BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS003C01

Length=567
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011099984.1|  PREDICTED: uncharacterized protein At1g04910...    210   2e-61   Sesamum indicum [beniseed]
ref|XP_011099981.1|  PREDICTED: uncharacterized protein At1g04910...    206   1e-59   Sesamum indicum [beniseed]
emb|CDP01562.1|  unnamed protein product                                200   1e-57   Coffea canephora [robusta coffee]
gb|EYU30936.1|  hypothetical protein MIMGU_mgv1a004530mg                199   2e-57   Erythranthe guttata [common monkey flower]
ref|XP_009623753.1|  PREDICTED: uncharacterized protein At1g04910...    199   2e-57   
gb|EYU30935.1|  hypothetical protein MIMGU_mgv1a004530mg                199   2e-57   Erythranthe guttata [common monkey flower]
ref|XP_009783617.1|  PREDICTED: uncharacterized protein At1g04910...    198   8e-57   Nicotiana sylvestris
gb|KJB44062.1|  hypothetical protein B456_007G232700                    191   3e-56   Gossypium raimondii
gb|EYU39303.1|  hypothetical protein MIMGU_mgv1a004838mg                196   3e-56   Erythranthe guttata [common monkey flower]
ref|XP_009623754.1|  PREDICTED: uncharacterized protein At1g04910...    195   8e-56   Nicotiana tomentosiformis
ref|XP_009797993.1|  PREDICTED: uncharacterized protein At1g04910...    195   9e-56   Nicotiana sylvestris
ref|XP_007047791.1|  O-fucosyltransferase family protein isoform 1      195   1e-55   
ref|XP_004143441.1|  PREDICTED: DUF246 domain-containing protein ...    194   1e-55   Cucumis sativus [cucumbers]
ref|XP_002533683.1|  conserved hypothetical protein                     194   2e-55   Ricinus communis
ref|XP_008440542.1|  PREDICTED: uncharacterized protein At1g04910       194   3e-55   Cucumis melo [Oriental melon]
gb|KJB44060.1|  hypothetical protein B456_007G232700                    192   3e-55   Gossypium raimondii
ref|XP_008236140.1|  PREDICTED: uncharacterized protein At1g04910...    194   3e-55   Prunus mume [ume]
ref|XP_011097478.1|  PREDICTED: uncharacterized protein At1g04910...    193   5e-55   Sesamum indicum [beniseed]
gb|KJB44059.1|  hypothetical protein B456_007G232700                    192   1e-54   Gossypium raimondii
gb|KHG05570.1|  hypothetical protein F383_31127                         192   1e-54   Gossypium arboreum [tree cotton]
gb|KDP29763.1|  hypothetical protein JCGZ_18698                         192   1e-54   Jatropha curcas
ref|XP_004288516.2|  PREDICTED: uncharacterized protein At1g04910       192   1e-54   Fragaria vesca subsp. vesca
ref|XP_004509777.1|  PREDICTED: uncharacterized protein At1g04910...    191   2e-54   Cicer arietinum [garbanzo]
ref|XP_009364252.1|  PREDICTED: uncharacterized protein At1g04910...    191   2e-54   Pyrus x bretschneideri [bai li]
ref|XP_010312650.1|  PREDICTED: uncharacterized protein At1g04910...    190   3e-54   Solanum lycopersicum
ref|XP_009797995.1|  PREDICTED: uncharacterized protein At1g04910...    191   3e-54   Nicotiana sylvestris
ref|XP_010312647.1|  PREDICTED: uncharacterized protein At1g04910...    191   4e-54   
ref|XP_003613049.1|  DUF246 domain-containing protein                   191   4e-54   Medicago truncatula
ref|XP_006353172.1|  PREDICTED: uncharacterized protein At1g04910...    190   6e-54   
ref|XP_010664406.1|  PREDICTED: uncharacterized protein At1g04910...    189   7e-54   Vitis vinifera
gb|KJB18181.1|  hypothetical protein B456_003G038000                    188   9e-54   Gossypium raimondii
ref|XP_002310868.1|  hypothetical protein POPTR_0007s14280g             189   1e-53   Populus trichocarpa [western balsam poplar]
ref|XP_007207425.1|  hypothetical protein PRUPE_ppa004921mg             188   1e-53   
ref|XP_011021848.1|  PREDICTED: uncharacterized protein At1g04910       189   2e-53   Populus euphratica
ref|XP_002283844.1|  PREDICTED: uncharacterized protein At1g04910...    189   2e-53   Vitis vinifera
gb|KJB18179.1|  hypothetical protein B456_003G038000                    189   2e-53   Gossypium raimondii
gb|KHG22139.1|  hypothetical protein F383_05782                         187   3e-53   Gossypium arboreum [tree cotton]
ref|XP_008347790.1|  PREDICTED: uncharacterized protein At1g04910...    188   3e-53   
gb|KJB18182.1|  hypothetical protein B456_003G038000                    189   3e-53   Gossypium raimondii
ref|XP_009350347.1|  PREDICTED: uncharacterized protein At1g04910...    188   3e-53   Pyrus x bretschneideri [bai li]
gb|AFK40388.1|  unknown                                                 188   3e-53   Lotus japonicus
gb|KDO81174.1|  hypothetical protein CISIN_1g020969mg                   183   5e-53   Citrus sinensis [apfelsine]
ref|XP_003517397.1|  PREDICTED: uncharacterized protein At1g04910...    188   5e-53   Glycine max [soybeans]
gb|KHN14510.1|  DUF246 domain-containing protein                        187   6e-53   Glycine soja [wild soybean]
ref|XP_006587571.1|  PREDICTED: uncharacterized protein At1g04910...    187   8e-53   Glycine max [soybeans]
ref|XP_010254530.1|  PREDICTED: uncharacterized protein At1g04910...    187   8e-53   Nelumbo nucifera [Indian lotus]
ref|XP_010312648.1|  PREDICTED: uncharacterized protein At1g04910...    186   1e-52   
ref|XP_007207426.1|  hypothetical protein PRUPE_ppa004921mg             186   1e-52   
ref|XP_010277498.1|  PREDICTED: uncharacterized protein At1g04910...    184   2e-52   
ref|XP_006353173.1|  PREDICTED: uncharacterized protein At1g04910...    186   2e-52   Solanum tuberosum [potatoes]
gb|KDO60569.1|  hypothetical protein CISIN_1g009234mg                   184   5e-52   Citrus sinensis [apfelsine]
ref|XP_010519195.1|  PREDICTED: uncharacterized protein At1g04910...    185   5e-52   Tarenaya hassleriana [spider flower]
ref|XP_008236135.1|  PREDICTED: uncharacterized protein At1g04910...    185   6e-52   Prunus mume [ume]
ref|XP_002268599.2|  PREDICTED: uncharacterized protein At1g04910       185   6e-52   Vitis vinifera
ref|XP_010277497.1|  PREDICTED: uncharacterized protein At1g04910...    184   9e-52   Nelumbo nucifera [Indian lotus]
ref|XP_006472461.1|  PREDICTED: uncharacterized protein At1g04910...    184   1e-51   Citrus sinensis [apfelsine]
ref|XP_008385667.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    184   1e-51   Malus domestica [apple tree]
ref|XP_010523312.1|  PREDICTED: uncharacterized protein At1g04910...    184   1e-51   Tarenaya hassleriana [spider flower]
ref|XP_010523308.1|  PREDICTED: uncharacterized protein At1g04910...    184   1e-51   Tarenaya hassleriana [spider flower]
ref|XP_006573005.1|  PREDICTED: uncharacterized protein At1g04910...    184   2e-51   Glycine max [soybeans]
ref|XP_006433827.1|  hypothetical protein CICLE_v10000880mg             184   2e-51   Citrus clementina [clementine]
ref|XP_006466306.1|  PREDICTED: uncharacterized protein At1g04910...    184   2e-51   Citrus sinensis [apfelsine]
ref|XP_006426272.1|  hypothetical protein CICLE_v10025329mg             184   2e-51   Citrus clementina [clementine]
gb|KJB58884.1|  hypothetical protein B456_009G229500                    179   2e-51   Gossypium raimondii
ref|XP_003534239.1|  PREDICTED: uncharacterized protein At1g04910...    183   3e-51   Glycine max [soybeans]
ref|XP_009364251.1|  PREDICTED: uncharacterized protein At1g04910...    183   4e-51   Pyrus x bretschneideri [bai li]
gb|AAX20003.1|  unknown protein                                         176   4e-51   Iris tectorum
gb|KHG27420.1|  hypothetical protein F383_15612                         182   5e-51   Gossypium arboreum [tree cotton]
ref|XP_009150636.1|  PREDICTED: uncharacterized protein At1g04910       182   7e-51   Brassica rapa
gb|KJB58885.1|  hypothetical protein B456_009G229500                    179   9e-51   Gossypium raimondii
ref|XP_004152738.1|  PREDICTED: DUF246 domain-containing protein ...    182   9e-51   Cucumis sativus [cucumbers]
gb|EPS73888.1|  hypothetical protein M569_00867                         181   1e-50   Genlisea aurea
ref|XP_010939815.1|  PREDICTED: uncharacterized protein At1g04910...    182   1e-50   
ref|XP_007158370.1|  hypothetical protein PHAVU_002G147300g             181   1e-50   Phaseolus vulgaris [French bean]
ref|XP_006394027.1|  hypothetical protein EUTSA_v10004041mg             181   2e-50   Eutrema salsugineum [saltwater cress]
ref|XP_006472463.1|  PREDICTED: uncharacterized protein At1g04910...    181   2e-50   
emb|CDY14569.1|  BnaC03g48900D                                          180   3e-50   Brassica napus [oilseed rape]
ref|XP_010680342.1|  PREDICTED: uncharacterized protein At1g04910       180   3e-50   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB58883.1|  hypothetical protein B456_009G229500                    180   3e-50   Gossypium raimondii
ref|XP_006280335.1|  hypothetical protein CARUB_v10026260mg             180   3e-50   
ref|XP_010113429.1|  hypothetical protein L484_026763                   181   4e-50   
ref|XP_006433826.1|  hypothetical protein CICLE_v10000880mg             180   4e-50   
ref|XP_008347789.1|  PREDICTED: uncharacterized protein At1g04910...    180   5e-50   
ref|XP_010444520.1|  PREDICTED: uncharacterized protein At1g04910...    180   5e-50   Camelina sativa [gold-of-pleasure]
ref|XP_009350346.1|  PREDICTED: uncharacterized protein At1g04910...    180   5e-50   Pyrus x bretschneideri [bai li]
ref|XP_009401410.1|  PREDICTED: uncharacterized protein At1g04910...    180   6e-50   
gb|KJB58881.1|  hypothetical protein B456_009G229500                    180   6e-50   Gossypium raimondii
ref|XP_010523344.1|  PREDICTED: uncharacterized protein At1g04910       179   6e-50   Tarenaya hassleriana [spider flower]
ref|XP_003602912.1|  PsRT17-1 like protein                              179   6e-50   Medicago truncatula
ref|XP_002864958.1|  hypothetical protein ARALYDRAFT_496780             179   7e-50   
ref|NP_194184.2|  O-fucosyltransferase family protein                   179   9e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008802622.1|  PREDICTED: uncharacterized protein At1g04910...    178   1e-49   Phoenix dactylifera
ref|XP_010463027.1|  PREDICTED: uncharacterized protein At1g04910...    178   1e-49   Camelina sativa [gold-of-pleasure]
ref|XP_004501643.1|  PREDICTED: uncharacterized protein At1g04910...    178   2e-49   Cicer arietinum [garbanzo]
ref|NP_201350.2|  O-fucosyltransferase family protein                   178   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010448552.1|  PREDICTED: uncharacterized protein At1g04910...    178   2e-49   Camelina sativa [gold-of-pleasure]
gb|AAM13166.1|  unknown protein                                         178   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008444924.1|  PREDICTED: uncharacterized protein At1g04910...    178   2e-49   Cucumis melo [Oriental melon]
ref|XP_010433755.1|  PREDICTED: uncharacterized protein At1g04910...    179   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010484355.1|  PREDICTED: uncharacterized protein At1g04910...    178   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_006394028.1|  hypothetical protein EUTSA_v10004041mg             178   2e-49   
ref|XP_010439017.1|  PREDICTED: uncharacterized protein At1g04910...    178   2e-49   
ref|XP_006338062.1|  PREDICTED: uncharacterized protein At1g04910...    178   2e-49   Solanum tuberosum [potatoes]
ref|XP_009138156.1|  PREDICTED: uncharacterized protein At1g04910       177   4e-49   Brassica rapa
ref|XP_006413418.1|  hypothetical protein EUTSA_v10024936mg             177   4e-49   Eutrema salsugineum [saltwater cress]
gb|KJB48896.1|  hypothetical protein B456_008G092600                    177   5e-49   Gossypium raimondii
ref|XP_010547595.1|  PREDICTED: uncharacterized protein At1g04910...    177   6e-49   Tarenaya hassleriana [spider flower]
emb|CDY03446.1|  BnaC01g16360D                                          178   9e-49   
ref|XP_007136338.1|  hypothetical protein PHAVU_009G0371000g            175   1e-48   Phaseolus vulgaris [French bean]
ref|XP_007018221.1|  O-fucosyltransferase family protein                176   2e-48   
emb|CDY34289.1|  BnaA01g13920D                                          178   2e-48   Brassica napus [oilseed rape]
ref|XP_010937178.1|  PREDICTED: uncharacterized protein At1g04910...    176   2e-48   Elaeis guineensis
gb|KGN62755.1|  hypothetical protein Csa_2G370540                       180   2e-48   Cucumis sativus [cucumbers]
gb|AGV54860.1|  O-fucosyltransferase family protein                     175   3e-48   Phaseolus vulgaris [French bean]
gb|KHN09000.1|  DUF246 domain-containing protein                        175   4e-48   Glycine soja [wild soybean]
ref|XP_003526543.1|  PREDICTED: uncharacterized protein At1g04910...    174   4e-48   Glycine max [soybeans]
gb|KDP41479.1|  hypothetical protein JCGZ_15886                         174   4e-48   Jatropha curcas
emb|CDY33958.1|  BnaC02g43790D                                          174   5e-48   Brassica napus [oilseed rape]
ref|XP_006285210.1|  hypothetical protein CARUB_v10006569mg             174   5e-48   Capsella rubella
emb|CDP11502.1|  unnamed protein product                                174   8e-48   Coffea canephora [robusta coffee]
ref|XP_004237994.1|  PREDICTED: uncharacterized protein At1g04910       172   3e-47   Solanum lycopersicum
ref|XP_002867661.1|  predicted protein                                  172   3e-47   Arabidopsis lyrata subsp. lyrata
dbj|BAB11569.1|  unnamed protein product                                172   4e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009130514.1|  PREDICTED: uncharacterized protein At1g04910...    171   7e-47   Brassica rapa
emb|CDY37829.1|  BnaAnng04900D                                          171   7e-47   Brassica napus [oilseed rape]
gb|KFK28724.1|  hypothetical protein AALP_AA7G039000                    171   9e-47   Arabis alpina [alpine rockcress]
gb|EPS72903.1|  hypothetical protein M569_01846                         170   2e-46   Genlisea aurea
gb|KCW54609.1|  hypothetical protein EUGRSUZ_I00557                     170   2e-46   Eucalyptus grandis [rose gum]
ref|XP_010027954.1|  PREDICTED: uncharacterized protein At1g04910       170   2e-46   Eucalyptus grandis [rose gum]
ref|XP_009130513.1|  PREDICTED: uncharacterized protein At1g04910...    170   2e-46   Brassica rapa
ref|XP_004301363.1|  PREDICTED: uncharacterized protein At1g04910       169   3e-46   Fragaria vesca subsp. vesca
gb|KHN08263.1|  DUF246 domain-containing protein                        169   4e-46   Glycine soja [wild soybean]
ref|XP_003523785.1|  PREDICTED: uncharacterized protein At1g04910...    169   4e-46   Glycine max [soybeans]
ref|XP_010061545.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    168   1e-45   Eucalyptus grandis [rose gum]
ref|XP_002514041.1|  conserved hypothetical protein                     167   2e-45   Ricinus communis
ref|XP_002301095.2|  hypothetical protein POPTR_0002s10600g             167   2e-45   
ref|XP_004956798.1|  PREDICTED: uncharacterized protein At1g04910...    166   4e-45   Setaria italica
ref|XP_009785662.1|  PREDICTED: uncharacterized protein At1g04910...    166   6e-45   Nicotiana sylvestris
ref|XP_008368388.1|  PREDICTED: uncharacterized protein At1g04910...    166   9e-45   
ref|XP_009624657.1|  PREDICTED: uncharacterized protein At1g04910...    166   9e-45   Nicotiana tomentosiformis
emb|CAN78778.1|  hypothetical protein VITISV_029752                     165   2e-44   Vitis vinifera
ref|XP_011016933.1|  PREDICTED: uncharacterized protein At1g04910...    165   2e-44   Populus euphratica
dbj|BAK06980.1|  predicted protein                                      164   3e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010692399.1|  PREDICTED: uncharacterized protein At1g04910       163   7e-44   Beta vulgaris subsp. vulgaris [field beet]
gb|EEC84568.1|  hypothetical protein OsI_31345                          163   7e-44   Oryza sativa Indica Group [Indian rice]
ref|NP_001150199.1|  LOC100283829                                       162   1e-43   Zea mays [maize]
ref|NP_001063155.1|  Os09g0412200                                       162   2e-43   
ref|XP_010312649.1|  PREDICTED: uncharacterized protein At1g04910...    160   4e-43   Solanum lycopersicum
gb|EEE69695.1|  hypothetical protein OsJ_29339                          162   7e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007222858.1|  hypothetical protein PRUPE_ppa004255mg             160   7e-43   Prunus persica
ref|XP_006661225.1|  PREDICTED: uncharacterized protein At1g04910...    160   8e-43   
ref|XP_002462371.1|  hypothetical protein SORBIDRAFT_02g024540          159   2e-42   Sorghum bicolor [broomcorn]
ref|XP_010107675.1|  hypothetical protein L484_007693                   157   1e-41   
ref|XP_009376221.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    156   2e-41   Pyrus x bretschneideri [bai li]
tpg|DAA61415.1|  TPA: hypothetical protein ZEAMMB73_640362              156   2e-41   
ref|XP_008219267.1|  PREDICTED: uncharacterized protein At1g04910...    155   8e-41   Prunus mume [ume]
gb|AGE09594.1|  UP7-like protein                                        149   4e-40   Eucalyptus cladocalyx
gb|KCW68511.1|  hypothetical protein EUGRSUZ_F02148                     152   6e-40   Eucalyptus grandis [rose gum]
gb|KCW54611.1|  hypothetical protein EUGRSUZ_I00557                     150   2e-39   Eucalyptus grandis [rose gum]
gb|ABJ96379.1|  expressed protein                                       146   7e-38   Prunus persica
ref|XP_003578106.1|  PREDICTED: uncharacterized protein At1g04910...    145   1e-37   Brachypodium distachyon [annual false brome]
ref|XP_008651492.1|  PREDICTED: LOC100283829 isoform X1                 144   2e-37   Zea mays [maize]
gb|KHN11061.1|  DUF246 domain-containing protein                        138   3e-37   Glycine soja [wild soybean]
ref|XP_006852943.1|  hypothetical protein AMTR_s00033p00238220          142   2e-36   
ref|XP_010523310.1|  PREDICTED: uncharacterized protein At1g04910...    140   6e-36   
ref|XP_008339020.1|  PREDICTED: uncharacterized protein LOC103402048    139   2e-35   
ref|XP_011016934.1|  PREDICTED: uncharacterized protein At1g04910...    139   3e-35   Populus euphratica
ref|XP_008378640.1|  PREDICTED: uncharacterized protein At1g04910...    137   1e-34   
emb|CAA23010.1|  PsRT17-1 like protein                                  134   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002967262.1|  hypothetical protein SELMODRAFT_87093              130   5e-32   
ref|XP_002960458.1|  hypothetical protein SELMODRAFT_75338              129   7e-32   
gb|KHN33918.1|  DUF246 domain-containing protein                        122   3e-31   Glycine soja [wild soybean]
gb|AAK84479.1|  putative auxin growth promotor protein                  124   9e-30   Solanum lycopersicum
gb|AAB72114.1|  PsRT17-1                                                123   1e-29   Pisum sativum [garden pea]
ref|XP_001777077.1|  predicted protein                                  116   3e-27   
gb|KJB18178.1|  hypothetical protein B456_003G038000                    105   1e-23   Gossypium raimondii
ref|XP_010098633.1|  hypothetical protein L484_012746                   105   6e-23   
gb|KJB44061.1|  hypothetical protein B456_007G232700                    103   1e-22   Gossypium raimondii
ref|XP_011074208.1|  PREDICTED: uncharacterized protein At1g04910       104   1e-22   Sesamum indicum [beniseed]
ref|XP_010025951.1|  PREDICTED: uncharacterized protein At1g04910...    103   2e-22   Eucalyptus grandis [rose gum]
ref|XP_010025946.1|  PREDICTED: uncharacterized protein At1g04910...    103   2e-22   Eucalyptus grandis [rose gum]
ref|XP_010025942.1|  PREDICTED: uncharacterized protein At1g04910...    103   2e-22   Eucalyptus grandis [rose gum]
ref|XP_007047792.1|  O-fucosyltransferase family protein isoform 2      102   2e-22   
gb|KHN26223.1|  DUF246 domain-containing protein                        102   4e-22   Glycine soja [wild soybean]
tpg|DAA38994.1|  TPA: hypothetical protein ZEAMMB73_412482              100   5e-22   
ref|XP_010044058.1|  PREDICTED: uncharacterized protein At1g04910       103   6e-22   Eucalyptus grandis [rose gum]
gb|KCW86055.1|  hypothetical protein EUGRSUZ_B02760                     103   6e-22   Eucalyptus grandis [rose gum]
ref|XP_003516326.1|  PREDICTED: uncharacterized protein At1g04910...    103   6e-22   Glycine max [soybeans]
ref|XP_008669810.1|  PREDICTED: uncharacterized protein At1g04910...    100   7e-22   
gb|KHM98943.1|  DUF246 domain-containing protein                        101   9e-22   Glycine soja [wild soybean]
ref|XP_011096470.1|  PREDICTED: uncharacterized protein At1g04910       102   1e-21   Sesamum indicum [beniseed]
emb|CBI18521.3|  unnamed protein product                                101   1e-21   Vitis vinifera
emb|CBI19199.3|  unnamed protein product                                102   1e-21   Vitis vinifera
ref|XP_010664349.1|  PREDICTED: uncharacterized protein At1g04910       102   1e-21   Vitis vinifera
ref|XP_008669809.1|  PREDICTED: uncharacterized protein At1g04910...    100   1e-21   Zea mays [maize]
ref|XP_002272758.2|  PREDICTED: uncharacterized protein At1g04910       102   1e-21   Vitis vinifera
ref|XP_010061980.1|  PREDICTED: uncharacterized protein At1g04910...    100   1e-21   
gb|KDP34835.1|  hypothetical protein JCGZ_11197                         102   1e-21   Jatropha curcas
ref|XP_009398160.1|  PREDICTED: uncharacterized protein At1g04910...    101   1e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008781543.1|  PREDICTED: uncharacterized protein At1g04910...    100   1e-21   
ref|XP_010930789.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    101   2e-21   
gb|EYU22809.1|  hypothetical protein MIMGU_mgv1a003510mg                101   2e-21   Erythranthe guttata [common monkey flower]
ref|XP_009390064.1|  PREDICTED: uncharacterized protein At1g04910...    101   2e-21   
ref|XP_009390063.1|  PREDICTED: uncharacterized protein At1g04910...    101   2e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006576578.1|  PREDICTED: uncharacterized protein At1g04910...    102   2e-21   
ref|XP_002969133.1|  hypothetical protein SELMODRAFT_90475              100   2e-21   
ref|XP_004152623.1|  PREDICTED: DUF246 domain-containing protein ...    101   2e-21   Cucumis sativus [cucumbers]
ref|XP_008669807.1|  PREDICTED: uncharacterized protein At1g04910...    100   2e-21   Zea mays [maize]
ref|XP_007222914.1|  hypothetical protein PRUPE_ppa003660mg             101   2e-21   Prunus persica
ref|XP_008669808.1|  PREDICTED: uncharacterized protein At1g04910...    100   2e-21   Zea mays [maize]
ref|XP_002973931.1|  hypothetical protein SELMODRAFT_100522             100   2e-21   
ref|XP_004977274.1|  PREDICTED: uncharacterized protein At1g04910...    100   2e-21   
ref|XP_010104480.1|  hypothetical protein L484_025449                 99.0    2e-21   
ref|XP_006363293.1|  PREDICTED: uncharacterized protein At1g04910...    101   2e-21   Solanum tuberosum [potatoes]
ref|XP_007207136.1|  hypothetical protein PRUPE_ppa002471mg             102   2e-21   Prunus persica
ref|XP_001765585.1|  predicted protein                                  100   2e-21   
ref|XP_008781542.1|  PREDICTED: uncharacterized protein At1g04910...    100   2e-21   
emb|CDY56371.1|  BnaAnng14240D                                        97.8    2e-21   Brassica napus [oilseed rape]
ref|XP_008221889.1|  PREDICTED: uncharacterized protein At1g04910       101   2e-21   Prunus mume [ume]
ref|XP_002441904.1|  hypothetical protein SORBIDRAFT_08g004650          100   2e-21   
ref|XP_001761221.1|  predicted protein                                  100   3e-21   
ref|XP_007018708.1|  O-fucosyltransferase family protein                100   3e-21   
ref|XP_008669805.1|  PREDICTED: uncharacterized protein At1g04910...    100   3e-21   Zea mays [maize]
ref|XP_002533585.1|  conserved hypothetical protein                     101   3e-21   Ricinus communis
gb|KEH35288.1|  growth regulator-like protein                         99.8    3e-21   Medicago truncatula
gb|KCW69027.1|  hypothetical protein EUGRSUZ_F02582                     100   3e-21   Eucalyptus grandis [rose gum]
ref|XP_010023452.1|  PREDICTED: uncharacterized protein At1g04910       100   3e-21   Eucalyptus grandis [rose gum]
gb|KJB50269.1|  hypothetical protein B456_008G161400                    100   3e-21   Gossypium raimondii
ref|NP_001066285.2|  Os12g0174100                                       100   3e-21   
ref|XP_010061979.1|  PREDICTED: uncharacterized protein At1g04910...    100   3e-21   Eucalyptus grandis [rose gum]
ref|XP_004490385.1|  PREDICTED: uncharacterized protein At1g04910...  99.8    3e-21   Cicer arietinum [garbanzo]
ref|XP_010535322.1|  PREDICTED: uncharacterized protein At1g04910...  99.4    3e-21   Tarenaya hassleriana [spider flower]
ref|XP_002960947.1|  hypothetical protein SELMODRAFT_402444             100   4e-21   Selaginella moellendorffii
gb|KJB76860.1|  hypothetical protein B456_012G110800                    100   4e-21   Gossypium raimondii
ref|XP_009804174.1|  PREDICTED: uncharacterized protein At1g04910...    100   4e-21   Nicotiana sylvestris
ref|XP_004502388.1|  PREDICTED: uncharacterized protein At1g04910...    100   4e-21   Cicer arietinum [garbanzo]
ref|XP_009594772.1|  PREDICTED: uncharacterized protein At1g04910       100   4e-21   Nicotiana tomentosiformis
ref|XP_006438229.1|  hypothetical protein CICLE_v10031037mg           99.8    4e-21   
ref|XP_009781764.1|  PREDICTED: uncharacterized protein At1g04910       100   4e-21   Nicotiana sylvestris
ref|XP_006664382.1|  PREDICTED: uncharacterized protein At1g04910...  99.0    4e-21   
gb|KDO82190.1|  hypothetical protein CISIN_1g008884mg                 99.4    5e-21   Citrus sinensis [apfelsine]
emb|CDP13245.1|  unnamed protein product                                100   5e-21   Coffea canephora [robusta coffee]
emb|CDY10050.1|  BnaC08g44010D                                        99.4    5e-21   Brassica napus [oilseed rape]
gb|AES98123.2|  auxin-independent growth promoter-like protein          100   5e-21   Medicago truncatula
ref|XP_008219343.1|  PREDICTED: uncharacterized protein At1g04910...    100   5e-21   Prunus mume [ume]
gb|EEE52851.1|  hypothetical protein OsJ_35390                          100   5e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006349651.1|  PREDICTED: uncharacterized protein At1g04910...    100   5e-21   Solanum tuberosum [potatoes]
ref|XP_008355708.1|  PREDICTED: uncharacterized protein At1g04910...    100   5e-21   Malus domestica [apple tree]
gb|AFY26903.1|  duf246 domain-containing protein                      99.8    6e-21   Morella rubra [Chinese arbutus]
ref|XP_010650286.1|  PREDICTED: uncharacterized protein At1g04910...  99.8    6e-21   Vitis vinifera
ref|XP_004490384.1|  PREDICTED: uncharacterized protein At1g04910...  99.8    6e-21   Cicer arietinum [garbanzo]
ref|XP_010535312.1|  PREDICTED: uncharacterized protein At1g04910...    100   6e-21   Tarenaya hassleriana [spider flower]
gb|KJB50270.1|  hypothetical protein B456_008G161400                  99.8    6e-21   Gossypium raimondii
gb|KHG25699.1|  hypothetical protein F383_04430                       99.8    7e-21   Gossypium arboreum [tree cotton]
ref|XP_009370260.1|  PREDICTED: uncharacterized protein At1g04910...    100   7e-21   Pyrus x bretschneideri [bai li]
ref|XP_009370233.1|  PREDICTED: uncharacterized protein At1g04910...    100   7e-21   Pyrus x bretschneideri [bai li]
ref|XP_010535316.1|  PREDICTED: uncharacterized protein At1g04910...  99.8    7e-21   Tarenaya hassleriana [spider flower]
ref|XP_006438227.1|  hypothetical protein CICLE_v10031037mg           99.8    7e-21   
emb|CBI17217.3|  unnamed protein product                              99.8    8e-21   Vitis vinifera
ref|XP_003615165.1|  DUF246 domain-containing protein                 99.8    8e-21   
ref|XP_006438228.1|  hypothetical protein CICLE_v10031037mg           99.8    8e-21   
ref|XP_002513963.1|  conserved hypothetical protein                   99.4    8e-21   
ref|XP_009121532.1|  PREDICTED: uncharacterized protein At1g04910...  99.4    9e-21   Brassica rapa
ref|XP_002450409.1|  hypothetical protein SORBIDRAFT_05g004890        99.4    9e-21   
gb|EEC68940.1|  hypothetical protein OsI_37646                        99.4    9e-21   Oryza sativa Indica Group [Indian rice]
gb|AES72149.2|  growth regulator-like protein                         99.4    9e-21   Medicago truncatula
ref|XP_004501690.1|  PREDICTED: uncharacterized protein At1g04910...  99.4    1e-20   
emb|CDY56370.1|  BnaAnng14230D                                        99.4    1e-20   Brassica napus [oilseed rape]
ref|XP_009398945.1|  PREDICTED: uncharacterized protein At1g04910...  97.8    1e-20   
ref|XP_006473172.1|  PREDICTED: uncharacterized protein At1g04910...  98.2    1e-20   
ref|XP_006473173.1|  PREDICTED: uncharacterized protein At1g04910...  98.2    1e-20   Citrus sinensis [apfelsine]
ref|XP_011003993.1|  PREDICTED: uncharacterized protein At1g04910     99.4    1e-20   Populus euphratica
ref|XP_010680244.1|  PREDICTED: uncharacterized protein At1g04910...  99.8    1e-20   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO82189.1|  hypothetical protein CISIN_1g008884mg                 99.4    1e-20   Citrus sinensis [apfelsine]
emb|CDY22004.1|  BnaC09g01100D                                        99.4    1e-20   Brassica napus [oilseed rape]
ref|XP_006434582.1|  hypothetical protein CICLE_v10000533mg           98.2    1e-20   Citrus clementina [clementine]
ref|XP_010680324.1|  PREDICTED: uncharacterized protein At1g04910...  99.4    1e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006483965.1|  PREDICTED: uncharacterized protein At1g04910...  99.4    1e-20   Citrus sinensis [apfelsine]
ref|XP_008239791.1|  PREDICTED: uncharacterized protein At1g04910...  99.8    1e-20   Prunus mume [ume]
ref|XP_010267002.1|  PREDICTED: uncharacterized protein At1g04910...  99.0    1e-20   
ref|XP_002530048.1|  conserved hypothetical protein                   99.0    1e-20   
ref|XP_010248690.1|  PREDICTED: uncharacterized protein At1g04910     99.0    1e-20   
ref|XP_008798951.1|  PREDICTED: uncharacterized protein At1g04910...  99.0    1e-20   
ref|XP_004237944.1|  PREDICTED: uncharacterized protein At1g04910     99.0    1e-20   
ref|XP_002325978.2|  hypothetical protein POPTR_0019s11020g           99.0    1e-20   
ref|XP_011071301.1|  PREDICTED: uncharacterized protein At1g04910     99.8    1e-20   
ref|XP_009359192.1|  PREDICTED: uncharacterized protein At1g04910     99.0    1e-20   
ref|XP_002285492.1|  PREDICTED: uncharacterized protein At1g04910     98.6    2e-20   
ref|XP_010425341.1|  PREDICTED: uncharacterized protein At1g04910...  98.6    2e-20   
gb|KJB78029.1|  hypothetical protein B456_012G173200                  98.6    2e-20   
gb|KDO83868.1|  hypothetical protein CISIN_1g008308mg                 97.8    2e-20   
ref|XP_008459666.1|  PREDICTED: uncharacterized protein At1g04910     98.6    2e-20   
gb|KDP26681.1|  hypothetical protein JCGZ_17839                       98.6    2e-20   
ref|XP_006433927.1|  hypothetical protein CICLE_v10000706mg           98.6    2e-20   
gb|KDO83867.1|  hypothetical protein CISIN_1g008308mg                 98.2    2e-20   
ref|XP_011464606.1|  PREDICTED: uncharacterized protein At1g04910...  98.2    2e-20   
ref|XP_007221810.1|  hypothetical protein PRUPE_ppa004094mg           98.2    2e-20   
ref|XP_007026820.1|  O-fucosyltransferase family protein isoform 2    98.2    2e-20   
ref|XP_010538926.1|  PREDICTED: uncharacterized protein At1g04910...  98.6    2e-20   
gb|AFW56213.1|  hypothetical protein ZEAMMB73_697257                  98.2    2e-20   
gb|KJB78030.1|  hypothetical protein B456_012G173200                  98.2    2e-20   
ref|XP_011016822.1|  PREDICTED: uncharacterized protein At1g04910...  97.8    2e-20   
gb|KHG19982.1|  hypothetical protein F383_25836                       98.6    2e-20   
gb|KFK44342.1|  hypothetical protein AALP_AA1G245400                  98.2    2e-20   
ref|XP_006433928.1|  hypothetical protein CICLE_v10000706mg           97.8    2e-20   
gb|KFK44341.1|  hypothetical protein AALP_AA1G245400                  98.2    2e-20   
gb|KHG20341.1|  hypothetical protein F383_05466                       98.6    2e-20   
ref|NP_566791.2|  O-fucosyltransferase family protein                 98.2    3e-20   
ref|XP_011009570.1|  PREDICTED: uncharacterized protein At1g04910...  98.2    3e-20   
ref|XP_004299674.1|  PREDICTED: uncharacterized protein At1g04910...  97.8    3e-20   
ref|XP_006434581.1|  hypothetical protein CICLE_v10000533mg           98.6    3e-20   
ref|XP_006473171.1|  PREDICTED: uncharacterized protein At1g04910...  98.2    3e-20   
ref|XP_008444860.1|  PREDICTED: uncharacterized protein At1g04910     98.2    3e-20   
ref|XP_002875314.1|  hypothetical protein ARALYDRAFT_484400           98.2    3e-20   
ref|XP_009387816.1|  PREDICTED: uncharacterized protein At1g04910     98.2    3e-20   
ref|XP_006434583.1|  hypothetical protein CICLE_v10000533mg           98.2    3e-20   
ref|XP_009759798.1|  PREDICTED: uncharacterized protein At1g04910     98.2    3e-20   
ref|XP_009602874.1|  PREDICTED: uncharacterized protein At1g04910     98.2    3e-20   
ref|XP_008661414.1|  PREDICTED: uncharacterized protein LOC100193...  98.2    3e-20   
ref|XP_009417593.1|  PREDICTED: uncharacterized protein At1g04910...  97.8    3e-20   
dbj|BAJ98197.1|  predicted protein                                    98.2    3e-20   
ref|XP_006290838.1|  hypothetical protein CARUB_v10016949mg           98.2    3e-20   
ref|XP_007044839.1|  O-fucosyltransferase family protein isoform 1    98.2    3e-20   
ref|XP_002893230.1|  hypothetical protein ARALYDRAFT_472486           98.2    3e-20   
ref|XP_010502552.1|  PREDICTED: uncharacterized protein At1g04910...  98.2    3e-20   
ref|XP_004141562.1|  PREDICTED: DUF246 domain-containing protein ...  98.2    3e-20   
ref|XP_010928952.1|  PREDICTED: uncharacterized protein At1g04910...  97.8    3e-20   
gb|KJB28878.1|  hypothetical protein B456_005G074200                  97.1    3e-20   
ref|XP_010514284.1|  PREDICTED: uncharacterized protein At1g04910...  97.8    3e-20   
ref|XP_010319880.1|  PREDICTED: uncharacterized protein At1g04910...  97.8    3e-20   
ref|XP_010928951.1|  PREDICTED: uncharacterized protein At1g04910...  97.8    3e-20   
ref|XP_003602836.1|  DUF246 domain-containing protein                 97.8    3e-20   
ref|XP_002279576.2|  PREDICTED: uncharacterized protein At1g04910     97.8    3e-20   
ref|XP_010498715.1|  PREDICTED: uncharacterized protein At1g04910...  96.7    3e-20   
ref|XP_007026819.1|  O-fucosyltransferase family protein isoform 1    98.2    3e-20   
gb|KFK33567.1|  hypothetical protein AALP_AA5G030400                  97.8    4e-20   
ref|XP_010475159.1|  PREDICTED: uncharacterized protein At1g04910...  97.4    4e-20   
gb|KHG19055.1|  hypothetical protein F383_06473                       97.4    4e-20   
gb|EPS71835.1|  hypothetical protein M569_02912                       97.4    4e-20   
ref|XP_010484389.1|  PREDICTED: uncharacterized protein At1g04910...  97.4    4e-20   
gb|KJB64222.1|  hypothetical protein B456_010G038100                  97.4    4e-20   
gb|KJB64220.1|  hypothetical protein B456_010G038100                  97.4    4e-20   
ref|XP_010457549.1|  PREDICTED: uncharacterized protein At1g04910...  97.1    5e-20   
ref|XP_004298993.2|  PREDICTED: uncharacterized protein At1g04910     97.4    5e-20   
ref|XP_004160299.1|  PREDICTED: DUF246 domain-containing protein ...  97.4    5e-20   
ref|XP_002967060.1|  hypothetical protein SELMODRAFT_408430           97.4    5e-20   
ref|XP_010932070.1|  PREDICTED: uncharacterized protein At1g04910     97.4    5e-20   
ref|XP_010926335.1|  PREDICTED: uncharacterized protein At1g04910...  97.1    5e-20   
ref|XP_004305155.1|  PREDICTED: uncharacterized protein At1g04910     97.8    5e-20   
gb|KJB46611.1|  hypothetical protein B456_007G377900                  97.4    5e-20   
ref|XP_010272985.1|  PREDICTED: uncharacterized protein At1g04910...  97.1    5e-20   
ref|XP_010928950.1|  PREDICTED: uncharacterized protein At1g04910...  97.4    5e-20   
gb|KHG19054.1|  hypothetical protein F383_06473                       97.4    6e-20   
ref|XP_010926334.1|  PREDICTED: uncharacterized protein At1g04910...  97.1    6e-20   
gb|KJB28877.1|  hypothetical protein B456_005G074200                  97.4    6e-20   
ref|XP_010498714.1|  PREDICTED: uncharacterized protein At1g04910...  97.1    6e-20   
gb|KJB28879.1|  hypothetical protein B456_005G074200                  97.1    6e-20   
ref|XP_008799030.1|  PREDICTED: uncharacterized protein At1g04910...  97.1    6e-20   
emb|CDX83614.1|  BnaC07g23540D                                        97.1    6e-20   
ref|XP_009632007.1|  PREDICTED: uncharacterized protein At1g04910...  97.1    6e-20   
ref|XP_003560475.2|  PREDICTED: uncharacterized protein At1g04910...  97.4    6e-20   
emb|CDY13629.1|  BnaA06g32940D                                        97.1    6e-20   
ref|XP_009632006.1|  PREDICTED: uncharacterized protein At1g04910...  97.1    6e-20   
ref|XP_010272984.1|  PREDICTED: uncharacterized protein At1g04910...  97.1    7e-20   
ref|XP_009152062.1|  PREDICTED: uncharacterized protein At1g04910     97.1    7e-20   
ref|XP_007020036.1|  O-fucosyltransferase family protein isoform 2    96.7    7e-20   
gb|AFW75944.1|  auxin-independent growth promoter-like protein, mRNA  95.1    7e-20   
ref|XP_006395561.1|  hypothetical protein EUTSA_v10003920mg           97.1    7e-20   
gb|KEH36621.1|  GDP-fucose protein O-fucosyltransferase               97.1    7e-20   
ref|XP_009121525.1|  PREDICTED: uncharacterized protein At1g04910...  96.7    7e-20   
ref|XP_007020035.1|  O-fucosyltransferase family protein isoform 1    97.1    8e-20   
ref|XP_002527876.1|  conserved hypothetical protein                   97.1    8e-20   
ref|XP_006472560.1|  PREDICTED: uncharacterized protein At1g04910...  96.7    8e-20   
ref|XP_004506640.1|  PREDICTED: uncharacterized protein At1g04910...  97.1    8e-20   
ref|XP_003544811.1|  PREDICTED: uncharacterized protein At1g04910...  96.7    8e-20   
ref|XP_008782174.1|  PREDICTED: uncharacterized protein At1g04910...  96.3    9e-20   
ref|XP_006416197.1|  hypothetical protein EUTSA_v10007232mg           96.7    9e-20   
ref|XP_006858424.1|  hypothetical protein AMTR_s00071p00069340        96.3    9e-20   
ref|XP_010912508.1|  PREDICTED: uncharacterized protein At1g04910...  96.7    9e-20   
ref|XP_002891187.1|  hypothetical protein ARALYDRAFT_473680           96.7    9e-20   
ref|XP_007163687.1|  hypothetical protein PHAVU_001G255600g           96.7    1e-19   
ref|XP_006472559.1|  PREDICTED: uncharacterized protein At1g04910...  96.3    1e-19   
ref|XP_002306564.2|  hypothetical protein POPTR_0005s17360g           96.3    1e-19   
gb|KHN35489.1|  DUF246 domain-containing protein                      96.3    1e-19   
ref|XP_011077663.1|  PREDICTED: uncharacterized protein At1g04910...  96.7    1e-19   
ref|XP_008388105.1|  PREDICTED: uncharacterized protein At1g04910     96.7    1e-19   
ref|XP_011094956.1|  PREDICTED: uncharacterized protein At1g04910     96.7    1e-19   
emb|CDP01105.1|  unnamed protein product                              96.3    1e-19   
ref|XP_011034053.1|  PREDICTED: uncharacterized protein At1g04910...  96.3    1e-19   
ref|XP_009358826.1|  PREDICTED: uncharacterized protein At1g04910...  96.7    1e-19   
ref|XP_010100364.1|  hypothetical protein L484_027673                 95.9    1e-19   
ref|XP_009388776.1|  PREDICTED: uncharacterized protein At1g04910...  95.9    1e-19   
gb|EPS61677.1|  hypothetical protein M569_13117                       94.7    1e-19   
ref|XP_010682284.1|  PREDICTED: uncharacterized protein At1g04910     95.9    2e-19   
ref|XP_009379852.1|  PREDICTED: uncharacterized protein At1g04910...  95.9    2e-19   
ref|XP_003538596.1|  PREDICTED: uncharacterized protein At1g04910...  95.9    2e-19   
ref|XP_009629250.1|  PREDICTED: uncharacterized protein At1g04910     96.3    2e-19   
ref|XP_004239143.1|  PREDICTED: uncharacterized protein At1g04910     95.9    2e-19   
ref|XP_004237568.1|  PREDICTED: uncharacterized protein At1g04910...  95.9    2e-19   
ref|XP_008647318.1|  PREDICTED: uncharacterized protein LOC100191...  94.0    2e-19   
ref|XP_009362464.1|  PREDICTED: uncharacterized protein At1g04910...  94.7    2e-19   
gb|EYU31450.1|  hypothetical protein MIMGU_mgv1a0047671mg             91.7    2e-19   
ref|XP_006303975.1|  hypothetical protein CARUB_v10008864mg           95.5    2e-19   
gb|KHN44375.1|  DUF246 domain-containing protein                      95.9    2e-19   
gb|EMS46071.1|  hypothetical protein TRIUR3_08015                     94.4    2e-19   
gb|AAF40446.1|AC004809_4  Similar to the auxin-independent growth...  95.5    2e-19   
ref|XP_009119234.1|  PREDICTED: uncharacterized protein At1g04910...  95.5    2e-19   
emb|CDX89777.1|  BnaA10g03050D                                        95.1    2e-19   
emb|CDY18269.1|  BnaC05g02920D                                        95.1    2e-19   
gb|KFK42839.1|  hypothetical protein AALP_AA1G045700                  95.5    2e-19   
ref|XP_002881557.1|  hypothetical protein ARALYDRAFT_482804           95.9    2e-19   
ref|NP_171983.2|  O-fucosyltransferase-like protein                   95.5    2e-19   
gb|EEC81207.1|  hypothetical protein OsI_24239                        95.9    2e-19   
ref|XP_010250060.1|  PREDICTED: uncharacterized protein At1g04910...  94.7    2e-19   
gb|EYU31451.1|  hypothetical protein MIMGU_mgv1a0047671mg             91.7    2e-19   
ref|XP_002892251.1|  hypothetical protein ARALYDRAFT_470476           95.5    2e-19   
ref|XP_010477505.1|  PREDICTED: uncharacterized protein At1g04910     95.5    2e-19   
gb|EYU27099.1|  hypothetical protein MIMGU_mgv1a004188mg              95.5    2e-19   
ref|XP_007141214.1|  hypothetical protein PHAVU_008G176800g           95.5    2e-19   
ref|XP_006418082.1|  hypothetical protein EUTSA_v10007374mg           95.5    2e-19   
gb|AFW79318.1|  hypothetical protein ZEAMMB73_338758                  93.6    2e-19   
ref|XP_006848051.1|  hypothetical protein AMTR_s00029p00193940        95.5    2e-19   
emb|CDP03096.1|  unnamed protein product                              95.9    2e-19   
ref|XP_003551990.1|  PREDICTED: uncharacterized protein At1g04910...  95.5    2e-19   
ref|XP_010040214.1|  PREDICTED: uncharacterized protein At1g04910     95.1    2e-19   
ref|XP_004485909.1|  PREDICTED: uncharacterized protein At1g04910...  95.5    2e-19   
emb|CBI30445.3|  unnamed protein product                              95.1    2e-19   
ref|XP_008340083.1|  PREDICTED: uncharacterized protein At1g04910     95.5    2e-19   
ref|NP_001152550.1|  auxin-independent growth promoter-like protein   95.5    2e-19   
ref|XP_002438900.1|  hypothetical protein SORBIDRAFT_10g027900        95.5    2e-19   
gb|EMT20301.1|  hypothetical protein F775_28818                       94.4    2e-19   
ref|XP_010460000.1|  PREDICTED: uncharacterized protein At1g04910...  95.1    2e-19   
ref|XP_004135279.1|  PREDICTED: DUF246 domain-containing protein ...  95.5    3e-19   
gb|AAK93632.1|  putative growth regulator protein                     95.5    3e-19   
ref|NP_564461.1|  O-fucosyltransferase-like protein                   95.5    3e-19   
ref|XP_010509241.1|  PREDICTED: uncharacterized protein At1g04910...  95.5    3e-19   
gb|ACF86391.1|  unknown                                               95.5    3e-19   
ref|XP_010674227.1|  PREDICTED: uncharacterized protein At1g04910...  95.1    3e-19   
ref|XP_010675873.1|  PREDICTED: uncharacterized protein At1g04910     95.1    3e-19   
ref|XP_009112144.1|  PREDICTED: uncharacterized protein At1g04910     95.1    3e-19   
ref|XP_010460001.1|  PREDICTED: uncharacterized protein At1g04910...  95.1    3e-19   
ref|XP_010674228.1|  PREDICTED: uncharacterized protein At1g04910...  95.1    3e-19   
ref|XP_004499554.1|  PREDICTED: uncharacterized protein At1g04910...  94.7    3e-19   
gb|KFK36698.1|  hypothetical protein AALP_AA4G157600                  95.5    3e-19   
ref|XP_006420975.1|  hypothetical protein CICLE_v10004740mg           95.1    3e-19   
ref|XP_010528094.1|  PREDICTED: uncharacterized protein At1g04910...  95.1    3e-19   
gb|EPS58265.1|  hypothetical protein M569_16550                       94.0    3e-19   
ref|XP_006841300.1|  hypothetical protein AMTR_s00134p00086190        94.4    3e-19   
ref|XP_002277149.2|  PREDICTED: uncharacterized protein At1g04910     95.5    3e-19   
gb|KHG04968.1|  hypothetical protein F383_30616                       94.7    3e-19   
ref|XP_008368399.1|  PREDICTED: uncharacterized protein At1g04910...  93.6    3e-19   
ref|XP_006840907.1|  hypothetical protein AMTR_s00087p00092870        93.6    3e-19   
ref|XP_006380002.1|  hypothetical protein POPTR_0008s18910g           94.7    3e-19   
ref|XP_002522229.1|  conserved hypothetical protein                   95.1    3e-19   
gb|KFK28149.1|  hypothetical protein AALP_AA8G479000                  94.7    3e-19   
ref|XP_011042385.1|  PREDICTED: uncharacterized protein At1g04910     94.7    3e-19   
ref|XP_003519179.1|  PREDICTED: uncharacterized protein At1g04910...  94.7    3e-19   
ref|XP_008446146.1|  PREDICTED: uncharacterized protein At1g04910     95.1    3e-19   
ref|XP_002314587.1|  hypothetical protein POPTR_0010s05850g           94.7    4e-19   
ref|XP_009348039.1|  PREDICTED: uncharacterized protein At1g04910...  94.7    4e-19   
ref|XP_009373119.1|  PREDICTED: uncharacterized protein At1g04910...  94.7    4e-19   
ref|XP_008805903.1|  PREDICTED: uncharacterized protein At1g04910...  94.0    4e-19   
ref|XP_010262721.1|  PREDICTED: uncharacterized protein At1g04910...  95.1    4e-19   
ref|XP_008798044.1|  PREDICTED: uncharacterized protein At1g04910...  94.4    4e-19   
ref|XP_008339228.1|  PREDICTED: uncharacterized protein At1g04910...  93.2    4e-19   
ref|XP_006306504.1|  hypothetical protein CARUB_v10012492mg           94.7    4e-19   
ref|XP_004970596.1|  PREDICTED: uncharacterized protein At1g04910...  92.8    4e-19   
gb|KJB36874.1|  hypothetical protein B456_006G180100                  95.1    4e-19   
ref|XP_001768745.1|  predicted protein                                94.4    4e-19   
gb|EMT00536.1|  hypothetical protein F775_27215                       94.0    4e-19   
ref|XP_004499553.1|  PREDICTED: uncharacterized protein At1g04910...  94.7    4e-19   
dbj|BAK05991.1|  predicted protein                                    94.0    4e-19   
gb|AES62612.2|  GDP-fucose protein O-fucosyltransferase               94.7    4e-19   
ref|XP_009362462.1|  PREDICTED: uncharacterized protein At1g04910...  94.7    4e-19   
emb|CDP10650.1|  unnamed protein product                              94.7    4e-19   
ref|XP_007225641.1|  hypothetical protein PRUPE_ppa004828mg           94.4    4e-19   
gb|KDP44840.1|  hypothetical protein JCGZ_01340                       94.7    4e-19   
ref|XP_006357586.1|  PREDICTED: uncharacterized protein At1g04910...  94.7    4e-19   
ref|XP_008359322.1|  PREDICTED: uncharacterized protein At1g04910...  92.8    4e-19   
ref|XP_010922337.1|  PREDICTED: uncharacterized protein At1g04910...  94.7    5e-19   
ref|XP_010060050.1|  PREDICTED: uncharacterized protein At1g04910...  94.4    5e-19   
ref|XP_008359321.1|  PREDICTED: uncharacterized protein At1g04910...  92.8    5e-19   
ref|XP_009624336.1|  PREDICTED: uncharacterized protein At1g04910     94.4    5e-19   
ref|XP_010913449.1|  PREDICTED: uncharacterized protein At1g04910...  94.7    5e-19   
ref|XP_009402762.1|  PREDICTED: uncharacterized protein At1g04910...  93.2    5e-19   
emb|CDY71049.1|  BnaCnng71080D                                        92.4    5e-19   
emb|CDY07758.1|  BnaA03g17530D                                        95.1    5e-19   
gb|KDO58033.1|  hypothetical protein CISIN_1g006724mg                 94.7    5e-19   
ref|XP_010543575.1|  PREDICTED: uncharacterized protein At1g04910...  94.7    5e-19   
ref|XP_010543593.1|  PREDICTED: uncharacterized protein At1g04910...  94.4    5e-19   
ref|XP_010556342.1|  PREDICTED: uncharacterized protein At1g04910     94.4    5e-19   
ref|XP_009772601.1|  PREDICTED: uncharacterized protein At1g04910     94.7    5e-19   
gb|KHN43981.1|  DUF246 domain-containing protein                      95.5    6e-19   
ref|XP_006578315.1|  PREDICTED: uncharacterized protein At1g04910...  94.4    6e-19   
gb|KHN27381.1|  DUF246 domain-containing protein                      94.0    6e-19   
gb|KJB64221.1|  hypothetical protein B456_010G038100                  93.2    6e-19   
ref|XP_008649667.1|  PREDICTED: uncharacterized protein At1g04910...  94.4    6e-19   
gb|ACN34743.1|  unknown                                               94.0    6e-19   
ref|XP_008349974.1|  PREDICTED: uncharacterized protein At1g04910...  94.0    6e-19   
ref|XP_006648331.1|  PREDICTED: uncharacterized protein At1g04910...  94.0    6e-19   



>ref|XP_011099984.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Sesamum indicum]
Length=517

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 130/156 (83%), Gaps = 0/156 (0%)
 Frame = +1

Query  100  FTSRGGAMaallllllpaffptlfttfIYASPSILSESIIAKPRHSSLFKSALQRETTPE  279
            +  RGG MA  L+LLLP  FP+LFT F +A PS+LSE    KPRHS L KSALQR+T+ E
Sbjct  10   YKQRGGTMAGALVLLLPFLFPSLFTPFSHALPSVLSEWNAPKPRHSRLLKSALQRQTSDE  69

Query  280  EKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILN  459
            ++AE+WMPLA+QGW+P   SG  S   EKS+GY+QVFLDGGLNQQRMGICDAVA+AKILN
Sbjct  70   QQAELWMPLAHQGWRPCARSGSTSTLPEKSQGYIQVFLDGGLNQQRMGICDAVALAKILN  129

Query  460  ATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            ATL+IP+LEVNPVWQDSS+FMDIFDVDHFI VLKDD
Sbjct  130  ATLIIPHLEVNPVWQDSSTFMDIFDVDHFINVLKDD  165



>ref|XP_011099981.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Sesamum indicum]
 ref|XP_011099982.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Sesamum indicum]
 ref|XP_011099983.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Sesamum indicum]
Length=518

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 130/157 (83%), Gaps = 1/157 (1%)
 Frame = +1

Query  100  FTSRGGAMaallllllpaffptlfttfIYASPSILSESIIAKPRHSSLFKSALQRETTPE  279
            +  RGG MA  L+LLLP  FP+LFT F +A PS+LSE    KPRHS L KSALQR+T+ E
Sbjct  10   YKQRGGTMAGALVLLLPFLFPSLFTPFSHALPSVLSEWNAPKPRHSRLLKSALQRQTSDE  69

Query  280  EKAEIWMPLANQGWKPVPDSGLFSK-FSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKIL  456
            ++AE+WMPLA+QGW+P   SG  S    EKS+GY+QVFLDGGLNQQRMGICDAVA+AKIL
Sbjct  70   QQAELWMPLAHQGWRPCARSGSTSTALPEKSQGYIQVFLDGGLNQQRMGICDAVALAKIL  129

Query  457  NATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            NATL+IP+LEVNPVWQDSS+FMDIFDVDHFI VLKDD
Sbjct  130  NATLIIPHLEVNPVWQDSSTFMDIFDVDHFINVLKDD  166



>emb|CDP01562.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +ASPS++SE    KPRHS L K ALQRET+ E+++E+W PL  Q WK    SG+ S+  E
Sbjct  36   HASPSVISEWNTPKPRHSRLLKGALQRETSLEQQSELWTPLPKQEWKTCKVSGMASRLPE  95

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
             SEGY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSS+FM+IFDVDH
Sbjct  96   SSEGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSTFMEIFDVDH  155

Query  544  FIEVLKDD  567
            FI VLKDD
Sbjct  156  FISVLKDD  163



>gb|EYU30936.1| hypothetical protein MIMGU_mgv1a004530mg [Erythranthe guttata]
 gb|EYU30937.1| hypothetical protein MIMGU_mgv1a004530mg [Erythranthe guttata]
Length=511

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 127/154 (82%), Gaps = 1/154 (1%)
 Frame = +1

Query  109  RGGAMaallllllpaffptlfttfIYASPSILSESIIAKPRHSSLFKSALQRETTPEEKA  288
            RGGAM A ++LLLP  FP LFT F +A PS+LSE    K RHS L KSALQRET+ E+ +
Sbjct  8    RGGAMVAAVVLLLPFLFPNLFTPFTHALPSLLSEWNAPKLRHSRLLKSALQRETSDEQLS  67

Query  289  EIWMPLANQGWKPVPDSGLF-SKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNAT  465
            E+WMPL+NQGWKP   S +  S  +EKS+GY+QVFLDGGLNQQRMGICDAVA+AKILNAT
Sbjct  68   ELWMPLSNQGWKPCIRSDIITSSLTEKSQGYIQVFLDGGLNQQRMGICDAVALAKILNAT  127

Query  466  LVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            L+IPYLEVNPVWQDSS+F DIFDVDHFIE LKD+
Sbjct  128  LIIPYLEVNPVWQDSSTFEDIFDVDHFIESLKDE  161



>ref|XP_009623753.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nicotiana tomentosiformis]
Length=504

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +ASP+IL +    K RHS L KSALQR+T+ EE++E+W PLA+QGWKP  +S   S   E
Sbjct  26   HASPTILKDLNAPKFRHSRLAKSALQRQTSNEEQSELWTPLAHQGWKPCTESDAASTVPE  85

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KSEGY+QVFLDGGLNQQRMGICDAV VAKILNATLVIP LEVNPVWQDSSSFMDIFDVDH
Sbjct  86   KSEGYVQVFLDGGLNQQRMGICDAVVVAKILNATLVIPQLEVNPVWQDSSSFMDIFDVDH  145

Query  544  FIEVLKDD  567
            FI VLKDD
Sbjct  146  FINVLKDD  153



>gb|EYU30935.1| hypothetical protein MIMGU_mgv1a004530mg [Erythranthe guttata]
Length=522

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 127/154 (82%), Gaps = 1/154 (1%)
 Frame = +1

Query  109  RGGAMaallllllpaffptlfttfIYASPSILSESIIAKPRHSSLFKSALQRETTPEEKA  288
            RGGAM A ++LLLP  FP LFT F +A PS+LSE    K RHS L KSALQRET+ E+ +
Sbjct  8    RGGAMVAAVVLLLPFLFPNLFTPFTHALPSLLSEWNAPKLRHSRLLKSALQRETSDEQLS  67

Query  289  EIWMPLANQGWKPVPDSGLF-SKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNAT  465
            E+WMPL+NQGWKP   S +  S  +EKS+GY+QVFLDGGLNQQRMGICDAVA+AKILNAT
Sbjct  68   ELWMPLSNQGWKPCIRSDIITSSLTEKSQGYIQVFLDGGLNQQRMGICDAVALAKILNAT  127

Query  466  LVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            L+IPYLEVNPVWQDSS+F DIFDVDHFIE LKD+
Sbjct  128  LIIPYLEVNPVWQDSSTFEDIFDVDHFIESLKDE  161



>ref|XP_009783617.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=512

 Score =   198 bits (503),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +ASPSI SE    KPRHS L KSALQR+T+ EE++++WMPL  QGWKP  +S + S   E
Sbjct  35   HASPSIFSEWNAPKPRHSRLLKSALQRQTSSEEQSDLWMPLPYQGWKPCSESVIASTLPE  94

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KSEGY+QVFLDGGLNQQRM ICDAV VAKILNATLVIP+LEVNPVWQDSS+F DIFDV H
Sbjct  95   KSEGYIQVFLDGGLNQQRMAICDAVVVAKILNATLVIPHLEVNPVWQDSSTFKDIFDVGH  154

Query  544  FIEVLKDD  567
            FI VLKDD
Sbjct  155  FINVLKDD  162



>gb|KJB44062.1| hypothetical protein B456_007G232700 [Gossypium raimondii]
Length=308

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +ASPS  SE  + KPRH  L +SALQRE    E++++W PLA+QGW+P   S       +
Sbjct  40   HASPSTFSEWNVPKPRHLRLLRSALQRERLTGEQSDLWAPLADQGWRPYLGSVNAPSLPQ  99

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQDSSSFMDIFDVDH
Sbjct  100  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQDSSSFMDIFDVDH  159

Query  544  FIEVLKDD  567
            F+ VLKDD
Sbjct  160  FMNVLKDD  167



>gb|EYU39303.1| hypothetical protein MIMGU_mgv1a004838mg [Erythranthe guttata]
Length=507

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +A PS+LSE    KPRHS L KSALQRET+  E+AE+WMPLA Q  KP       S   E
Sbjct  43   HALPSVLSEWNAPKPRHSRLLKSALQRETSDREQAELWMPLAQQQLKPCVQFASTSSLPE  102

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KS GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVW+DSS+FMDIFDVDH
Sbjct  103  KSNGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWKDSSTFMDIFDVDH  162

Query  544  FIEVLKDD  567
            FI +LKDD
Sbjct  163  FINILKDD  170



>ref|XP_009623754.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Nicotiana tomentosiformis]
Length=503

 Score =   195 bits (495),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 107/128 (84%), Gaps = 1/128 (1%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +ASP+IL +    K RHS L KSALQR+T+ EE++E+W PLA+QGWKP  +S   S   E
Sbjct  26   HASPTILKDLNAPKFRHSRLAKSALQRQTSNEEQSELWTPLAHQGWKPCTESDAAS-IPE  84

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KSEGY+QVFLDGGLNQQRMGICDAV VAKILNATLVIP LEVNPVWQDSSSFMDIFDVDH
Sbjct  85   KSEGYVQVFLDGGLNQQRMGICDAVVVAKILNATLVIPQLEVNPVWQDSSSFMDIFDVDH  144

Query  544  FIEVLKDD  567
            FI VLKDD
Sbjct  145  FINVLKDD  152



>ref|XP_009797993.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009797994.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nicotiana sylvestris]
Length=504

 Score =   195 bits (495),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +ASP+IL +    K RHS L KSAL R+T+ EE++E+W PLA+QGWKP  +S   S   E
Sbjct  26   HASPTILKDLNAPKFRHSRLAKSALLRQTSNEEQSELWTPLAHQGWKPCTESDGASTVPE  85

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KSEGY+QVFLDGGLNQQRMGICDAV VAKILNATLVIP LEVNPVWQDSSSFMDIFDVDH
Sbjct  86   KSEGYVQVFLDGGLNQQRMGICDAVVVAKILNATLVIPQLEVNPVWQDSSSFMDIFDVDH  145

Query  544  FIEVLKDD  567
            FI VLKDD
Sbjct  146  FINVLKDD  153



>ref|XP_007047791.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOX91948.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
Length=518

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +ASPS  SE  + KPRH  L +SALQRE +  E++++W PLA+QGW+P  +  +     +
Sbjct  40   HASPSTFSEWNVPKPRHLPLLRSALQRENSNGEQSDLWAPLADQGWRPCLECVIAPSLPQ  99

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQDSS+FMDIFDVDH
Sbjct  100  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQDSSTFMDIFDVDH  159

Query  544  FIEVLKDD  567
            FI VLKDD
Sbjct  160  FINVLKDD  167



>ref|XP_004143441.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 ref|XP_004160919.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 gb|KGN48703.1| hypothetical protein Csa_6G498990 [Cucumis sativus]
Length=513

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +ASPS  SE    KPRH  L KSALQR+++  +++++W PLA++GW+P  DS   S   E
Sbjct  36   HASPSTFSEWNTPKPRHLRLLKSALQRQSSKPDQSDLWAPLADEGWRPCVDSSKASSLPE  95

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KSEGY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVW+DSSSF+DIFDVDH
Sbjct  96   KSEGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWKDSSSFVDIFDVDH  155

Query  544  FIEVLKDD  567
            FI VLKDD
Sbjct  156  FINVLKDD  163



>ref|XP_002533683.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28699.1| conserved hypothetical protein [Ricinus communis]
Length=509

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +ASPS  SE  + KPRH +L KSALQRET+ E++A++W PLA+QGW+   +S        
Sbjct  31   HASPSTFSEWNVPKPRHLALLKSALQRETSQEKQADLWAPLADQGWRTCAESKSVPSLPA  90

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIP+ E+NPVW+DSS+FM+IFDVDH
Sbjct  91   KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHFEINPVWRDSSTFMEIFDVDH  150

Query  544  FIEVLKDD  567
            FI VLKDD
Sbjct  151  FINVLKDD  158



>ref|XP_008440542.1| PREDICTED: uncharacterized protein At1g04910 [Cucumis melo]
Length=513

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +ASPS  SE    KPRH  L KSALQR ++  +++++W PLA++GW+P  DS   S   E
Sbjct  36   HASPSTFSEWNTPKPRHLRLLKSALQRRSSKPDQSDLWAPLADEGWRPCVDSSKASSLPE  95

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KSEGY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVW+DSSSF+DIFDVDH
Sbjct  96   KSEGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWKDSSSFVDIFDVDH  155

Query  544  FIEVLKDD  567
            FI VLKDD
Sbjct  156  FINVLKDD  163



>gb|KJB44060.1| hypothetical protein B456_007G232700 [Gossypium raimondii]
Length=428

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +ASPS  SE  + KPRH  L +SALQRE    E++++W PLA+QGW+P   S       +
Sbjct  40   HASPSTFSEWNVPKPRHLRLLRSALQRERLTGEQSDLWAPLADQGWRPYLGSVNAPSLPQ  99

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQDSSSFMDIFDVDH
Sbjct  100  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQDSSSFMDIFDVDH  159

Query  544  FIEVLKDD  567
            F+ VLKDD
Sbjct  160  FMNVLKDD  167



>ref|XP_008236140.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Prunus 
mume]
Length=518

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +ASPS+LSE  + K RH  L KSALQR+T+  E +++W PLANQ  KP  +S +     +
Sbjct  40   HASPSMLSEWNVPKSRHQRLLKSALQRQTSEGELSDLWTPLANQSLKPCAESSIAPSLPD  99

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KSEG++QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVW+DSSSFMDIFDVDH
Sbjct  100  KSEGFIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWRDSSSFMDIFDVDH  159

Query  544  FIEVLKDD  567
            FI VLKDD
Sbjct  160  FINVLKDD  167



>ref|XP_011097478.1| PREDICTED: uncharacterized protein At1g04910-like [Sesamum indicum]
Length=516

 Score =   193 bits (491),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +A PS+ SE    KPRHS L KSALQR+T  E+ A++W PLA Q WK    S   S   E
Sbjct  38   HALPSVFSEWNAPKPRHSRLLKSALQRQTPDEQLADLWRPLAQQQWKRCARSDSVSSLPE  97

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KS+GY+QVFLDGGLNQQRMGICDAVAVAKILNATL+IP+LEVNPVWQDSS+FMDIFDVDH
Sbjct  98   KSQGYIQVFLDGGLNQQRMGICDAVAVAKILNATLIIPHLEVNPVWQDSSTFMDIFDVDH  157

Query  544  FIEVLKDD  567
            FI VLKDD
Sbjct  158  FINVLKDD  165



>gb|KJB44059.1| hypothetical protein B456_007G232700 [Gossypium raimondii]
Length=518

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +ASPS  SE  + KPRH  L +SALQRE    E++++W PLA+QGW+P   S       +
Sbjct  40   HASPSTFSEWNVPKPRHLRLLRSALQRERLTGEQSDLWAPLADQGWRPYLGSVNAPSLPQ  99

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQDSSSFMDIFDVDH
Sbjct  100  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQDSSSFMDIFDVDH  159

Query  544  FIEVLKDD  567
            F+ VLKDD
Sbjct  160  FMNVLKDD  167



>gb|KHG05570.1| hypothetical protein F383_31127 [Gossypium arboreum]
Length=518

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 108/129 (84%), Gaps = 1/129 (1%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDS-GLFSKFS  360
            YASPS  SE  + KPRH SL +SAL+ +++ +E++++W PLA+QGW+P  +S    S   
Sbjct  39   YASPSTFSEWNVIKPRHLSLLRSALEGKSSNKEQSDLWTPLADQGWRPCLESVNTPSALP  98

Query  361  EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVD  540
            + SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDI+DVD
Sbjct  99   QNSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIYDVD  158

Query  541  HFIEVLKDD  567
            HFI VLKDD
Sbjct  159  HFINVLKDD  167



>gb|KDP29763.1| hypothetical protein JCGZ_18698 [Jatropha curcas]
Length=509

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +AS S  SES + KPRH  L  SALQ ET+ E+++++W+PLA+QGW+   +S       E
Sbjct  31   HASLSTFSESHVPKPRHLPLLNSALQHETSQEKQSDLWVPLADQGWRTCAESTNAPSLPE  90

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KSEGYLQ+FLDGGLNQQRMGICDAVAVAKILNATLVIP+ EVNPVW+DSSSFMDIFD+DH
Sbjct  91   KSEGYLQIFLDGGLNQQRMGICDAVAVAKILNATLVIPHFEVNPVWRDSSSFMDIFDIDH  150

Query  544  FIEVLKDD  567
            FI+VLKDD
Sbjct  151  FIDVLKDD  158



>ref|XP_004288516.2| PREDICTED: uncharacterized protein At1g04910 [Fragaria vesca 
subsp. vesca]
Length=529

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 107/139 (77%), Gaps = 11/139 (8%)
 Frame = +1

Query  184  YASPSILSE-----------SIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPV  330
            +ASPS+LSE             + K RH  L KSALQR+T+ EE +E+W PLA+Q WKP 
Sbjct  40   HASPSMLSEWNVMVKSNAQEGNVPKSRHQRLLKSALQRQTSEEELSELWTPLADQAWKPC  99

Query  331  PDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDS  510
             +  +     EKSEG++QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVW+DS
Sbjct  100  IEPSIAPSLPEKSEGFIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWRDS  159

Query  511  SSFMDIFDVDHFIEVLKDD  567
            SSFMDIFDVDHFI VLKDD
Sbjct  160  SSFMDIFDVDHFINVLKDD  178



>ref|XP_004509777.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum]
Length=501

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = +1

Query  223  KPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGG  402
            KPRHS L +SA+QRET   + +EIW PL NQGWKP  +S       EKSEGY+QVFLDGG
Sbjct  36   KPRHSRLLRSAVQRETPTSQLSEIWTPLENQGWKPCDESRNKPTLPEKSEGYIQVFLDGG  95

Query  403  LNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            LNQQRMGICDAVAVAKILNATLVIPYLE+NPVW+DSSSFMDIFDVDHFI+VLKDD
Sbjct  96   LNQQRMGICDAVAVAKILNATLVIPYLELNPVWRDSSSFMDIFDVDHFIDVLKDD  150



>ref|XP_009364252.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Pyrus 
x bretschneideri]
Length=513

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +ASPS+ SE  + K +H  L KSALQR+T+  E +++W PLAN+ WKP  +S +     E
Sbjct  35   HASPSMYSEWNVPKSKHLRLLKSALQRQTSEGELSDLWTPLANESWKPCAESSIAPSLPE  94

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
             SEG++QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVW+DSSSFMDIFDVDH
Sbjct  95   NSEGFIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWRDSSSFMDIFDVDH  154

Query  544  FIEVLKDD  567
            FI VLKDD
Sbjct  155  FINVLKDD  162



>ref|XP_010312650.1| PREDICTED: uncharacterized protein At1g04910 isoform X4 [Solanum 
lycopersicum]
Length=468

 Score =   190 bits (483),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            Y SP+ILS+    K RHS L KSA+QR+T+ EE++ +W PL +QGWKP   S   S   E
Sbjct  28   YGSPTILSDLNAPKFRHSRLAKSAIQRQTSNEEQSRLWTPLEHQGWKPCTKSDAASTVPE  87

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KSEGY+QVFLDGGLNQQRMGICDAV VAKILNATLVIP LEVNPVWQDSSSF DIFDVDH
Sbjct  88   KSEGYVQVFLDGGLNQQRMGICDAVVVAKILNATLVIPQLEVNPVWQDSSSFEDIFDVDH  147

Query  544  FIEVLKDD  567
            FI  LKDD
Sbjct  148  FINALKDD  155



>ref|XP_009797995.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Nicotiana sylvestris]
Length=503

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 106/128 (83%), Gaps = 1/128 (1%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +ASP+IL +    K RHS L KSAL R+T+ EE++E+W PLA+QGWKP  +S   S   E
Sbjct  26   HASPTILKDLNAPKFRHSRLAKSALLRQTSNEEQSELWTPLAHQGWKPCTESDGAS-IPE  84

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KSEGY+QVFLDGGLNQQRMGICDAV VAKILNATLVIP LEVNPVWQDSSSFMDIFDVDH
Sbjct  85   KSEGYVQVFLDGGLNQQRMGICDAVVVAKILNATLVIPQLEVNPVWQDSSSFMDIFDVDH  144

Query  544  FIEVLKDD  567
            FI VLKDD
Sbjct  145  FINVLKDD  152



>ref|XP_010312647.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Solanum 
lycopersicum]
Length=506

 Score =   191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            Y SP+ILS+    K RHS L KSA+QR+T+ EE++ +W PL +QGWKP   S   S   E
Sbjct  28   YGSPTILSDLNAPKFRHSRLAKSAIQRQTSNEEQSRLWTPLEHQGWKPCTKSDAASTVPE  87

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KSEGY+QVFLDGGLNQQRMGICDAV VAKILNATLVIP LEVNPVWQDSSSF DIFDVDH
Sbjct  88   KSEGYVQVFLDGGLNQQRMGICDAVVVAKILNATLVIPQLEVNPVWQDSSSFEDIFDVDH  147

Query  544  FIEVLKDD  567
            FI  LKDD
Sbjct  148  FINALKDD  155



>ref|XP_003613049.1| DUF246 domain-containing protein [Medicago truncatula]
 gb|AES96007.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=503

 Score =   191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            +S S+ SE    KPRHS L +SA+QRET   + +EIW PL NQGWK   +SG      EK
Sbjct  26   SSSSMYSEMNPIKPRHSRLLRSAVQRETPTSQLSEIWAPLENQGWKSCDESGNRPTLPEK  85

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            SEGY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLE+NPVW+DSSSF DIFDVDHF
Sbjct  86   SEGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLELNPVWKDSSSFEDIFDVDHF  145

Query  547  IEVLKDD  567
            I+VLKDD
Sbjct  146  IDVLKDD  152



>ref|XP_006353172.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum tuberosum]
Length=506

 Score =   190 bits (483),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +ASP+ILS+    K RHS L KSA+QR+T+ EE +++W PL +QGWKP  +S   S   E
Sbjct  28   HASPTILSDLNAPKFRHSRLAKSAIQRQTSNEEVSQLWTPLEHQGWKPCSESDAASTVPE  87

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KSEGY+QVFLDGGLNQQRMGICDAV VAKILNATLVIP LEVNPVWQDSSSF DIFDVDH
Sbjct  88   KSEGYVQVFLDGGLNQQRMGICDAVVVAKILNATLVIPQLEVNPVWQDSSSFEDIFDVDH  147

Query  544  FIEVLKDD  567
            FI  LKDD
Sbjct  148  FINALKDD  155



>ref|XP_010664406.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Vitis 
vinifera]
Length=446

 Score =   189 bits (479),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASPSI SE    KPRH  L K ALQ +T   ++A +W PLANQGWKP  DS       +K
Sbjct  37   ASPSIFSEWNAPKPRHLQLLKGALQLQTPDRQQANLWSPLANQGWKPCVDSADTPLLPKK  96

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S+GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQDSSSF +IFD+DHF
Sbjct  97   SQGYVQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQDSSSFAEIFDIDHF  156

Query  547  IEVLKDD  567
            I VLKDD
Sbjct  157  INVLKDD  163



>gb|KJB18181.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=451

 Score =   188 bits (478),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 103/129 (80%), Gaps = 1/129 (1%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSK-FS  360
            +ASPS   E  + KPRH  L  SALQRE++  E  ++W PLA+QGW+P     + +    
Sbjct  39   HASPSTFLEWSVPKPRHLQLLSSALQRESSDGEPTDLWAPLADQGWRPCLGGSVNAPPLP  98

Query  361  EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVD  540
            +KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVD
Sbjct  99   QKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVD  158

Query  541  HFIEVLKDD  567
            HFI VLKDD
Sbjct  159  HFINVLKDD  167



>ref|XP_002310868.1| hypothetical protein POPTR_0007s14280g [Populus trichocarpa]
 gb|ABK95421.1| unknown [Populus trichocarpa]
 gb|EEE91318.1| hypothetical protein POPTR_0007s14280g [Populus trichocarpa]
Length=506

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 105/129 (81%), Gaps = 1/129 (1%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDS-GLFSKFS  360
            +ASPS+LSE    KPRH  L KSALQ  T+ E+++++W PL +QGW+P  +S        
Sbjct  28   HASPSVLSEWNAPKPRHLPLLKSALQLPTSNEKQSDLWTPLDDQGWRPCAESTNSPPSLP  87

Query  361  EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVD  540
            EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIP+ EVNPVWQDSSSFMDIFDVD
Sbjct  88   EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHFEVNPVWQDSSSFMDIFDVD  147

Query  541  HFIEVLKDD  567
            HFI VLKDD
Sbjct  148  HFINVLKDD  156



>ref|XP_007207425.1| hypothetical protein PRUPE_ppa004921mg [Prunus persica]
 gb|EMJ08624.1| hypothetical protein PRUPE_ppa004921mg [Prunus persica]
Length=474

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +1

Query  199  ILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGY  378
            +LSE  + K RH  L KSALQR+T+  E +++W PLANQ  KP  +S + +   EKSEG+
Sbjct  1    MLSEWNVPKSRHQRLLKSALQRQTSEGELSDLWTPLANQSLKPCAESSIATSLPEKSEGF  60

Query  379  LQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVL  558
            +QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVW+DSSSFMDIFDVDHFI VL
Sbjct  61   IQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWRDSSSFMDIFDVDHFINVL  120

Query  559  KDD  567
            KDD
Sbjct  121  KDD  123



>ref|XP_011021848.1| PREDICTED: uncharacterized protein At1g04910 [Populus euphratica]
Length=506

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 105/129 (81%), Gaps = 1/129 (1%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKP-VPDSGLFSKFS  360
            +ASPS+LSE    KPRH  L KSALQ  T+ E+++++W PL +QGW+P V  +       
Sbjct  28   HASPSVLSEWNAPKPRHLPLLKSALQLPTSNEKQSDLWTPLDDQGWRPCVESTNSPPSLP  87

Query  361  EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVD  540
            EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIP+ EVNPVWQDSSSFMDIFDVD
Sbjct  88   EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHFEVNPVWQDSSSFMDIFDVD  147

Query  541  HFIEVLKDD  567
            HFI VLKDD
Sbjct  148  HFINVLKDD  156



>ref|XP_002283844.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Vitis 
vinifera]
 emb|CBI19265.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASPSI SE    KPRH  L K ALQ +T   ++A +W PLANQGWKP  DS       +K
Sbjct  37   ASPSIFSEWNAPKPRHLQLLKGALQLQTPDRQQANLWSPLANQGWKPCVDSADTPLLPKK  96

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S+GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQDSSSF +IFD+DHF
Sbjct  97   SQGYVQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQDSSSFAEIFDIDHF  156

Query  547  IEVLKDD  567
            I VLKDD
Sbjct  157  INVLKDD  163



>gb|KJB18179.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
 gb|KJB18180.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
 gb|KJB18183.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
 gb|KJB18184.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=518

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 103/129 (80%), Gaps = 1/129 (1%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSK-FS  360
            +ASPS   E  + KPRH  L  SALQRE++  E  ++W PLA+QGW+P     + +    
Sbjct  39   HASPSTFLEWSVPKPRHLQLLSSALQRESSDGEPTDLWAPLADQGWRPCLGGSVNAPPLP  98

Query  361  EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVD  540
            +KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVD
Sbjct  99   QKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVD  158

Query  541  HFIEVLKDD  567
            HFI VLKDD
Sbjct  159  HFINVLKDD  167



>gb|KHG22139.1| hypothetical protein F383_05782 [Gossypium arboreum]
Length=467

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 103/129 (80%), Gaps = 1/129 (1%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSK-FS  360
            +ASPS   E  + KPRH  L  SALQRE++  E  ++W PLA+QGW+P     + +    
Sbjct  39   HASPSTFLEWNVPKPRHLRLLTSALQRESSNGEPTDLWAPLADQGWRPCLGGSVNAPPLP  98

Query  361  EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVD  540
            +KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVD
Sbjct  99   QKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVD  158

Query  541  HFIEVLKDD  567
            HFI V+KDD
Sbjct  159  HFINVMKDD  167



>ref|XP_008347790.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Malus domestica]
Length=513

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +ASPS+ SE  + K +H  L  SALQR+T+  E +++W PLA++ WKP  +S +     E
Sbjct  35   HASPSMYSEWNVPKSKHQRLLXSALQRQTSEGELSDLWAPLASESWKPCAESSVAPSLPE  94

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KSEG++QVFLDGGLNQQRMGICDAVAVA+ILNATLVIPYLEVNPVW+DSSSFMDIFDVDH
Sbjct  95   KSEGFIQVFLDGGLNQQRMGICDAVAVARILNATLVIPYLEVNPVWRDSSSFMDIFDVDH  154

Query  544  FIEVLKDD  567
            FI VLKDD
Sbjct  155  FINVLKDD  162



>gb|KJB18182.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=519

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFS--KF  357
            +ASPS   E  + KPRH  L  SALQRE++  E  ++W PLA+QGW+P     + +    
Sbjct  39   HASPSTFLEWSVPKPRHLQLLSSALQRESSDGEPTDLWAPLADQGWRPCLGGSVNAPPAL  98

Query  358  SEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDV  537
             +KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDV
Sbjct  99   PQKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDV  158

Query  538  DHFIEVLKDD  567
            DHFI VLKDD
Sbjct  159  DHFINVLKDD  168



>ref|XP_009350347.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Pyrus x bretschneideri]
Length=513

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +ASPS+ SE  + K +H  L +SALQR+T+  E +++W PLA++ WKP  +S +     E
Sbjct  35   HASPSMYSEWNVPKSKHQRLLRSALQRQTSEGELSDLWAPLASESWKPCAESSVAPSLPE  94

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KSEG++QVFLDGGLNQQRMGICDAVAVA+ILNATLVIPYLEVNPVW+DSSSFM+IFDVDH
Sbjct  95   KSEGFIQVFLDGGLNQQRMGICDAVAVARILNATLVIPYLEVNPVWRDSSSFMEIFDVDH  154

Query  544  FIEVLKDD  567
            FI VLKDD
Sbjct  155  FINVLKDD  162



>gb|AFK40388.1| unknown [Lotus japonicus]
Length=502

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 99/115 (86%), Gaps = 1/115 (1%)
 Frame = +1

Query  223  KPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGG  402
            KPRHS L +SA+QRET   + +EIW PL NQGWKPV +S       EKSEGY+QVFLDGG
Sbjct  38   KPRHSRLLRSAVQRETPTSQLSEIWSPLENQGWKPV-ESRNKPTLPEKSEGYIQVFLDGG  96

Query  403  LNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            LNQQRMGICDAVAVAKILNATLVIPYLE+NPVW+DSSSFMDIFDVDHFI+VLKDD
Sbjct  97   LNQQRMGICDAVAVAKILNATLVIPYLELNPVWRDSSSFMDIFDVDHFIDVLKDD  151



>gb|KDO81174.1| hypothetical protein CISIN_1g020969mg [Citrus sinensis]
Length=319

 Score =   183 bits (465),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASP++LSE    KPRHSSL K AL R+   E+++E+W PL +QGW+P  +S   S   +K
Sbjct  40   ASPTMLSEWNAPKPRHSSLLKIALHRQIPTEQQSELWSPLVSQGWRPCAESTGTSSLPKK  99

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S GY+QVFLDGGLNQQRMGICDAVAVAKILNATLV+P+LEVNPVW+DSSSF DIFDVDHF
Sbjct  100  SRGYVQVFLDGGLNQQRMGICDAVAVAKILNATLVLPHLEVNPVWRDSSSFADIFDVDHF  159

Query  547  IEVLKDD  567
            I  L+D+
Sbjct  160  ISSLRDE  166



>ref|XP_003517397.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
Length=516

 Score =   188 bits (477),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  SPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKS  369
            S S+  E    KPRHS L +SA+QRET   + +E+W PL +QGWKP  +S   +   EKS
Sbjct  40   SSSVFPELNPIKPRHSRLLRSAVQRETPTSQLSELWSPLESQGWKPYVESNKPTALPEKS  99

Query  370  EGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFI  549
            EGY+QVFLDGGLNQQ+MGICDAVAVAKILNATLVIPYLE+NPVW+DSSSFMDIFDVDHFI
Sbjct  100  EGYIQVFLDGGLNQQKMGICDAVAVAKILNATLVIPYLELNPVWRDSSSFMDIFDVDHFI  159

Query  550  EVLKDD  567
            +VLKDD
Sbjct  160  DVLKDD  165



>gb|KHN14510.1| DUF246 domain-containing protein [Glycine soja]
Length=516

 Score =   187 bits (476),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  SPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKS  369
            S S+  E    KPRHS L +SA+QRET   + +E+W PL +QGWKP  +S   +   EKS
Sbjct  40   SSSVFPELNPIKPRHSRLLRSAVQRETPTSQLSELWSPLESQGWKPYVESNKPTALPEKS  99

Query  370  EGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFI  549
            EGY+QVFLDGGLNQQ+MGICDAVAVAKILNATLVIPYLE+NPVW+DSSSFMDIFDVDHFI
Sbjct  100  EGYIQVFLDGGLNQQKMGICDAVAVAKILNATLVIPYLELNPVWRDSSSFMDIFDVDHFI  159

Query  550  EVLKDD  567
            +VLKDD
Sbjct  160  DVLKDD  165



>ref|XP_006587571.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Glycine max]
Length=516

 Score =   187 bits (475),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = +1

Query  223  KPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGG  402
            KPRHS L +SA+Q ET   + +EIW PL +QGWKP  +S   +   EKSEGY+QVFLDGG
Sbjct  51   KPRHSRLLRSAVQHETPTSQLSEIWSPLESQGWKPYVESNKPTALPEKSEGYIQVFLDGG  110

Query  403  LNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            LNQQRMGICDAVAVAKILNATLVIPYLE+NPVW+DSSSFMDIFDVDHFI+VLKDD
Sbjct  111  LNQQRMGICDAVAVAKILNATLVIPYLELNPVWRDSSSFMDIFDVDHFIDVLKDD  165



>ref|XP_010254530.1| PREDICTED: uncharacterized protein At1g04910-like [Nelumbo nucifera]
Length=522

 Score =   187 bits (476),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +ASPS+ SE    KPRH  L K ALQR+++  +++++W PLA+QGWKP  +S   S   E
Sbjct  36   HASPSVFSEWNAPKPRHLPLLKGALQRQSSDRQQSDLWSPLADQGWKPCINSANPSVIPE  95

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KS+GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+ EVNPVWQDSSSF +IFDVDH
Sbjct  96   KSQGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHFEVNPVWQDSSSFSEIFDVDH  155

Query  544  FIEVLKDD  567
            FI VLKD+
Sbjct  156  FINVLKDE  163



>ref|XP_010312648.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Solanum 
lycopersicum]
Length=505

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 102/128 (80%), Gaps = 1/128 (1%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            Y SP+ILS+    K RHS L KSA+QR+T+ EE++ +W PL +QGWKP   S   S   E
Sbjct  28   YGSPTILSDLNAPKFRHSRLAKSAIQRQTSNEEQSRLWTPLEHQGWKPCTKSDAAS-IPE  86

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KSEGY+QVFLDGGLNQQRMGICDAV VAKILNATLVIP LEVNPVWQDSSSF DIFDVDH
Sbjct  87   KSEGYVQVFLDGGLNQQRMGICDAVVVAKILNATLVIPQLEVNPVWQDSSSFEDIFDVDH  146

Query  544  FIEVLKDD  567
            FI  LKDD
Sbjct  147  FINALKDD  154



>ref|XP_007207426.1| hypothetical protein PRUPE_ppa004921mg [Prunus persica]
 gb|EMJ08625.1| hypothetical protein PRUPE_ppa004921mg [Prunus persica]
Length=485

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = +1

Query  217  IAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLD  396
            + K RH  L KSALQR+T+  E +++W PLANQ  KP  +S + +   EKSEG++QVFLD
Sbjct  18   VPKSRHQRLLKSALQRQTSEGELSDLWTPLANQSLKPCAESSIATSLPEKSEGFIQVFLD  77

Query  397  GGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            GGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVW+DSSSFMDIFDVDHFI VLKDD
Sbjct  78   GGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWRDSSSFMDIFDVDHFINVLKDD  134



>ref|XP_010277498.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Nelumbo nucifera]
Length=396

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +ASPS+ SE    KP+H  L K ALQR+ +  +++E+W PLA+QGWKP   S   S   +
Sbjct  36   HASPSLFSEWNAPKPKHLPLLKGALQRQPSGRQQSELWSPLADQGWKPCLKSASSSVLPK  95

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KS+GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+ EVNPVWQDSSSF +IFDVDH
Sbjct  96   KSQGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHFEVNPVWQDSSSFSEIFDVDH  155

Query  544  FIEVLKDD  567
            FI+VLKD+
Sbjct  156  FIDVLKDE  163



>ref|XP_006353173.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Solanum tuberosum]
Length=505

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 104/128 (81%), Gaps = 1/128 (1%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +ASP+ILS+    K RHS L KSA+QR+T+ EE +++W PL +QGWKP  +S   S   E
Sbjct  28   HASPTILSDLNAPKFRHSRLAKSAIQRQTSNEEVSQLWTPLEHQGWKPCSESDAAS-IPE  86

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KSEGY+QVFLDGGLNQQRMGICDAV VAKILNATLVIP LEVNPVWQDSSSF DIFDVDH
Sbjct  87   KSEGYVQVFLDGGLNQQRMGICDAVVVAKILNATLVIPQLEVNPVWQDSSSFEDIFDVDH  146

Query  544  FIEVLKDD  567
            FI  LKDD
Sbjct  147  FINALKDD  154



>gb|KDO60569.1| hypothetical protein CISIN_1g009234mg [Citrus sinensis]
Length=473

 Score =   184 bits (467),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +1

Query  202  LSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYL  381
            + E    KPRH  LFKSALQR +   +++++W+PLANQGW+    S       +KS+GY+
Sbjct  1    MQEPNAPKPRHLPLFKSALQRPSANAKQSDLWLPLANQGWRSCAQSANNPSLPQKSQGYI  60

Query  382  QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLK  561
            QVFLDGGLNQQRMGICDAVAV KILNATLVIPYLEVNPVWQDSSSFMDI+DVDHFI VLK
Sbjct  61   QVFLDGGLNQQRMGICDAVAVTKILNATLVIPYLEVNPVWQDSSSFMDIYDVDHFINVLK  120

Query  562  DD  567
            DD
Sbjct  121  DD  122



>ref|XP_010519195.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=518

 Score =   185 bits (470),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 104/127 (82%), Gaps = 2/127 (2%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            A+ S  SE    KPRH SL KS+LQR +   E++++W PL +QGW+P  DSG      EK
Sbjct  41   AASSTSSEWNTVKPRHLSLLKSSLQRPSG--EQSDLWRPLTDQGWRPCIDSGNGPSLPEK  98

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            SEGY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSF++IFDVDHF
Sbjct  99   SEGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFVEIFDVDHF  158

Query  547  IEVLKDD  567
            IEVLK+D
Sbjct  159  IEVLKND  165



>ref|XP_008236135.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Prunus 
mume]
Length=529

 Score =   185 bits (470),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 106/139 (76%), Gaps = 11/139 (8%)
 Frame = +1

Query  184  YASPSILS-----------ESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPV  330
            +ASPS+LS           E  + K RH  L KSALQR+T+  E +++W PLANQ  KP 
Sbjct  40   HASPSMLSGLNVMMKSNFQEWNVPKSRHQRLLKSALQRQTSEGELSDLWTPLANQSLKPC  99

Query  331  PDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDS  510
             +S +     +KSEG++QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVW+DS
Sbjct  100  AESSIAPSLPDKSEGFIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWRDS  159

Query  511  SSFMDIFDVDHFIEVLKDD  567
            SSFMDIFDVDHFI VLKDD
Sbjct  160  SSFMDIFDVDHFINVLKDD  178



>ref|XP_002268599.2| PREDICTED: uncharacterized protein At1g04910 [Vitis vinifera]
 emb|CBI38269.3| unnamed protein product [Vitis vinifera]
Length=510

 Score =   185 bits (469),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +ASPS+ SE    KPRHS L KS LQ +++  E++++W PL NQGWK    S       +
Sbjct  33   HASPSVFSEWNAPKPRHSRLLKSVLQGQSSNVEQSDLWTPLVNQGWKACELSASTPGLPQ  92

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            +++GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVW+DSSSFMDIFDVDH
Sbjct  93   ETQGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWRDSSSFMDIFDVDH  152

Query  544  FIEVLKDD  567
            FI VLKDD
Sbjct  153  FINVLKDD  160



>ref|XP_010277497.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nelumbo nucifera]
Length=514

 Score =   184 bits (468),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +ASPS+ SE    KP+H  L K ALQR+ +  +++E+W PLA+QGWKP   S   S   +
Sbjct  36   HASPSLFSEWNAPKPKHLPLLKGALQRQPSGRQQSELWSPLADQGWKPCLKSASSSVLPK  95

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KS+GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+ EVNPVWQDSSSF +IFDVDH
Sbjct  96   KSQGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHFEVNPVWQDSSSFSEIFDVDH  155

Query  544  FIEVLKDD  567
            FI+VLKD+
Sbjct  156  FIDVLKDE  163



>ref|XP_006472461.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Citrus sinensis]
 ref|XP_006472462.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Citrus sinensis]
Length=517

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASP++LSE    KPRHSSL K AL R+   E+++E+W PL +QGW+P  +S   S   +K
Sbjct  40   ASPTMLSEWNAPKPRHSSLLKIALHRQIPTEQQSELWSPLVSQGWRPCAESTGTSSLPKK  99

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S GY+QVFLDGGLNQQRMGICDAVAVAKILNATLV+P+LEVNPVW+DSSSF DIFDVDHF
Sbjct  100  SRGYVQVFLDGGLNQQRMGICDAVAVAKILNATLVLPHLEVNPVWRDSSSFADIFDVDHF  159

Query  547  IEVLKDD  567
            I  L+D+
Sbjct  160  ISSLRDE  166



>ref|XP_008385667.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g04910 
[Malus domestica]
Length=524

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 106/139 (76%), Gaps = 11/139 (8%)
 Frame = +1

Query  184  YASPSILS-----------ESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPV  330
            +ASPS+ S           E  + K +H  L KSALQR+T+  E +++W PLAN+ WKP 
Sbjct  35   HASPSMYSGLDVMTKPTFQEWNVPKSKHLRLLKSALQRQTSEGELSDLWTPLANESWKPC  94

Query  331  PDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDS  510
             +S +     EKSEG++QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVW+DS
Sbjct  95   AESSIAPSLPEKSEGFIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWRDS  154

Query  511  SSFMDIFDVDHFIEVLKDD  567
            SSFMDIFDVDHFI VLKDD
Sbjct  155  SSFMDIFDVDHFINVLKDD  173



>ref|XP_010523312.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=517

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 104/128 (81%), Gaps = 2/128 (2%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +A+ S  SE    KPRH SL KSA+QR +   E++++W PL +QGWKP  D G      E
Sbjct  41   HAASSKSSEWNAVKPRHLSLLKSAVQRSSG--EQSDLWRPLTDQGWKPCIDPGNAPSIPE  98

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KSEGY+QVFLDGGLNQQRMGICDAVAVAKILNATLV+PYLEVNPVWQDSSSF++IFDVDH
Sbjct  99   KSEGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVVPYLEVNPVWQDSSSFVEIFDVDH  158

Query  544  FIEVLKDD  567
            FI+VLKDD
Sbjct  159  FIDVLKDD  166



>ref|XP_010523308.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Tarenaya hassleriana]
 ref|XP_010523309.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Tarenaya hassleriana]
Length=517

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 104/128 (81%), Gaps = 2/128 (2%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +A+ S  SE    KPRH SL KSA+QR +   E++++W PL +QGWKP  D G      E
Sbjct  41   HAASSKPSEWNAVKPRHLSLLKSAVQRSSG--EQSDLWRPLTDQGWKPCIDPGNAPSIPE  98

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KSEGY+QVFLDGGLNQQRMGICDAVAVAKILNATLV+PYLEVNPVWQDSSSF++IFDVDH
Sbjct  99   KSEGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVVPYLEVNPVWQDSSSFVEIFDVDH  158

Query  544  FIEVLKDD  567
            FI+VLKDD
Sbjct  159  FIDVLKDD  166



>ref|XP_006573005.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Glycine max]
Length=515

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 102/126 (81%), Gaps = 1/126 (1%)
 Frame = +1

Query  190  SPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKS  369
            S S+  E    KPRHS L +SA+QRET   + +E+W PL +QGWKP  +S       EKS
Sbjct  40   SSSVFPELNPIKPRHSRLLRSAVQRETPTSQLSELWSPLESQGWKPYVESNK-PTLPEKS  98

Query  370  EGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFI  549
            EGY+QVFLDGGLNQQ+MGICDAVAVAKILNATLVIPYLE+NPVW+DSSSFMDIFDVDHFI
Sbjct  99   EGYIQVFLDGGLNQQKMGICDAVAVAKILNATLVIPYLELNPVWRDSSSFMDIFDVDHFI  158

Query  550  EVLKDD  567
            +VLKDD
Sbjct  159  DVLKDD  164



>ref|XP_006433827.1| hypothetical protein CICLE_v10000880mg [Citrus clementina]
 gb|ESR47067.1| hypothetical protein CICLE_v10000880mg [Citrus clementina]
Length=517

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASP++ SE    +PRHSSL K AL R+   E+++E+W PL NQGW+P  +S   S   +K
Sbjct  40   ASPTMFSEWNAPQPRHSSLLKIALHRQIPTEQQSELWSPLVNQGWRPCAESTGTSSLPKK  99

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S GY+QVFLDGGLNQQRMGICDAVAVAKILNATLV+P+LEVNPVW+DSSSF DIFDVDHF
Sbjct  100  SRGYVQVFLDGGLNQQRMGICDAVAVAKILNATLVLPHLEVNPVWRDSSSFADIFDVDHF  159

Query  547  IEVLKDD  567
            I  L+D+
Sbjct  160  ISSLRDE  166



>ref|XP_006466306.1| PREDICTED: uncharacterized protein At1g04910-like [Citrus sinensis]
Length=539

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +1

Query  223  KPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGG  402
            KPRH  LFKSALQR +   +++++W+PLANQGW+    S       +KS+GY+QVFLDGG
Sbjct  74   KPRHLPLFKSALQRPSANAKQSDLWLPLANQGWRSCAQSANNPSLPQKSQGYIQVFLDGG  133

Query  403  LNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            LNQQRMGICDAVAV KILNATLVIPYLEVNPVWQDSSSFMDI+DVDHFI VLKDD
Sbjct  134  LNQQRMGICDAVAVTKILNATLVIPYLEVNPVWQDSSSFMDIYDVDHFINVLKDD  188



>ref|XP_006426272.1| hypothetical protein CICLE_v10025329mg [Citrus clementina]
 gb|ESR39512.1| hypothetical protein CICLE_v10025329mg [Citrus clementina]
 gb|KDO60568.1| hypothetical protein CISIN_1g009234mg [Citrus sinensis]
Length=539

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +1

Query  223  KPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGG  402
            KPRH  LFKSALQR +   +++++W+PLANQGW+    S       +KS+GY+QVFLDGG
Sbjct  74   KPRHLPLFKSALQRPSANAKQSDLWLPLANQGWRSCAQSANNPSLPQKSQGYIQVFLDGG  133

Query  403  LNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            LNQQRMGICDAVAV KILNATLVIPYLEVNPVWQDSSSFMDI+DVDHFI VLKDD
Sbjct  134  LNQQRMGICDAVAVTKILNATLVIPYLEVNPVWQDSSSFMDIYDVDHFINVLKDD  188



>gb|KJB58884.1| hypothetical protein B456_009G229500 [Gossypium raimondii]
Length=330

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASPS+ SE    KPRH SL + AL  +T  ++  ++W PL NQGWKP  DS       E+
Sbjct  41   ASPSLFSEWNAPKPRHLSLLEVALHWKTPIKQLFDLWSPLPNQGWKPCIDSADTPSLPER  100

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S+GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQDSSSF DIFDVDHF
Sbjct  101  SQGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQDSSSFTDIFDVDHF  160

Query  547  IEVLKDD  567
            I VL+D+
Sbjct  161  INVLRDE  167



>ref|XP_003534239.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
 gb|KHN38876.1| DUF246 domain-containing protein [Glycine soja]
Length=515

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 97/115 (84%), Gaps = 1/115 (1%)
 Frame = +1

Query  223  KPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGG  402
            KPRHS L +SA+Q ET   + +EIW PL +QGWKP  +S       EKSEGY+QVFLDGG
Sbjct  51   KPRHSRLLRSAVQHETPTSQLSEIWSPLESQGWKPYVESNK-PTLPEKSEGYIQVFLDGG  109

Query  403  LNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            LNQQRMGICDAVAVAKILNATLVIPYLE+NPVW+DSSSFMDIFDVDHFI+VLKDD
Sbjct  110  LNQQRMGICDAVAVAKILNATLVIPYLELNPVWRDSSSFMDIFDVDHFIDVLKDD  164



>ref|XP_009364251.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Pyrus 
x bretschneideri]
Length=524

 Score =   183 bits (464),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 99/124 (80%), Gaps = 0/124 (0%)
 Frame = +1

Query  196  SILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEG  375
            S   E  + K +H  L KSALQR+T+  E +++W PLAN+ WKP  +S +     E SEG
Sbjct  50   STFQEWNVPKSKHLRLLKSALQRQTSEGELSDLWTPLANESWKPCAESSIAPSLPENSEG  109

Query  376  YLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEV  555
            ++QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVW+DSSSFMDIFDVDHFI V
Sbjct  110  FIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWRDSSSFMDIFDVDHFINV  169

Query  556  LKDD  567
            LKDD
Sbjct  170  LKDD  173



>gb|AAX20003.1| unknown protein [Iris tectorum]
Length=251

 Score =   176 bits (446),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 100/128 (78%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +ASPS  SE    K RH SL K ALQRE + E+KAE+W PL  QGWKP   S   +    
Sbjct  35   HASPSTFSEWNAPKSRHLSLLKGALQREISEEQKAELWSPLKAQGWKPCIRSASNALLPT  94

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KS GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVW+D+SSF ++FDV+H
Sbjct  95   KSGGYVQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWKDTSSFDEVFDVEH  154

Query  544  FIEVLKDD  567
            FI++LK D
Sbjct  155  FIQILKYD  162



>gb|KHG27420.1| hypothetical protein F383_15612 [Gossypium arboreum]
Length=498

 Score =   182 bits (462),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +1

Query  217  IAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLD  396
            + KPRH  L +SALQRE    E++++W PLA+QGW+P   S       +KSEGYLQVFLD
Sbjct  31   VPKPRHLRLLRSALQRERLTGEQSDLWAPLADQGWRPYLGSVNAPSLPQKSEGYLQVFLD  90

Query  397  GGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            GGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQDSSSFMDIFDVDHF+ VLKD+
Sbjct  91   GGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQDSSSFMDIFDVDHFMNVLKDE  147



>ref|XP_009150636.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
 emb|CDY08790.1| BnaA06g24340D [Brassica napus]
Length=503

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 96/118 (81%), Gaps = 2/118 (2%)
 Frame = +1

Query  214  IIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFL  393
            I  KPRH SL KSALQR +   E++E+W P+ +QGW P  D G      EK+EGY+QVFL
Sbjct  35   ITIKPRHLSLLKSALQRPSG--EQSELWRPMTDQGWSPCLDLGNSPSLPEKTEGYIQVFL  92

Query  394  DGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            DGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSF+DIFDVDHFI  LKDD
Sbjct  93   DGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFVDIFDVDHFINTLKDD  150



>gb|KJB58885.1| hypothetical protein B456_009G229500 [Gossypium raimondii]
Length=399

 Score =   179 bits (455),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASPS+ SE    KPRH SL + AL  +T  ++  ++W PL NQGWKP  DS       E+
Sbjct  41   ASPSLFSEWNAPKPRHLSLLEVALHWKTPIKQLFDLWSPLPNQGWKPCIDSADTPSLPER  100

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S+GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQDSSSF DIFDVDHF
Sbjct  101  SQGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQDSSSFTDIFDVDHF  160

Query  547  IEVLKDD  567
            I VL+D+
Sbjct  161  INVLRDE  167



>ref|XP_004152738.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 ref|XP_004163454.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
Length=515

 Score =   182 bits (461),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASPS+ SE I  KPRH+ L  SAL R TT E++ EIW PL+NQGWKP            K
Sbjct  39   ASPSLFSEWISPKPRHTILLDSALHRITTFEDQKEIWSPLSNQGWKPCLKPTRMELSQRK  98

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S+GY+QVFLDGGLNQQRMGICDAVAVA+ILNATL+IP+LE+N VW+DSSSF +IFDVDHF
Sbjct  99   SQGYIQVFLDGGLNQQRMGICDAVAVARILNATLIIPHLEINAVWKDSSSFGEIFDVDHF  158

Query  547  IEVLKDD  567
            I+VL+DD
Sbjct  159  IDVLRDD  165



>gb|EPS73888.1| hypothetical protein M569_00867, partial [Genlisea aurea]
Length=498

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFS-KFS  360
            +ASPS+LSE    KP+HS+L KSAL+R+TT E + E+W PL++QGW     S        
Sbjct  32   HASPSVLSEWNPVKPQHSTLLKSALERQTTDERRTELWKPLSHQGWSSCASSRSSPSTLP  91

Query  361  EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVD  540
            EKS+GYLQVFLDGGLNQQRMGICDAVA+AKILNATLVIP  EV+ VWQDSS+FMDIFDVD
Sbjct  92   EKSQGYLQVFLDGGLNQQRMGICDAVALAKILNATLVIPQFEVHSVWQDSSTFMDIFDVD  151

Query  541  HFIEVLKDD  567
            HFI+VLKDD
Sbjct  152  HFIDVLKDD  160



>ref|XP_010939815.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=558

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 106/130 (82%), Gaps = 3/130 (2%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFS-  360
            +ASPS+ SE    KPRH SL K ALQR+   E+K+E+W PLA+QGW+P  +S  +S  S 
Sbjct  82   HASPSMFSEWNAPKPRHMSLLKGALQRQILDEQKSELWAPLAHQGWRPCIESA-YSPVSL  140

Query  361  -EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDV  537
              +S GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVW+DSSSF +I+DV
Sbjct  141  PTRSTGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWKDSSSFEEIYDV  200

Query  538  DHFIEVLKDD  567
            DHFI VLKD+
Sbjct  201  DHFISVLKDE  210



>ref|XP_007158370.1| hypothetical protein PHAVU_002G147300g [Phaseolus vulgaris]
 gb|ESW30364.1| hypothetical protein PHAVU_002G147300g [Phaseolus vulgaris]
Length=514

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 98/115 (85%), Gaps = 1/115 (1%)
 Frame = +1

Query  223  KPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGG  402
            KPRHS L +SA+QRET   + +E+W PL +QGWK   +S    K  EKSEGY+QVFLDGG
Sbjct  50   KPRHSRLLRSAVQRETPASQLSELWSPLESQGWKSYVESNK-PKLPEKSEGYIQVFLDGG  108

Query  403  LNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            LNQQRMGICDAVAVAKILNATLVIPYLE+NPVW+DSSSF+DIFDVDHFI+VLKDD
Sbjct  109  LNQQRMGICDAVAVAKILNATLVIPYLELNPVWRDSSSFVDIFDVDHFIDVLKDD  163



>ref|XP_006394027.1| hypothetical protein EUTSA_v10004041mg [Eutrema salsugineum]
 gb|ESQ31313.1| hypothetical protein EUTSA_v10004041mg [Eutrema salsugineum]
Length=506

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 98/120 (82%), Gaps = 2/120 (2%)
 Frame = +1

Query  208  ESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQV  387
            E+I  KPRH SL KSALQR +   E++ +W P+ +QGW P  D G      +K+EGY+QV
Sbjct  36   EAITIKPRHLSLLKSALQRSSG--EQSNLWRPMIDQGWSPCIDFGNSPSLPDKTEGYIQV  93

Query  388  FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSF+DIFDVDHFI+ LKDD
Sbjct  94   FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFVDIFDVDHFIDALKDD  153



>ref|XP_006472463.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Citrus sinensis]
Length=514

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 102/127 (80%), Gaps = 3/127 (2%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASP++LSE    KPRHSSL K AL R+   E+++E+W PL +QGW+P  +S    K   K
Sbjct  40   ASPTMLSEWNAPKPRHSSLLKIALHRQIPTEQQSELWSPLVSQGWRPCAESTALPK---K  96

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S GY+QVFLDGGLNQQRMGICDAVAVAKILNATLV+P+LEVNPVW+DSSSF DIFDVDHF
Sbjct  97   SRGYVQVFLDGGLNQQRMGICDAVAVAKILNATLVLPHLEVNPVWRDSSSFADIFDVDHF  156

Query  547  IEVLKDD  567
            I  L+D+
Sbjct  157  ISSLRDE  163



>emb|CDY14569.1| BnaC03g48900D [Brassica napus]
Length=503

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 96/118 (81%), Gaps = 2/118 (2%)
 Frame = +1

Query  214  IIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFL  393
            I  KPRH SL KSALQR +   E++E+W P+ +QGW P  D G      +K+EGY+QVFL
Sbjct  35   ITIKPRHLSLLKSALQRPSG--EQSELWRPMTDQGWSPCLDLGNSPSLPDKTEGYIQVFL  92

Query  394  DGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            DGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSF+DIFDVDHFI  LKDD
Sbjct  93   DGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFVDIFDVDHFINTLKDD  150



>ref|XP_010680342.1| PREDICTED: uncharacterized protein At1g04910 [Beta vulgaris subsp. 
vulgaris]
Length=506

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 104/127 (82%), Gaps = 1/127 (1%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            +SP++ SE + AKPRHS+L K AL  ET+P E +E+W PL +QGW+P   +G  +K    
Sbjct  31   SSPNLFSEWMSAKPRHSNLLKYALTSETSPGEPSELWSPLPDQGWRPCGVNGGAAK-PAN  89

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIP LEVNPVW+D+SSF +IFDVDHF
Sbjct  90   SSGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPLLEVNPVWKDTSSFEEIFDVDHF  149

Query  547  IEVLKDD  567
            I+VLKDD
Sbjct  150  IDVLKDD  156



>gb|KJB58883.1| hypothetical protein B456_009G229500 [Gossypium raimondii]
Length=489

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASPS+ SE    KPRH SL + AL  +T  ++  ++W PL NQGWKP  DS       E+
Sbjct  41   ASPSLFSEWNAPKPRHLSLLEVALHWKTPIKQLFDLWSPLPNQGWKPCIDSADTPSLPER  100

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S+GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQDSSSF DIFDVDHF
Sbjct  101  SQGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQDSSSFTDIFDVDHF  160

Query  547  IEVLKDD  567
            I VL+D+
Sbjct  161  INVLRDE  167



>ref|XP_006280335.1| hypothetical protein CARUB_v10026260mg [Capsella rubella]
 gb|EOA13233.1| hypothetical protein CARUB_v10026260mg [Capsella rubella]
Length=508

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 97/120 (81%), Gaps = 2/120 (2%)
 Frame = +1

Query  208  ESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQV  387
            E I  KPRH SL KSALQR +   E++++W PL +QGW P  D G       KSEGY+QV
Sbjct  38   EVITIKPRHLSLLKSALQRSSG--EQSDLWRPLTDQGWSPCIDLGNSPALPVKSEGYIQV  95

Query  388  FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQD+SSF+DIFDVDHFI+ LKDD
Sbjct  96   FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDTSSFVDIFDVDHFIDALKDD  155



>ref|XP_010113429.1| hypothetical protein L484_026763 [Morus notabilis]
 gb|EXC35456.1| hypothetical protein L484_026763 [Morus notabilis]
Length=553

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +1

Query  217  IAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLD  396
            + KPRHS L KSALQ ET+  +++++W PL NQGWK   +S +     EKS GY+QVFLD
Sbjct  89   VPKPRHSWLLKSALQAETSNTQQSDLWTPLGNQGWKQCVESSVGPTLPEKSTGYIQVFLD  148

Query  397  GGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            GGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVW+DSSSF DIFDV HFI VLKDD
Sbjct  149  GGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWRDSSSFEDIFDVHHFINVLKDD  205



>ref|XP_006433826.1| hypothetical protein CICLE_v10000880mg [Citrus clementina]
 gb|ESR47066.1| hypothetical protein CICLE_v10000880mg [Citrus clementina]
Length=514

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 101/127 (80%), Gaps = 3/127 (2%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASP++ SE    +PRHSSL K AL R+   E+++E+W PL NQGW+P  +S    K   K
Sbjct  40   ASPTMFSEWNAPQPRHSSLLKIALHRQIPTEQQSELWSPLVNQGWRPCAESTALPK---K  96

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S GY+QVFLDGGLNQQRMGICDAVAVAKILNATLV+P+LEVNPVW+DSSSF DIFDVDHF
Sbjct  97   SRGYVQVFLDGGLNQQRMGICDAVAVAKILNATLVLPHLEVNPVWRDSSSFADIFDVDHF  156

Query  547  IEVLKDD  567
            I  L+D+
Sbjct  157  ISSLRDE  163



>ref|XP_008347789.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Malus domestica]
Length=524

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 105/139 (76%), Gaps = 11/139 (8%)
 Frame = +1

Query  184  YASPSILS-----------ESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPV  330
            +ASPS+ S           E  + K +H  L  SALQR+T+  E +++W PLA++ WKP 
Sbjct  35   HASPSMYSGLNVMTKSTFQEWNVPKSKHQRLLXSALQRQTSEGELSDLWAPLASESWKPC  94

Query  331  PDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDS  510
             +S +     EKSEG++QVFLDGGLNQQRMGICDAVAVA+ILNATLVIPYLEVNPVW+DS
Sbjct  95   AESSVAPSLPEKSEGFIQVFLDGGLNQQRMGICDAVAVARILNATLVIPYLEVNPVWRDS  154

Query  511  SSFMDIFDVDHFIEVLKDD  567
            SSFMDIFDVDHFI VLKDD
Sbjct  155  SSFMDIFDVDHFINVLKDD  173



>ref|XP_010444520.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=507

 Score =   180 bits (456),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 98/121 (81%), Gaps = 2/121 (2%)
 Frame = +1

Query  205  SESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQ  384
            S+ I  KPRH SL KSALQR +   E++++W PL +QGW P  D G       KSEGY+Q
Sbjct  36   SDVITIKPRHLSLLKSALQRSSG--EQSDLWRPLTDQGWSPCIDLGNSPSLPVKSEGYIQ  93

Query  385  VFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKD  564
            VFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQD+SSF+DIFDVDHFI+ LKD
Sbjct  94   VFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDTSSFVDIFDVDHFIDSLKD  153

Query  565  D  567
            D
Sbjct  154  D  154



>ref|XP_009350346.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Pyrus x bretschneideri]
Length=524

 Score =   180 bits (456),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = +1

Query  196  SILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEG  375
            S   E  + K +H  L +SALQR+T+  E +++W PLA++ WKP  +S +     EKSEG
Sbjct  50   STFQEWNVPKSKHQRLLRSALQRQTSEGELSDLWAPLASESWKPCAESSVAPSLPEKSEG  109

Query  376  YLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEV  555
            ++QVFLDGGLNQQRMGICDAVAVA+ILNATLVIPYLEVNPVW+DSSSFM+IFDVDHFI V
Sbjct  110  FIQVFLDGGLNQQRMGICDAVAVARILNATLVIPYLEVNPVWRDSSSFMEIFDVDHFINV  169

Query  556  LKDD  567
            LKDD
Sbjct  170  LKDD  173



>ref|XP_009401410.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009401411.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=518

 Score =   180 bits (456),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +A PS+ SE    KP H SL + AL+R+T+ ++++E+W PLA+QGWKP  +S   S    
Sbjct  43   HAFPSLFSEWNAPKPMHLSLLRDALERKTSIDQQSELWAPLASQGWKPCIESTSTSSLPS  102

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KS GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLE+NPVW+DSSSF +I+DVDH
Sbjct  103  KSNGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEINPVWRDSSSFEEIYDVDH  162

Query  544  FIEVLKDD  567
            FI+VLK++
Sbjct  163  FIDVLKEE  170



>gb|KJB58881.1| hypothetical protein B456_009G229500 [Gossypium raimondii]
 gb|KJB58882.1| hypothetical protein B456_009G229500 [Gossypium raimondii]
Length=518

 Score =   180 bits (456),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASPS+ SE    KPRH SL + AL  +T  ++  ++W PL NQGWKP  DS       E+
Sbjct  41   ASPSLFSEWNAPKPRHLSLLEVALHWKTPIKQLFDLWSPLPNQGWKPCIDSADTPSLPER  100

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S+GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQDSSSF DIFDVDHF
Sbjct  101  SQGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQDSSSFTDIFDVDHF  160

Query  547  IEVLKDD  567
            I VL+D+
Sbjct  161  INVLRDE  167



>ref|XP_010523344.1| PREDICTED: uncharacterized protein At1g04910 [Tarenaya hassleriana]
 ref|XP_010523345.1| PREDICTED: uncharacterized protein At1g04910 [Tarenaya hassleriana]
Length=519

 Score =   179 bits (455),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  PSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSE  372
            PS+ SE    +PRH  L + AL RE    ++ E+W PL +QGWKP  +S   S  SEKS+
Sbjct  42   PSLFSEWNAPRPRHLRLLEGALSREIPIRQQVELWSPLPDQGWKPCTESYTVSSLSEKSQ  101

Query  373  GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIE  552
            G+LQVFLDGGLNQQRMGICDAVAVAKILN TLVIP+ EVNPVWQDSSSF DIFDVDHFI 
Sbjct  102  GFLQVFLDGGLNQQRMGICDAVAVAKILNVTLVIPHFEVNPVWQDSSSFTDIFDVDHFIS  161

Query  553  VLKDD  567
            +LKD+
Sbjct  162  ILKDE  166



>ref|XP_003602912.1| PsRT17-1 like protein [Medicago truncatula]
 gb|AES73163.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=517

 Score =   179 bits (455),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASPSI SE I  KPRH +L + ALQR  + E +  +W PLA QGWKP           EK
Sbjct  40   ASPSIFSEWIAPKPRHVTLLQGALQRRISVEVQTNLWSPLAYQGWKPCTVPPKSPSLPEK  99

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S GY+QVFLDGGLNQQ+MGICDAVAVAKILN TLVIP+ EVNPVWQDSSSF DIFDVDHF
Sbjct  100  SRGYIQVFLDGGLNQQKMGICDAVAVAKILNVTLVIPHFEVNPVWQDSSSFADIFDVDHF  159

Query  547  IEVLKDD  567
            I+VL+D+
Sbjct  160  IDVLRDE  166



>ref|XP_002864958.1| hypothetical protein ARALYDRAFT_496780 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41217.1| hypothetical protein ARALYDRAFT_496780 [Arabidopsis lyrata subsp. 
lyrata]
Length=504

 Score =   179 bits (454),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 97/120 (81%), Gaps = 2/120 (2%)
 Frame = +1

Query  208  ESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQV  387
            E I  KPRH SL KSALQR +   E++++W PL +QGW P  D G      +K+ GY+QV
Sbjct  34   EVITIKPRHLSLLKSALQRSSG--EQSDLWRPLTDQGWSPCIDLGNSPSLPDKTAGYVQV  91

Query  388  FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSF+DIFDVDHFI+ LKDD
Sbjct  92   FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFVDIFDVDHFIDALKDD  151



>ref|NP_194184.2| O-fucosyltransferase family protein [Arabidopsis thaliana]
 gb|AAP68214.1| At4g24530 [Arabidopsis thaliana]
 dbj|BAE99793.1| PsRT17-1 like protein [Arabidopsis thaliana]
 gb|AEE84921.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=519

 Score =   179 bits (454),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASPS+ SE    +PRH SL + AL R+ +  ++ E+W PLA+QGWKP  +S   +   EK
Sbjct  41   ASPSLFSEWNAPRPRHLSLLQGALDRQISIRQQVELWSPLADQGWKPCTESYRGASLPEK  100

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            SEG+LQVFLDGGLNQQRMGICDAVAVAKI+N TLVIP LEVN VWQDSSSF DIFD+DHF
Sbjct  101  SEGFLQVFLDGGLNQQRMGICDAVAVAKIMNVTLVIPRLEVNTVWQDSSSFTDIFDLDHF  160

Query  547  IEVLKDD  567
            I VLKD+
Sbjct  161  ISVLKDE  167



>ref|XP_008802622.1| PREDICTED: uncharacterized protein At1g04910-like, partial [Phoenix 
dactylifera]
Length=495

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 103/129 (80%), Gaps = 1/129 (1%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFS-KFS  360
            +ASPS+ SE    KPRH SL K ALQR+ + ++K+EIW PLA+QGW+   +S        
Sbjct  79   HASPSLFSEWNAPKPRHISLVKGALQRQISNDQKSEIWAPLAHQGWRTCIESANNPVSLP  138

Query  361  EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVD  540
             KS GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVW+DSSSF +I+DVD
Sbjct  139  AKSTGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWKDSSSFEEIYDVD  198

Query  541  HFIEVLKDD  567
            HFI VLKD+
Sbjct  199  HFINVLKDE  207



>ref|XP_010463027.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=508

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 96/118 (81%), Gaps = 2/118 (2%)
 Frame = +1

Query  214  IIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFL  393
            I  KPRH SL KSALQR +   E++++W PL +QGW P  D G       KSEGY+QVFL
Sbjct  40   ITIKPRHLSLLKSALQRSSG--EQSDLWRPLTDQGWSPCIDLGNSPSLPVKSEGYIQVFL  97

Query  394  DGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            DGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQD+SSF+DIFDVDHFI+ LKDD
Sbjct  98   DGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDTSSFVDIFDVDHFIDSLKDD  155



>ref|XP_004501643.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum]
Length=513

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASPS+ SE I  KPRH +L ++ALQ +T+ E +  +W PLA QGWKP           EK
Sbjct  36   ASPSLFSEWIAPKPRHVTLLQAALQHKTSVEVQTNLWSPLAYQGWKPCTMPPKSPSLPEK  95

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S+GY+QVFLDGGLNQQ+MGICDAVAVAKILN TLVIP+ EVNPVWQDSSSF DIFDVDHF
Sbjct  96   SQGYIQVFLDGGLNQQKMGICDAVAVAKILNVTLVIPHFEVNPVWQDSSSFADIFDVDHF  155

Query  547  IEVLKDD  567
            IEVL+ +
Sbjct  156  IEVLRGE  162



>ref|NP_201350.2| O-fucosyltransferase family protein [Arabidopsis thaliana]
 dbj|BAE99053.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED98060.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=504

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 97/120 (81%), Gaps = 2/120 (2%)
 Frame = +1

Query  208  ESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQV  387
            E I  KPRH SL KSALQR +   E++++W PL +QGW P  D G      +K+ GY+QV
Sbjct  34   EVITIKPRHLSLLKSALQRSSG--EQSDLWRPLTDQGWSPCIDLGNSPSLPDKTAGYVQV  91

Query  388  FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSF+DIFDVDHFI+ LKDD
Sbjct  92   FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFVDIFDVDHFIDSLKDD  151



>ref|XP_010448552.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=518

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASPS+ SE    +PRH  L + AL RE +  ++ E+W PL +QGWKP   S   S   EK
Sbjct  40   ASPSLFSEWNAPRPRHMRLLQGALDREISIRQQVELWSPLPDQGWKPCTQSFRGSPLPEK  99

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S+G+LQVFLDGGLNQQRMGICDAVAVAKI+N TLVIP LEVNPVWQDSSSF DIFDV+HF
Sbjct  100  SQGFLQVFLDGGLNQQRMGICDAVAVAKIMNVTLVIPRLEVNPVWQDSSSFTDIFDVEHF  159

Query  547  IEVLKDD  567
            I VLKD+
Sbjct  160  ISVLKDE  166



>gb|AAM13166.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91219.1| unknown protein [Arabidopsis thaliana]
Length=504

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 97/120 (81%), Gaps = 2/120 (2%)
 Frame = +1

Query  208  ESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQV  387
            E I  KPRH SL KSALQR +   E++++W PL +QGW P  D G      +K+ GY+QV
Sbjct  34   EVITIKPRHLSLLKSALQRSSG--EQSDLWRPLTDQGWSPCIDLGNSPSLPDKTAGYVQV  91

Query  388  FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSF+DIFDVDHFI+ LKDD
Sbjct  92   FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFVDIFDVDHFIDSLKDD  151



>ref|XP_008444924.1| PREDICTED: uncharacterized protein At1g04910-like [Cucumis melo]
Length=515

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASPS+ SE I  KPRH+ L  SAL R TT E++ EIW PL+NQGWKP            K
Sbjct  39   ASPSLFSEWISPKPRHTILLDSALHRITTFEDQKEIWSPLSNQGWKPCLKPTRRELSRRK  98

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S+GY+QVFLDGGLNQQRMGICDAVAVA+ILNATL+IP+LE+N VW+DSSSF +IFDVD+F
Sbjct  99   SQGYIQVFLDGGLNQQRMGICDAVAVARILNATLIIPHLEINAVWKDSSSFGEIFDVDYF  158

Query  547  IEVLKDD  567
            I+VL+DD
Sbjct  159  IDVLRDD  165



>ref|XP_010433755.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=529

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASPS+ SE    +PRH  L + AL RE +  ++ E+W PL +QGWKP   S   S   EK
Sbjct  51   ASPSLFSEWNAPRPRHMRLLQGALDREISIRQQVELWSPLPDQGWKPCTQSYRGSPLPEK  110

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S+G+LQVFLDGGLNQQRMGICDAVAVAKI+N TLVIP LEVNPVWQDSSSF DIFDV+HF
Sbjct  111  SQGFLQVFLDGGLNQQRMGICDAVAVAKIMNVTLVIPRLEVNPVWQDSSSFTDIFDVEHF  170

Query  547  IEVLKDD  567
            I VLKD+
Sbjct  171  ISVLKDE  177



>ref|XP_010484355.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=508

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 96/118 (81%), Gaps = 2/118 (2%)
 Frame = +1

Query  214  IIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFL  393
            I  KPRH SL KSALQR +   E++++W PL +QGW P  D G       KSEGY+QVFL
Sbjct  40   ITIKPRHLSLLKSALQRSSG--EQSDLWRPLTDQGWSPCIDLGNSPSLPIKSEGYIQVFL  97

Query  394  DGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            DGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQD+SSF+DIFDVDHFI+ LKDD
Sbjct  98   DGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDTSSFVDIFDVDHFIDSLKDD  155



>ref|XP_006394028.1| hypothetical protein EUTSA_v10004041mg [Eutrema salsugineum]
 gb|ESQ31314.1| hypothetical protein EUTSA_v10004041mg [Eutrema salsugineum]
Length=507

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 99/121 (82%), Gaps = 3/121 (2%)
 Frame = +1

Query  208  ESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLF-SKFSEKSEGYLQ  384
            E+I  KPRH SL KSALQR +   E++ +W P+ +QGW P  D G   S   +K+EGY+Q
Sbjct  36   EAITIKPRHLSLLKSALQRSSG--EQSNLWRPMIDQGWSPCIDFGNSPSALPDKTEGYIQ  93

Query  385  VFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKD  564
            VFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSF+DIFDVDHFI+ LKD
Sbjct  94   VFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFVDIFDVDHFIDALKD  153

Query  565  D  567
            D
Sbjct  154  D  154



>ref|XP_010439017.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
 ref|XP_010439018.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Camelina sativa]
 ref|XP_010439019.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
Length=518

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASPS+ SE    +PRH  L + AL RE +  ++ E+W PL +QGWKP   S   S   EK
Sbjct  40   ASPSLFSEWNAPRPRHMRLLQGALDREISIRQQVELWSPLPDQGWKPCTQSYKGSPLPEK  99

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S+G+LQVFLDGGLNQQRMGICDAVAVAKI+N TLVIP LEVNPVWQDSSSF DIFDV+HF
Sbjct  100  SQGFLQVFLDGGLNQQRMGICDAVAVAKIMNVTLVIPRLEVNPVWQDSSSFTDIFDVEHF  159

Query  547  IEVLKDD  567
            I VLKD+
Sbjct  160  ISVLKDE  166



>ref|XP_006338062.1| PREDICTED: uncharacterized protein At1g04910-like [Solanum tuberosum]
Length=516

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  PSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSE  372
            PS+ SE    +P HS L   ALQ++T+  ++AE+W PL NQGW+   D         KS+
Sbjct  43   PSVFSEWNAPRPMHSHLLNRALQQQTSKAQEAELWSPLPNQGWEACADKQDTQSLGRKSQ  102

Query  373  GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIE  552
            GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSF DIFDVDHFI 
Sbjct  103  GYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFADIFDVDHFIS  162

Query  553  VLKDD  567
             L +D
Sbjct  163  ALSND  167



>ref|XP_009138156.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
Length=515

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASPS+ SE    +PRH  L + AL R+ +  ++ E+W PL +Q WKP   S   S   EK
Sbjct  37   ASPSLFSEWNAPRPRHLRLLEGALHRQISIRQQVELWSPLPDQSWKPCTQSFTGSPLPEK  96

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S+G+LQVFLDGGLNQQRMGICDAVAVAKILN TLVIP LEVNPVWQDSSSF DIFDVDHF
Sbjct  97   SQGFLQVFLDGGLNQQRMGICDAVAVAKILNVTLVIPRLEVNPVWQDSSSFADIFDVDHF  156

Query  547  IEVLKDD  567
            I VLKD+
Sbjct  157  ITVLKDE  163



>ref|XP_006413418.1| hypothetical protein EUTSA_v10024936mg [Eutrema salsugineum]
 gb|ESQ54871.1| hypothetical protein EUTSA_v10024936mg [Eutrema salsugineum]
Length=518

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  PSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSE  372
            PS+ SE    +PRH  L   AL R+ +  ++ E+W PLA+QGWKP  +S   S   EKS+
Sbjct  42   PSLFSEWNAPRPRHLRLLHGALDRQISIRQQVELWSPLADQGWKPCTESYRVSPLPEKSQ  101

Query  373  GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIE  552
            G+LQVFLDGGLNQQRMGICDAVAVAKILN TLVIP LEVNPVWQDSSSF DIFDVDHFI 
Sbjct  102  GFLQVFLDGGLNQQRMGICDAVAVAKILNVTLVIPRLEVNPVWQDSSSFADIFDVDHFIA  161

Query  553  VLKDD  567
             LKD+
Sbjct  162  FLKDE  166



>gb|KJB48896.1| hypothetical protein B456_008G092600, partial [Gossypium raimondii]
Length=495

 Score =   177 bits (448),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +1

Query  217  IAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLD  396
            + KPRH SL +SAL+ +++  EK+++W PLA+QGW+P  +S       + SEGYLQVFLD
Sbjct  4    VIKPRHLSLLRSALEGKSSNGEKSDLWTPLADQGWRPCLESVNTPSLPQNSEGYLQVFLD  63

Query  397  GGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            GGLNQQRMG+CDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDI+DVD  I VLKDD
Sbjct  64   GGLNQQRMGLCDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIYDVDRLINVLKDD  120



>ref|XP_010547595.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=513

 Score =   177 bits (448),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 97/117 (83%), Gaps = 2/117 (2%)
 Frame = +1

Query  217  IAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLD  396
            I KPRH SL KSALQR     E++++W PL +QGWKP  DSG      EKSEGY+QVFLD
Sbjct  48   IVKPRHLSLLKSALQRPGG--EQSDLWRPLTDQGWKPCIDSGNAPSLPEKSEGYIQVFLD  105

Query  397  GGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            GGLNQQRMGICDAVAVAKILNATLVIP+LEVN VWQDSSSF++IFDVDHFI+ LK+D
Sbjct  106  GGLNQQRMGICDAVAVAKILNATLVIPFLEVNSVWQDSSSFVEIFDVDHFIDELKND  162



>emb|CDY03446.1| BnaC01g16360D [Brassica napus]
Length=613

 Score =   178 bits (451),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASPS+ SE    +PRH  L + AL R+ +  ++ E+W PL +Q WKP   S   S   EK
Sbjct  135  ASPSLFSEWNAPRPRHLRLLEGALHRQISIRQQVELWSPLPDQSWKPCTQSFTGSPLPEK  194

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S+G+LQVFLDGGLNQQRMGICDAVAVAKILN TLVIP LEVNPVWQDSSSF DIFDVDHF
Sbjct  195  SQGFLQVFLDGGLNQQRMGICDAVAVAKILNVTLVIPRLEVNPVWQDSSSFADIFDVDHF  254

Query  547  IEVLKDD  567
            I VLKD+
Sbjct  255  ITVLKDE  261



>ref|XP_007136338.1| hypothetical protein PHAVU_009G0371000g, partial [Phaseolus vulgaris]
 gb|ESW08332.1| hypothetical protein PHAVU_009G0371000g, partial [Phaseolus vulgaris]
Length=449

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASPS+ SE I  +P H SL + ALQR+ + E +  +W PLA QGWKP  +        EK
Sbjct  41   ASPSMFSEWIAPRPMHVSLLEGALQRQISVELQTSLWSPLAFQGWKPCTERPKPPSLPEK  100

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S GY+QVFLDGGLNQQ+MGICDAVAVAKILNATLVIP+ EVNPVWQDSSSF DIFD+DHF
Sbjct  101  SRGYIQVFLDGGLNQQKMGICDAVAVAKILNATLVIPHFEVNPVWQDSSSFEDIFDLDHF  160

Query  547  IEVLKDD  567
            I+VL+++
Sbjct  161  IDVLRNE  167



>ref|XP_007018221.1| O-fucosyltransferase family protein [Theobroma cacao]
 gb|EOY15446.1| O-fucosyltransferase family protein [Theobroma cacao]
Length=540

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 107/149 (72%), Gaps = 22/149 (15%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSG--------  342
            ASPS+ SE    KPRH  L + AL R+++ ++++++W PL NQGWKP  DS         
Sbjct  41   ASPSLFSEWNAPKPRHLPLVEVALHRKSSFKQQSDLWSPLPNQGWKPCIDSANIPRKCLE  100

Query  343  --------LFSKFS------EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPY  480
                    L S FS      EKS+GY+QVFLDGGLNQQRMGICDAVAVAK+LNATLVIP+
Sbjct  101  IEMGIFFFLISLFSLLEVLPEKSQGYIQVFLDGGLNQQRMGICDAVAVAKVLNATLVIPH  160

Query  481  LEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            LEVNPVWQDSSSF DIFDVDHFI VL+D+
Sbjct  161  LEVNPVWQDSSSFTDIFDVDHFINVLRDE  189



>emb|CDY34289.1| BnaA01g13920D [Brassica napus]
Length=792

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASPS+ SE    +PRH  L + AL R+ +  ++ E+W PL +Q WKP   S   S   EK
Sbjct  314  ASPSLFSEWNAPRPRHLRLLEGALHRQISIRQQVELWSPLPDQSWKPCTQSFTGSPLPEK  373

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S+G+LQVFLDGGLNQQRMGICDAVAVAKILN TLVIP LEVNPVWQDSSSF DIFDVDHF
Sbjct  374  SQGFLQVFLDGGLNQQRMGICDAVAVAKILNVTLVIPRLEVNPVWQDSSSFADIFDVDHF  433

Query  547  IEVLKDD  567
            I VLKD+
Sbjct  434  ITVLKDE  440



>ref|XP_010937178.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=560

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 101/129 (78%), Gaps = 1/129 (1%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDS-GLFSKFS  360
            +A PSI SE    KPRH SL K ALQR+ + E+ +E+W  LA+QGW+P  +S        
Sbjct  84   HALPSIFSEWNAPKPRHMSLLKGALQRQISDEQNSELWASLAHQGWRPCIESENNPVSLP  143

Query  361  EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVD  540
             KS GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVW+DSSSF DI+DVD
Sbjct  144  TKSTGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWKDSSSFEDIYDVD  203

Query  541  HFIEVLKDD  567
            HFI VLKD+
Sbjct  204  HFISVLKDE  212



>gb|KGN62755.1| hypothetical protein Csa_2G370540 [Cucumis sativus]
Length=1445

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  187   ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
             ASPS+ SE I  KPRH+ L  SAL R TT E++ EIW PL+NQGWKP            K
Sbjct  969   ASPSLFSEWISPKPRHTILLDSALHRITTFEDQKEIWSPLSNQGWKPCLKPTRMELSQRK  1028

Query  367   SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
             S+GY+QVFLDGGLNQQRMGICDAVAVA+ILNATL+IP+LE+N VW+DSSSF +IFDVDHF
Sbjct  1029  SQGYIQVFLDGGLNQQRMGICDAVAVARILNATLIIPHLEINAVWKDSSSFGEIFDVDHF  1088

Query  547   IEVLKDD  567
             I+VL+DD
Sbjct  1089  IDVLRDD  1095



>gb|AGV54860.1| O-fucosyltransferase family protein [Phaseolus vulgaris]
Length=516

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASPS+ SE I  +P H SL + ALQR+ + E +  +W PLA QGWKP  +        EK
Sbjct  39   ASPSMFSEWIAPRPMHVSLLEGALQRQISVELQTSLWSPLAFQGWKPCTERPKPPSLPEK  98

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S GY+QVFLDGGLNQQ+MGICDAVAVAKILNATLVIP+ EVNPVWQDSSSF DIFD+DHF
Sbjct  99   SRGYIQVFLDGGLNQQKMGICDAVAVAKILNATLVIPHFEVNPVWQDSSSFEDIFDLDHF  158

Query  547  IEVLKDD  567
            I+VL+++
Sbjct  159  IDVLRNE  165



>gb|KHN09000.1| DUF246 domain-containing protein [Glycine soja]
Length=510

 Score =   175 bits (443),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            +SPS+ SE    +P H +L + ALQR+T+ E +  +W PLA QGWKP  +        EK
Sbjct  38   SSPSVFSEWNAPRPMHVALLEGALQRQTSVELQTSLWSPLAFQGWKPCTERPKPHSLPEK  97

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S GY+QVFLDGGLNQQ+MG+CDAVAVAKILNATLV+P+ EVNPVWQDSSSF DIFDVDHF
Sbjct  98   SRGYIQVFLDGGLNQQKMGVCDAVAVAKILNATLVLPHFEVNPVWQDSSSFADIFDVDHF  157

Query  547  IEVLKDD  567
            I+VL+D+
Sbjct  158  IDVLRDE  164



>ref|XP_003526543.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=511

 Score =   174 bits (442),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            +SPS+ SE    +P H +L + ALQR+T+ E +  +W PLA QGWKP  +        EK
Sbjct  39   SSPSVFSEWNAPRPMHVALLEGALQRQTSVELQTSLWSPLAFQGWKPCTERPKPHSLPEK  98

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S GY+QVFLDGGLNQQ+MG+CDAVAVAKILNATLV+P+ EVNPVWQDSSSF DIFDVDHF
Sbjct  99   SRGYIQVFLDGGLNQQKMGVCDAVAVAKILNATLVLPHFEVNPVWQDSSSFADIFDVDHF  158

Query  547  IEVLKDD  567
            I+VL+D+
Sbjct  159  IDVLRDE  165



>gb|KDP41479.1| hypothetical protein JCGZ_15886 [Jatropha curcas]
Length=513

 Score =   174 bits (442),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  PSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSE  372
            PS+ SE    KPRH  L K+AL R     +++E+W PL +QGWKP  +        + S 
Sbjct  41   PSLFSEWNAPKPRHLPLLKAALNRPILSRQQSELWSPLPDQGWKPCIEPVTIPSLPQTSR  100

Query  373  GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIE  552
            GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQDSSSF+DIFDVDHFI+
Sbjct  101  GYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQDSSSFVDIFDVDHFID  160

Query  553  VLKDD  567
            VL D+
Sbjct  161  VLHDE  165



>emb|CDY33958.1| BnaC02g43790D [Brassica napus]
Length=505

 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 98/120 (82%), Gaps = 2/120 (2%)
 Frame = +1

Query  208  ESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQV  387
            E+I  KPRH SL KSALQR +   E++++W P+ +QGW P  D        +K++GY+QV
Sbjct  35   EAITIKPRHLSLLKSALQRASG--EQSDLWKPMTDQGWSPCIDLEDSPSLPDKTKGYIQV  92

Query  388  FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            FLDGGLNQQRMGICDAVAVAKILNATLVIP+LE+NPVWQDSSSF+DIFDVDHFI+ LKDD
Sbjct  93   FLDGGLNQQRMGICDAVAVAKILNATLVIPFLEINPVWQDSSSFVDIFDVDHFIDALKDD  152



>ref|XP_006285210.1| hypothetical protein CARUB_v10006569mg [Capsella rubella]
 gb|EOA18108.1| hypothetical protein CARUB_v10006569mg [Capsella rubella]
Length=521

 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASPS+ SE    +PRH  L + AL R+ +  ++ E+W PL +QGWKP   S   S   EK
Sbjct  43   ASPSLFSEWNAPRPRHLRLLQGALDRQISIRQQVELWSPLPDQGWKPCTLSYRGSPLPEK  102

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S+G+LQVFLDGGLNQQRMGICDAVAVAKI+N TLVIP LEVNPVWQDSSSF DIFDV+H+
Sbjct  103  SQGFLQVFLDGGLNQQRMGICDAVAVAKIMNVTLVIPRLEVNPVWQDSSSFTDIFDVEHY  162

Query  547  IEVLKDD  567
            I VLKD+
Sbjct  163  ISVLKDE  169



>emb|CDP11502.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   174 bits (440),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            A PS+ SE    +P H  L   ALQ++T+ E+++E+W PL +QGWK   DS   S   +K
Sbjct  40   AYPSLFSEWNAPRPMHLELMNGALQQQTSGEQESELWSPLPDQGWKRCADSHAKSSLPKK  99

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S+GY+QVFLDGGLNQQRMGICDAVAVAKILNATLV+P+ EVNPVWQDSSSF DIFD DHF
Sbjct  100  SQGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVLPHFEVNPVWQDSSSFTDIFDADHF  159

Query  547  IEVLKDD  567
            I+ LK++
Sbjct  160  IDALKNE  166



>ref|XP_004237994.1| PREDICTED: uncharacterized protein At1g04910 [Solanum lycopersicum]
Length=516

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  PSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSE  372
            PS+ SE    +P HS L   ALQ++T+  ++AE+W PL +QGW+             KS+
Sbjct  43   PSVFSEWNAPRPMHSHLLNRALQQQTSKPQEAELWSPLPDQGWEACAYKQETQSLGRKSQ  102

Query  373  GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIE  552
            GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSF DIFDVDHFI 
Sbjct  103  GYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFADIFDVDHFIS  162

Query  553  VLKDD  567
            VL  D
Sbjct  163  VLSGD  167



>ref|XP_002867661.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43920.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=519

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASPS+ SE    + RH  L + AL R+ +  ++ E+W PLA+QGWKP  +S       EK
Sbjct  41   ASPSLFSEWNAPRARHLRLLQGALDRQISIRQQVELWSPLADQGWKPCTESYRGVPLPEK  100

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S+G+LQVFLDGGLNQQRMGICDAVAVAKI+N TLVIP LEVNPVWQDSSSF DIFD+ HF
Sbjct  101  SQGFLQVFLDGGLNQQRMGICDAVAVAKIMNVTLVIPRLEVNPVWQDSSSFTDIFDLGHF  160

Query  547  IEVLKDD  567
            I VLKD+
Sbjct  161  ISVLKDE  167



>dbj|BAB11569.1| unnamed protein product [Arabidopsis thaliana]
Length=523

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 98/137 (72%), Gaps = 17/137 (12%)
 Frame = +1

Query  208  ESIIAKPRHSSLFKSALQR-----------------ETTPEEKAEIWMPLANQGWKPVPD  336
            E I  KPRH SL KSALQR                 + +  E++++W PL +QGW P  D
Sbjct  34   EVITIKPRHLSLLKSALQRVKLDDFIKVSLSISFRFQKSSGEQSDLWRPLTDQGWSPCID  93

Query  337  SGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSS  516
             G      +K+ GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSS
Sbjct  94   LGNSPSLPDKTAGYVQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSS  153

Query  517  FMDIFDVDHFIEVLKDD  567
            F+DIFDVDHFI+ LKDD
Sbjct  154  FVDIFDVDHFIDSLKDD  170



>ref|XP_009130514.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Brassica rapa]
Length=505

 Score =   171 bits (434),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 97/120 (81%), Gaps = 2/120 (2%)
 Frame = +1

Query  208  ESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQV  387
            E+I  KPRH SL KSALQR +   E++++W P+ +QGW P  D        +K++ Y+QV
Sbjct  35   EAITIKPRHLSLLKSALQRPSG--EQSDLWKPMTDQGWSPCIDLEDPPSLPDKTKSYIQV  92

Query  388  FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            FLDGGLNQQRMGICDAVAVAKILNATLVIP+LE+NPVWQDSSSF+DIFDVDHFI+ LKDD
Sbjct  93   FLDGGLNQQRMGICDAVAVAKILNATLVIPFLEINPVWQDSSSFVDIFDVDHFIDALKDD  152



>emb|CDY37829.1| BnaAnng04900D [Brassica napus]
Length=505

 Score =   171 bits (433),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 97/120 (81%), Gaps = 2/120 (2%)
 Frame = +1

Query  208  ESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQV  387
            E+I  KPRH SL KSALQR +   E++++W P+ +QGW P  D        +K++ Y+QV
Sbjct  35   EAITIKPRHLSLLKSALQRPSG--EQSDLWKPMTDQGWSPCIDLEDPPSLPDKTKSYIQV  92

Query  388  FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            FLDGGLNQQRMGICDAVAVAKILNATLVIP+LE+NPVWQDSSSF+DIFDVDHFI+ LKDD
Sbjct  93   FLDGGLNQQRMGICDAVAVAKILNATLVIPFLEINPVWQDSSSFVDIFDVDHFIDALKDD  152



>gb|KFK28724.1| hypothetical protein AALP_AA7G039000 [Arabis alpina]
Length=513

 Score =   171 bits (433),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 98/130 (75%), Gaps = 3/130 (2%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSG---LFSKF  357
            +SPS+ SE    +PRH  L + AL R+ +  ++ E+W PL +QG+KP  DS    LF   
Sbjct  31   SSPSLFSEWNTPRPRHLRLLQGALDRQISIRQQVELWSPLPDQGYKPCTDSNKGRLFVSL  90

Query  358  SEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDV  537
             EKS  +LQVFLDGGLNQQRMGICDAVAVAKILN TLVIP LEVNPVWQDSSSF DIFDV
Sbjct  91   PEKSLRFLQVFLDGGLNQQRMGICDAVAVAKILNVTLVIPRLEVNPVWQDSSSFEDIFDV  150

Query  538  DHFIEVLKDD  567
            DHF+ +LKD+
Sbjct  151  DHFLSILKDE  160



>gb|EPS72903.1| hypothetical protein M569_01846, partial [Genlisea aurea]
Length=497

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 99/128 (77%), Gaps = 1/128 (1%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKP-VPDSGLFSKFSE  363
            A PS+ SE    KPRHS L KSALQ +T+  +K ++W  L +Q WK  +  S   S   +
Sbjct  25   AFPSVFSEWNAPKPRHSRLLKSALQHQTSDVQKDDLWKQLPSQNWKSCIHFSYKSSALPD  84

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KS+GY+QVFLDGGLNQQRMGICDAVAVAK+LNATLVIPYLEVN VWQD+SSF DIFDVDH
Sbjct  85   KSQGYIQVFLDGGLNQQRMGICDAVAVAKLLNATLVIPYLEVNSVWQDTSSFGDIFDVDH  144

Query  544  FIEVLKDD  567
            FI VLKDD
Sbjct  145  FINVLKDD  152



>gb|KCW54609.1| hypothetical protein EUGRSUZ_I00557 [Eucalyptus grandis]
Length=506

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = +1

Query  196  SILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEG  375
            S  SE    KPRH  L KSA++R+++   + E W PL++ GW+P   +       EKS G
Sbjct  32   SAFSEWNAIKPRHMHLLKSAVERQSSDSVQNEFWNPLSDPGWRPCIQTTNAPSLPEKSRG  91

Query  376  YLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEV  555
            Y+QVFLDGGLNQQRM +CDAVAVAKILNATLVIPYLEVNPVWQDSSSF DIFDV+HFI+V
Sbjct  92   YVQVFLDGGLNQQRMAVCDAVAVAKILNATLVIPYLEVNPVWQDSSSFGDIFDVEHFIDV  151

Query  556  LKDD  567
            LKDD
Sbjct  152  LKDD  155



>ref|XP_010027954.1| PREDICTED: uncharacterized protein At1g04910 [Eucalyptus grandis]
 gb|KCW54610.1| hypothetical protein EUGRSUZ_I00557 [Eucalyptus grandis]
Length=505

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = +1

Query  196  SILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEG  375
            S  SE    KPRH  L KSA++R+++   + E W PL++ GW+P   +       EKS G
Sbjct  32   SAFSEWNAIKPRHMHLLKSAVERQSSDSVQNEFWNPLSDPGWRPCIQTTNAPSLPEKSRG  91

Query  376  YLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEV  555
            Y+QVFLDGGLNQQRM +CDAVAVAKILNATLVIPYLEVNPVWQDSSSF DIFDV+HFI+V
Sbjct  92   YVQVFLDGGLNQQRMAVCDAVAVAKILNATLVIPYLEVNPVWQDSSSFGDIFDVEHFIDV  151

Query  556  LKDD  567
            LKDD
Sbjct  152  LKDD  155



>ref|XP_009130513.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Brassica rapa]
Length=506

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 98/121 (81%), Gaps = 3/121 (2%)
 Frame = +1

Query  208  ESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPD-SGLFSKFSEKSEGYLQ  384
            E+I  KPRH SL KSALQR +   E++++W P+ +QGW P  D     S   +K++ Y+Q
Sbjct  35   EAITIKPRHLSLLKSALQRPSG--EQSDLWKPMTDQGWSPCIDLEDPPSALPDKTKSYIQ  92

Query  385  VFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKD  564
            VFLDGGLNQQRMGICDAVAVAKILNATLVIP+LE+NPVWQDSSSF+DIFDVDHFI+ LKD
Sbjct  93   VFLDGGLNQQRMGICDAVAVAKILNATLVIPFLEINPVWQDSSSFVDIFDVDHFIDALKD  152

Query  565  D  567
            D
Sbjct  153  D  153



>ref|XP_004301363.1| PREDICTED: uncharacterized protein At1g04910 [Fragaria vesca 
subsp. vesca]
Length=513

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 101/128 (79%), Gaps = 1/128 (1%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASPSI SE    KPRH  L ++AL  +++ E++ ++W PL NQGWK  P+    +    K
Sbjct  38   ASPSIFSEWNAPKPRHLHLLEAALSTQSSVEQQIKVWAPLGNQGWKHCPEEPKSASLKPK  97

Query  367  -SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
             S GY+QVFLDGGLNQQ+MGICDAVAVAKILNATLV+P+LEVNPVWQDSSSF +IFDVDH
Sbjct  98   GSNGYIQVFLDGGLNQQKMGICDAVAVAKILNATLVLPHLEVNPVWQDSSSFEEIFDVDH  157

Query  544  FIEVLKDD  567
            F++VL+++
Sbjct  158  FLDVLRNE  165



>gb|KHN08263.1| DUF246 domain-containing protein [Glycine soja]
Length=511

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASPS  SE    +P H +L + ALQR+T+ E +  IW PLA QGWKP  +        EK
Sbjct  39   ASPSTFSEWNAPRPMHVALLEGALQRQTSVELQTSIWSPLAFQGWKPCTERPKPPSLPEK  98

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S GY+QVFLDGGLNQQ++GICDAVAVAKILNATLV+P+ EVNPVWQDSSSF DIFDVDHF
Sbjct  99   SWGYIQVFLDGGLNQQKIGICDAVAVAKILNATLVLPHFEVNPVWQDSSSFADIFDVDHF  158

Query  547  IEVLKDD  567
            I+ L+D+
Sbjct  159  IDDLRDE  165



>ref|XP_003523785.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=511

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASPS  SE    +P H +L + ALQR+T+ E +  IW PLA QGWKP  +        EK
Sbjct  39   ASPSTFSEWNAPRPMHVALLEGALQRQTSVELQTSIWSPLAFQGWKPCTERPKPPSLPEK  98

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S GY+QVFLDGGLNQQ++GICDAVAVAKILNATLV+P+ EVNPVWQDSSSF DIFDVDHF
Sbjct  99   SWGYIQVFLDGGLNQQKIGICDAVAVAKILNATLVLPHFEVNPVWQDSSSFADIFDVDHF  158

Query  547  IEVLKDD  567
            I+ L+D+
Sbjct  159  IDDLRDE  165



>ref|XP_010061545.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g04910 
[Eucalyptus grandis]
Length=517

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASPS+ SE    KPRH  L K+A+QR+    ++ ++W PL +QGWKP   S        K
Sbjct  40   ASPSMFSEWNAPKPRHLPLLKAAIQRQIPFRQQLDLWSPLPDQGWKPCIRSADDMPLPGK  99

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            S GY+Q FLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQD+SSF DIFDVDHF
Sbjct  100  SMGYIQXFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQDASSFSDIFDVDHF  159

Query  547  IEVLKDD  567
            I  L+ D
Sbjct  160  ISALEGD  166



>ref|XP_002514041.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48624.1| conserved hypothetical protein [Ricinus communis]
Length=519

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 97/128 (76%), Gaps = 1/128 (1%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFS-KFSE  363
            A PS+ SE    KPRH  L ++AL R     E++E+W PL  QGWKP  +  +      +
Sbjct  37   AYPSLFSEWNAPKPRHFPLLRAALNRPILSREQSELWSPLPYQGWKPCTEPNIIQPSLPQ  96

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            KS+ Y+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQDSSSF++IFD DH
Sbjct  97   KSQVYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQDSSSFVEIFDADH  156

Query  544  FIEVLKDD  567
            FI++L+ +
Sbjct  157  FIDILRHE  164



>ref|XP_002301095.2| hypothetical protein POPTR_0002s10600g [Populus trichocarpa]
 gb|EEE80368.2| hypothetical protein POPTR_0002s10600g [Populus trichocarpa]
Length=513

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  PSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSE  372
            PS+ SE    KPRH  L K+AL R     +K E+W PL  QGWKP  +         KS+
Sbjct  38   PSLFSEWNAPKPRHLPLLKAALDRHIPVRQKNELWSPLPYQGWKPCIEPTTIHTLPTKSQ  97

Query  373  GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIE  552
            GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVN VWQD+SSF DIFDV+HFI+
Sbjct  98   GYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNAVWQDTSSFADIFDVEHFID  157

Query  553  VLKDD  567
             L  D
Sbjct  158  TLSHD  162



>ref|XP_004956798.1| PREDICTED: uncharacterized protein At1g04910-like [Setaria italica]
Length=512

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +A PS+ SE    KP H SL   AL+     E+K E+W PL+ QGWKP   S +      
Sbjct  38   HAFPSLFSEWNAPKPMHPSLLNEALRWAIPGEQKRELWSPLSYQGWKPCLKSSISHALPL  97

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            +  GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVW+DSSSF +IFDVDH
Sbjct  98   EPSGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWKDSSSFEEIFDVDH  157

Query  544  FIEVLKDD  567
            FI  LKDD
Sbjct  158  FINSLKDD  165



>ref|XP_009785662.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=516

 Score =   166 bits (420),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  PSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSE  372
            PS+ SE    K  H  L   ALQ++T+  ++A++W PL NQGW+   D+        KS+
Sbjct  43   PSLFSEWNAPKSMHVHLLNRALQQQTSNAQEADLWSPLRNQGWESCADNQDTQSLHRKSQ  102

Query  373  GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIE  552
             Y+QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSF +IFDVDHFI 
Sbjct  103  VYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFAEIFDVDHFIN  162

Query  553  VLKDD  567
            +L  D
Sbjct  163  ILSGD  167



>ref|XP_008368388.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=519

 Score =   166 bits (419),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 101/129 (78%), Gaps = 1/129 (1%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGL-FSKFS  360
            +ASPSI SE    +PRHS L   AL  +++ ++++++W PL +QGWK  P+     S   
Sbjct  42   HASPSIFSEWNAPQPRHSRLLSPALLLQSSVDQQSKLWAPLPDQGWKHCPEEPRSLSSSP  101

Query  361  EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVD  540
            ++S GY+QVFLDGGLNQQ+MGICDAVAVAKILNATLVIP+LEVNPVWQDSSSF +IFDVD
Sbjct  102  KESTGYIQVFLDGGLNQQKMGICDAVAVAKILNATLVIPHLEVNPVWQDSSSFEEIFDVD  161

Query  541  HFIEVLKDD  567
            HFIE L+ +
Sbjct  162  HFIEALQGE  170



>ref|XP_009624657.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
tomentosiformis]
Length=516

 Score =   166 bits (419),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 92/125 (74%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  PSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSE  372
            PS+ SE    K  H  L   ALQ++T+  ++A++W PL NQGW+   D+        KS+
Sbjct  43   PSLFSEWNAPKSMHVHLLNRALQQQTSNAQEADLWSPLPNQGWEACADNQDTQSLHRKSQ  102

Query  373  GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIE  552
             Y+QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQD SSF DIFDVDHFI 
Sbjct  103  VYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDPSSFADIFDVDHFIN  162

Query  553  VLKDD  567
            +L  D
Sbjct  163  ILSGD  167



>emb|CAN78778.1| hypothetical protein VITISV_029752 [Vitis vinifera]
Length=507

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 93/126 (74%), Gaps = 3/126 (2%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPE---EKAEIWMPLANQGWKPVPDSGLFSKF  357
            ASPSI SE    KPRH  L K ALQ +T       K     PLANQGWKP  DS      
Sbjct  37   ASPSIFSEWNAPKPRHLQLLKGALQLQTVSGLIGNKPISRSPLANQGWKPCVDSADTPLL  96

Query  358  SEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDV  537
             +KS+GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQDSSSF +IFD+
Sbjct  97   PKKSQGYVQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQDSSSFAEIFDI  156

Query  538  DHFIEV  555
            DHFI +
Sbjct  157  DHFINL  162



>ref|XP_011016933.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Populus 
euphratica]
Length=513

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  PSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSE  372
            P + SE    KPRH  L K+AL R     +K E+W PL  QGWKP  +         KS+
Sbjct  38   PFLFSEWNAPKPRHLPLLKAALDRHIPVRQKNELWSPLPYQGWKPCIEPTTIHTLPTKSQ  97

Query  373  GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIE  552
            GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVN VWQD+SSF DIFDV+HFI+
Sbjct  98   GYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNAVWQDTSSFADIFDVEHFID  157

Query  553  VLKDD  567
             L  D
Sbjct  158  TLSHD  162



>dbj|BAK06980.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=512

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            A PS+ SE    KP H SLF  +L+     E+K ++W PL +QGWKP   S +      +
Sbjct  39   AFPSLFSEWNAPKPMHESLFNESLRWTIPDEQKRDLWTPLPDQGWKPCIRSSITRGLPSQ  98

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
              GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVW+DSSSF DIF+VDHF
Sbjct  99   PSGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWKDSSSFGDIFNVDHF  158

Query  547  IEVLKDD  567
            I  L+ D
Sbjct  159  INTLRGD  165



>ref|XP_010692399.1| PREDICTED: uncharacterized protein At1g04910 [Beta vulgaris subsp. 
vulgaris]
Length=503

 Score =   163 bits (412),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = +1

Query  196  SILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEG  375
            S+ SE    + RH  L + ALQ +T  +++ E+W PL++QGWKP  DS       EKS G
Sbjct  45   SLFSEWNAPQSRHVRLLQGALQWQTPFKQQLELWTPLSHQGWKPCHDSQKPHSLPEKSRG  104

Query  376  YLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEV  555
            Y+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVN VWQDSSSF ++FD+DHFI  
Sbjct  105  YIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNSVWQDSSSFAEVFDLDHFINS  164

Query  556  LKDD  567
            L D+
Sbjct  165  LSDE  168



>gb|EEC84568.1| hypothetical protein OsI_31345 [Oryza sativa Indica Group]
Length=519

 Score =   163 bits (413),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            A PS+ SE    KP H SL   AL+R  + E+K E+W PL  QGWKP   S        +
Sbjct  40   AFPSLFSEWNAPKPMHESLLNEALRRTISNEQKRELWSPLPYQGWKPCLKSSSVHGVPLE  99

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
              GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVW+D+SSF +IFDVDHF
Sbjct  100  PTGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWKDTSSFEEIFDVDHF  159

Query  547  IEVLKDD  567
            I  LK +
Sbjct  160  INTLKAE  166



>ref|NP_001150199.1| LOC100283829 [Zea mays]
 gb|ACG38224.1| psRT17-1 like protein [Zea mays]
 tpg|DAA61416.1| TPA: psRT17-1 like protein [Zea mays]
Length=511

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 93/128 (73%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +A PS+ SE    KP H SL   AL+   T  +K ++W PL  QGWKP     +  K   
Sbjct  38   HAFPSVFSEWNAPKPMHPSLLNEALRWTATDGQKKDLWSPLPYQGWKPCLTPSVSHKLPL  97

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            +  GY+QVFLDGGLNQQRMGICDA+AVAKILNATLVIP+LEVNPVW+DSSSF +IFDVDH
Sbjct  98   EPSGYIQVFLDGGLNQQRMGICDAIAVAKILNATLVIPHLEVNPVWKDSSSFEEIFDVDH  157

Query  544  FIEVLKDD  567
            FI  LKD+
Sbjct  158  FINSLKDE  165



>ref|NP_001063155.1| Os09g0412200 [Oryza sativa Japonica Group]
 dbj|BAD28369.1| putative auxin-independent growth promoter [Oryza sativa Japonica 
Group]
 dbj|BAF25069.1| Os09g0412200 [Oryza sativa Japonica Group]
 dbj|BAG90088.1| unnamed protein product [Oryza sativa Japonica Group]
Length=512

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            A PS+ SE    KP H SL   AL+R  + E+K E+W PL  QGWKP   S        +
Sbjct  40   AFPSLFSEWNAPKPMHESLLNEALRRTISNEQKRELWSPLPYQGWKPCLKSSSVHGVPLE  99

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
              GY+QVFLDGGLNQQRMGICDAVAVAKILNA+LVIP+LEVNPVW+D+SSF +IFDVDHF
Sbjct  100  PTGYIQVFLDGGLNQQRMGICDAVAVAKILNASLVIPHLEVNPVWKDTSSFEEIFDVDHF  159

Query  547  IEVLKDD  567
            I  LK +
Sbjct  160  INTLKAE  166



>ref|XP_010312649.1| PREDICTED: uncharacterized protein At1g04910 isoform X3 [Solanum 
lycopersicum]
Length=470

 Score =   160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  277  EEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKIL  456
            EE++ +W PL +QGWKP   S   S   EKSEGY+QVFLDGGLNQQRMGICDAV VAKIL
Sbjct  23   EEQSRLWTPLEHQGWKPCTKSDAASTVPEKSEGYVQVFLDGGLNQQRMGICDAVVVAKIL  82

Query  457  NATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            NATLVIP LEVNPVWQDSSSF DIFDVDHFI  LKDD
Sbjct  83   NATLVIPQLEVNPVWQDSSSFEDIFDVDHFINALKDD  119



>gb|EEE69695.1| hypothetical protein OsJ_29339 [Oryza sativa Japonica Group]
Length=722

 Score =   162 bits (410),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            A PS+ SE    KP H SL   AL+R  + E+K E+W PL  QGWKP   S        +
Sbjct  40   AFPSLFSEWNAPKPMHESLLNEALRRTISNEQKRELWSPLPYQGWKPCLKSSSVHGVPLE  99

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
              GY+QVFLDGGLNQQRMGICDAVAVAKILNA+LVIP+LEVNPVW+D+SSF +IFDVDHF
Sbjct  100  PTGYIQVFLDGGLNQQRMGICDAVAVAKILNASLVIPHLEVNPVWKDTSSFEEIFDVDHF  159

Query  547  IEVLKDD  567
            I  LK +
Sbjct  160  INTLKAE  166



>ref|XP_007222858.1| hypothetical protein PRUPE_ppa004255mg [Prunus persica]
 gb|EMJ24057.1| hypothetical protein PRUPE_ppa004255mg [Prunus persica]
Length=520

 Score =   160 bits (406),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 98/128 (77%), Gaps = 1/128 (1%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKP-VPDSGLFSKFSE  363
            ASPS  SE    K RH  L   AL  +++ E+++++W PL NQGWK  + +    S   +
Sbjct  43   ASPSFFSEWNAPKARHLHLLNPALLSQSSVEQQSKLWSPLPNQGWKHCLEEPKSLSLTPK  102

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
             S GY+QVFLDGGLNQQ+MGICDAVAVAKILNATLV+P+LEVNPVWQDSSSF +IFD+DH
Sbjct  103  GSTGYIQVFLDGGLNQQKMGICDAVAVAKILNATLVVPHLEVNPVWQDSSSFEEIFDLDH  162

Query  544  FIEVLKDD  567
            FIEVL+D+
Sbjct  163  FIEVLRDE  170



>ref|XP_006661225.1| PREDICTED: uncharacterized protein At1g04910-like, partial [Oryza 
brachyantha]
Length=492

 Score =   160 bits (405),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            A PS+ SE    KP H +L   AL++  + E+K E+W PL  QGWKP            +
Sbjct  20   AFPSLFSEWNAPKPMHETLLNEALRQAISNEQKRELWSPLPYQGWKPCLKLSSVHGVPSE  79

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
              GY+QVFLDGGLNQQRMGICDAVAVAK+LNATLVIP+LEVNPVW+DSSSF +IFDVDHF
Sbjct  80   PTGYIQVFLDGGLNQQRMGICDAVAVAKVLNATLVIPHLEVNPVWKDSSSFAEIFDVDHF  139

Query  547  IEVLKDD  567
            I  LK +
Sbjct  140  INTLKAE  146



>ref|XP_002462371.1| hypothetical protein SORBIDRAFT_02g024540 [Sorghum bicolor]
 gb|EER98892.1| hypothetical protein SORBIDRAFT_02g024540 [Sorghum bicolor]
Length=511

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 92/128 (72%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +A PS+ SE    KP H SL   AL+   T ++K  +W PL  QGWKP     +      
Sbjct  38   HAFPSLFSEWNAPKPMHPSLLNEALRWAVTDKQKTGLWSPLPYQGWKPCLKPSVSHTLPL  97

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            +  G++QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVW+DSSSF +IFDVDH
Sbjct  98   EPSGFIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWKDSSSFEEIFDVDH  157

Query  544  FIEVLKDD  567
            FI  LKD+
Sbjct  158  FINSLKDE  165



>ref|XP_010107675.1| hypothetical protein L484_007693 [Morus notabilis]
 gb|EXC16648.1| hypothetical protein L484_007693 [Morus notabilis]
Length=529

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 99/138 (72%), Gaps = 11/138 (8%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRET---TPE-----EKAEIWMPLANQGWKPVPDSG  342
            A PS+ SE    KP H  L   AL+R T   +PE     ++  +W PLANQGW+P  D  
Sbjct  41   AFPSLFSEWNAPKPMHLHLLNGALERHTVSSSPEPPSVQQQKNLWSPLANQGWRPCLDFE  100

Query  343  LFSKFS---EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSS  513
                     +KS GY+QVFLDGGLNQQ+MGICDAVAVAKILNATLVIP+L+VNPVWQDSS
Sbjct  101  GPRDVPLSLKKSNGYIQVFLDGGLNQQKMGICDAVAVAKILNATLVIPHLDVNPVWQDSS  160

Query  514  SFMDIFDVDHFIEVLKDD  567
            SF +IFDVDHFI+VL+++
Sbjct  161  SFAEIFDVDHFIDVLRNE  178



>ref|XP_009376221.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g04910 
[Pyrus x bretschneideri]
Length=520

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 98/129 (76%), Gaps = 1/129 (1%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDS-GLFSKFS  360
            +A+PSI SE    KPRH  L   AL  ++  ++++++W PL NQGWK  P+     S   
Sbjct  42   HAAPSIFSEWNAPKPRHLRLLNPALLLQSYVDQQSKLWAPLPNQGWKHCPEEPNSLSSSP  101

Query  361  EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVD  540
            ++S  Y+QVFLDGGLNQ++MGICDAVAVAKILNATLVIP+LEVNPVWQDSSSF DIFDVD
Sbjct  102  KESTWYIQVFLDGGLNQKKMGICDAVAVAKILNATLVIPHLEVNPVWQDSSSFEDIFDVD  161

Query  541  HFIEVLKDD  567
            HFIE L+ +
Sbjct  162  HFIEALQGE  170



>tpg|DAA61415.1| TPA: hypothetical protein ZEAMMB73_640362 [Zea mays]
Length=486

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 86/115 (75%), Gaps = 0/115 (0%)
 Frame = +1

Query  223  KPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGG  402
            KP H SL   AL+   T  +K ++W PL  QGWKP     +  K   +  GY+QVFLDGG
Sbjct  16   KPMHPSLLNEALRWTATDGQKKDLWSPLPYQGWKPCLTPSVSHKLPLEPSGYIQVFLDGG  75

Query  403  LNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            LNQQRMGICDA+AVAKILNATLVIP+LEVNPVW+DSSSF +IFDVDHFI  LKD+
Sbjct  76   LNQQRMGICDAIAVAKILNATLVIPHLEVNPVWKDSSSFEEIFDVDHFINSLKDE  130



>ref|XP_008219267.1| PREDICTED: uncharacterized protein At1g04910-like [Prunus mume]
Length=520

 Score =   155 bits (391),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 98/128 (77%), Gaps = 1/128 (1%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKP-VPDSGLFSKFSE  363
            ASPSI SE    K RH  L   AL  +++ E+++++W PL NQGWK  + +    S   +
Sbjct  43   ASPSIFSEWNAPKARHLHLLNPALLLQSSVEQQSKLWSPLPNQGWKHCLEEPKSLSLTPK  102

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
             S GY+QVFLDGGLNQQ+MGICDAVAVAKIL ATLV+P+LEVNPVWQDSSSF +IFD+DH
Sbjct  103  GSTGYIQVFLDGGLNQQKMGICDAVAVAKILKATLVVPHLEVNPVWQDSSSFEEIFDLDH  162

Query  544  FIEVLKDD  567
            FIEVL+D+
Sbjct  163  FIEVLRDE  170



>gb|AGE09594.1| UP7-like protein, partial [Eucalyptus cladocalyx]
Length=297

 Score =   149 bits (375),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +1

Query  289  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  468
            E W PL+  GW+P   +       EKS GY+QVFLDGGLNQQRM +CDAVAVAKILNATL
Sbjct  7    EFWNPLSEPGWRPCIQTTNAPSLPEKSRGYIQVFLDGGLNQQRMAVCDAVAVAKILNATL  66

Query  469  VIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            VIPYLEVNPVWQDSSSF DIFDV+HFI+VLKDD
Sbjct  67   VIPYLEVNPVWQDSSSFGDIFDVEHFIDVLKDD  99



>gb|KCW68511.1| hypothetical protein EUGRSUZ_F02148 [Eucalyptus grandis]
Length=491

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 92/127 (72%), Gaps = 11/127 (9%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            ASPS+ SE    KPRH  L K+A+QR+    ++ ++W PL +QGWKP   S         
Sbjct  25   ASPSMFSEWNAPKPRHLPLLKAAIQRQIPFRQQLDLWSPLPDQGWKPCIRS---------  75

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            ++  L  FLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQD+SSF DIFDVDHF
Sbjct  76   ADDML--FLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQDASSFSDIFDVDHF  133

Query  547  IEVLKDD  567
            I  L+ D
Sbjct  134  ISALEGD  140



>gb|KCW54611.1| hypothetical protein EUGRSUZ_I00557 [Eucalyptus grandis]
Length=484

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +1

Query  289  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  468
            E W PL++ GW+P   +       EKS GY+QVFLDGGLNQQRM +CDAVAVAKILNATL
Sbjct  42   EFWNPLSDPGWRPCIQTTNAPSLPEKSRGYVQVFLDGGLNQQRMAVCDAVAVAKILNATL  101

Query  469  VIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            VIPYLEVNPVWQDSSSF DIFDV+HFI+VLKDD
Sbjct  102  VIPYLEVNPVWQDSSSFGDIFDVEHFIDVLKDD  134



>gb|ABJ96379.1| expressed protein [Prunus persica]
Length=517

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 95/128 (74%), Gaps = 4/128 (3%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKP-VPDSGLFSKFSE  363
            ASPS  SE    K RH  L   AL  +++ E+++++W PL NQGWK  + +    S   +
Sbjct  43   ASPSFFSEWNAPKARHLHLLNPALLSQSSVEQQSKLWSPLPNQGWKHCLEEPKSLSLTPK  102

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
             S GY+QVFLDGGLNQQ+MG+   VAVAKILNATLV+P+LEVNPVWQDSSSF +IFD+DH
Sbjct  103  GSTGYIQVFLDGGLNQQKMGV---VAVAKILNATLVVPHLEVNPVWQDSSSFEEIFDLDH  159

Query  544  FIEVLKDD  567
            FIEVL+D+
Sbjct  160  FIEVLRDE  167



>ref|XP_003578106.1| PREDICTED: uncharacterized protein At1g04910-like [Brachypodium 
distachyon]
Length=512

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 85/127 (67%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  366
            A PS+ SE    KP H  L   AL+     + K  +W  L  QGWKP            +
Sbjct  39   AFPSLFSEWNAPKPMHEFLLNEALRWTILDDHKKNLWTSLPFQGWKPCLKPSTAHGLPLE  98

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
               Y+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+L++NPVW+D+SSF +IFDVDHF
Sbjct  99   PSRYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLDINPVWKDTSSFEEIFDVDHF  158

Query  547  IEVLKDD  567
            I  LKD+
Sbjct  159  INTLKDE  165



>ref|XP_008651492.1| PREDICTED: LOC100283829 isoform X1 [Zea mays]
 gb|ACF82519.1| unknown [Zea mays]
 tpg|DAA61414.1| TPA: hypothetical protein ZEAMMB73_640362 [Zea mays]
Length=447

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +1

Query  280  EKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILN  459
            +K ++W PL  QGWKP     +  K   +  GY+QVFLDGGLNQQRMGICDA+AVAKILN
Sbjct  6    QKKDLWSPLPYQGWKPCLTPSVSHKLPLEPSGYIQVFLDGGLNQQRMGICDAIAVAKILN  65

Query  460  ATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            ATLVIP+LEVNPVW+DSSSF +IFDVDHFI  LKD+
Sbjct  66   ATLVIPHLEVNPVWKDSSSFEEIFDVDHFINSLKDE  101



>gb|KHN11061.1| DUF246 domain-containing protein, partial [Glycine soja]
Length=178

 Score =   138 bits (348),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 80/96 (83%), Gaps = 3/96 (3%)
 Frame = +1

Query  280  EKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILN  459
            + +++W PL +QGWKP  +S   +   EKSEGY+QVFLDGGLNQQ+MG    + VAKILN
Sbjct  49   QLSKLWSPLESQGWKPYVESNKPTALLEKSEGYIQVFLDGGLNQQKMGF---IVVAKILN  105

Query  460  ATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            ATLVIPYLE+NPVW+DSSSFMDIFDVDHFI+VLK+D
Sbjct  106  ATLVIPYLELNPVWRDSSSFMDIFDVDHFIDVLKND  141



>ref|XP_006852943.1| hypothetical protein AMTR_s00033p00238220 [Amborella trichopoda]
 gb|ERN14410.1| hypothetical protein AMTR_s00033p00238220 [Amborella trichopoda]
Length=446

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +1

Query  277  EEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKIL  456
            ++++++W PL +QGWK             +S+GY+QVFLDGGLNQQRMGICDAVAVAKIL
Sbjct  3    DKQSDLWSPLPSQGWKACNAPFSTPVLPRRSQGYIQVFLDGGLNQQRMGICDAVAVAKIL  62

Query  457  NATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            NATLVIP+ EVNPVW+DSS+F DIFDVD+FI VLKDD
Sbjct  63   NATLVIPHFEVNPVWRDSSTFGDIFDVDYFIHVLKDD  99



>ref|XP_010523310.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Tarenaya hassleriana]
Length=445

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 69/69 (100%), Gaps = 0/69 (0%)
 Frame = +1

Query  361  EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVD  540
            EKSEGY+QVFLDGGLNQQRMGICDAVAVAKILNATLV+PYLEVNPVWQDSSSF++IFDVD
Sbjct  26   EKSEGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVVPYLEVNPVWQDSSSFVEIFDVD  85

Query  541  HFIEVLKDD  567
            HFI+VLKDD
Sbjct  86   HFIDVLKDD  94



>ref|XP_008339020.1| PREDICTED: uncharacterized protein LOC103402048 [Malus domestica]
Length=483

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 86/111 (77%), Gaps = 1/111 (1%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGL-FSKFS  360
            +ASPSI SE    +PRHS L   AL  +++ ++++++W PL +QGWK  P+     S   
Sbjct  42   HASPSIFSEWNAPQPRHSRLLSPALLLQSSVDQQSKLWAPLPDQGWKHCPEEPRSLSSSP  101

Query  361  EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSS  513
            ++S GY+QVFLDGGLNQQ+MGICDAVAVAKILNATLVIP+LEVNPVWQDSS
Sbjct  102  KESTGYIQVFLDGGLNQQKMGICDAVAVAKILNATLVIPHLEVNPVWQDSS  152



>ref|XP_011016934.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Populus 
euphratica]
Length=495

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = +1

Query  193  PSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSE  372
            P + SE    KPRH  L K+AL R     +K E+W PL  QGWKP  +         KS+
Sbjct  38   PFLFSEWNAPKPRHLPLLKAALDRHIPVRQKNELWSPLPYQGWKPCIEPTTIHTLPTKSQ  97

Query  373  GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFM  522
            GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVN VWQD+  F+
Sbjct  98   GYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNAVWQDTRYFV  147



>ref|XP_008378640.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=441

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 3/100 (3%)
 Frame = +1

Query  277  EEKAEIWMPLANQGWKPVPDS-GLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVA--  447
            ++++++W PL N GWK  P+     S   ++S GY+QVFLD GLNQQ+MGICDAVAVA  
Sbjct  126  DQQSKLWAPLPNHGWKHCPEEPNSLSSSPKESTGYIQVFLDEGLNQQKMGICDAVAVAVA  185

Query  448  KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            KILNATLVIP+LEVNPVWQDSSSF DIFDVDHFIE L+ +
Sbjct  186  KILNATLVIPHLEVNPVWQDSSSFEDIFDVDHFIEALQGE  225



>emb|CAA23010.1| PsRT17-1 like protein [Arabidopsis thaliana]
 emb|CAB79363.1| PsRT17-1 like protein [Arabidopsis thaliana]
Length=431

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +1

Query  343  LFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFM  522
            LF+   EKSEG+LQVFLDGGLNQQRMGICDAVAVAKI+N TLVIP LEVN VWQDSSSF 
Sbjct  5    LFAALPEKSEGFLQVFLDGGLNQQRMGICDAVAVAKIMNVTLVIPRLEVNTVWQDSSSFT  64

Query  523  DIFDVDHFIEVLKDD  567
            DIFD+DHFI VLKD+
Sbjct  65   DIFDLDHFISVLKDE  79



>ref|XP_002967262.1| hypothetical protein SELMODRAFT_87093 [Selaginella moellendorffii]
 gb|EFJ31861.1| hypothetical protein SELMODRAFT_87093 [Selaginella moellendorffii]
Length=476

 Score =   130 bits (326),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 84/126 (67%), Gaps = 4/126 (3%)
 Frame = +1

Query  196  SILSESIIAKPR--HSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKS  369
            SIL   ++  PR      F   +Q  +   E A +W P  N GW P     + S  S  S
Sbjct  12   SILVYFVLYAPRVFLFYFFPFVVQNSSRSGESALLWHPPDNDGWAPCLRQSVGSISS--S  69

Query  370  EGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFI  549
              YLQVFL+GGLNQQRMG+CDAVAVAKILNATLV+P+L+VNPVWQDSSSF DI+DVD+FI
Sbjct  70   NFYLQVFLEGGLNQQRMGVCDAVAVAKILNATLVVPHLDVNPVWQDSSSFADIYDVDYFI  129

Query  550  EVLKDD  567
            + L  D
Sbjct  130  DYLAAD  135



>ref|XP_002960458.1| hypothetical protein SELMODRAFT_75338 [Selaginella moellendorffii]
 gb|EFJ37997.1| hypothetical protein SELMODRAFT_75338 [Selaginella moellendorffii]
Length=464

 Score =   129 bits (325),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 77/109 (71%), Gaps = 2/109 (2%)
 Frame = +1

Query  241  LFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRM  420
             F   +Q  +   E A +W P  N GW P     + S  S  S  YLQVFL+GGLNQQRM
Sbjct  17   FFPFVVQNNSRSGESALLWHPPDNDGWAPCLRESVGSISS--SNFYLQVFLEGGLNQQRM  74

Query  421  GICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            G+CDAVAVAKILNATLV+P+L+VNPVWQDSSSF DI+DVD+FI+ L  D
Sbjct  75   GVCDAVAVAKILNATLVVPHLDVNPVWQDSSSFADIYDVDYFIDYLAAD  123



>gb|KHN33918.1| DUF246 domain-containing protein [Glycine soja]
Length=169

 Score =   122 bits (306),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 71/96 (74%), Gaps = 5/96 (5%)
 Frame = +1

Query  223  KPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGG  402
            KPRHS L +S         + +E+W PL +QGWKP  +S   +   EK EGY+QVFLDGG
Sbjct  78   KPRHSRLLRSV-----PTSQLSELWSPLESQGWKPYVESNKPTALLEKLEGYIQVFLDGG  132

Query  403  LNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDS  510
            LNQQ++GICDAV VAKILNAT VIPYLE+NPVW+DS
Sbjct  133  LNQQKLGICDAVVVAKILNATPVIPYLELNPVWRDS  168



>gb|AAK84479.1| putative auxin growth promotor protein [Solanum lycopersicum]
Length=478

 Score =   124 bits (310),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 77/128 (60%), Gaps = 28/128 (22%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            Y SP+ILS+    K RHS L KSA+QR+T+ EE++ +W PL +QGWKP   S   S    
Sbjct  28   YGSPTILSDLNAPKFRHSRLAKSAIQRQTSNEEQSRLWTPLEHQGWKPCTKSDAAS----  83

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
                                    + VAKILNATLVIP LEVNPVWQDSSSF DIFDVDH
Sbjct  84   ------------------------IVVAKILNATLVIPQLEVNPVWQDSSSFEDIFDVDH  119

Query  544  FIEVLKDD  567
            FI  LKDD
Sbjct  120  FINALKDD  127



>gb|AAB72114.1| PsRT17-1 [Pisum sativum]
Length=406

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +1

Query  361  EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVD  540
            EKSEGY+QVFLDGGLNQQRMG   AV VAKILNATLVIPYLE+NPVW+DSSSF D  DVD
Sbjct  23   EKSEGYIQVFLDGGLNQQRMGYVIAVVVAKILNATLVIPYLELNPVWKDSSSFEDYIDVD  82

Query  541  HFIEVLKDD  567
            HFI+VLKDD
Sbjct  83   HFIDVLKDD  91



>ref|XP_001777077.1| predicted protein [Physcomitrella patens]
 gb|EDQ58070.1| predicted protein, partial [Physcomitrella patens]
Length=437

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +1

Query  367  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHF  546
            + GYLQVFL+GGLNQQRMGICDAVAVAKILNATLV+P+ +VNPVW+DSSSF DIF+VDHF
Sbjct  11   TNGYLQVFLEGGLNQQRMGICDAVAVAKILNATLVLPHFDVNPVWKDSSSFADIFNVDHF  70

Query  547  IEVL  558
            +  L
Sbjct  71   LNTL  74



>gb|KJB18178.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=401

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/50 (98%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +1

Query  418  MGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            MGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFI VLKDD
Sbjct  1    MGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFINVLKDD  50



>ref|XP_010098633.1| hypothetical protein L484_012746 [Morus notabilis]
 gb|EXB75372.1| hypothetical protein L484_012746 [Morus notabilis]
Length=518

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = +1

Query  289  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  468
            ++W P +N+ + P  + GL      +S GYL V  +GGLNQ R GICD VAVA+I+NATL
Sbjct  96   KLWKPPSNRDFIPCAEPGLNYTPPAESRGYLLVHTNGGLNQMRAGICDMVAVARIINATL  155

Query  469  VIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            VIP L+    WQDSS+F D+FD DHFI+ L +D
Sbjct  156  VIPELDKRSFWQDSSNFSDVFDEDHFIKALAND  188



>gb|KJB44061.1| hypothetical protein B456_007G232700 [Gossypium raimondii]
Length=401

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +1

Query  418  MGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            MGICDAVAVAKILNATLVIP+LEVNPVWQDSSSFMDIFDVDHF+ VLKDD
Sbjct  1    MGICDAVAVAKILNATLVIPHLEVNPVWQDSSSFMDIFDVDHFMNVLKDD  50



>ref|XP_011074208.1| PREDICTED: uncharacterized protein At1g04910 [Sesamum indicum]
Length=537

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 74/128 (58%), Gaps = 9/128 (7%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +A P +L   +IA+    +  K +L  ET       +W PL N+ + P  D         
Sbjct  74   FAHPHVLEAPLIAQKLRGA--KRSLNLET-------LWKPLPNRDYAPCTDPSSSYSTPP  124

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            +S GYL V  +GGLNQ R GICD VAVA+I+NATLVIP L+    WQDSS+F D+FD  H
Sbjct  125  ESRGYLLVHANGGLNQMRAGICDMVAVARIINATLVIPELDKRSYWQDSSNFSDVFDEYH  184

Query  544  FIEVLKDD  567
            FI  L +D
Sbjct  185  FINSLVND  192



>ref|XP_010025951.1| PREDICTED: uncharacterized protein At1g04910 isoform X3 [Eucalyptus 
grandis]
Length=533

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = +1

Query  289  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  468
            ++W P +N+ + P  + GL       S+GYL V  +GGLNQ R GICD VAVA+I+NATL
Sbjct  97   KLWKPPSNRDFVPCTEPGLDYTSPRGSQGYLLVSTNGGLNQMRAGICDMVAVARIINATL  156

Query  469  VIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            VIP L+    WQD+S+F D+FD DHFI  L +D
Sbjct  157  VIPELDKRSFWQDTSNFSDVFDEDHFINALAND  189



>ref|XP_010025946.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Eucalyptus 
grandis]
Length=562

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = +1

Query  289  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  468
            ++W P +N+ + P  + GL       S+GYL V  +GGLNQ R GICD VAVA+I+NATL
Sbjct  126  KLWKPPSNRDFVPCTEPGLDYTSPRGSQGYLLVSTNGGLNQMRAGICDMVAVARIINATL  185

Query  469  VIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            VIP L+    WQD+S+F D+FD DHFI  L +D
Sbjct  186  VIPELDKRSFWQDTSNFSDVFDEDHFINALAND  218



>ref|XP_010025942.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Eucalyptus 
grandis]
 gb|KCW83081.1| hypothetical protein EUGRSUZ_B00039 [Eucalyptus grandis]
Length=563

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = +1

Query  289  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  468
            ++W P +N+ + P  + GL       S+GYL V  +GGLNQ R GICD VAVA+I+NATL
Sbjct  127  KLWKPPSNRDFVPCTEPGLDYTSPRGSQGYLLVSTNGGLNQMRAGICDMVAVARIINATL  186

Query  469  VIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            VIP L+    WQD+S+F D+FD DHFI  L +D
Sbjct  187  VIPELDKRSFWQDTSNFSDVFDEDHFINALAND  219



>ref|XP_007047792.1| O-fucosyltransferase family protein isoform 2, partial [Theobroma 
cacao]
 gb|EOX91949.1| O-fucosyltransferase family protein isoform 2, partial [Theobroma 
cacao]
Length=403

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 65/91 (71%), Gaps = 2/91 (2%)
 Frame = +1

Query  184  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  363
            +ASPS  SE  + KPRH  L +SALQRE +  E++++W PLA+QGW+P  +  +     +
Sbjct  40   HASPSTFSEWNVPKPRHLPLLRSALQRENSNGEQSDLWAPLADQGWRPCLECVIAPSLPQ  99

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKIL  456
            KSEGYLQVFLDGGLNQQRMG  D +++ K L
Sbjct  100  KSEGYLQVFLDGGLNQQRMG--DDISIVKEL  128



>gb|KHN26223.1| DUF246 domain-containing protein [Glycine soja]
Length=509

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 81/125 (65%), Gaps = 9/125 (7%)
 Frame = +1

Query  205  SESIIAKPR---HSSLFKSALQRETTPEEKAEIWM-PLANQGWKPVPDSGLFSKFSEKSE  372
            ++ ++++ R    +S+ K  L+R TTPE    IWM P +++ +K V       +  +K+ 
Sbjct  44   AQRVVSEARTGTETSMPKRVLERLTTPE----IWMKPNSDKYYKCVSRPRNVIRL-KKTN  98

Query  373  GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIE  552
            GYL V  +GGLNQ R GICD VAVAKI+NATLV+P L+ +  W D S F DIFD  HF++
Sbjct  99   GYLLVHANGGLNQMRTGICDMVAVAKIMNATLVLPSLDHDSFWTDPSDFKDIFDWRHFMK  158

Query  553  VLKDD  567
            VLKDD
Sbjct  159  VLKDD  163



>tpg|DAA38994.1| TPA: hypothetical protein ZEAMMB73_412482 [Zea mays]
Length=293

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +1

Query  319  WKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPV  498
            W+P    GL       S G+L V  +GGLNQQR+ ICDA+AVAKILNATLV P   +N V
Sbjct  163  WEPCISKGLIHSELPPSNGFLIVEANGGLNQQRISICDAIAVAKILNATLVTPAFHLNSV  222

Query  499  WQDSSSFMDIFDVDHFIEVLK  561
            W+DSS F DIFD DHFIE L+
Sbjct  223  WRDSSKFGDIFDEDHFIESLR  243



>ref|XP_010044058.1| PREDICTED: uncharacterized protein At1g04910 [Eucalyptus grandis]
Length=668

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 70/111 (63%), Gaps = 5/111 (5%)
 Frame = +1

Query  238  SLFKSALQRETTPEEKAEIWM-PLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQ  414
            S+ K  L++ +TPE    IWM P ++  +K V       +   K+ GYL V  +GGLNQ 
Sbjct  215  SMPKRVLEKLSTPE----IWMKPNSDNYYKCVTRPKNRIRTDAKTNGYLLVHANGGLNQM  270

Query  415  RMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            R GICD VAVAKI+NATLV+P L+    W D S F DIFD  HFIEVLKDD
Sbjct  271  RTGICDMVAVAKIMNATLVLPSLDHESFWTDPSDFKDIFDWKHFIEVLKDD  321



>gb|KCW86055.1| hypothetical protein EUGRSUZ_B02760 [Eucalyptus grandis]
Length=667

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 70/111 (63%), Gaps = 5/111 (5%)
 Frame = +1

Query  238  SLFKSALQRETTPEEKAEIWM-PLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQ  414
            S+ K  L++ +TPE    IWM P ++  +K V       +   K+ GYL V  +GGLNQ 
Sbjct  215  SMPKRVLEKLSTPE----IWMKPNSDNYYKCVTRPKNRIRTDAKTNGYLLVHANGGLNQM  270

Query  415  RMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            R GICD VAVAKI+NATLV+P L+    W D S F DIFD  HFIEVLKDD
Sbjct  271  RTGICDMVAVAKIMNATLVLPSLDHESFWTDPSDFKDIFDWKHFIEVLKDD  321



>ref|XP_003516326.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
Length=639

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 81/125 (65%), Gaps = 9/125 (7%)
 Frame = +1

Query  205  SESIIAKPR---HSSLFKSALQRETTPEEKAEIWM-PLANQGWKPVPDSGLFSKFSEKSE  372
            ++ ++++ R    +S+ K  L+R TTPE    IWM P +++ +K V       +  +K+ 
Sbjct  174  AQRVVSEARTGTETSMPKRVLERLTTPE----IWMKPNSDKYYKCVSRPRNVIRL-KKTN  228

Query  373  GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIE  552
            GYL V  +GGLNQ R GICD VAVAKI+NATLV+P L+ +  W D S F DIFD  HF++
Sbjct  229  GYLLVHANGGLNQMRTGICDMVAVAKIMNATLVLPSLDHDSFWTDPSDFKDIFDWRHFMK  288

Query  553  VLKDD  567
            VLKDD
Sbjct  289  VLKDD  293



>ref|XP_008669810.1| PREDICTED: uncharacterized protein At1g04910-like isoform X6 
[Zea mays]
Length=385

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +1

Query  319  WKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPV  498
            W+P    GL       S G+L V  +GGLNQQR+ ICDA+AVAKILNATLV P   +N V
Sbjct  118  WEPCISKGLIHSELPPSNGFLIVEANGGLNQQRISICDAIAVAKILNATLVTPAFHLNSV  177

Query  499  WQDSSSFMDIFDVDHFIEVLK  561
            W+DSS F DIFD DHFIE L+
Sbjct  178  WRDSSKFGDIFDEDHFIESLR  198



>gb|KHM98943.1| DUF246 domain-containing protein [Glycine soja]
Length=508

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 83/128 (65%), Gaps = 11/128 (9%)
 Frame = +1

Query  199  ILSESIIAKPR---HSSLFKSALQRETTPEEKAEIWM-PLANQGWKPV-PDSGLFSKFSE  363
            + ++ ++++ R    +S+ K  L+R TTPE    IWM P +++ +K V P   +     +
Sbjct  42   VSAQRVVSESRTRTETSMPKRVLERLTTPE----IWMKPNSDKYYKCVSPPRNVIR--PK  95

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            ++ GYL V  +GGLNQ R GICD VAVAKI+NATLV+P L+ +  W D S F DIFD  H
Sbjct  96   QTNGYLLVHANGGLNQMRTGICDMVAVAKIMNATLVLPSLDHDSFWTDPSDFKDIFDWRH  155

Query  544  FIEVLKDD  567
            F++VLKDD
Sbjct  156  FVKVLKDD  163



>ref|XP_011096470.1| PREDICTED: uncharacterized protein At1g04910 [Sesamum indicum]
Length=586

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 65/94 (69%), Gaps = 3/94 (3%)
 Frame = +1

Query  292  IWMPLANQGWKP-VPDSGLFSKFSE--KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNA  462
            +W P   QGWKP +  + + S  SE  KS G+L +  +GGLNQQR+ ICDAVAVA +LNA
Sbjct  145  VWNPKLRQGWKPCIKQTVIQSGLSEFPKSNGFLIIEANGGLNQQRLSICDAVAVAGLLNA  204

Query  463  TLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKD  564
            TLVIP   +N VWQDSS F DIFD + FI  L++
Sbjct  205  TLVIPIFHLNSVWQDSSKFGDIFDEEFFIYALRN  238



>emb|CBI18521.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 62/92 (67%), Gaps = 0/92 (0%)
 Frame = +1

Query  292  IWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLV  471
            +W P  +Q WKP  +  + +    KS GY  +  +GGLNQQR+ ICDAVAVA +LNATLV
Sbjct  54   VWHPKPHQSWKPCVNQRISAAELPKSNGYFIIEANGGLNQQRLSICDAVAVAGLLNATLV  113

Query  472  IPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            IP   +N VW+DSS F DIFD + FI  L+++
Sbjct  114  IPMFHLNSVWRDSSKFGDIFDEEFFIYTLRNN  145



>emb|CBI19199.3| unnamed protein product [Vitis vinifera]
Length=536

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = +1

Query  289  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  468
            ++W P  N+ + P  D G       +S+GYL V  +GGLNQ R GICD VAVA+I+NATL
Sbjct  98   KLWKPPQNRDFVPCVDPGANYTSPAESQGYLLVHTNGGLNQMRAGICDMVAVARIINATL  157

Query  469  VIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            VIP L+    WQDSS+F D+FD DHFI  L  D
Sbjct  158  VIPELDKRSFWQDSSNFSDVFDEDHFISALAYD  190



>ref|XP_010664349.1| PREDICTED: uncharacterized protein At1g04910 [Vitis vinifera]
Length=535

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = +1

Query  289  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  468
            ++W P  N+ + P  D G       +S+GYL V  +GGLNQ R GICD VAVA+I+NATL
Sbjct  98   KLWKPPQNRDFVPCVDPGANYTSPAESQGYLLVHTNGGLNQMRAGICDMVAVARIINATL  157

Query  469  VIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            VIP L+    WQDSS+F D+FD DHFI  L  D
Sbjct  158  VIPELDKRSFWQDSSNFSDVFDEDHFISALAYD  190



>ref|XP_008669809.1| PREDICTED: uncharacterized protein At1g04910-like isoform X5 
[Zea mays]
Length=436

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +1

Query  319  WKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPV  498
            W+P    GL       S G+L V  +GGLNQQR+ ICDA+AVAKILNATLV P   +N V
Sbjct  118  WEPCISKGLIHSELPPSNGFLIVEANGGLNQQRISICDAIAVAKILNATLVTPAFHLNSV  177

Query  499  WQDSSSFMDIFDVDHFIEVLK  561
            W+DSS F DIFD DHFIE L+
Sbjct  178  WRDSSKFGDIFDEDHFIESLR  198



>ref|XP_002272758.2| PREDICTED: uncharacterized protein At1g04910 [Vitis vinifera]
Length=582

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 62/92 (67%), Gaps = 0/92 (0%)
 Frame = +1

Query  292  IWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLV  471
            +W P  +Q WKP  +  + +    KS GY  +  +GGLNQQR+ ICDAVAVA +LNATLV
Sbjct  144  VWHPKPHQSWKPCVNQRISAAELPKSNGYFIIEANGGLNQQRLSICDAVAVAGLLNATLV  203

Query  472  IPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            IP   +N VW+DSS F DIFD + FI  L+++
Sbjct  204  IPMFHLNSVWRDSSKFGDIFDEEFFIYTLRNN  235



>ref|XP_010061980.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Eucalyptus 
grandis]
Length=454

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 64/94 (68%), Gaps = 3/94 (3%)
 Frame = +1

Query  295  WMPLANQGWKPVPD---SGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNAT  465
            W P  +Q WKP      S + SK   +S G+L +  +GGLNQQR+ ICD VAVA +LNAT
Sbjct  129  WSPTLHQSWKPCGSMTISQIGSKQLPESNGFLIIEANGGLNQQRLSICDVVAVAGLLNAT  188

Query  466  LVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            LVIP   +N VWQDSS+F DIFD D FI+ LK++
Sbjct  189  LVIPIFHLNSVWQDSSNFSDIFDEDFFIDSLKNN  222



>gb|KDP34835.1| hypothetical protein JCGZ_11197 [Jatropha curcas]
Length=594

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 62/93 (67%), Gaps = 2/93 (2%)
 Frame = +1

Query  295  WMPLANQGWKPVPDSGLFSKFSE--KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  468
            W P    GWKP  +    +  +E  KS G+L +  +GGLNQQR+ ICDAVAVA +LNATL
Sbjct  149  WDPKLRNGWKPCGNGNNETSEAELPKSNGFLIIEANGGLNQQRLSICDAVAVAGLLNATL  208

Query  469  VIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            VIP   +N VWQDSS F DIFD + FI  LK+D
Sbjct  209  VIPIFHLNSVWQDSSKFGDIFDEEFFIHALKND  241



>ref|XP_009398160.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=533

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 63/96 (66%), Gaps = 4/96 (4%)
 Frame = +1

Query  286  AEIWMPLANQGWKPV--PDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILN  459
            A++W P AN+ + P   P S        +S GYL V  +GGLNQ R GICD VAVA+++N
Sbjct  95   AKLWKPPANRNFVPCVAPSSSFLP--PSQSRGYLLVHANGGLNQMRAGICDMVAVARLIN  152

Query  460  ATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            ATLVIP L+    WQDSS+F D+FD +HFI  L DD
Sbjct  153  ATLVIPQLDKRSFWQDSSNFSDVFDEEHFIHTLADD  188



>ref|XP_008781543.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Phoenix dactylifera]
Length=423

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 61/90 (68%), Gaps = 0/90 (0%)
 Frame = +1

Query  295  WMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVI  474
            W   A+Q WKP  +  L       S G+L +  +GGLNQQR+ ICDAVAVA +LNATLVI
Sbjct  123  WHQKASQRWKPCLNKRLSHAELPPSNGFLIIEANGGLNQQRLSICDAVAVAGLLNATLVI  182

Query  475  PYLEVNPVWQDSSSFMDIFDVDHFIEVLKD  564
            P   +N VW+DSS F +IFD D+FIE LK+
Sbjct  183  PMFHLNSVWRDSSKFGEIFDEDYFIETLKN  212



>ref|XP_010930789.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g04910-like 
[Elaeis guineensis]
Length=553

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 61/90 (68%), Gaps = 0/90 (0%)
 Frame = +1

Query  295  WMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVI  474
            W   A+Q WKP  +  L       S GYL +  +GGLNQQR+ ICDAVAVA +LNATLVI
Sbjct  127  WHQKASQRWKPCVNKRLSHAELPLSNGYLIIEANGGLNQQRLSICDAVAVAGLLNATLVI  186

Query  475  PYLEVNPVWQDSSSFMDIFDVDHFIEVLKD  564
            P   +N VW+DSS F +IFD D+FIE LK+
Sbjct  187  PIFHLNSVWRDSSKFGEIFDEDYFIETLKN  216



>gb|EYU22809.1| hypothetical protein MIMGU_mgv1a003510mg [Erythranthe guttata]
Length=580

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = +1

Query  286  AEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNAT  465
            + +W P   QGWKP     +      +S G+L +  +GGLNQQR+ ICDAVAVA +LNAT
Sbjct  140  SNVWNPKMKQGWKPCIKQTVSQSELSQSNGFLIIEANGGLNQQRISICDAVAVAGLLNAT  199

Query  466  LVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKD  564
            LVIP   +N VWQDSS F DIFD + FI  L++
Sbjct  200  LVIPIFHLNSVWQDSSKFGDIFDEEFFIYALRN  232



>ref|XP_009390064.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=521

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 70/131 (53%), Gaps = 16/131 (12%)
 Frame = +1

Query  181  IYASPSILSES---IIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFS  351
            +Y SP +  E    + A   HSS   +A             W   A Q WKP     L  
Sbjct  87   VYRSPRLFHELWAFMQADVNHSSALMTA-------------WHQKATQKWKPRLPKRLLQ  133

Query  352  KFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIF  531
                 S GYL +  +GGLNQQRM ICDAVAVA +LNATLVIP    N VW+DSS F DIF
Sbjct  134  AELPPSNGYLIIEANGGLNQQRMSICDAVAVAGLLNATLVIPIFHFNSVWRDSSKFEDIF  193

Query  532  DVDHFIEVLKD  564
            D ++F E LK+
Sbjct  194  DEEYFTETLKN  204



>ref|XP_009390063.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=541

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 70/131 (53%), Gaps = 16/131 (12%)
 Frame = +1

Query  181  IYASPSILSES---IIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFS  351
            +Y SP +  E    + A   HSS   +A             W   A Q WKP     L  
Sbjct  87   VYRSPRLFHELWAFMQADVNHSSALMTA-------------WHQKATQKWKPRLPKRLLQ  133

Query  352  KFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIF  531
                 S GYL +  +GGLNQQRM ICDAVAVA +LNATLVIP    N VW+DSS F DIF
Sbjct  134  AELPPSNGYLIIEANGGLNQQRMSICDAVAVAGLLNATLVIPIFHFNSVWRDSSKFEDIF  193

Query  532  DVDHFIEVLKD  564
            D ++F E LK+
Sbjct  194  DEEYFTETLKN  204



>ref|XP_006576578.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=637

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 83/128 (65%), Gaps = 11/128 (9%)
 Frame = +1

Query  199  ILSESIIAKPR---HSSLFKSALQRETTPEEKAEIWM-PLANQGWKPV-PDSGLFSKFSE  363
            + ++ ++++ R    +S+ K  L+R TTPE    IWM P +++ +K V P   +     +
Sbjct  171  VSAQRVVSESRTRTETSMPKRVLERLTTPE----IWMKPNSDKYYKCVSPPRNVIR--PK  224

Query  364  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDH  543
            ++ GYL V  +GGLNQ R GICD VAVAKI+NATLV+P L+ +  W D S F DIFD  H
Sbjct  225  QTNGYLLVHANGGLNQMRTGICDMVAVAKIMNATLVLPSLDHDSFWTDPSDFKDIFDWRH  284

Query  544  FIEVLKDD  567
            F++VLKDD
Sbjct  285  FVKVLKDD  292



>ref|XP_002969133.1| hypothetical protein SELMODRAFT_90475, partial [Selaginella moellendorffii]
 gb|EFJ30249.1| hypothetical protein SELMODRAFT_90475, partial [Selaginella moellendorffii]
Length=458

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 66/95 (69%), Gaps = 8/95 (8%)
 Frame = +1

Query  307  ANQGWKPVPDS------GLFSKF--SEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNA  462
            A + W+P  +       G F+ F   +++ GYL +  +GGLNQQR+ IC+AVAVA+I+N 
Sbjct  31   ATKSWRPCAEERASKHIGSFASFLSEDETNGYLGIHAEGGLNQQRIAICNAVAVARIMNV  90

Query  463  TLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            TL+IP ++ + +W+D + F D+FDVDHFIE LKDD
Sbjct  91   TLIIPLMKQDQIWKDKTRFEDVFDVDHFIESLKDD  125



>ref|XP_004152623.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 ref|XP_004162223.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
Length=534

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = +1

Query  289  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  468
            ++W P +N+ + P  D  +      +S GYL V  +GGLNQ R GICD VAVA+I+NATL
Sbjct  97   KLWKPPSNRDFLPCVDPSVNYTAPMESRGYLLVHTNGGLNQMRAGICDMVAVARIINATL  156

Query  469  VIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            VIP L+    WQD+S+F D+FD DHFI  L +D
Sbjct  157  VIPELDKQSFWQDTSNFSDVFDEDHFISALAED  189



>ref|XP_008669807.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Zea mays]
Length=492

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +1

Query  319  WKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPV  498
            W+P    GL       S G+L V  +GGLNQQR+ ICDA+AVAKILNATLV P   +N V
Sbjct  118  WEPCISKGLIHSELPPSNGFLIVEANGGLNQQRISICDAIAVAKILNATLVTPAFHLNSV  177

Query  499  WQDSSSFMDIFDVDHFIEVLK  561
            W+DSS F DIFD DHFIE L+
Sbjct  178  WRDSSKFGDIFDEDHFIESLR  198



>ref|XP_007222914.1| hypothetical protein PRUPE_ppa003660mg [Prunus persica]
 gb|EMJ24113.1| hypothetical protein PRUPE_ppa003660mg [Prunus persica]
Length=558

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 65/91 (71%), Gaps = 4/91 (4%)
 Frame = +1

Query  307  ANQGWKPVPDSGL--FSKFSEKSE--GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVI  474
            A   WKP  +  L  FS    ++E  GY+ +  +GGLNQQR+ IC+AVAVAKI+NATL++
Sbjct  135  ATTSWKPCAERRLGGFSDLPPENETTGYIFIHAEGGLNQQRIAICNAVAVAKIMNATLIL  194

Query  475  PYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            P L+ + +W+D + F DIFDVDHFI+ LKDD
Sbjct  195  PVLKQDQIWKDQTKFEDIFDVDHFIDYLKDD  225



>ref|XP_008669808.1| PREDICTED: uncharacterized protein At1g04910-like isoform X4 
[Zea mays]
Length=488

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +1

Query  319  WKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPV  498
            W+P    GL       S G+L V  +GGLNQQR+ ICDA+AVAKILNATLV P   +N V
Sbjct  118  WEPCISKGLIHSELPPSNGFLIVEANGGLNQQRISICDAIAVAKILNATLVTPAFHLNSV  177

Query  499  WQDSSSFMDIFDVDHFIEVLK  561
            W+DSS F DIFD DHFIE L+
Sbjct  178  WRDSSKFGDIFDEDHFIESLR  198



>ref|XP_002973931.1| hypothetical protein SELMODRAFT_100522, partial [Selaginella 
moellendorffii]
 gb|EFJ24886.1| hypothetical protein SELMODRAFT_100522, partial [Selaginella 
moellendorffii]
Length=458

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 66/95 (69%), Gaps = 8/95 (8%)
 Frame = +1

Query  307  ANQGWKPVPDS------GLFSKF--SEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNA  462
            A + W+P  +       G F+ F   +++ GYL +  +GGLNQQR+ IC+AVAVA+I+N 
Sbjct  31   ATKSWRPCAEERASNHIGSFASFLSEDETNGYLGIHAEGGLNQQRIAICNAVAVARIMNV  90

Query  463  TLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            TL+IP ++ + +W+D + F D+FDVDHFIE LKDD
Sbjct  91   TLIIPLMKQDQIWKDKTRFEDVFDVDHFIESLKDD  125



>ref|XP_004977274.1| PREDICTED: uncharacterized protein At1g04910-like [Setaria italica]
Length=511

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +1

Query  319  WKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPV  498
            W P  +S L       S GYL +  +GGLNQQR+ ICDAVAVA +LNATLVIP   +N V
Sbjct  92   WMPCVNSRLIRSELPPSNGYLMIEANGGLNQQRLSICDAVAVASLLNATLVIPTFHLNSV  151

Query  499  WQDSSSFMDIFDVDHFIEVLKD  564
            W+D+S F DIFD DHFIE L++
Sbjct  152  WRDASKFGDIFDEDHFIETLRE  173



>ref|XP_010104480.1| hypothetical protein L484_025449 [Morus notabilis]
 gb|EXC01081.1| hypothetical protein L484_025449 [Morus notabilis]
Length=290

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 68/111 (61%), Gaps = 12/111 (11%)
 Frame = +1

Query  256  LQRETTPEEKA--EIWMPLANQGWKP-----VPDSGLFSKFSEKSEGYLQVFLDGGLNQQ  414
            +Q E+   E A   +W    +Q WKP     +P +GL      KS G+  +  +GGLNQQ
Sbjct  116  MQAESNGSENAMMSVWNSTVHQVWKPCLHRDIPKAGL-----PKSNGFFIIEANGGLNQQ  170

Query  415  RMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            R+ ICDAVAVA +LNATL+IP   +N VW+DSS+F DIFD D FI  L+  
Sbjct  171  RLSICDAVAVAGLLNATLLIPIFHLNSVWRDSSNFRDIFDEDFFIHTLRHH  221



>ref|XP_006363293.1| PREDICTED: uncharacterized protein At1g04910-like [Solanum tuberosum]
Length=531

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 65/94 (69%), Gaps = 2/94 (2%)
 Frame = +1

Query  289  EIWMPLANQGWKP-VPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNAT  465
            ++W P  N+   P V  S L++   E S GYL V  +GGLNQ R GICD VAVA+I+NAT
Sbjct  94   KLWKPPPNRDHVPCVAASPLYTPPPE-SRGYLLVHANGGLNQMRAGICDMVAVARIINAT  152

Query  466  LVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            LVIP L+   +WQDSS+F D+FD DHFI  LK+D
Sbjct  153  LVIPELDKRSLWQDSSNFSDVFDEDHFINSLKND  186



>ref|XP_007207136.1| hypothetical protein PRUPE_ppa002471mg [Prunus persica]
 gb|EMJ08335.1| hypothetical protein PRUPE_ppa002471mg [Prunus persica]
Length=669

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 74/124 (60%), Gaps = 5/124 (4%)
 Frame = +1

Query  199  ILSESIIAKPRHSSLFKSALQRETTPEEKAEIWM-PLANQGWKPVPDSGLFSKFSEKSEG  375
            +L    +++   S++FK  L+R  TPE    IW  P ++   K +       +   K+ G
Sbjct  203  VLERERLSESEPSTMFKRLLERSPTPE----IWRKPNSDNFDKCIARPKNRIRTGSKTNG  258

Query  376  YLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEV  555
            YL V  +GGLNQ R GICD VAVAKI+NATLV+P L+    W D S F DIFD  HF++V
Sbjct  259  YLLVHANGGLNQMRTGICDMVAVAKIMNATLVLPLLDHQSFWTDPSDFKDIFDWRHFMKV  318

Query  556  LKDD  567
            LKDD
Sbjct  319  LKDD  322



>ref|XP_001765585.1| predicted protein [Physcomitrella patens]
 gb|EDQ69635.1| predicted protein, partial [Physcomitrella patens]
Length=469

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = +1

Query  289  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  468
            ++W P  N+G+ P  +          S GYL V  +GGLNQ R GICD VAVA+ILNATL
Sbjct  1    KLWKPPPNRGFHPCVEPSESYSGPGISRGYLLVQSNGGLNQMRAGICDMVAVARILNATL  60

Query  469  VIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            V+P L+    WQDSS+F DIFD DHFI  L+ D
Sbjct  61   VVPELDKRSFWQDSSNFSDIFDADHFIAALRGD  93



>ref|XP_008781542.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Phoenix dactylifera]
Length=461

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 61/90 (68%), Gaps = 0/90 (0%)
 Frame = +1

Query  295  WMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVI  474
            W   A+Q WKP  +  L       S G+L +  +GGLNQQR+ ICDAVAVA +LNATLVI
Sbjct  123  WHQKASQRWKPCLNKRLSHAELPPSNGFLIIEANGGLNQQRLSICDAVAVAGLLNATLVI  182

Query  475  PYLEVNPVWQDSSSFMDIFDVDHFIEVLKD  564
            P   +N VW+DSS F +IFD D+FIE LK+
Sbjct  183  PMFHLNSVWRDSSKFGEIFDEDYFIETLKN  212



>emb|CDY56371.1| BnaAnng14240D [Brassica napus]
Length=226

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 70/104 (67%), Gaps = 7/104 (7%)
 Frame = +1

Query  277  EEKAEIW-MPL-ANQGWKPVPDSGLFSKFSE-----KSEGYLQVFLDGGLNQQRMGICDA  435
            +E A  W  PL A   WKP  +  +    S+     ++ GY+ +  +GGLNQQR+ IC+A
Sbjct  95   KESASRWENPLPATTSWKPCAERRIGGGVSDVLPENETNGYVFIHAEGGLNQQRIAICNA  154

Query  436  VAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            VAVAKI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD
Sbjct  155  VAVAKIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDD  198



>ref|XP_008221889.1| PREDICTED: uncharacterized protein At1g04910 [Prunus mume]
Length=558

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 65/91 (71%), Gaps = 4/91 (4%)
 Frame = +1

Query  307  ANQGWKPVPDSGL--FSKFSEKSE--GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVI  474
            A   WKP  +  L  FS    ++E  GY+ +  +GGLNQQR+ IC+AVAVAKI+NATL++
Sbjct  135  ATTSWKPCAERRLGGFSDLPPENETTGYIFIHAEGGLNQQRIAICNAVAVAKIMNATLIL  194

Query  475  PYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            P L+ + +W+D + F DIFDVDHFI+ LKDD
Sbjct  195  PVLKQDQIWKDQTKFEDIFDVDHFIDYLKDD  225



>ref|XP_002441904.1| hypothetical protein SORBIDRAFT_08g004650 [Sorghum bicolor]
 gb|EES15742.1| hypothetical protein SORBIDRAFT_08g004650 [Sorghum bicolor]
Length=533

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 71/114 (62%), Gaps = 9/114 (8%)
 Frame = +1

Query  250  SALQRETTPEE----KAEIWMPLA---NQG--WKPVPDSGLFSKFSEKSEGYLQVFLDGG  402
            S+L+R T P +     A++ +  +   N G  W P  +S L       S GYL +  +GG
Sbjct  82   SSLRRRTRPVDGEPPHAQLRLMTSHYQNSGDPWMPCVNSRLTRSELPPSNGYLMIEANGG  141

Query  403  LNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKD  564
            LNQQR+ ICDAVAVA +LNATLVIP   +N VW+D S F DIFD DHFIE LK+
Sbjct  142  LNQQRLSICDAVAVASLLNATLVIPTFHLNSVWRDPSKFGDIFDEDHFIETLKE  195



>ref|XP_001761221.1| predicted protein [Physcomitrella patens]
 gb|EDQ73943.1| predicted protein, partial [Physcomitrella patens]
Length=461

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = +1

Query  289  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  468
            ++W P A++G+ P  + G      + ++GYL V  +GGLNQ R GICD VA+A+++NATL
Sbjct  2    QLWEPPADKGFVPCVEPGPAHSGPKPAKGYLMVSTNGGLNQMRAGICDMVAIARLINATL  61

Query  469  VIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            VIP L+    WQD+S+F D+FDV++FI+ L +D
Sbjct  62   VIPELDKGSFWQDASNFSDVFDVEYFIKALAND  94



>ref|XP_007018708.1| O-fucosyltransferase family protein [Theobroma cacao]
 gb|EOY15933.1| O-fucosyltransferase family protein [Theobroma cacao]
Length=563

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = +1

Query  289  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  468
            ++W P AN+ + P           ++S GYL V  +GGLNQ R GICD VAVA+I+NATL
Sbjct  109  KLWKPPANRDFVPCVQHSSNYAAPDESRGYLLVHTNGGLNQMRAGICDMVAVARIINATL  168

Query  469  VIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            V+P L+    WQDSS+F D+FD DHFI  L +D
Sbjct  169  VVPELDKRSYWQDSSNFSDVFDEDHFINALAND  201



>ref|XP_008669805.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Zea mays]
Length=544

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +1

Query  319  WKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPV  498
            W+P    GL       S G+L V  +GGLNQQR+ ICDA+AVAKILNATLV P   +N V
Sbjct  118  WEPCISKGLIHSELPPSNGFLIVEANGGLNQQRISICDAIAVAKILNATLVTPAFHLNSV  177

Query  499  WQDSSSFMDIFDVDHFIEVLK  561
            W+DSS F DIFD DHFIE L+
Sbjct  178  WRDSSKFGDIFDEDHFIESLR  198



>ref|XP_002533585.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28803.1| conserved hypothetical protein [Ricinus communis]
Length=587

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 60/94 (64%), Gaps = 0/94 (0%)
 Frame = +1

Query  286  AEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNAT  465
            A+ W     +GWKP   + +      KS GYL +  +GGLNQQR+ ICDAVAVA +LNAT
Sbjct  144  AKAWDVKLLEGWKPCGSNTISEAELPKSNGYLIIEANGGLNQQRLSICDAVAVAGLLNAT  203

Query  466  LVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            LVIP   +N +WQD S F DIFD D FI  LK D
Sbjct  204  LVIPIFHLNSIWQDKSKFGDIFDEDFFIHALKHD  237



>gb|KEH35288.1| growth regulator-like protein [Medicago truncatula]
Length=439

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 71/103 (69%), Gaps = 6/103 (6%)
 Frame = +1

Query  277  EEKAEIW-MPLANQ-GWKPVPDS--GLFSKFSEKSE--GYLQVFLDGGLNQQRMGICDAV  438
            +E A +W  P ++   WKP  +   G  S    ++E  GY+ +  +GGLNQQR+ IC+AV
Sbjct  114  KESASLWENPYSSTTSWKPCAERRDGAISDLPHENETNGYIFIHAEGGLNQQRIAICNAV  173

Query  439  AVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            AVAKI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD
Sbjct  174  AVAKIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDD  216



>gb|KCW69027.1| hypothetical protein EUGRSUZ_F02582 [Eucalyptus grandis]
Length=524

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 64/94 (68%), Gaps = 3/94 (3%)
 Frame = +1

Query  295  WMPLANQGWKPVPD---SGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNAT  465
            W P  +Q WKP      S + SK   +S G+L +  +GGLNQQR+ ICD VAVA +LNAT
Sbjct  129  WSPTLHQSWKPCGSMTISQIGSKQLPESNGFLIIEANGGLNQQRLSICDVVAVAGLLNAT  188

Query  466  LVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            LVIP   +N VWQDSS+F DIFD D FI+ LK++
Sbjct  189  LVIPIFHLNSVWQDSSNFSDIFDEDFFIDSLKNN  222



>ref|XP_010023452.1| PREDICTED: uncharacterized protein At1g04910 [Eucalyptus grandis]
 gb|KCW59721.1| hypothetical protein EUGRSUZ_H02475 [Eucalyptus grandis]
Length=572

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 65/91 (71%), Gaps = 4/91 (4%)
 Frame = +1

Query  307  ANQGWKPVP---DSGLFSKFSE-KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVI  474
            A   WKP     D G+    SE ++ GY+ +  +GGLNQQR+ IC+AVAVAKILNATL++
Sbjct  149  ATTSWKPCAERRDDGISDVPSENETNGYIFIHAEGGLNQQRIAICNAVAVAKILNATLIL  208

Query  475  PYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            P L+ + +W+D + F DIFDVDHFI+ LKDD
Sbjct  209  PVLKQDQIWKDQTKFEDIFDVDHFIDYLKDD  239



>gb|KJB50269.1| hypothetical protein B456_008G161400 [Gossypium raimondii]
Length=502

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 69/103 (67%), Gaps = 6/103 (6%)
 Frame = +1

Query  277  EEKAEIWM-PL-ANQGWKPVPD--SGLFSKFSEKSE--GYLQVFLDGGLNQQRMGICDAV  438
            +EK  +W  P  A   WKP  +   G  S    ++E  GYL +  +GGLNQQR+ IC+AV
Sbjct  119  KEKPSLWENPFSATTSWKPCAERREGGISDLPPENETSGYLFIHAEGGLNQQRIAICNAV  178

Query  439  AVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            AVAKI+NATL++P L+ + +W+D + F DIFDVDHFI  LKDD
Sbjct  179  AVAKIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFINYLKDD  221



>ref|NP_001066285.2| Os12g0174100 [Oryza sativa Japonica Group]
 gb|ABA96586.1| Growth regulator protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29304.2| Os12g0174100 [Oryza sativa Japonica Group]
Length=491

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 59/96 (61%), Gaps = 8/96 (8%)
 Frame = +1

Query  277  EEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKIL  456
            +   E+WMP  N+         L       S GYL +  +GGLNQQR+ ICDAVAVA +L
Sbjct  66   QNPGELWMPCVNRK--------LIRPELPPSNGYLMIEANGGLNQQRLSICDAVAVASLL  117

Query  457  NATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKD  564
            NATLVIP    N VW+D S F DIFD DHFIE LK+
Sbjct  118  NATLVIPAFHFNSVWRDHSKFGDIFDEDHFIETLKE  153



>ref|XP_010061979.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Eucalyptus 
grandis]
 gb|KCW69026.1| hypothetical protein EUGRSUZ_F02582 [Eucalyptus grandis]
Length=562

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 64/94 (68%), Gaps = 3/94 (3%)
 Frame = +1

Query  295  WMPLANQGWKPVPD---SGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNAT  465
            W P  +Q WKP      S + SK   +S G+L +  +GGLNQQR+ ICD VAVA +LNAT
Sbjct  129  WSPTLHQSWKPCGSMTISQIGSKQLPESNGFLIIEANGGLNQQRLSICDVVAVAGLLNAT  188

Query  466  LVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            LVIP   +N VWQDSS+F DIFD D FI+ LK++
Sbjct  189  LVIPIFHLNSVWQDSSNFSDIFDEDFFIDSLKNN  222



>ref|XP_004490385.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Cicer arietinum]
Length=451

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = +1

Query  289  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  468
            ++W P +N+G+ P            +S GYL V  +GGLNQ R GICD VAVA+ILNATL
Sbjct  14   KLWKPPSNRGFLPCTKPTPNYTAPAESRGYLLVHTNGGLNQMRSGICDMVAVARILNATL  73

Query  469  VIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            VIP L+    WQD+S+F DIFD +HFI  L +D
Sbjct  74   VIPELDKRSFWQDTSNFSDIFDEEHFINSLAND  106



>ref|XP_010535322.1| PREDICTED: uncharacterized protein At1g04910 isoform X3 [Tarenaya 
hassleriana]
Length=442

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = +1

Query  289  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  468
            ++W    N+G+ P  D       S+ S GYL V  +GGLNQ R GICD VA+A+I+NATL
Sbjct  6    KLWKSPTNRGFVPCIDPSPNYTSSKGSRGYLLVHTNGGLNQMRAGICDMVAIARIINATL  65

Query  469  VIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            V+P L+    WQD+S+F DIFD DHFI  L +D
Sbjct  66   VVPELDKRSFWQDTSNFSDIFDEDHFIVALSND  98



>ref|XP_002960947.1| hypothetical protein SELMODRAFT_402444 [Selaginella moellendorffii]
 gb|EFJ38486.1| hypothetical protein SELMODRAFT_402444 [Selaginella moellendorffii]
Length=571

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 70/111 (63%), Gaps = 11/111 (10%)
 Frame = +1

Query  265  ETTPEEKAEIWMPLANQGWKPVPDSGLF------SKFSEK----SEGYLQVFLDGGLNQQ  414
            E+T  + + +   L N  W   PDS  +      SK S K    + GYL+V  +GGLNQ 
Sbjct  122  ESTITKVSHVERKLYNSLWAN-PDSSKYEQCIARSKKSRKAGAATNGYLRVNANGGLNQM  180

Query  415  RMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            R GICD VAVA+I+NATLV+P L+ +  W+D S F DIFD+DHFIE LKDD
Sbjct  181  RTGICDMVAVARIMNATLVMPTLDHSSFWEDPSEFADIFDIDHFIETLKDD  231



>gb|KJB76860.1| hypothetical protein B456_012G110800 [Gossypium raimondii]
Length=633

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 76/123 (62%), Gaps = 6/123 (5%)
 Frame = +1

Query  202  LSESIIAKPRHSSLFKSALQRETTPEEKAEIWM-PLANQGWKPVPDSGLFSKFSEKSEGY  378
            +++ ++++  HS + K  L+R +TPE    IWM P ++   + +       +   KS GY
Sbjct  171  MAQRVVSETEHS-MPKRVLERISTPE----IWMKPNSDNYHQCISRPKNQIRTRSKSNGY  225

Query  379  LQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVL  558
            + V  +GGLNQ R GICD VAVAKI+NATLV+P L+    W D S F DIFD  HFI VL
Sbjct  226  IIVHANGGLNQMRTGICDMVAVAKIMNATLVLPSLDHESFWTDPSDFKDIFDWRHFINVL  285

Query  559  KDD  567
            KDD
Sbjct  286  KDD  288



>ref|XP_009804174.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=521

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 66/94 (70%), Gaps = 2/94 (2%)
 Frame = +1

Query  289  EIWMPLANQGWKP-VPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNAT  465
            ++W P  N+ + P V  S +++   E S GYL V  +GGLNQ R GICD VAVA+I+NAT
Sbjct  94   KLWKPPPNRDYVPCVAPSPIYTSPPE-SRGYLLVHTNGGLNQMRAGICDMVAVARIINAT  152

Query  466  LVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            LVIP L+   +WQDSS+F D+FD DHFI  L++D
Sbjct  153  LVIPELDKRSLWQDSSNFSDVFDEDHFISSLEND  186



>ref|XP_004502388.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum]
Length=551

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 71/103 (69%), Gaps = 6/103 (6%)
 Frame = +1

Query  277  EEKAEIW-MPLANQ-GWKPVPDS--GLFSKF--SEKSEGYLQVFLDGGLNQQRMGICDAV  438
            +E A +W  P ++   WKP  +   G  S+     K+ GY+ +  +GGLNQQR+ IC+AV
Sbjct  116  KESASLWENPYSSTTSWKPCAERRDGALSELPHENKTNGYIFIHAEGGLNQQRIAICNAV  175

Query  439  AVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            AVAKI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD
Sbjct  176  AVAKIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDD  218



>ref|XP_009594772.1| PREDICTED: uncharacterized protein At1g04910 [Nicotiana tomentosiformis]
Length=564

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 62/95 (65%), Gaps = 3/95 (3%)
 Frame = +1

Query  286  AEIWMPLANQGWKP--VPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILN  459
              +W P  +Q WKP  V   G   +   KS GYL +  +GGLNQQR+ ICDAVAVA +LN
Sbjct  123  TNVWNPKLHQVWKPCTVSQEGFIDQLP-KSNGYLIIEANGGLNQQRLSICDAVAVAGLLN  181

Query  460  ATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKD  564
            ATLVIP   +N VW+DSS F DIFD D FI  L++
Sbjct  182  ATLVIPIFHLNSVWRDSSKFGDIFDEDFFIYALRN  216



>ref|XP_006438229.1| hypothetical protein CICLE_v10031037mg [Citrus clementina]
 gb|ESR51469.1| hypothetical protein CICLE_v10031037mg [Citrus clementina]
Length=488

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 65/91 (71%), Gaps = 4/91 (4%)
 Frame = +1

Query  307  ANQGWKPVPDSGL--FSKFSEKSE--GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVI  474
            A   WKP  +  L   S+   ++E  GY+ +  +GGLNQQR+ IC+AVAVAKI+NATL++
Sbjct  166  ATTSWKPCAERRLGGISELPPENETNGYIFIHAEGGLNQQRIAICNAVAVAKIMNATLIL  225

Query  475  PYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            P L+ + +W+D + F DIFDVDHFI+ LKDD
Sbjct  226  PVLKQDQIWKDQTKFEDIFDVDHFIDYLKDD  256



>ref|XP_009781764.1| PREDICTED: uncharacterized protein At1g04910 [Nicotiana sylvestris]
Length=565

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 63/95 (66%), Gaps = 3/95 (3%)
 Frame = +1

Query  286  AEIWMPLANQGWKP--VPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILN  459
              +W P  +Q WKP  V   G  ++   KS GYL +  +GGLNQQR+ ICDAVAVA +LN
Sbjct  124  TNVWNPKLHQVWKPCSVSQEGFTAQLP-KSNGYLIIEANGGLNQQRLSICDAVAVAGLLN  182

Query  460  ATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKD  564
            ATLVIP   +N VW+DSS F DIFD D FI  L++
Sbjct  183  ATLVIPIFHLNSVWRDSSKFGDIFDEDFFIYALRN  217



>ref|XP_006664382.1| PREDICTED: uncharacterized protein At1g04910-like [Oryza brachyantha]
Length=431

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +1

Query  319  WKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPV  498
            W P  +  L       S GYL +  +GGLNQQR+ ICDAVAVA +LNATLVIP    N V
Sbjct  12   WAPCINRKLIRSELPPSNGYLMIEANGGLNQQRLSICDAVAVASLLNATLVIPAFHFNSV  71

Query  499  WQDSSSFMDIFDVDHFIEVLKD  564
            W+D S F DIFD DHFIE LK+
Sbjct  72   WRDHSKFGDIFDEDHFIETLKE  93



>gb|KDO82190.1| hypothetical protein CISIN_1g008884mg [Citrus sinensis]
Length=449

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 65/91 (71%), Gaps = 4/91 (4%)
 Frame = +1

Query  307  ANQGWKPVPDSGL--FSKFSEKSE--GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVI  474
            A   WKP  +  L   S+   ++E  GY+ +  +GGLNQQR+ IC+AVAVAKI+NATL++
Sbjct  127  ATTSWKPCAERRLGGISELPPENETNGYIFIHAEGGLNQQRIAICNAVAVAKIMNATLIL  186

Query  475  PYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            P L+ + +W+D + F DIFDVDHFI+ LKDD
Sbjct  187  PVLKQDQIWKDQTKFEDIFDVDHFIDYLKDD  217



>emb|CDP13245.1| unnamed protein product [Coffea canephora]
Length=564

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 65/91 (71%), Gaps = 4/91 (4%)
 Frame = +1

Query  307  ANQGWKPVPDS--GLFSKFSEKSE--GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVI  474
            A   WKP  +   G+ S    ++E  GY+ +  +GGLNQQR+ IC+AVAVAKI+NATL++
Sbjct  141  ATTSWKPCAERRVGIISDLPAENETTGYIFIHAEGGLNQQRIAICNAVAVAKIMNATLIL  200

Query  475  PYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            P L+ + +W+D + F DIFDVDHFI+ L+DD
Sbjct  201  PVLKQDQIWKDQTKFEDIFDVDHFIDYLRDD  231



>emb|CDY10050.1| BnaC08g44010D [Brassica napus]
Length=458

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 75/119 (63%), Gaps = 9/119 (8%)
 Frame = +1

Query  235  SSLFKSALQRETTPEEKA------EIWMPLANQGWKP--VPDSGLFSKFSEKSEGYLQVF  390
            S LF ++++R+  P   +      E+W    + GW+P   P S  +   +E++ GYL+V 
Sbjct  18   SLLFSASIRRDPEPTRSSKINVVEELWESAESGGWRPSSAPCSD-WPPPTEETNGYLRVR  76

Query  391  LDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
             +GGLNQQR  IC+AV  A+I+NATLV+P L+ N  W D S F+ I+DV+HFI+ LK D
Sbjct  77   CNGGLNQQRSAICNAVLAARIMNATLVLPELDANSFWHDDSGFLGIYDVEHFIDSLKYD  135



>gb|AES98123.2| auxin-independent growth promoter-like protein [Medicago truncatula]
Length=525

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 66/109 (61%), Gaps = 0/109 (0%)
 Frame = +1

Query  241  LFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRM  420
            L  S L R     +  ++W P +N+G+ P            +S GYL V  +GGLNQ R 
Sbjct  69   LSTSKLNRLRGDSDYVKLWKPPSNRGFLPCTKPTPNYTAPAESRGYLLVHTNGGLNQMRS  128

Query  421  GICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            GICD VAVA+I+NATLVIP L+    WQD+S+F D+FD +HFI  L +D
Sbjct  129  GICDMVAVARIINATLVIPELDKRSFWQDTSNFSDVFDEEHFINSLAND  177



>ref|XP_008219343.1| PREDICTED: uncharacterized protein At1g04910-like [Prunus mume]
Length=530

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 61/96 (64%), Gaps = 0/96 (0%)
 Frame = +1

Query  280  EKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILN  459
            E  ++W P  N+ + P  +         +S GYL V  +GGLNQ R GICD VAVA+I+N
Sbjct  94   ETDKLWKPPPNRDFVPCVEPSPNYTSPTESRGYLLVHTNGGLNQMRAGICDMVAVARIIN  153

Query  460  ATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            ATLVIP L+    W+DSS+F D+FD DHFI  L DD
Sbjct  154  ATLVIPELDKRSFWKDSSNFSDVFDEDHFINALADD  189



>gb|EEE52851.1| hypothetical protein OsJ_35390 [Oryza sativa Japonica Group]
Length=562

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 59/96 (61%), Gaps = 8/96 (8%)
 Frame = +1

Query  277  EEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKIL  456
            +   E+WMP  N+         L       S GYL +  +GGLNQQR+ ICDAVAVA +L
Sbjct  137  QNPGELWMPCVNRK--------LIRPELPPSNGYLMIEANGGLNQQRLSICDAVAVASLL  188

Query  457  NATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKD  564
            NATLVIP    N VW+D S F DIFD DHFIE LK+
Sbjct  189  NATLVIPAFHFNSVWRDHSKFGDIFDEDHFIETLKE  224



>ref|XP_006349651.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum tuberosum]
Length=571

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 64/94 (68%), Gaps = 3/94 (3%)
 Frame = +1

Query  292  IWMPLANQGWKPVPDSGLFSK-FSE--KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNA  462
            +W P  +Q WKP     +  + F+E  KS GYL +  +GGLNQQR+ ICDAVAVA +LNA
Sbjct  130  VWNPKLHQVWKPCIAHTVSQEGFAELPKSNGYLIIEANGGLNQQRLSICDAVAVAGLLNA  189

Query  463  TLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKD  564
            TLVIP   +N VW+DSS F DIFD D FI  L++
Sbjct  190  TLVIPIFHLNSVWRDSSKFCDIFDEDFFIYALRN  223



>ref|XP_008355708.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=664

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 74/124 (60%), Gaps = 5/124 (4%)
 Frame = +1

Query  199  ILSESIIAKPRHSSLFKSALQRETTPEEKAEIWM-PLANQGWKPVPDSGLFSKFSEKSEG  375
            +L    +++   S++FK  L+R  TPE    IW  P ++   K +       +   K+ G
Sbjct  198  VLERERLSETESSTMFKRLLERLPTPE----IWRKPNSDNLDKCIARPKNRIRTGSKTNG  253

Query  376  YLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEV  555
            YL V  +GGLNQ R GICD VAVAKI+NATLV+P ++    W D S F DIFD  HF++V
Sbjct  254  YLLVHANGGLNQMRTGICDMVAVAKIMNATLVLPLMDHQSFWTDPSDFKDIFDWRHFMKV  313

Query  556  LKDD  567
            LKDD
Sbjct  314  LKDD  317



>gb|AFY26903.1| duf246 domain-containing protein, partial [Morella rubra]
Length=500

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 71/113 (63%), Gaps = 5/113 (4%)
 Frame = +1

Query  232  HSSLFKSALQRETTPEEKAEIWM-PLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLN  408
            H+S+ K  L++ +TPE    IWM P ++   + +       +   K+ GY+ V  +GGLN
Sbjct  176  HTSMPKRVLEKVSTPE----IWMKPNSDSISQCIARPKNRIRRCSKTNGYILVHANGGLN  231

Query  409  QQRMGICDAVAVAKILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            Q R GICD VAVAKI+NA+LV+P L+    W D S F DIFD  HF+EVLKDD
Sbjct  232  QMRTGICDMVAVAKIMNASLVLPSLDHESFWTDPSGFKDIFDWRHFMEVLKDD  284



>ref|XP_010650286.1| PREDICTED: uncharacterized protein At1g04910-like [Vitis vinifera]
Length=524

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 63/94 (67%), Gaps = 3/94 (3%)
 Frame = +1

Query  292  IWMPLANQGWKP--VPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNAT  465
            +W P  + GW+P   P S   S  SE S GYL+V  +GGLNQQR  IC+AV  A+I+NAT
Sbjct  64   LWGPADSSGWRPSSAPRSDWPSPPSE-SNGYLRVRCNGGLNQQRTAICNAVLAARIMNAT  122

Query  466  LVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDD  567
            LV+P L+ N  W DSS F  I+DV+HFI VL+ D
Sbjct  123  LVLPELDANSFWHDSSGFQGIYDVEHFIAVLRFD  156



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960