVAGATSFPQVILT  127



>ref|XP_002285805.1| PREDICTED: probable beta-D-xylosidase 7 [Vitis vinifera]
Length=774

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 67/105 (64%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  IIGPVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAG  281
            I+  V+S   P ++CD+  NP  KS  FC   L +  RV DLV RLTL EKI+ LVN+A 
Sbjct  17   ILVGVESTQSPPFSCDS-SNPSTKSYHFCKTTLPIPDRVRDLVSRLTLDEKISQLVNSAP  75

Query  282  NESRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
               RLGIP YEWW EALHG+   GPG+ F G +  ATSFP  +LT
Sbjct  76   AIPRLGIPAYEWWSEALHGVADAGPGIRFNGTIRSATSFPQVILT  120



>ref|XP_003615003.1| Xylan 1 4-beta-xylosidase [Medicago truncatula]
 gb|AES97961.1| glycoside hydrolase family 3 amino-terminal domain protein [Medicago 
truncatula]
Length=780

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 62/94 (66%), Gaps = 1/94 (1%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P Y+CDT  NP  KS PFCN  L +  R  D+V RLTL EKI+ LVNTA    RLGIP+Y
Sbjct  32   PPYSCDT-SNPLTKSFPFCNLNLTITQRAKDIVSRLTLDEKISQLVNTAPAIPRLGIPSY  90

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLL  413
            +WW EALHG+ Y G G+   G +  ATSFP  +L
Sbjct  91   QWWNEALHGVSYVGKGIRLNGSITAATSFPQIIL  124



>emb|CAE03635.1| OSJNBb0003B01.27 [Oryza sativa Japonica Group]
Length=839

 Score =   107 bits (266),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 52/100 (52%), Positives = 64/100 (64%), Gaps = 2/100 (2%)
 Frame = +3

Query  117  QSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRL  296
            ++QT PV+ACD   N  +    FC++      R ADL+ RLTL EK+  LVN      RL
Sbjct  25   RAQT-PVFACDA-SNATVSGYGFCDRTKSSAARAADLLGRLTLAEKVGFLVNKQAALPRL  82

Query  297  GIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            GIP YEWW EALHG+ Y GPG  F+ +VP ATSFP P+LT
Sbjct  83   GIPAYEWWSEALHGVSYVGPGTRFSTLVPGATSFPQPILT  122



>ref|NP_001054038.1| Os04g0640700 [Oryza sativa Japonica Group]
 emb|CAE02971.2| OSJNBb0079B02.3 [Oryza sativa Japonica Group]
 dbj|BAF15952.1| Os04g0640700 [Oryza sativa Japonica Group]
 emb|CAH67823.1| OSIGBa0138H21-OSIGBa0138E01.14 [Oryza sativa Indica Group]
 gb|EEC78109.1| hypothetical protein OsI_17615 [Oryza sativa Indica Group]
Length=765

 Score =   107 bits (266),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 64/101 (63%), Gaps = 2/101 (2%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
             ++QT PV+ACD   N  +    FC++      R ADL+ RLTL EK+  LVN      R
Sbjct  24   ARAQT-PVFACD-ASNATVSGYGFCDRTKSSAARAADLLGRLTLAEKVGFLVNKQAALPR  81

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+ Y GPG  F+ +VP ATSFP P+LT
Sbjct  82   LGIPAYEWWSEALHGVSYVGPGTRFSTLVPGATSFPQPILT  122



>emb|CBI19138.3| unnamed protein product [Vitis vinifera]
Length=1411

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 67/105 (64%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  IIGPVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAG  281
            I+  V+S   P ++CD+  NP  KS  FC   L +  RV DLV RLTL EKI+ LVN+A 
Sbjct  17   ILVGVESTQSPPFSCDS-SNPSTKSYHFCKTTLPIPDRVRDLVSRLTLDEKISQLVNSAP  75

Query  282  NESRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
               RLGIP YEWW EALHG+   GPG+ F G +  ATSFP  +LT
Sbjct  76   AIPRLGIPAYEWWSEALHGVADAGPGIRFNGTIRSATSFPQVILT  120


 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 64/100 (64%), Gaps = 2/100 (2%)
 Frame = +3

Query  117  QSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRL  296
            Q  + P +ACD+  +P  KS  FCN  L +  R +DL+ RLTL EKI+ L+++A +  RL
Sbjct  691  QLSSSPPFACDS-SDPLTKSYAFCNTTLRISQRASDLISRLTLDEKISQLISSAASIPRL  749

Query  297  GIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            GIP YEWW EALHG+     G+ F G +  ATSFP  +LT
Sbjct  750  GIPAYEWWSEALHGIR-DRHGIRFNGTIRSATSFPQVILT  788



>ref|XP_002302285.1| glycosyl hydrolase family 3 family protein [Populus trichocarpa]
 gb|EEE81558.1| glycosyl hydrolase family 3 family protein [Populus trichocarpa]
Length=773

 Score =   106 bits (265),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 51/97 (53%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = +3

Query  126  TGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIP  305
            T P ++CD+  NP  K+ PFC   L +  R  DLV RLTL EKI+ LVN+A    RLGIP
Sbjct  24   TQPPFSCDS-SNPSTKAFPFCETTLPISQRARDLVSRLTLDEKISQLVNSAPPIPRLGIP  82

Query  306  TYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
             YEWW EALHG+   GPG++F   +  ATSFP  +LT
Sbjct  83   GYEWWSEALHGVSNAGPGIHFNDNIKGATSFPQVILT  119



>ref|XP_010269208.1| PREDICTED: probable beta-D-xylosidase 7 [Nelumbo nucifera]
Length=823

 Score =   106 bits (265),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 52/97 (54%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = +3

Query  126  TGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIP  305
            T P +ACD+ KNP   S  FCN  L +  RV DLV RLTL EKI+ LVN A    RLGIP
Sbjct  67   TQPPFACDS-KNPATASYTFCNPSLPIPQRVKDLVSRLTLDEKISQLVNNAPAIPRLGIP  125

Query  306  TYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            +YEWW EALHG+   G G+   G++  ATSFP  +L+
Sbjct  126  SYEWWSEALHGVTSAGRGIQLNGIIKGATSFPQVILS  162



>gb|AAF17692.1|AC009243_19 F28K19.27 [Arabidopsis thaliana]
Length=696

 Score =   105 bits (263),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 51/95 (54%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P ++CD   NP  K   FC   L +  R  DLV RLT+ EKI+ LVNTA    RLG+P Y
Sbjct  22   PPHSCDP-SNPTTKLYQFCRTDLPIGKRARDLVSRLTIDEKISQLVNTAPGIPRLGVPAY  80

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EWW EALHG+ Y GPG+ F G V  ATSFP  +LT
Sbjct  81   EWWSEALHGVAYAGPGIRFNGTVKAATSFPQVILT  115



>ref|NP_177929.1| putative beta-D-xylosidase 7 [Arabidopsis thaliana]
 sp|Q9SGZ5.2|BXL7_ARATH RecName: Full=Probable beta-D-xylosidase 7; Short=AtBXL7; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL57631.1| At1g78060/F28K19_32 [Arabidopsis thaliana]
 gb|AEE36063.1| putative beta-D-xylosidase 7 [Arabidopsis thaliana]
Length=767

 Score =   105 bits (263),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 51/95 (54%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P ++CD   NP  K   FC   L +  R  DLV RLT+ EKI+ LVNTA    RLG+P Y
Sbjct  22   PPHSCDP-SNPTTKLYQFCRTDLPIGKRARDLVSRLTIDEKISQLVNTAPGIPRLGVPAY  80

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EWW EALHG+ Y GPG+ F G V  ATSFP  +LT
Sbjct  81   EWWSEALHGVAYAGPGIRFNGTVKAATSFPQVILT  115



>gb|KHN30647.1| Putative beta-D-xylosidase 2 [Glycine soja]
Length=582

 Score =   105 bits (261),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 51/93 (55%), Positives = 57/93 (61%), Gaps = 1/93 (1%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            +ACD  KN   K+LPFC   L    RV DL+ RLTL EK+ LLVN A    RLGI  YEW
Sbjct  27   FACDP-KNTATKNLPFCKAWLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEW  85

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+   GPG  F G  P ATSFP  + T
Sbjct  86   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITT  118



>ref|XP_004976989.1| PREDICTED: beta-D-xylosidase 4-like isoform X2 [Setaria italica]
Length=770

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            PV+ACD   N  L +  FCN+      R ADLV RL L EK+  LV+      RLGIP Y
Sbjct  33   PVFACDA-SNATLAAYGFCNRSATPAARAADLVSRLKLAEKVGFLVDKQAALPRLGIPAY  91

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EWW EALHG+ Y GPG  F+ +VP ATSFP P+LT
Sbjct  92   EWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILT  126



>ref|XP_002448619.1| hypothetical protein SORBIDRAFT_06g030270 [Sorghum bicolor]
 gb|EES12947.1| hypothetical protein SORBIDRAFT_06g030270 [Sorghum bicolor]
Length=767

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 65/101 (64%), Gaps = 2/101 (2%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
             ++QT PV+ACD   N  L S  FCN+      R ADLV RLTL EK+  LV+      R
Sbjct  27   ARAQT-PVFACD-ASNATLASYGFCNRSASASARAADLVSRLTLAEKVGFLVDKQAALPR  84

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW EALHG+ Y GPG  F+ +VP ATSFP P+LT
Sbjct  85   LGIPLYEWWSEALHGVSYVGPGTRFSSLVPAATSFPQPILT  125



>gb|EYU44008.1| hypothetical protein MIMGU_mgv1a0207571mg, partial [Erythranthe 
guttata]
Length=203

 Score =   100 bits (250),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 59/93 (63%), Gaps = 1/93 (1%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            +ACD   N   K++PFC   L ++ RV DL+ RLTL EKI  LVN A    RLGI  YEW
Sbjct  33   FACDP-SNSVSKNMPFCRVSLHIRDRVGDLIGRLTLQEKIRSLVNNAAPVDRLGIKGYEW  91

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+  TGPGV F G  P ATSFP  + T
Sbjct  92   WSEALHGVSNTGPGVKFGGEFPGATSFPQVITT  124



>ref|XP_006301942.1| hypothetical protein CARUB_v10022420mg [Capsella rubella]
 gb|EOA34840.1| hypothetical protein CARUB_v10022420mg [Capsella rubella]
Length=767

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P +ACD   NP  K   FC   L +  R  DLV RLT+ EKI+ LVNTA    RLG+P Y
Sbjct  22   PPHACDP-SNPATKLYQFCRTDLQISNRAHDLVSRLTVDEKISQLVNTAPGIPRLGVPAY  80

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EWW EALHG+ YTGPG  F G V  ATSFP  +LT
Sbjct  81   EWWSEALHGIAYTGPGTWFNGTVKAATSFPQVILT  115



>ref|XP_004500608.1| PREDICTED: probable beta-D-xylosidase 7-like [Cicer arietinum]
Length=1028

 Score =   105 bits (263),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 53/105 (50%), Positives = 64/105 (61%), Gaps = 1/105 (1%)
 Frame = +3

Query  102  IIGPVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAG  281
            +I    S   P +ACD   NP  +S PFCN +L +  R  DLV RLTL EK+  LVN+A 
Sbjct  21   LIAHSSSSPLPPFACDW-SNPSTRSYPFCNPKLPITQRTKDLVSRLTLNEKLAQLVNSAP  79

Query  282  NESRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
               RLGIP YEWW EALHG+   G G+ F G +  ATSFP  +LT
Sbjct  80   PIPRLGIPAYEWWSEALHGVGNVGRGIFFNGTISSATSFPQVILT  124



>ref|NP_001266114.1| SlArf/Xyl4 protein precursor [Solanum lycopersicum]
 dbj|BAL44719.1| SlArf/Xyl4 [Solanum lycopersicum]
Length=775

 Score =   105 bits (262),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 55/105 (52%), Positives = 68/105 (65%), Gaps = 2/105 (2%)
 Frame = +3

Query  102  IIGPVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAG  281
            ++  VQS T P ++CD+  NP  KSL FC   L +  RV DLV RLTL EKI+ LVN+A 
Sbjct  18   LVSIVQS-TQPPFSCDS-SNPQTKSLKFCQTGLPISVRVLDLVSRLTLDEKISQLVNSAP  75

Query  282  NESRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
               RLGIP YEWW E+LHG+   G G+ F G +  ATSFP  +LT
Sbjct  76   AIPRLGIPAYEWWSESLHGVGSAGKGIFFNGSIAGATSFPQVILT  120



>gb|KEH28065.1| glycoside hydrolase family 3 amino-terminal domain protein [Medicago 
truncatula]
Length=601

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 62/95 (65%), Gaps = 1/95 (1%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P Y+CDT  NP  K  PFCN  L +  R  D+V RLTL EK++ LVNTA    RL IP+Y
Sbjct  34   PPYSCDT-SNPRTKLFPFCNLNLTITQRAKDIVSRLTLDEKVSQLVNTAPAIPRLDIPSY  92

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            +WW EALHG+ Y G G+   G +P ATSFP  +LT
Sbjct  93   QWWNEALHGVSYVGMGIILNGSIPAATSFPQVILT  127



>ref|XP_002980053.1| hypothetical protein SELMODRAFT_112087 [Selaginella moellendorffii]
 gb|EFJ18923.1| hypothetical protein SELMODRAFT_112087 [Selaginella moellendorffii]
Length=772

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 61/93 (66%), Gaps = 2/93 (2%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            YACD   N  L + PFCN  L +  RV D V RLTL EKI+ L+NTA    RLG+P Y+W
Sbjct  30   YACDQ-SNATLAAFPFCNTSLAITDRVEDYVARLTLEEKISQLINTATGIPRLGVPKYQW  88

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+  + PGV F G VP ATSFP P+ T
Sbjct  89   WQEALHGVA-SSPGVQFGGSVPAATSFPMPITT  120



>gb|KFK42187.1| hypothetical protein AALP_AA2G222800 [Arabis alpina]
Length=777

 Score =   105 bits (261),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 51/97 (53%), Positives = 61/97 (63%), Gaps = 1/97 (1%)
 Frame = +3

Query  126  TGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIP  305
            + P +ACD+  NP  K   FC   + +  R  DLV RLT+ EKI+ LVNTA    RLGIP
Sbjct  21   SAPPHACDS-SNPTTKLFLFCRTDISINRRAKDLVSRLTVDEKISQLVNTAPGIPRLGIP  79

Query  306  TYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
             YEWW EALHG+   GPG+ F G V  ATSFP  +LT
Sbjct  80   AYEWWSEALHGVAGVGPGIRFNGTVHAATSFPQVILT  116



>gb|KJB59941.1| hypothetical protein B456_009G282000 [Gossypium raimondii]
Length=590

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +3

Query  126  TGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIP  305
            T P +ACD+  NP  K+  FC   L +  R  DLV RLTL EKI+ LVN+A    RLGIP
Sbjct  21   TQPPFACDS-SNPETKNYLFCQTELPITQRARDLVSRLTLDEKISQLVNSAPAIPRLGIP  79

Query  306  TYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
             YEWW EALHG+   GPGV F G +  ATSFP  +LT
Sbjct  80   AYEWWSEALHGVSNVGPGVKFDGTIKAATSFPQVILT  116



>ref|XP_011016184.1| PREDICTED: probable beta-D-xylosidase 7 [Populus euphratica]
Length=805

 Score =   105 bits (261),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 50/97 (52%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = +3

Query  126  TGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIP  305
            T P ++CD+  NP  ++ PFC   L +  R  DLV RLTL EKI+ LVN+A    RLGIP
Sbjct  56   TPPPFSCDS-SNPSTEAFPFCETTLPISQRARDLVSRLTLDEKISQLVNSAPPIPRLGIP  114

Query  306  TYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
             YEWW EALHG+   GPG++F   +  ATSFP  +LT
Sbjct  115  GYEWWSEALHGVSNAGPGIHFNDNIKGATSFPQVILT  151



>ref|XP_010472005.1| PREDICTED: probable beta-D-xylosidase 7 [Camelina sativa]
Length=764

 Score =   104 bits (260),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 53/95 (56%), Positives = 59/95 (62%), Gaps = 1/95 (1%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P +ACD   NP  K   FC   L V  R  DLV RLT+ EKI+ LVNTA    RLGIP Y
Sbjct  21   PPHACDP-SNPATKLYQFCRTDLPVNKRARDLVSRLTVDEKISQLVNTAPGIPRLGIPAY  79

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EWW EALHG+   GPG+ F G V  ATSFP  +LT
Sbjct  80   EWWSEALHGVAGVGPGIRFNGTVKAATSFPQVILT  114



>gb|AES97964.2| glycoside hydrolase family 3 amino-terminal domain protein [Medicago 
truncatula]
Length=791

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 62/95 (65%), Gaps = 1/95 (1%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P Y+CDT  NP  K  PFCN  L +  R  D+V RLTL EK++ LVNTA    RL IP+Y
Sbjct  34   PPYSCDT-SNPRTKLFPFCNLNLTITQRAKDIVSRLTLDEKVSQLVNTAPAIPRLDIPSY  92

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            +WW EALHG+ Y G G+   G +P ATSFP  +LT
Sbjct  93   QWWNEALHGVSYVGMGIILNGSIPAATSFPQVILT  127



>ref|XP_006354009.1| PREDICTED: probable beta-D-xylosidase 7-like [Solanum tuberosum]
Length=775

 Score =   104 bits (260),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 52/101 (51%), Positives = 64/101 (63%), Gaps = 1/101 (1%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            +   T P ++CD+  NP  KSL FC   L +  RV DLV RLTL EKI+ LVN+A    R
Sbjct  21   IVESTQPPFSCDS-SNPQTKSLKFCQTGLPISVRVQDLVSRLTLDEKISQLVNSAPAIPR  79

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP YEWW E+LHG+   G G+ F G +  ATSFP  +LT
Sbjct  80   LGIPAYEWWSESLHGVGSAGKGIFFNGSIAGATSFPQVILT  120



>gb|EYU46800.1| hypothetical protein MIMGU_mgv1a018473mg [Erythranthe guttata]
Length=757

 Score =   104 bits (259),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 51/89 (57%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            +ACD  KNP  K+LPFC   L  + RV DL++RLTL EK+ LLVN A    RLGI  YEW
Sbjct  29   FACDP-KNPATKTLPFCRTNLRTEDRVRDLIRRLTLQEKVKLLVNNAAAVPRLGIVEYEW  87

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPH  404
            W EALHG+   GPG  F G  P ATSFP 
Sbjct  88   WSEALHGVSNVGPGTKFGGEFPGATSFPQ  116



>gb|EYU18509.1| hypothetical protein MIMGU_mgv1a001665mg [Erythranthe guttata]
Length=777

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 68/106 (64%), Gaps = 2/106 (2%)
 Frame = +3

Query  105  IGPVQSQTGPV-YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAG  281
            I PV S   P  +ACD  KNP L+S  FCN  LD++TRVADLV +LTL EKI  +++ + 
Sbjct  27   ITPVFSAGKPGPFACDVSKNPDLESFTFCNPSLDIETRVADLVNKLTLKEKIGWVISGSE  86

Query  282  NESRLGIPTYEWWPEALHGLPYTGPGVNFT-GVVPPATSFPHPLLT  416
              SRLGIP Y WW EALHG+   GPG  F    V  ATSFP  +LT
Sbjct  87   GVSRLGIPGYWWWSEALHGIGSNGPGSKFEPDNVRAATSFPQVILT  132



>ref|XP_006390030.1| hypothetical protein EUTSA_v10018160mg [Eutrema salsugineum]
 gb|ESQ27316.1| hypothetical protein EUTSA_v10018160mg [Eutrema salsugineum]
Length=771

 Score =   104 bits (259),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 50/95 (53%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P +ACD+  NP  K   FC   L +  R  DLV RLT+ EKI+ LVN+A    RLG+P Y
Sbjct  26   PPHACDS-SNPSTKLFQFCRTDLPISRRARDLVSRLTISEKISQLVNSAPGIPRLGVPAY  84

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EWW EALHG+   GPG+ F G V  ATSFP  +LT
Sbjct  85   EWWSEALHGVAGAGPGIRFNGTVKAATSFPQVILT  119



>ref|XP_002987446.1| hypothetical protein SELMODRAFT_426206 [Selaginella moellendorffii]
 gb|EFJ11533.1| hypothetical protein SELMODRAFT_426206 [Selaginella moellendorffii]
Length=772

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 61/93 (66%), Gaps = 2/93 (2%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            YACD   N  L + PFCN  L +  RV D V RLTL EKI+ L+NTA    RLG+P Y+W
Sbjct  30   YACDQ-SNATLAAFPFCNTSLPITDRVEDYVARLTLEEKISQLINTATGIPRLGVPKYQW  88

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+  + PGV F G VP ATSFP P+ T
Sbjct  89   WQEALHGVA-SSPGVQFGGSVPAATSFPMPITT  120



>ref|XP_010676938.1| PREDICTED: probable beta-D-xylosidase 7 [Beta vulgaris subsp. 
vulgaris]
Length=778

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = +3

Query  126  TGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIP  305
            T P +ACD+  NP  K   FC   L ++ R  DL+ RLTL EK++ LVNTA +  RLGIP
Sbjct  27   TEPPFACDS-SNPNTKHYTFCRADLPIRKRAKDLIARLTLDEKVSQLVNTAPSIPRLGIP  85

Query  306  TYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
             YEWW EALHG+   GPGV+  G +  ATSFP  +LT
Sbjct  86   AYEWWSEALHGVADAGPGVSLYGTIRAATSFPQVILT  122



>gb|AFW59619.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=451

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 64/101 (63%), Gaps = 2/101 (2%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
             ++QT P +ACD   N  L S  FCN+      R ADLV RLTL EK+  LV+      R
Sbjct  33   ARAQT-PAFACD-ASNATLASYGFCNRSAAAAARAADLVSRLTLAEKVGFLVDKQAALPR  90

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LG+P YEWW EALHG+ Y GPG  F+ +VP ATSFP P+LT
Sbjct  91   LGVPLYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILT  131



>ref|XP_003625957.1| Beta-xylosidase [Medicago truncatula]
 gb|AES82175.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Medicago truncatula]
Length=771

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 62/93 (67%), Gaps = 1/93 (1%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            +ACD  K+   K+LPFCN +L +  RV DL+ RLT+ EK+ LLVN A    R+G+ +YEW
Sbjct  28   FACDA-KDAATKNLPFCNVKLAIPERVKDLIGRLTMQEKVNLLVNNAPAVPRVGMKSYEW  86

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+   GPG  F GV P ATSFP  + T
Sbjct  87   WSEALHGVSNVGPGTRFGGVFPAATSFPQVITT  119



>gb|KDP28242.1| hypothetical protein JCGZ_14013 [Jatropha curcas]
Length=772

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 61/93 (66%), Gaps = 1/93 (1%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            +ACD  K    ++LPFC  +L ++ RV DL+ RLTL EK+ LLVN A + SRLGI  YEW
Sbjct  30   FACDP-KEETTRNLPFCQVKLPIQDRVKDLIGRLTLQEKVVLLVNNAASVSRLGIKGYEW  88

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+   GPG  F G  P ATSFP  + T
Sbjct  89   WSEALHGVSNVGPGTKFGGAFPGATSFPQVITT  121



>gb|KJB59940.1| hypothetical protein B456_009G282000 [Gossypium raimondii]
Length=769

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +3

Query  126  TGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIP  305
            T P +ACD+  NP  K+  FC   L +  R  DLV RLTL EKI+ LVN+A    RLGIP
Sbjct  21   TQPPFACDS-SNPETKNYLFCQTELPITQRARDLVSRLTLDEKISQLVNSAPAIPRLGIP  79

Query  306  TYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
             YEWW EALHG+   GPGV F G +  ATSFP  +LT
Sbjct  80   AYEWWSEALHGVSNVGPGVKFDGTIKAATSFPQVILT  116



>gb|KHG13360.1| putative beta-D-xylosidase 7 -like protein [Gossypium arboreum]
Length=769

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +3

Query  126  TGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIP  305
            T P +ACD+  NP  K+  FC   L +  R  DLV RLTL EKI+ LVN+A    RLGIP
Sbjct  21   TQPPFACDS-SNPETKNYLFCQTELPITQRARDLVSRLTLDEKISQLVNSAPAIPRLGIP  79

Query  306  TYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
             YEWW EALHG+   GPGV F G +  ATSFP  +LT
Sbjct  80   AYEWWSEALHGVSNVGPGVRFDGTIKAATSFPQVILT  116



>ref|XP_008234021.1| PREDICTED: probable beta-D-xylosidase 7 [Prunus mume]
Length=781

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = +3

Query  126  TGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIP  305
            T P YACD+ + P   S PFC   L +  RV DLV RLTL EKI+ LVN+A    RLGIP
Sbjct  29   TQPPYACDSSQ-PSTSSYPFCKTALPINQRVQDLVSRLTLDEKISQLVNSAPPIPRLGIP  87

Query  306  TYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            +YEWW EALHG+   G G+N  G +  ATSFP  +LT
Sbjct  88   SYEWWSEALHGVADVGKGINLYGTISNATSFPQVILT  124



>ref|XP_004976988.1| PREDICTED: beta-D-xylosidase 4-like isoform X1 [Setaria italica]
Length=833

 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            PV+ACD   N  L +  FCN+      R ADLV RL L EK+  LV+      RLGIP Y
Sbjct  33   PVFACDA-SNATLAAYGFCNRSATPAARAADLVSRLKLAEKVGFLVDKQAALPRLGIPAY  91

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EWW EALHG+ Y GPG  F+ +VP ATSFP P+LT
Sbjct  92   EWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILT  126



>ref|XP_010416771.1| PREDICTED: probable beta-D-xylosidase 7 [Camelina sativa]
Length=765

 Score =   103 bits (258),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 52/95 (55%), Positives = 59/95 (62%), Gaps = 1/95 (1%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P +ACD   NP  K   FC   L V  R  DLV RLT+ EKI+ LVNTA    RLG+P Y
Sbjct  21   PPHACDP-SNPSTKLYQFCRTDLPVNKRARDLVSRLTVDEKISQLVNTAPGIPRLGVPAY  79

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EWW EALHG+   GPG+ F G V  ATSFP  +LT
Sbjct  80   EWWSEALHGVAGVGPGIRFNGTVKAATSFPQVILT  114



>ref|XP_011074159.1| PREDICTED: probable beta-D-xylosidase 7 [Sesamum indicum]
Length=792

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 61/101 (60%), Gaps = 1/101 (1%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
             +S   P ++CD   NP  KSLPFCN +L + +R  DLV RLTL EK+  LVNTA    R
Sbjct  37   AESDHSPPFSCDP-SNPSTKSLPFCNTQLPISSRAKDLVSRLTLDEKVQQLVNTADAVPR  95

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            L I  YEWW EALHG+   G GV F G V  AT FP  +L 
Sbjct  96   LNISAYEWWSEALHGVSRHGKGVTFNGTVTAATMFPQVILA  136



>ref|XP_004513829.1| PREDICTED: probable beta-D-xylosidase 7-like [Cicer arietinum]
Length=781

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 65/101 (64%), Gaps = 1/101 (1%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
             +S T P Y+CD + NP  KS  FCN +L +  R  D+V RLTL EK+  LVNTA +  R
Sbjct  25   AESPTQPPYSCD-ISNPLTKSYAFCNLKLPIIERAKDIVSRLTLDEKLAQLVNTAPSIPR  83

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGIP+Y+WW EALHG+   G G+   G +  ATSFP  +LT
Sbjct  84   LGIPSYQWWSEALHGVANAGKGIRLNGTIKAATSFPQVILT  124



>ref|XP_006826952.1| hypothetical protein AMTR_s00010p00188970 [Amborella trichopoda]
 gb|ERM94189.1| hypothetical protein AMTR_s00010p00188970 [Amborella trichopoda]
Length=778

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 61/95 (64%), Gaps = 1/95 (1%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P +ACD   NP   S  FC   L +  RV DL+  LTL EK++ LVNTA   SRLGIP+Y
Sbjct  27   PPFACDQ-SNPSTSSFKFCTTSLSINERVWDLISHLTLEEKVSQLVNTAPAISRLGIPSY  85

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            +WW E+LHG+   GPG+ F G +  ATSFP  +LT
Sbjct  86   QWWSESLHGVSNIGPGIRFNGTIRSATSFPQVILT  120



>ref|XP_002987447.1| hypothetical protein SELMODRAFT_426207 [Selaginella moellendorffii]
 gb|EFJ11534.1| hypothetical protein SELMODRAFT_426207 [Selaginella moellendorffii]
Length=779

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 60/93 (65%), Gaps = 2/93 (2%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            YACD  +N  L    FCN RL   TRV DL+ R+TL EKI  LVN A    RLG+P YEW
Sbjct  32   YACDQ-RNATLLQFGFCNTRLPTSTRVEDLISRMTLQEKIIQLVNNAAGIPRLGLPRYEW  90

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+  + PGV F G  P ATSFP P+LT
Sbjct  91   WQEALHGVAVS-PGVKFGGKFPGATSFPMPILT  122



>ref|XP_002980054.1| hypothetical protein SELMODRAFT_419541 [Selaginella moellendorffii]
 gb|EFJ18924.1| hypothetical protein SELMODRAFT_419541 [Selaginella moellendorffii]
Length=779

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 60/93 (65%), Gaps = 2/93 (2%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            YACD  +N  L    FCN RL   TRV DL+ R+TL EKI  LVN A    RLG+P YEW
Sbjct  32   YACDQ-RNATLLQFGFCNTRLPTSTRVEDLISRMTLQEKIIQLVNNAAGIPRLGLPRYEW  90

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+  + PGV F G  P ATSFP P+LT
Sbjct  91   WQEALHGVAVS-PGVKFGGKFPGATSFPMPILT  122



>ref|XP_010457247.1| PREDICTED: probable beta-D-xylosidase 2 [Camelina sativa]
Length=769

 Score =   103 bits (257),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 50/93 (54%), Positives = 61/93 (66%), Gaps = 1/93 (1%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            +ACDT K+    +L FC   + ++ RV DL+ RLTLPEK++LL NTA    RLGI  YEW
Sbjct  31   FACDT-KDAATATLRFCQLSVPIQERVKDLIGRLTLPEKVSLLGNTAAAIPRLGIKGYEW  89

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+   GPG  F GV P ATSFP  + T
Sbjct  90   WSEALHGVSNVGPGTKFGGVYPAATSFPQVITT  122



>ref|XP_002885319.1| beta-1,4-xylosidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61578.1| beta-1,4-xylosidase [Arabidopsis lyrata subsp. lyrata]
Length=865

 Score =   103 bits (257),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 50/93 (54%), Positives = 58/93 (62%), Gaps = 1/93 (1%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            +ACD   +P      FCN  L  + R  DLV RL+L EK+  LVN A   SRLG+P YEW
Sbjct  27   FACDR-NDPATAKYGFCNVSLSYEARAKDLVSRLSLKEKVQQLVNKATGVSRLGVPPYEW  85

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+   GPGV F G VP ATSFP  +LT
Sbjct  86   WSEALHGVSDVGPGVRFNGTVPGATSFPATILT  118



>ref|XP_010113184.1| putative beta-D-xylosidase 5 [Morus notabilis]
 gb|EXC72717.1| putative beta-D-xylosidase 5 [Morus notabilis]
Length=293

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            +ACD    P     PFC+  L    R  D++ RLTL EK+  LV+ +   SRLG+P+YEW
Sbjct  28   HACDVTSFPQASQFPFCDTSLSYDIRAKDIISRLTLQEKVQQLVSGSAGISRLGVPSYEW  87

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+   GPG  F   VP ATSFP  +L+
Sbjct  88   WSEALHGVSNVGPGTTFNATVPGATSFPAVILS  120



>ref|XP_007136230.1| hypothetical protein PHAVU_009G029300g [Phaseolus vulgaris]
 gb|ESW08224.1| hypothetical protein PHAVU_009G029300g [Phaseolus vulgaris]
Length=773

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = +3

Query  126  TGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIP  305
            + P +ACD   NP  KS PFCN +L +  R  DL+ RLTL EK++ LVNTA +  RLGIP
Sbjct  21   SNPPFACDW-SNPSSKSYPFCNPKLPIPQRTKDLLSRLTLQEKLSQLVNTAPSIPRLGIP  79

Query  306  TYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
             Y+WW EALHG+   GPG+ F   +  ATSFP  +L+
Sbjct  80   AYQWWSEALHGVGSVGPGIRFNASISSATSFPQVILS  116



>gb|KDP44489.1| hypothetical protein JCGZ_16322 [Jatropha curcas]
Length=796

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 58/93 (62%), Gaps = 1/93 (1%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            YACD  KNP      FCN  L  + R  DL+ RLTL EK+  LVN A   SRLGIP YEW
Sbjct  27   YACDQ-KNPETSQYAFCNTTLPYQDRAKDLISRLTLQEKVQQLVNHAAGISRLGIPAYEW  85

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+   G GV+F   VP ATSFP  +L+
Sbjct  86   WSEALHGVSNVGYGVHFNETVPGATSFPAVILS  118



>gb|KCW68842.1| hypothetical protein EUGRSUZ_F02442 [Eucalyptus grandis]
Length=729

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 63/102 (62%), Gaps = 1/102 (1%)
 Frame = +3

Query  111  PVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNES  290
            P  S   P ++CD    P   S PFCN  L +  R  DLV RLTL EKI+ LV++A    
Sbjct  25   PATSAQPPPFSCDP-SGPSTTSFPFCNASLPISQRAQDLVYRLTLDEKISQLVSSAPTIP  83

Query  291  RLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            RLGIP YEWW E+LHG+  +GPG+ F G +  ATSFP  +LT
Sbjct  84   RLGIPAYEWWSESLHGVSESGPGIRFNGTIRSATSFPQVILT  125



>ref|XP_009596711.1| PREDICTED: probable beta-D-xylosidase 7, partial [Nicotiana tomentosiformis]
Length=131

 Score = 96.3 bits (238),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 59/97 (61%), Gaps = 1/97 (1%)
 Frame = +3

Query  126  TGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIP  305
            T P ++CD   NP  ++  FCN  L +  RV DL+ RL L EKI+ L NTA    RL I 
Sbjct  22   TRPPFSCD-ASNPVTRTFTFCNISLPISQRVEDLISRLNLDEKISQLGNTAPAIPRLNIS  80

Query  306  TYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
             YEWW E+LHGL Y G G++F G +  AT FP  +LT
Sbjct  81   AYEWWSESLHGLTYAGEGMSFNGSIRTATQFPQIILT  117



>gb|EYU23224.1| hypothetical protein MIMGU_mgv1a001695mg [Erythranthe guttata]
Length=772

 Score =   102 bits (255),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 52/101 (51%), Positives = 62/101 (61%), Gaps = 3/101 (3%)
 Frame = +3

Query  123  QTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGI  302
            Q  P ++CD++ NP  KS PFCN  L +  R  DLV RLTL EKI+ LVN A    RLGI
Sbjct  27   QPLPPFSCDSITNPSTKSYPFCNVDLPIGKRAHDLVSRLTLNEKISQLVNKASAIPRLGI  86

Query  303  PTYEWWPEALHGLPYT---GPGVNFTGVVPPATSFPHPLLT  416
            P Y+WW EALHG+  T     G  F G +  ATSFP  +LT
Sbjct  87   PYYQWWSEALHGVAGTLGVDTGFFFNGTIRAATSFPQVILT  127



>ref|XP_006287090.1| hypothetical protein CARUB_v10000252mg, partial [Capsella rubella]
 gb|EOA19988.1| hypothetical protein CARUB_v10000252mg, partial [Capsella rubella]
Length=803

 Score =   102 bits (255),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 50/95 (53%), Positives = 59/95 (62%), Gaps = 3/95 (3%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P + C   K P   S PFCN  L VK R   LV  LTLPEKI  L NTA +  RLGIP Y
Sbjct  36   PQFPC---KPPHFSSYPFCNVSLSVKQRAISLVSLLTLPEKIGQLSNTAASVPRLGIPPY  92

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EWW E+LHG+   GPGV+F G +  ATSFP  +++
Sbjct  93   EWWSESLHGIADNGPGVSFNGSISSATSFPQVIVS  127



>ref|XP_010064766.1| PREDICTED: probable beta-D-xylosidase 7 [Eucalyptus grandis]
Length=781

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 63/102 (62%), Gaps = 1/102 (1%)
 Frame = +3

Query  111  PVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNES  290
            P  S   P ++CD    P   S PFCN  L +  R  DLV RLTL EKI+ LV++A    
Sbjct  25   PATSAQPPPFSCDP-SGPSTTSFPFCNASLPISQRAQDLVYRLTLDEKISQLVSSAPTIP  83

Query  291  RLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            RLGIP YEWW E+LHG+  +GPG+ F G +  ATSFP  +LT
Sbjct  84   RLGIPAYEWWSESLHGVSESGPGIRFNGTIRSATSFPQVILT  125



>ref|XP_003519750.1| PREDICTED: probable beta-D-xylosidase 2-like [Glycine max]
Length=772

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 57/93 (61%), Gaps = 1/93 (1%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            +ACD  KN   K+LPFC   L    RV DL+ RLTL EK+ LLVN A    RLGI  YEW
Sbjct  28   FACDP-KNTATKNLPFCKASLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEW  86

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+   GPG  F G  P ATSFP  + T
Sbjct  87   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITT  119



>ref|NP_001266104.1| SlArf/Xyl1 protein precursor [Solanum lycopersicum]
 dbj|BAL44716.1| SlArf/Xyl1 [Solanum lycopersicum]
Length=771

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 59/93 (63%), Gaps = 1/93 (1%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            +ACD   N G+++L FC   L +  RV DL+ RLTL EKI LLVN A    RLGI  YEW
Sbjct  25   FACDPA-NAGIRNLRFCKTSLPIHVRVQDLIARLTLQEKIRLLVNNAAPVQRLGISGYEW  83

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+  TG GV F G  P ATSFP  + T
Sbjct  84   WSEALHGVSNTGYGVKFGGAFPGATSFPQVITT  116



>ref|XP_004170761.1| PREDICTED: beta-D-xylosidase 1-like [Cucumis sativus]
Length=241

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 58/91 (64%), Gaps = 1/91 (1%)
 Frame = +3

Query  144  CDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEWWP  323
            CD  +N G +++ FC + L ++ RV DL+ RLTL EKI LLVN A    RLGI  YEWW 
Sbjct  34   CDK-RNVGTRNMGFCQESLGIEERVKDLIGRLTLGEKIRLLVNNAIAVPRLGIRGYEWWS  92

Query  324  EALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EALHG+   GPG  F G  P ATSFP  + T
Sbjct  93   EALHGVSNVGPGTKFGGTFPGATSFPQVITT  123



>ref|XP_007018823.1| Glycosyl hydrolase family protein isoform 1 [Theobroma cacao]
 gb|EOY16048.1| Glycosyl hydrolase family protein isoform 1 [Theobroma cacao]
Length=1593

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +3

Query  126  TGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIP  305
            T P ++CD   +P  K+ PFC   L +  R  DLV RLTL EKI+ LVN+A    RLGIP
Sbjct  24   TQPPFSCDP-SDPSTKNYPFCQTTLPISQRARDLVSRLTLDEKISQLVNSAPAIPRLGIP  82

Query  306  TYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
             YEWW EALHG+   GPG+ F G +  ATSFP  +LT
Sbjct  83   AYEWWSEALHGVANVGPGIKFDGSIKAATSFPQVILT  119


 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 62/100 (62%), Gaps = 4/100 (4%)
 Frame = +3

Query  126  TGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIP  305
            T P ++CDT  +P  KS PFC   L +  RV DL+ RLTL EKI+ LVN+A    RLGIP
Sbjct  841  TQPPFSCDT-SDPRTKSYPFCKTTLPINQRVQDLISRLTLDEKISQLVNSAPPIPRLGIP  899

Query  306  TYEWWPEALHGLPY---TGPGVNFTGVVPPATSFPHPLLT  416
              EWW EALHG+ +      G+ F G +  ATSFP  +LT
Sbjct  900  GDEWWSEALHGVAFLASVSQGIRFNGTIQSATSFPQVILT  939



>ref|XP_006300771.1| hypothetical protein CARUB_v10019845mg [Capsella rubella]
 gb|EOA33669.1| hypothetical protein CARUB_v10019845mg [Capsella rubella]
Length=768

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P +ACD   NP  K   FC   L ++ R  DLV RLT+ EKI+ LVNTA    RLG+P Y
Sbjct  23   PPHACDP-SNPTTKLYQFCRTDLRIRNRAHDLVSRLTIDEKISQLVNTAPGIPRLGVPAY  81

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EWW EALHG+   GPG+ F G V  ATSFP  +LT
Sbjct  82   EWWSEALHGVANVGPGIRFNGTVRAATSFPQVILT  116



>ref|XP_007018825.1| Glycosyl hydrolase family protein isoform 3 [Theobroma cacao]
 gb|EOY16050.1| Glycosyl hydrolase family protein isoform 3 [Theobroma cacao]
Length=1593

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +3

Query  126  TGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIP  305
            T P ++CD   +P  K+ PFC   L +  R  DLV RLTL EKI+ LVN+A    RLGIP
Sbjct  24   TQPPFSCDP-SDPSTKNYPFCQTTLPISQRARDLVSRLTLDEKISQLVNSAPAIPRLGIP  82

Query  306  TYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
             YEWW EALHG+   GPG+ F G +  ATSFP  +LT
Sbjct  83   AYEWWSEALHGVANVGPGIKFDGSIKAATSFPQVILT  119


 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 62/100 (62%), Gaps = 4/100 (4%)
 Frame = +3

Query  126  TGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIP  305
            T P ++CDT  +P  KS PFC   L +  RV DL+ RLTL EKI+ LVN+A    RLGIP
Sbjct  841  TQPPFSCDT-SDPRTKSYPFCKTTLPINQRVQDLISRLTLDEKISQLVNSAPPIPRLGIP  899

Query  306  TYEWWPEALHGLPY---TGPGVNFTGVVPPATSFPHPLLT  416
              EWW EALHG+ +      G+ F G +  ATSFP  +LT
Sbjct  900  GDEWWSEALHGVAFLASVSQGIRFNGTIQSATSFPQVILT  939



>ref|XP_007018824.1| Glycosyl hydrolase family protein isoform 2 [Theobroma cacao]
 gb|EOY16049.1| Glycosyl hydrolase family protein isoform 2 [Theobroma cacao]
Length=1597

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +3

Query  126  TGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIP  305
            T P ++CD   +P  K+ PFC   L +  R  DLV RLTL EKI+ LVN+A    RLGIP
Sbjct  24   TQPPFSCDP-SDPSTKNYPFCQTTLPISQRARDLVSRLTLDEKISQLVNSAPAIPRLGIP  82

Query  306  TYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
             YEWW EALHG+   GPG+ F G +  ATSFP  +LT
Sbjct  83   AYEWWSEALHGVANVGPGIKFDGSIKAATSFPQVILT  119


 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 62/100 (62%), Gaps = 4/100 (4%)
 Frame = +3

Query  126  TGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIP  305
            T P ++CDT  +P  KS PFC   L +  RV DL+ RLTL EKI+ LVN+A    RLGIP
Sbjct  841  TQPPFSCDT-SDPRTKSYPFCKTTLPINQRVQDLISRLTLDEKISQLVNSAPPIPRLGIP  899

Query  306  TYEWWPEALHGLPY---TGPGVNFTGVVPPATSFPHPLLT  416
              EWW EALHG+ +      G+ F G +  ATSFP  +LT
Sbjct  900  GDEWWSEALHGVAFLASVSQGIRFNGTIQSATSFPQVILT  939



>ref|XP_004163321.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-D-xylosidase 7-like 
[Cucumis sativus]
Length=783

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 62/99 (63%), Gaps = 1/99 (1%)
 Frame = +3

Query  120  SQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLG  299
            S + P YACD+  NP  K+LPFC   L +K R  DLV RLTL EK+  LVNT     RLG
Sbjct  32   SSSQPPYACDS-SNPLTKTLPFCKTYLPIKLRARDLVSRLTLDEKVLQLVNTVPPIPRLG  90

Query  300  IPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            IP YEWW EALHG+   G G+   G +  ATSFP  +LT
Sbjct  91   IPAYEWWSEALHGVANVGYGIRLNGTITAATSFPQVILT  129



>emb|CDP17081.1| unnamed protein product [Coffea canephora]
Length=643

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P +ACD  ++   K   FC   L +  RV+DL+ RLTL EK+ LLVN A   +RLGI  Y
Sbjct  96   PAFACD-ARDARTKGWGFCGTNLGIAERVSDLIGRLTLQEKVRLLVNNAAEVARLGIKGY  154

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EWW EALHG+   GPG  F G  P ATSFP  + T
Sbjct  155  EWWSEALHGVSNVGPGTKFGGEFPAATSFPQVITT  189



>ref|XP_003544783.1| PREDICTED: probable beta-D-xylosidase 7-like [Glycine max]
Length=776

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 61/97 (63%), Gaps = 2/97 (2%)
 Frame = +3

Query  126  TGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIP  305
            T P Y+CD+  N      PFCN RL +  R  DLV RLTL EK+  LVNTA    RLGIP
Sbjct  26   TQPPYSCDSSSNS--PYYPFCNTRLPISKRAQDLVSRLTLDEKLAQLVNTAPAIPRLGIP  83

Query  306  TYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            +Y+WW EALHG+   G G+ F G +  ATSFP  +LT
Sbjct  84   SYQWWSEALHGVADAGFGIRFNGTIKSATSFPQVILT  120



>ref|XP_004150696.1| PREDICTED: probable beta-D-xylosidase 7-like [Cucumis sativus]
 gb|KGN62174.1| Periplasmic beta-glucosidase [Cucumis sativus]
Length=783

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 62/99 (63%), Gaps = 1/99 (1%)
 Frame = +3

Query  120  SQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLG  299
            S + P YACD+  NP  K+LPFC   L +K R  DLV RLTL EK+  LVNT     RLG
Sbjct  32   SSSQPPYACDS-SNPLTKTLPFCKTYLPIKLRARDLVSRLTLDEKVLQLVNTVPPIPRLG  90

Query  300  IPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            IP YEWW EALHG+   G G+   G +  ATSFP  +LT
Sbjct  91   IPAYEWWSEALHGVANVGYGIRLNGTITAATSFPQVILT  129



>dbj|BAB02547.1| beta-1,4-xylosidase [Arabidopsis thaliana]
Length=876

 Score =   102 bits (254),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 49/93 (53%), Positives = 58/93 (62%), Gaps = 1/93 (1%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            +ACD +  P      FCN  L  + R  DLV RL+L EK+  LVN A    RLG+P YEW
Sbjct  27   FACD-ISAPATAKYGFCNVSLSYEARAKDLVSRLSLKEKVQQLVNKATGVPRLGVPPYEW  85

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+   GPGV+F G VP ATSFP  +LT
Sbjct  86   WSEALHGVSDVGPGVHFNGTVPGATSFPATILT  118



>ref|XP_007145157.1| hypothetical protein PHAVU_007G215100g [Phaseolus vulgaris]
 gb|ESW17151.1| hypothetical protein PHAVU_007G215100g [Phaseolus vulgaris]
Length=767

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 57/93 (61%), Gaps = 1/93 (1%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            +ACD  KN    SLPFC   L +  RV DL+ RLT+ EK+ LLVN A    RLGI  YEW
Sbjct  27   FACDP-KNAATSSLPFCKASLAIAERVKDLIGRLTMEEKVGLLVNNAAAVPRLGIKGYEW  85

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+   GPG  F G  P ATSFP  + T
Sbjct  86   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITT  118



>ref|XP_002513892.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
 gb|EEF48475.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
Length=774

 Score =   102 bits (253),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 50/99 (51%), Positives = 63/99 (64%), Gaps = 1/99 (1%)
 Frame = +3

Query  120  SQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLG  299
            + T P ++CD   NP   S  FC   L +  RV DLV RLTL EKI+ LV++A +  RLG
Sbjct  23   TSTEPPFSCDP-SNPSTSSFLFCKTSLPISQRVRDLVSRLTLDEKISQLVSSAPSIPRLG  81

Query  300  IPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            IP YEWW EALHG+   G G++F G +  ATSFP  +LT
Sbjct  82   IPAYEWWSEALHGVANVGRGIHFEGAIKAATSFPQVILT  120



>ref|XP_008386729.1| PREDICTED: probable beta-D-xylosidase 2 [Malus domestica]
Length=788

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 63/102 (62%), Gaps = 1/102 (1%)
 Frame = +3

Query  111  PVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNES  290
            P   + G  +AC+  K+   K LPFC   L V+ RV DL+ RLTL EK+ LLVNTA    
Sbjct  28   PKTCEGGESFACNP-KDAATKDLPFCRATLPVQDRVRDLLGRLTLQEKVKLLVNTALPVP  86

Query  291  RLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            RLGI  YEWW EALHG+   GPG  F GV P ATSFP  + T
Sbjct  87   RLGIKGYEWWSEALHGVSNVGPGTKFGGVFPGATSFPQVITT  128



>ref|XP_008661822.1| PREDICTED: uncharacterized protein LOC100279996 isoform X1 [Zea 
mays]
 gb|AFW59620.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=773

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 64/101 (63%), Gaps = 2/101 (2%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
             ++QT P +ACD   N  L S  FCN+      R ADLV RLTL EK+  LV+      R
Sbjct  33   ARAQT-PAFACD-ASNATLASYGFCNRSAAAAARAADLVSRLTLAEKVGFLVDKQAALPR  90

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LG+P YEWW EALHG+ Y GPG  F+ +VP ATSFP P+LT
Sbjct  91   LGVPLYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILT  131



>ref|XP_007042636.1| Glycosyl hydrolase family protein [Theobroma cacao]
 gb|EOX98467.1| Glycosyl hydrolase family protein [Theobroma cacao]
Length=852

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 57/93 (61%), Gaps = 1/93 (1%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            +ACD   +P     PFC+  L  + R  DLV  LTL EK+  LVNTA   SRLG+P YEW
Sbjct  85   FACDK-NDPNTSQFPFCDYALSYEDRAKDLVSHLTLQEKVQQLVNTASGISRLGVPAYEW  143

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+   GPG  F   VP ATSFP  +L+
Sbjct  144  WSEALHGVSDLGPGTRFNATVPGATSFPAVILS  176



>gb|KJB77632.1| hypothetical protein B456_012G147500 [Gossypium raimondii]
Length=788

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 63/105 (60%), Gaps = 2/105 (2%)
 Frame = +3

Query  102  IIGPVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAG  281
            ++ P  +Q  P +ACD   +P     PFC+  L  + R  DLV RLTL EK+  LVNTA 
Sbjct  18   VLVPYNTQAQP-FACDK-NDPNTSKFPFCDTTLSYQDRTKDLVSRLTLQEKVQQLVNTAS  75

Query  282  NESRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
               RLG+P Y+WW EALHG+   GPG  F   VP ATSFP  +L+
Sbjct  76   GIPRLGVPAYQWWSEALHGVSDLGPGTRFNATVPGATSFPAVILS  120



>ref|XP_011041424.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 61/93 (66%), Gaps = 1/93 (1%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            +ACD  K+   ++LPFC  +L ++TRV DL+ R+TL EK+ LLVN A    RLGI  YEW
Sbjct  27   FACDP-KDGTKRNLPFCQVKLPIQTRVKDLIGRMTLQEKVGLLVNNAAAVPRLGIKRYEW  85

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+   GPG  F G  P ATSFP  + T
Sbjct  86   WSEALHGVSNVGPGTKFGGAFPVATSFPQVITT  118



>ref|XP_007018826.1| Glycosyl hydrolase family protein [Theobroma cacao]
 gb|EOY16051.1| Glycosyl hydrolase family protein [Theobroma cacao]
Length=840

 Score =   102 bits (253),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 52/103 (50%), Positives = 65/103 (63%), Gaps = 4/103 (4%)
 Frame = +3

Query  117  QSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRL  296
            QS   P ++CD+  +P  KS PFC   L +  RV DL+ RLTL EKI+ LVN+A   SRL
Sbjct  31   QSTDQPPFSCDS-SDPLTKSYPFCKTTLPINQRVQDLISRLTLDEKISQLVNSAPPISRL  89

Query  297  GIPTYEWWPEALHGLPYTG---PGVNFTGVVPPATSFPHPLLT  416
            GIP YEWW EALHG+ +      G+ F G +  ATSFP  +LT
Sbjct  90   GIPGYEWWSEALHGVAFVANISQGIRFNGTIQSATSFPQVILT  132



>ref|XP_011015623.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 61/93 (66%), Gaps = 1/93 (1%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            +ACD  K+   ++LPFC  +L ++TRV DL+ R+TL EK+ LLVN A    RLGI  YEW
Sbjct  27   FACDP-KDGTKRNLPFCQVKLPIQTRVKDLIGRMTLQEKVGLLVNNAAAVPRLGIKRYEW  85

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+   GPG  F G  P ATSFP  + T
Sbjct  86   WSEALHGVSNVGPGTKFGGAFPVATSFPQVITT  118



>gb|KHG24361.1| Beta-D-xylosidase 1 -like protein [Gossypium arboreum]
Length=244

 Score = 98.2 bits (243),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P +ACD  +N   +SL FC   L +  RV DL+ RLTLPEKI LLVN A +  RLGI  Y
Sbjct  30   PPFACDP-RNGLTRSLRFCRTNLPIHVRVRDLLGRLTLPEKIRLLVNNAIDVPRLGIRGY  88

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EWW EALHG+   GPG  F G  P ATSFP  + T
Sbjct  89   EWWSEALHGVSNVGPGTKFGGSFPGATSFPQVITT  123



>ref|XP_009757165.1| PREDICTED: probable beta-D-xylosidase 2 [Nicotiana sylvestris]
Length=770

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 61/101 (60%), Gaps = 1/101 (1%)
 Frame = +3

Query  114  VQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESR  293
            +  Q  P +ACD  ++   K+ PFC   L +  RV DL+ RLTL EK+ LL NTA   SR
Sbjct  22   ISVQARPPFACDP-RDRATKNFPFCQTNLAIGDRVRDLIGRLTLQEKVKLLGNTAAAVSR  80

Query  294  LGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            LGI  YEWW EALHG+   GPG  F G  P ATSFP  + T
Sbjct  81   LGIKGYEWWSEALHGVSNVGPGTKFGGDFPGATSFPQVIST  121



>ref|XP_007225247.1| hypothetical protein PRUPE_ppa001675mg [Prunus persica]
 gb|EMJ26446.1| hypothetical protein PRUPE_ppa001675mg [Prunus persica]
Length=781

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +3

Query  126  TGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIP  305
            T P YACD+ + P   S PFC   L +  RV DLV RLTL EKI+ LVN+A    RL IP
Sbjct  29   TQPPYACDSSQ-PSTSSYPFCKTTLPINQRVQDLVSRLTLDEKISQLVNSAPPIPRLSIP  87

Query  306  TYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            +YEWW EALHG+   G G+N  G +  ATSFP  +LT
Sbjct  88   SYEWWSEALHGVADVGKGINLYGTISNATSFPQVILT  124



>ref|XP_002889174.1| glycosyl hydrolase family 3 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65433.1| glycosyl hydrolase family 3 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=766

 Score =   101 bits (252),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 49/95 (52%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P ++CD   NP  K   FC   L +  R  DLV RL + EKI+ L NTA    RLG+P Y
Sbjct  21   PPHSCDP-SNPTTKLYQFCRTDLPISQRARDLVSRLNIDEKISQLGNTAPGIPRLGVPAY  79

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EWW EALHG+ Y GPG+ F G V  ATSFP  +LT
Sbjct  80   EWWSEALHGVAYAGPGIRFNGTVKAATSFPQVILT  114



>ref|XP_011100796.1| PREDICTED: beta-D-xylosidase 1 [Sesamum indicum]
Length=770

 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 60/93 (65%), Gaps = 1/93 (1%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            +ACD   N    +LPFC+  L ++ RV DL+ RLTL EKI LLVN A    RLGI  YEW
Sbjct  28   FACDPT-NHITTTLPFCSVSLHIRDRVKDLIGRLTLQEKIRLLVNNAAPVDRLGIRGYEW  86

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+  TGPGV F G  P ATSFP  + T
Sbjct  87   WSEALHGVSNTGPGVKFGGQFPGATSFPQVITT  119



>ref|XP_003535953.1| PREDICTED: probable beta-D-xylosidase 2 [Glycine max]
Length=771

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 57/93 (61%), Gaps = 1/93 (1%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            +ACD  KN   K+LPFC   L    RV DL+ RLTL EK+ LLVN A    RLGI  YEW
Sbjct  27   FACDP-KNTATKNLPFCKAWLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEW  85

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+   GPG  F G  P ATSFP  + T
Sbjct  86   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITT  118



>ref|XP_003638778.1| Xylan 1 4-beta-xylosidase [Medicago truncatula]
 gb|KEH34893.1| glycoside hydrolase family 3 amino-terminal domain protein [Medicago 
truncatula]
Length=776

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 61/95 (64%), Gaps = 1/95 (1%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P +ACD   NP  +S PFCN +L +  R  DLV RLTL EK+  LVN+A    RLGIP Y
Sbjct  28   PPFACD-YSNPSTRSYPFCNPKLPITQRTKDLVSRLTLDEKLAQLVNSAPPIPRLGIPAY  86

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EWW EALHG+   G G+ F G +  ATSFP  +LT
Sbjct  87   EWWSEALHGIGNVGRGIFFNGSITSATSFPQVILT  121



>ref|XP_009339788.1| PREDICTED: probable beta-D-xylosidase 2 [Pyrus x bretschneideri]
Length=788

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 63/102 (62%), Gaps = 1/102 (1%)
 Frame = +3

Query  111  PVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNES  290
            P   + G  +AC+  K+   K LPFC   L V+ RV DL+ RLTL EK+ LLVNTA    
Sbjct  28   PKICEGGESFACNP-KDAATKDLPFCRATLPVQDRVRDLLGRLTLQEKVKLLVNTALPVP  86

Query  291  RLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            RLGI  YEWW EALHG+   GPG  F GV P ATSFP  + T
Sbjct  87   RLGIKGYEWWSEALHGVSNVGPGTKFGGVFPGATSFPQVITT  128



>gb|KHN08645.1| Putative beta-D-xylosidase 2 [Glycine soja]
Length=749

 Score =   101 bits (251),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 57/93 (61%), Gaps = 1/93 (1%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            +ACD  KN   K+LPFC   L    RV DL+ RLTL EK+ LLVN A    RLGI  YEW
Sbjct  28   FACDP-KNTATKNLPFCKAWLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEW  86

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+   GPG  F G  P ATSFP  + T
Sbjct  87   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITT  119



>ref|XP_002320310.2| hypothetical protein POPTR_0014s11730g [Populus trichocarpa]
 gb|EEE98625.2| hypothetical protein POPTR_0014s11730g [Populus trichocarpa]
Length=765

 Score =   101 bits (251),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 60/93 (65%), Gaps = 1/93 (1%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            +ACD  K+   + LPFC  +L ++TRV DL+ R+TL EK+ LLVN A    RLGI  YEW
Sbjct  27   FACDP-KDGTTRDLPFCQVKLPIQTRVNDLIGRMTLQEKVGLLVNNAAAVPRLGIKGYEW  85

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+   GPG  F G  P ATSFP  + T
Sbjct  86   WSEALHGVSNVGPGTKFGGAFPVATSFPQVITT  118



>ref|XP_006653810.1| PREDICTED: beta-D-xylosidase 4-like [Oryza brachyantha]
Length=776

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 62/103 (60%), Gaps = 1/103 (1%)
 Frame = +3

Query  108  GPVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNE  287
            G V     PV+ACD   N  +    FC++      R ADL+ RLTL EK+  LVN     
Sbjct  25   GNVARAQTPVFACDA-SNATVAGYGFCDRSKSAAARAADLLGRLTLAEKVGFLVNKQAAL  83

Query  288  SRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
             RLGIP YEWW EALHG+ Y GPG  F+ +VP ATSFP P+LT
Sbjct  84   PRLGIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILT  126



>emb|CDP18762.1| unnamed protein product [Coffea canephora]
Length=506

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 62/95 (65%), Gaps = 6/95 (6%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P YAC +       +  F    LDVKTRV DL+K+L+L EKI  LV+ A   SRL IP Y
Sbjct  18   PAYACAS------GNYTFYYTSLDVKTRVDDLIKKLSLQEKIGNLVDGAAGVSRLRIPIY  71

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EWW E LHG+  TGPGV+FT +VP ATSFP  +LT
Sbjct  72   EWWSEILHGVSNTGPGVHFTSLVPGATSFPQVILT  106



>ref|XP_010428909.1| PREDICTED: probable beta-D-xylosidase 7 isoform X1 [Camelina 
sativa]
 ref|XP_010428911.1| PREDICTED: probable beta-D-xylosidase 7 isoform X3 [Camelina 
sativa]
Length=766

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 59/95 (62%), Gaps = 1/95 (1%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P +ACD   NP  K   FC   L V  R  DLV RLT+ EKI+ LVNTA    RLG+P Y
Sbjct  22   PPHACDP-SNPTTKLYQFCRTELPVNKRARDLVSRLTVDEKISQLVNTAPGIPRLGVPAY  80

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EWW EALHG+   GPG+ F G V  ATSFP  +LT
Sbjct  81   EWWSEALHGVAGVGPGIRFNGTVKAATSFPQVILT  115



>ref|XP_008384517.1| PREDICTED: probable beta-D-xylosidase 5 [Malus domestica]
Length=802

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 59/93 (63%), Gaps = 1/93 (1%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            +ACD  +       PFCN  L  +TR  DLV RLTL EK+  LV+ +   +RLG+P YEW
Sbjct  32   FACDN-RASATSQFPFCNTSLPYETRAKDLVSRLTLQEKVIQLVDKSTGIARLGVPAYEW  90

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+   GPG +F G VP ATSFP  +L+
Sbjct  91   WSEALHGVSNVGPGTSFNGTVPGATSFPAVILS  123



>ref|XP_006399554.1| hypothetical protein EUTSA_v10012725mg [Eutrema salsugineum]
 gb|ESQ41007.1| hypothetical protein EUTSA_v10012725mg [Eutrema salsugineum]
Length=796

 Score =   101 bits (251),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 49/95 (52%), Positives = 59/95 (62%), Gaps = 3/95 (3%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P + C   K P   S PFCN  L ++ R   LV  LTLPEKI  L NTA +  RLGIP Y
Sbjct  28   PKFPC---KPPHFSSYPFCNVSLSIRQRALSLVSFLTLPEKIGQLSNTAASVPRLGIPPY  84

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EWW E+LHG+   GPGV+F G V  ATSFP  +++
Sbjct  85   EWWSESLHGIADNGPGVSFNGSVSSATSFPQVIVS  119



>gb|ACD93208.1| beta xylosidase [Camellia sinensis]
Length=767

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 61/99 (62%), Gaps = 4/99 (4%)
 Frame = +3

Query  120  SQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLG  299
            S++ P +ACD       ++LPFC   L ++ RV DL+ RLTL EKI LLVN A    RLG
Sbjct  25   SESRPAFACDGAT----RNLPFCRVSLPIQDRVRDLIGRLTLQEKIRLLVNNAAAVPRLG  80

Query  300  IPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            I  YEWW EALHG+    PGV F G  P ATSFP  + T
Sbjct  81   IKGYEWWSEALHGVSNADPGVKFGGAFPGATSFPQVIST  119



>ref|XP_002527511.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF34909.1| Beta-glucosidase, putative [Ricinus communis]
Length=810

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 62/105 (59%), Gaps = 4/105 (4%)
 Frame = +3

Query  102  IIGPVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAG  281
            +I P+ SQ    +ACD   +P      FCN  L  + R  DL+ RLTL EK+  +VN A 
Sbjct  16   VIFPIASQN---FACDK-NSPQTNDYSFCNTSLSYQDRAKDLISRLTLQEKVQQVVNHAA  71

Query  282  NESRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
               RLGIP YEWW EALHG+   G GV F G VP ATSFP  +L+
Sbjct  72   GIPRLGIPAYEWWSEALHGVSNVGFGVRFNGTVPGATSFPAMILS  116



>ref|XP_003592512.1| Xylosidase [Medicago truncatula]
 gb|AES62763.1| beta-D-xylosidase-like protein [Medicago truncatula]
Length=781

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 63/105 (60%), Gaps = 4/105 (4%)
 Frame = +3

Query  102  IIGPVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAG  281
             I P+ SQ    +ACD   +P   + PFCN  L  +TR  DLV RLTL EK   LVN + 
Sbjct  15   FILPITSQK---HACDK-GSPKTSNFPFCNTSLSYETRAKDLVSRLTLQEKAQQLVNPST  70

Query  282  NESRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
              SRLG+P YEWW EALHG+   GPG  F   VP ATSFP  +L+
Sbjct  71   GISRLGVPAYEWWSEALHGVSNVGPGTRFDSRVPGATSFPAVILS  115



>ref|NP_188596.1| putative beta-D-xylosidase 5 [Arabidopsis thaliana]
 sp|Q9LJN4.2|BXL5_ARATH RecName: Full=Probable beta-D-xylosidase 5; Short=AtBXL5; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AEE76268.1| putative beta-D-xylosidase 5 [Arabidopsis thaliana]
Length=781

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 64/107 (60%), Gaps = 3/107 (3%)
 Frame = +3

Query  102  IIGPVQS--QTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNT  275
            II  V S  ++   +ACD +  P      FCN  L  + R  DLV RL+L EK+  LVN 
Sbjct  13   IIALVSSLCESQKNFACD-ISAPATAKYGFCNVSLSYEARAKDLVSRLSLKEKVQQLVNK  71

Query  276  AGNESRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            A    RLG+P YEWW EALHG+   GPGV+F G VP ATSFP  +LT
Sbjct  72   ATGVPRLGVPPYEWWSEALHGVSDVGPGVHFNGTVPGATSFPATILT  118



>ref|XP_002873465.1| glycosyl hydrolase family 3 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49724.1| glycosyl hydrolase family 3 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=796

 Score =   100 bits (250),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 49/95 (52%), Positives = 58/95 (61%), Gaps = 3/95 (3%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P + C   K P   S PFCN  L +K R   LV  LTLPEKI  L  TA +  RLGIP Y
Sbjct  28   PQFPC---KPPHFSSYPFCNVSLSIKQRAISLVSLLTLPEKIGQLSTTAASVPRLGIPPY  84

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EWW E+LHGL   GPGV+F G +  ATSFP  +++
Sbjct  85   EWWSESLHGLADNGPGVSFNGSISAATSFPQVIVS  119



>gb|KHN43468.1| Putative beta-D-xylosidase 2 [Glycine soja]
Length=867

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 57/93 (61%), Gaps = 1/93 (1%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            +ACD  KN   K+LPFC   L    RV DL+ RLTL EK+ LLVN A    RLGI  YEW
Sbjct  113  FACDP-KNTATKNLPFCKAWLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEW  171

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+   GPG  F G  P ATSFP  + T
Sbjct  172  WSEALHGVSNVGPGTKFGGQFPAATSFPQVITT  204


 Score = 81.3 bits (199),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 47/75 (63%), Gaps = 1/75 (1%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            +ACD  KN G K + FC   L +  RV DL+ RLTL EK+ LLVN A    RLG+  YEW
Sbjct  27   FACDP-KNGGTKKMAFCKVSLAIAERVKDLIGRLTLEEKVRLLVNNAAAVPRLGMKGYEW  85

Query  318  WPEALHGLPYTGPGV  362
            W EALHG+   GP +
Sbjct  86   WSEALHGVSNLGPAL  100



>gb|EPS70883.1| hypothetical protein M569_03875, partial [Genlisea aurea]
Length=716

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P ++CD+  N   ++L FC   L ++ RV DLV RLTL EKI+ LVN+A    RLGIP Y
Sbjct  1    PPFSCDS-SNAATRTLLFCRTSLPIRRRVEDLVSRLTLEEKISQLVNSAAAIPRLGIPAY  59

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EWW EALHG+   G GV+F+G +  ATSFP  +L+
Sbjct  60   EWWSEALHGVSNYGLGVSFSGKITGATSFPQVILS  94



>emb|CDY00033.1| BnaC09g02680D [Brassica napus]
Length=788

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P++ACD+  N   ++L FC   + V+ RV DL+ RLTL EKI LLVN A    RLGI  Y
Sbjct  49   PLFACDSA-NELTRTLRFCQVNIPVRMRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIGGY  107

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EWW EALHG+   GPG  F G  P ATSFP  + T
Sbjct  108  EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITT  142



>gb|KJB29303.1| hypothetical protein B456_005G093200 [Gossypium raimondii]
Length=803

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 64/100 (64%), Gaps = 4/100 (4%)
 Frame = +3

Query  126  TGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIP  305
            T P ++CD + +P  KS PFC   L +  RV DLV RLTL EKI+ LVN+  +  RLGIP
Sbjct  52   TQPPFSCD-ISDPRTKSYPFCKTTLPITQRVQDLVSRLTLDEKISQLVNSVSSIPRLGIP  110

Query  306  TYEWWPEALHGLPYT---GPGVNFTGVVPPATSFPHPLLT  416
             Y+WW EALHG+ Y+     G+ F G +  ATSFP  +LT
Sbjct  111  AYQWWSEALHGVAYSLRVTQGIRFNGTIQSATSFPQVILT  150



>gb|KJB29304.1| hypothetical protein B456_005G093200 [Gossypium raimondii]
Length=797

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 64/100 (64%), Gaps = 4/100 (4%)
 Frame = +3

Query  126  TGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIP  305
            T P ++CD + +P  KS PFC   L +  RV DLV RLTL EKI+ LVN+  +  RLGIP
Sbjct  52   TQPPFSCD-ISDPRTKSYPFCKTTLPITQRVQDLVSRLTLDEKISQLVNSVSSIPRLGIP  110

Query  306  TYEWWPEALHGLPYT---GPGVNFTGVVPPATSFPHPLLT  416
             Y+WW EALHG+ Y+     G+ F G +  ATSFP  +LT
Sbjct  111  AYQWWSEALHGVAYSLRVTQGIRFNGTIQSATSFPQVILT  150



>ref|XP_010534139.1| PREDICTED: probable beta-D-xylosidase 7 [Tarenaya hassleriana]
Length=140

 Score = 94.7 bits (234),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 57/95 (60%), Gaps = 1/95 (1%)
 Frame = +3

Query  132  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTY  311
            P +AC    +P  K+  FC   + +  R  DLV RLTL EKI+ LVN+A    RLGIP Y
Sbjct  26   PPHACHP-SDPSTKTFQFCRTDIPISRRAGDLVSRLTLDEKISQLVNSAEAIPRLGIPAY  84

Query  312  EWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            EWW EALHG+   G G+   G V  ATSFP  +LT
Sbjct  85   EWWSEALHGVADAGKGIRLNGTVSAATSFPQVILT  119



>ref|XP_010481135.1| PREDICTED: probable beta-D-xylosidase 2 [Camelina sativa]
Length=769

 Score =   100 bits (249),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 49/93 (53%), Positives = 60/93 (65%), Gaps = 1/93 (1%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            +ACDT K+    +L FC   + ++ RV DL+ RLTL EK++LL NTA    RLGI  YEW
Sbjct  31   FACDT-KDAATATLRFCQLSVAIQERVKDLIGRLTLAEKVSLLGNTAAAIPRLGIKGYEW  89

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+   GPG  F GV P ATSFP  + T
Sbjct  90   WSEALHGVSNVGPGTKFGGVYPAATSFPQVITT  122



>ref|XP_004300463.1| PREDICTED: probable beta-D-xylosidase 2 [Fragaria vesca subsp. 
vesca]
Length=790

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 61/100 (61%), Gaps = 1/100 (1%)
 Frame = +3

Query  117  QSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRL  296
            QS T   +AC+   +   K LPFC  +L +  RV DL+ RLTL EK+ LLVN+A    RL
Sbjct  28   QSPTSSSFACNP-NDASTKDLPFCRVKLPIHVRVRDLIGRLTLQEKVKLLVNSAKAVPRL  86

Query  297  GIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            GI  YEWW EALHG+   GPG  F G  P ATSFP  + T
Sbjct  87   GIKDYEWWSEALHGVSNVGPGTKFGGEFPGATSFPQVITT  126



>ref|XP_010111676.1| putative beta-D-xylosidase 5 [Morus notabilis]
 gb|EXC31467.1| putative beta-D-xylosidase 5 [Morus notabilis]
Length=802

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            +ACD    P     PFC+  L    R  D++ RLTL EK+  LV+ +   SRLG+P+YEW
Sbjct  28   HACDVTSFPQASQFPFCDTSLSYDIRAKDIISRLTLQEKVQQLVSGSAGISRLGVPSYEW  87

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+   GPG  F   VP ATSFP  +L+
Sbjct  88   WSEALHGVSNVGPGTTFNATVPGATSFPAVILS  120



>emb|CDY15255.1| BnaC05g01340D [Brassica napus]
Length=762

 Score =   100 bits (249),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 49/93 (53%), Positives = 59/93 (63%), Gaps = 1/93 (1%)
 Frame = +3

Query  138  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEW  317
            +ACDT K+    +L FC Q + +  RV DL+ RLTL EK++LL NTA    RLGI  YEW
Sbjct  24   FACDT-KDAATATLRFCQQSVPIPERVKDLIGRLTLAEKVSLLGNTAAAIPRLGIKGYEW  82

Query  318  WPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            W EALHG+   GPG  F G  P ATSFP  + T
Sbjct  83   WSEALHGVSNVGPGTKFGGTFPAATSFPQVITT  115



>ref|XP_003580652.1| PREDICTED: beta-D-xylosidase 4-like [Brachypodium distachyon]
Length=774

 Score =   100 bits (249),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 52/100 (52%), Positives = 65/100 (65%), Gaps = 2/100 (2%)
 Frame = +3

Query  117  QSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRL  296
            ++QT PV+ACD   N  +    FC++      R ADLV RLTL +K+  LVN     +RL
Sbjct  32   RAQT-PVFACDAA-NSTVAGYAFCDRAKSASARAADLVSRLTLADKVGFLVNKQPALARL  89

Query  297  GIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            GIP YEWW EALHG+ Y GPG  F+ +VP ATSFP P+LT
Sbjct  90   GIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILT  129



>ref|XP_010914548.1| PREDICTED: probable beta-D-xylosidase 2 [Elaeis guineensis]
Length=772

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 60/98 (61%), Gaps = 3/98 (3%)
 Frame = +3

Query  111  PVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNES  290
            P    T P +AC     P   +LPFC   L ++ RVADL+ RLTL EKI LLVN A    
Sbjct  20   PRGGATRPAFACG--GGPA-AALPFCRVALPIRARVADLIGRLTLDEKIRLLVNNAAGVP  76

Query  291  RLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPH  404
            RLGI  YEWW EALHG+   GPGV+F G  P ATSFP 
Sbjct  77   RLGIAGYEWWSEALHGVSDVGPGVHFGGAYPGATSFPQ  114



>ref|XP_003534261.1| PREDICTED: probable beta-D-xylosidase 6-like [Glycine max]
Length=780

 Score =   100 bits (249),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +3

Query  171  KSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNESRLGIPTYEWWPEALHGLPYT  350
            +S PFC+  L   TR   LV  LTLPEKI LL N A +  RLGIP Y+WW E+LHGL   
Sbjct  37   QSHPFCDTSLPTLTRARSLVSLLTLPEKILLLSNNASSIPRLGIPAYQWWSESLHGLALN  96

Query  351  GPGVNFTGVVPPATSFPHPLLT  416
            GPGV+F G VP ATSFP  +L+
Sbjct  97   GPGVSFAGAVPSATSFPQVILS  118



>ref|XP_010657638.1| PREDICTED: beta-D-xylosidase 4-like [Vitis vinifera]
Length=242

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +3

Query  216  VADLVKRLTLPEKITLLVNTAGNESRLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATS  395
            VADLVKRLTL EKI  LVN+A   SRLGIP YEWW +ALHG+ Y GPG +F  VVP ATS
Sbjct  71   VADLVKRLTLEEKIGFLVNSAARVSRLGIPKYEWWSQALHGVSYVGPGTHFNSVVPGATS  130

Query  396  FPHPLL  413
            FP  +L
Sbjct  131  FPQVIL  136



>ref|XP_009378701.1| PREDICTED: probable beta-D-xylosidase 2 [Pyrus x bretschneideri]
Length=789

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 62/102 (61%), Gaps = 1/102 (1%)
 Frame = +3

Query  111  PVQSQTGPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITLLVNTAGNES  290
            P   + G  +AC+  K+   K LPFC   L V+ RV DL+ RLTL EK+ LLVNTA    
Sbjct  28   PKTCEAGESFACNP-KDAATKDLPFCRATLPVQDRVRDLLGRLTLQEKVKLLVNTALPVP  86

Query  291  RLGIPTYEWWPEALHGLPYTGPGVNFTGVVPPATSFPHPLLT  416
            RLGI  YEWW EALHG+   GPG  F G  P ATSFP  + T
Sbjct  87   RLGIKGYEWWSEALHGVSNVGPGTKFGGDFPGATSFPQVITT  128



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562275868875